5C8KA

Egfr kinase domain mutant "tmlr" with compound 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
300
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYEEDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 300
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5c8kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c8kA01
5CEKA 4JI9A 4PDPA 4DEAA 4ZJIA 4C4EA 4PPBA 5M4FA 3G6HA 3UIBA 3FUPA 3RCDA 3G6GA 4MH7A 2A1AB 4DFNA 3AC8A 4RWJA 3AT2A 1CTPE 4LI5A 3OCBA 5CEOA 3NRMA 3CKWA 3Q9ZA 3BBTB 5CAUA 3VF9A 2W9ZB 3VS5A 2QOIA 3P7AA 2XM8A 3E62A 3OS3A 4NW5A 3UMWA 3L8SA 1V1KA 3O17A 3T8OA 5EYKA 4L7FA 1GZNA 1Q41A 2IZUA 2OICA 2R7IA 3W55A 4E4XA 2VTTA 4IAAA 1OL5A 3LM0A 3NAYA 4FSUA 1STCE 3NW6A 4FX3A 4M13A 4E3CA 4BIDA 2X8DA 4FTIA 4AA0A 4YJRA 4U42A 3VNTA 4DEEA 4J71A 4M0YA 2C6MA 4GCJA 4PPCA 4ZTNA 4O1PA 5DR9A 4WG3A 2WQOA 5FEDA 3JY9A 1H4LA 1PMUA 3JVRA 3CY3A 3MTFA 4HNIA 1WBNA 2YIXA 3QQGA 4FKJA 4RA4A 4BDGA 2ZB1A 3QQFA 3TXOA 1HCKA 5I9VA 2G2IA 2B4SB 5LMAA 4IAIA 4XX9A 4BTJA 1LEWA 2XF0A 5AUYA 4I93A 4NTTA 1Z9XA 4QP4A 2W5HA 4O91A 4DH5A 3LM5A 5JRQA 4FIGA 4XP2A 5AMNA 4CMUA 2IW9A 5CVFA 3UG2A 4IC7A 3C1XA 3MFSA 3TT0A 3DT1A 4QQJA 1TVOA 3GUBA 4U3ZA 3TM0A 3F5UA 5JZNA 1NVRA 5J5TA 2CGVA 3DB8A 1OKWA 4KWPA 2V5QA 3DDQA 3BBWA 4L7SA 5E9EA 4YTFA 3AC1A 3IOKA 2JBPA 4NM3A 3RPYA 3L8XA 2YCQA 3BHTA 4TT7A 5EW9A 3D2KA 3QF9A 4FYNA 3R22A 5B2KA 4G6LA 1OI9A 2QD9A 5GJFA 2Y6MA 3I81A 5FP6A 3LMIA 4O0WA 4FL1A 3KCFA 4BDEA 4DAWA 4U79A 3VO3A 4RIXA 3AMYA 3OWPA 5ETIA 4A9RA 3R71A 3PPZA 4FBXA 3QTUA 4GKHA 3ZH8A 4NSTA 5IA5A 4D1XA 2Q83A 2WMTA 4DCAA 3W2OA 3E7OA 3R04A 2Y0AA 4I20A 4C57A 1F0QA 2OXDA 4IEBA 3GEQA 4PX6A 4RC3A 4CEGA 3VJOA 4JX7A 4WRGA 2VWBA 3NZ0A 1K2PA 3PVGA 3BQRA 4RJ7A 5HEZA 1T46A 3HKOA 2CNQA 4BY9E 4O82A 2GDOA 5AM6A 1E9HA 2I0YA 1LPUA 5J9YA 5TF9A 4O2PA 3DJ7A 4TWPA 3GCSA 4F0IA 3COKA 5C26A 3OXIA 4F1TA 2IZRA 3H9FA 4IFGA 3TCPA 4RLKA 4NJDA 3RWPA 1URCA 4G2FA 3VJNA 5JGBA 3PY3A 4RC4A 2Z7SA 3NS9A 3VUTA 4WBBB 3U6JA 4FYOA 3PXZA 4BBEA 4UZDA 4EQMA 3JR1A 4F0GA 1RE8A 4YO6A 2PUIA 3CKXA 3NUPA 5HOAA 3FDNA 4Z55A 1WCCA 4KBAA 5M51A 1H0WA 2IVVA 1H1QA 3GNIB 1IA8A 1IAHA 4M84A 4TWCA 5K0KA 4G9CA 4HNFA 3D4QA 4AS0A 1Q8YA 4UWYA 4QP2A 2XIZA 3PIXA 3NX8A 5A6NA 2ITOA 4UWCA 2JKOA 2WU7A 5C8NA 4EHVA 2GFCA 3R9NA 4A9YA 5HQ0A 2F4JA 4RX8A 3M11A 3SDJA 1X8BA 3V8TA 1M2QA 3NGAA 4IZAA 1Q4LA 4PTGA 4RJ5A 1UKIA 2Z60A 3HV3A 5AX9A 1OIQA 4BFMA 4M7IA 3I5ZA 2BALA 3FYJX 4XH6A 1ZZ2A 2NO3A 2VTMA 4RIXB 2JC6A 3VBVA 4J96A 4CNHA 3EKKA 1JBPE 3QKLA 4EORA 4FZ6A 1WVXA 3PP0A 1XKKA 2WB8A 1PHKA 2YLEA 4RMZA 4E6DA 4F64A 3ENMA 1P5EA 3NNXA 4ZTHA 3TJDA 5J8IA 5CVGA 4BI0A 4W8EA 1A9UA 4H36A 2PVHA 2WGJA 1NXKA 2VWUA 1CKPA 2C69A 2V22A 4QTDA 4JR7A 1XH9A 2G2FA 5DI1A 5F20A 3V6RA 4XG8A 3KKVA 5J87A 3ZSGA 4F9CA 4HVGA 1J7LA 4ZS4A 3FMNA 3LAUA 5F94A 5C4KA 1LEZA 1NVSA 2WTCA 3AG9A 5EKOA 4N57A 4L68A 4MKCA 5J9ZA 2BMCA 1M14A 1GOLA 5AP4A 4FNYA 5DT0A 1H8FA 1H0VA 5CYIA 2ZV2A 3DBQA 5IH4A 2HK5A 1DI9A 2IG7A 4KIKA 3UIUA 2CKEA 1J3HA 3NUUA 4A4LA 4D0XA 1JSVA 4H3PA 1H01A 2R3GA 3WZDA 5J95A 2PMLX 4TRLA 2GHGA 3LOKA 4HVHA 2WMQA 3SGCA 1JKLA 2R5TA 2UW8A 3GU4A 4LRJA 4ASZA 3DXPA 2ACXA 2RFDA 2YM4A 4U0IA 5ANGA 4EOKA 5IA4A 5KMIA 2XYNA 4DHFA 1FPUA 4F9AA 3DNDA 3C5IA 3V5WA 3MS9A 4ITIA 3QTWA 3A61A 4C61A 5A4LA 5IEVA 3KVWA 4ZEGA 1AGWA 3EYHA 4EK6A 1BI8A 3PPJA 4K33A 2UW9A 2VN9A 5DYJA 4O6LA 4JDHA 2EXEA 4AE6A 3C4XA 4FVPA 1QL6A 3RINA 5HVKA 4ZSEA 3WF7A 4NFMA 1J7UA 3MVMA 3SRVB 3EL7A 3A7FA 4QOXA 4AN2A 3Q9WA 3TIYA 1P4OA 4FE2A 3MH3A 4JBOA 3BYVA 2PE2A 3BRBA 3MFRA 3QRUA 2QHMA 3A4OX 4NWMA 1KOBA 3WE8A 5F9EA 1J1CA 5IF1A 4GYIA 4IB0A 2CKOA 4MXCA 5C4LA 1PYEA 5L2SA 1ND4A 4RA5A 5J79A 3CQWA 4QMMA 5A4CA 5HLNA 4L67A 3FI3A 4A9SA 3G33A 4IVBA 3LCSA 3GC9A 4BTKA 3UJGA 4DN5A 5LVNA 3HMOA 3BYMA 3ACKA 4D2WA 3NLBA 4DEHA 4DH3A 3QC4A 1JNKA 4O81A 3BI6A 4LYNA 4BKJA 1P14A 4U8ZA 4QYEA 2B52A 3E87A 3R1YA 4D4YA 4F7NA 1QPEA 4RPVA 5J1WA 5DR2A 4USDA 4BZDA 3IGOA 5BPYA 3UGCA 5GZAA 4FIJA 5E92A 4P5QA 4EONA 2FVDA 3GU8A 3NAXA 4BCGA 3PSCA 4EH4A 4G3EA 2ONLA 3K5UA 3MPTA 3PUPA 5HI2A 4BCPA 4EOLA 4TYHB 4D2PA 4UXLA 1GIIA 5CU4A 5BVNA 2OFUA 3BLQA 2BCJA 3BU5A 1YKRA 3ORXA 4OTFA 2X8IA 5EQEA 4KIKB 2OFVA 4JXFA 3OEZA 4UEUA 1OL7A 2DQ7X 5IQAA 3CPBA 3FSKA 3IW8A 2BRBA 3WF5A 3OW3A 4DLIA 5CF5A 1OBGA 4MD9E 3H30A 1CKIA 2H96A 5L8JA 4TL0A 2O2UA 3T3UA 1QCFA 3B2TA 3GOKA 4J98A 3BE9A 3NUNA 2WTIA 3E88A 3R9DA 5KMJA 1OZ1A 3IPHA 5CLPA 1PXNA 4QD6A 1QPCA 5EH0A 3RBWA 1U59A 3P23A 3M2WA 4O7WA 1H07A 3A8XA 4UY9A 3BHHA 3QD3A 2GS2A 4EOQA 4NCTA 5GHVA 4BDFA 4FKOA 1H25A 2YA9A 1UWHA 3DXQA 2NRYA 4AACA 2X8EA 3Q60A 4IWPA 4ANSA 5DH3A 2XVDA 3UPXA 4CKJA 5LMBA 3VQUA 4IM0A 2XIYA 4PTEA 4EOOA 4EEVA 3HVCA 5BQ0A 2GPHA 3ENHA 4U41A 4F4PA 3CGOA 1PJKA 2RG5A 3QX4A 2ZMDA 1PXPA 3FZSA 4X3FC 4AFJA 2YM5A 3HUBA 4ID7A 1BX6A 2YEXA 5HBEA 3ZLXA 1GZOA 4C3PA 5FLFA 5IEXA 4B9DA 4KKHA 3KVXA 3LFSA 4B4LA 3EQGA 1XH6A 4DG2E 4S32A 3KMMA 1L3RE 4FF8A 4QYHA 2VZ6A 4BCNA 3IGGA 4BI1A 2BFXA 4GU6A 4ERKA 4AWIA 3RGFA 3LFEA 2R3JA 3EMGA 3F3WA 4IADA 3R7EA 4FUYA 5HTBA 3G9LX 2OIQA 4C4HA 5CQWA 5IEYA 4DEDA 1JKTA 3QRTA 4F7JA 2O64A 3IW7A 3SXRA 2JEDA 4FTNA 3DS6A 3F88A 3HA6A 3K3JA 3MIYA 5IA0A 5LJJA 3FEGA 1H26A 2F7XE 3ZO4A 1BI7A 3VRYA 2R7BA 4UALA 2C3KA 4WUNA 4IANA 5ANJA 2HZNA 5HCYA 5BVWA 5JGDA 4OT6A 4F6WA 3H3CA 3BHUA 5CNNA 4A07A 5EYCA 3I6WA 4YJTA 4ENYA 2E9OA 4YJPA 4C02A 3ZC5A 1UA2A 2ITQA 2JDTA 2XK8A 4LOQA 3P1AA 4AT3A 3UOJA 3EFJA 3HV5A 3OTUA 3M42A 4DEBA 2GNGA 5EM5A 5HO7A 3FKOA 3U9NA 5KBRA 1AD5A 3ZDUA 2RIOA 3GI3A 3PE1A 4MBJA 2WTWA 3DQXA 4MQ1A 2XP2A 4S31A 2UUEA 4L52A 3FYKX 4FV1A 5AV3A 4PY1A 4QT1A 3V01A 2G01A 3EB0A 3FHIA 4TWOA 4BZNA 4AT4A 4EHGA 2W4JA 3QD0A 2YAKA 2PUNA 4FSQA 3MESA 5IQIA 1Q8TA 2YIWA 3R73A 1IEPA 2YM8A 2I0HA 4S30A 2R3FA 2HY81 3DNEA 2VNYA 3CC6A 4PPAA 4DH8A 4YBJA 3PJ2A 5IG1A 2UZDA 4PP7A 2R3PA 1U46A 3P79A 3TIZA 3KXGA 2PZYA 4YZ9A 5M56A 4FT0A 4PMMA 3AGLA 4M15A 4K9YA 3MA3A 1FGIA 2HXQA 2P55A 4RT7A 4EK8A 5E8WA 3R8MA 1VYWA 5E90A 3RPSA 2JDSA 2ITXA 4CCUA 4MXAA 3PWYA 5DG5A 3V6SA 1YDRE 2XCHA 2X2LA 2W1DA 4ANLA 4G6OA 4MWHA 3WZUA 4FEXA 3KMWA 4UX9A 2CN5A 1JAMA 4RJ4A 4IWDA 2HZ4A 5HVJA 3B8QA 3BEGA 4P4CA 2XK6A 2C6DA 4MCVA 4L01A 3REPA 4O84A 3OMVA 3FC2A 2OIBA 4EHZA 4RQVA 3UG1A 2BDJA 3KB7A 3OWLA 5EM7A 4C34A 2R3MA 3ERKA 3BU3A 4HCTA 5CSHA 5AR5A 1O6LA 2E9PA 3NCZA 3TNIA 1GZKA 2KULA 1ZMUA 2I6LA 2JLDA 5FBNC 1SM2A 4BKYA 3BKBA 2C5XA 4AT5A 4J99A 3E8DA 5CAOA 4E6QA 4QP3A 4U43A 3TV7A 4TYJA 3UP2A 4J53A 3RZFA 3G15A 2ZM3A 3FKNA 3QWJA 3KFAA 3GBZA 4ZZNA 4AQCA 2YIRA 3TZ8A 5IUIA 2YHVA 2G15A 4RIYB 1SYKA 2XEYA 3IG7A 3R2BA 4N6YA 5C8MA 4EH6A 2Q0NA 3FZ1A 3QTQA 4RWLA 4EZ3A 1ZY5A 3P0MA 4I21A 4HJOA 4O0TA 4YTCA 3G0EA 4ZLYA 3R01A 4R1YA 1XR1A 3ORIA 2WMWA 5TT7A 4KAOA 2PU8A 4EC8A 4OAVB 3MV5A 1E1VA 2LGCA 2NP8A 3ZYAA 5CSWA 4EK4A 1KV1A 4CMOA 3GC8A 4OBQA 1CKJA 4V0GA 4AX8A 3F7WA 2OXXA 3QHRA 4GK4A 3KXNA 5M4CA 4H05A 2BROA 3POOA 4BDBA 1XWSA 4G3GA 3FHRA 3DY7A 2PMIA 4ZTSA 5CEMA 4EOPA 2JKKA 2B1PA 3V3VA 5BX0A 3UQCA 3TACA 4YU2A 2EB3A 2XNEA 5IZFA 2UVXA 1Y6AA 4FV2A 5AP7A 4GFOA 4LMNA 4QTCA 2AUHA 2J0IA 3H0ZA 3DGKA 4RRVA 5CASA 3VC4A 1MQ4A 4ZLZA 3VBYA 3ODYX 4AOIA 4D1SA 2DS1A 3BV2A 1YWVA 4IIRA 3SG8A 4D58A 3FZTA 4P5ZA 3BCEA 2HWPA 3A62A 4FNZA 4KSQA 4DC2A 3VS7A 4YR8A 2R0UA 3OD6X 1I44A 4IXPA 4I22A 4YUQA 3ZO3A 5FXRA 4NIFB 2R64A 3HMIA 4G17A 1LUFA 1KE9A 4AZFA 3MI9A 3KN6A 1WAKA 2YM6A 3F7ZA 4JDKA 3ANQA 4R8QA 2PZRA 3A7IA 1OIUA 2IVTA 4G34A 4ZK5A 4AG8A 1XJDA 3B8RA 4TKSA 1UNHA 2WQBA 3QQJA 4M66A 4I6QA 3COHA 4HPUE 3QZFA 5KO1A 1YRPA 4RGJA 3C4ZA 5LWNA 2RSVA 4RX7A 2HYYA 5L2IA 3D9VA 2OU7A 1YHVA 3ELJA 4ZZMA 1YWRA 3TL8A 4CT1A 2IVUA 4ALVA 5JRSA 5HNIX 3KU2A 3BPRA 2JIIA 3F3VA 5JSMA 4ZS0A 4QMLA 4BCOA 3LFFA 4ALWA 4LQMA 3FI4A 2BAJA 2WOUA 3G2FA 3FL4A 1T45A 4YO4A 3N4VA 3D5XA 3OY1A 4IH8A 1R78A 2UZNA 2EXCX 4LM5A 4QPAA 5ANDA 4DA5A 4FKUA 5E8YA 3ORTA 5HIBA 4GG5A 3OC1A 5DT4A 1DS5A 3ZXTA 3DK3A 3GC7A 3IS5A 2ERKA 4H58A 2CPKE 4JT3A 5GIOE 4ZTLA 3VBXA 3L8VA 3CEKA 3QHWA 3VN9A 5I9WA 4V0GB 3MW1A 1PKGA 1R0EA 2X9FA 3ZXZA 2VWVA 4YNEA 4Y95A 5LCKA 3R7VA 4GT5A 3PYYA 2QURA 4E8AA 2VO0A 4ANBA 1ZOHA 4AZEA 3MB6A 4D2TA 3VBQA 2G2HA 4F70A 3LPBA 5L8LA 4FKQA 4YTIA 4FG9A 4PTCA 3VUHA 4BDHA 1YW2A 5H8BA 4CTBA 1RQQA 4G1WA 4AW5A 4EOSA 2QU6A 2CCIA 5BNJA 2WMXA 1PF8A 4FEQA 2A4LA 4FV0A 4LRKA 2FYSA 3ORNA 4JBPA 2IN6A 1XBCA 3HAMA 4FTLA 5CQUA 4RJ6A 4PWNA 3V5QA 2WMRA 3EQPA 2WAJA 2ETKA 2GNFA 3ORMA 5E1EA 4CXAA 1WBOA 5AP3A 2C5VA 3WI6A 2BR1A 2PZIA 2XKEA 3KK8A 4LGHA 1CMKE 4L9IA 2PZPA 3A8WA 3FMHA 3LLTA 3R9RA 3BQCA 3MY1A 2X0GA 1V0BA 1PMVA 2XMYA 4BHNA 2OI4X 5HCXA 4AUAA 2HXLA 3AQVA 4TY1A 4ASXA 2OXYA 2ZV8A 5H3QA 4S2ZA 1PXOA 5M53A 1QPDA 3AD4A 4Y46A 4L00A 4X6QC 3IW5A 1UV5A 1OMWA 2B9FA 2G1TA 3PXKA 3W2QA 3FMDA 5GJGA 4BDAA 3W32A 2PMNX 3MFTA 2PULA 3R6XA 3VS2A 2UW4A 4TWNA 4DYMA 4X2NA 3RK7A 2J5FA 5CS6A 1OL2A 5DBXA 4MAOA 4WO5A 2VO6A 4E5BA 5LXMA 4CLIA 1YHWA 4FIEA 1YI4A 2A0CX 3RNYA 5DE2A 5L6PA 3DDPA 4FIFA 3UP7A 1A48A 5C9CA 4FKSA 3EFWA 3V5PA 3ZSIA 2W1CA 4RWIA 5HE3A 2J4ZA 2XK4A 2VX1A 3PRFA 5DOSA 4RJ8A 5HZNA 3R83A 1Q8ZA 5FD2A 3TN8A 1TKIA 3GCUA 5A54A 4JAJA 4EQUA 1Q8UA 5BMSA 3P9JA 3R1NA 5AIKA 3QGWA 2R3RA 2VWIA 4KS8A 3LFNA 3DTCA 4CTCA 3OBGA 4ANQA 4E5AX 2XH5A 3L9MA 4KINA 4IB3A 3R8UA 3V04A 4DGOA 4UMTA 4YZMA 3RMFA 2J0LA 3LQ3A 4IACA 3PY0A 4XV9A 5DWRA 5HNBA 3QFVA 3TJCA 3VW8A 4M8TA 4FR4A 2VD5A 5EK7A 5ETAA 2BIYA 3KL8A 2CKQA 1JKKA 4NU1A 2QI8A 2QG5A 1GIJA 1OECA 4HGSA 4FZ7A 4ZSGA 2ZMCA 4FSRA 5EM8A 4ENXA 5JN2A 3HZTA 5AP6A 3W2RA 4PP9A 2BUJA 5M57A 3SW7A 3QA0A 3WOWA 3Q9YA 4RC2A 3DKGA 2JBOA 4UN0C 2QOCA 4O2ZA 4UV0A 1G3NA 4HCUA 3R28A 2OH4A 4K2RA 1PMEA 1M17A 2VWYA 4PQNA 3VS1A 2YERA 4ZSLA 3W1FA 2QOQA 4I0TA 2WKMA 2XZSA 3EL8A 3R00A 3UOLA 4DGLC 2R3NA 3KXZA 4F1OA 2ONLC 2VV9A 2YIQA 5EW3A 3ZZEA 2JITA 4G6NA 1ZZLA 2C1AA 3MH2A 3I4BA 2NNWB 1ZOEA 3GCPA 3IDBA 5IQEA 2B54A 3HEGA 2XNNA 4CMTA 3TTIA 4MXZA 1URWA 5LVPA 5E4HA 3OCTA 1U54A 1W98A 3UIMA 3R1QA 2VWZA 4OTDA 1BL6A 4MBIA 5D12A 2VAGA 1PXJA 3LJ0A 3W16A 5HNGA 1JPAA 2C6KA 1Q61A 3AXWA 4JRNA 4QQCA 4B7TA 3HA8A 4IW0A 3BZ3A 2B53A 4Y72A 4HCVA 5FRIA 4DTAA 2O8YA 4QMSA 5AR7A 2BRNA 4QMXA 4I94A 5AR8A 3VUMA 5HG9A 2F57A 4RJ3A 3S95A 4P7EA 4EH3A 3K5VA 4P90A 5EI6A 5BUEA 4MQ2A 1FMOE 4JIAA 4X7QA 1OL1A 3CTQA 3GCVA 4JL9A 4OTGA 3O8PA 4XBUA 5I3OA 5JKGA 5GIPE 4O86A 1UU3A 3FSFA 4NCTC 1OPLA 3U4WA 1FVRA 3HAVA 5HIDA 2QU5A 4JRVA 2JIUA 5BUJA 3BHYA 5M55A 3OY3A 4I5CA 4YP8A 3EN9A 3GOPA 3R8PA 2O0UA 3NNUA 3PVWA 3G90X 2ZV7A 1OITA 2CMWA 4O7RA 5HX8A 2VNWA 1SVHA 4JDIA 1F5QA 3GB2A 3QD4A 4AF3A 4A4XA 4DG3E 5ICPA 3BGZA 4GIHA 4U80A 2QKRA 5CT0A 5CSXA 4KUJA 1YXUA 4E4MA 1GZ8A 3VRZA 3AGMA 4AZWA 3SW4A 3O51A 1IRKA 4WNMA 2XJ2A 1O6YA 4BCKA 4EYJA 3CQEA 4XLIA 4W8DA 2QOFA 5AJQA 3ZUUA 5K4IA 1MQBA 3OP5A 5HO8A 4ZY6A 4BGGA 3EKNA 4X2JA 3P7BA 2B9HA 5C01A 2VU3A 3Q53A 1Y6BA 4NJ3A 5IDNA 3C51A 3II5A 3F5PA 1TQPA 4KABA 2RL5A 1YOMA 4ZSJA 3OOMA 1U5RA 2YJRA 4OT5A 4WSQA 3UPZA 3THBA 4FTQA 3UBDA 3QCXA 3UZTA 1ZYSA 1PXIA 2F9GA 2HZIA 2PVRA 5CZIA 3V5LA 5JQ5A 1JOWB 1MRVA 3DPKA 5F95A 5HESA 4XP0A 3VUIA 4ACDA 2YABA 4A7CA 3FLNC 2VTOA 2J51A 2C47A 2OJ9A 2V55A 3VUDA 3WF6A 2B7AA 2BHEA 5C27A 4C3FA 3VULA 4MEDA 3QRIA 3ID6C 3U54A 4II5A 1PYXA 2WOTA 5LVMA 1B39A 3IQ7A 1HOWA 2VTJA 4CFUA 4U6RA 3U51A 4YMJA 5A9UA 5BVKA 5D41A 3T3VA 5HD4A 4DF3A 2PE0A 4TNBA 5AFVA 5AUZA 1W82A 1XBBA 5EQPA 1SMHA 5IQDA 4AGWA 4O1OA 3RNIA 4EOIA 4FV7A 2OWBA 3ZM9A 3QX2A 3Q4TA 5B0XA 4D4SA 3Q9XA 1YOLA 1UVRA 2B9JA 4AGCA 3V51A 4I24A 4B99A 3U6HA 4I5MA 4F65A 4TZRA 5CF4A 5AP1A 3PSBA 5K5NA 1H1RA 5EOLA 5CALA 4U81A 3HRCA 4HZRA 5GNKA 4BDKA 3SX9A 3D2IA 1WZYA 5AR4A 3MSSA 5KZIA 2WTKB 2W99B 4YPDA 3R9HA 1JVPP 4YHTA 4XJ0A 4DGGA 2W1GA 5EDRA 3U4UA 3F61A 4U40A 2PVKA 5C8KA 4H3BA 5T3QA 4Z3VA 4OBPA 1FOTA 1JWHA 4BVUA 3OT8A 5CX9A 1WBPA 3FI8A 2JIVA 4AFEA 3MBLA 3RPRA 3HUCA 3E7VA 4BCJA 3ZONA 4F0FA 1FBNA 1TQIA 1S9JA 3IDPA 4JOAA 2YWPA 2OJGA 5HD7A 4FTAA 5IU2A 3UDBA 4FNWA 3HLLA 4PMSA 1FVVA 5AA8A 4E93A 4PF4A 4KNBA 3QTSA 4AOJA 3QKKA 1GJOA 2XIRA 2WIPA 4FKTA 4UYNA 5HBHA 5FTQA 5K5XA 4BCFA 1W8CA 4DFUA 4WHZA 4BYJA 4BRXA 4BWPA 4F7LA 3RPVA 4JVGA 4BWKA 4ITJA 4HVSA 5IA2A 4OGRA 4XHKB 4MX9A 1CDKA 4BDDA 3IKAA 2JGZA 5JFSA 3LHJA 4BF2A 3FXXA 3O0GA 3ZM4A 5ETCA 4V01A 4C33A 5ANIA 4ZP5A 4FV3A 3F2RA 2OKRA 4TN6A 4FT7A 3FV8A 2FUMA 4OTRA 3KK9A 2ITYA 1NVQA 3BHVA 2QNJA 4QP8A 3KRRA 3QA8A 4XUFA 4QTEA 3LXPA 3VBWA 2OK1A 5IMXA 5CXHA 2WQEA 3I5NA 4IWQA 4FK6A 1V0OA 5H8EA 2AC5A 2PTKA 4AAAA 5EKNA 2I40A 2VTQA 3MYGA 5CF8A 5CVHA 4CFMA 2VUWA 2HCKA 4FSWA 3A60A 4U9AA 5J1VA 2GFSA 1Y91A 2WXVA 4MD8E 5CWZA 3MJ2A 4A4OA 2WD1A 4O83A 4LGDA 2EB2A 4NKAA 3ZFYA 1RW8A 2HW6A 5TOZA 3WIKA 4LL5A 4EQCA 3AD6A 4ZAUA 2X2KA 2Z02A 1OGUA 4RX5A 2XNMA 4YURA 2WZJA 4ZMFA 4EH2A 3RAIA 5EYMA 4M12A 3ROCA 2GQSA 3NVMB 1KE5A 2P3GX 4KD1A 5CNOA 3TZMA 2FSTX 5D7VA 4K1BA 4Z9LA 2WEVA 4S33A 3HMNA 2C5OA 2UZUE 4UMRA 3DCVA 4XRJA 2UVZA 3HV6A 3UC4A 4H1JA 3H0YA 4IHPA 4QYYA 4Y85A 4BGHA 4F09A 3KN5A 3N4UA 4YPSA 4I3ZA 2Z2WA 2O63A 3ZU7A 1OKZA 2P2HA 3W2SA 2Q0BA 4QYGA 3TNPC 3VHEA 4R5YA 5AP2A 5IH5A 3IECA 4I1ZA 2PPQA 1L8TA 2YDKA 4IX3A 4IC8A 5IUHA 3R7GA 3I79A 3PY1A 3DFCB 3L1SA 2XIKA 3A7GA 3LCDA 3LVPA 4YHJA 3WE4A 2XRUA 5CAVA 5J7BA 2QQ7A 3OVVA 4DGNA 1OPJA 3PVBA 3QCSA 4X3JA 4IJ9A 1PMNA 3BIZA 2W4KA 3RM6A 3NUYA 2ZYBA 3EQRA 3QTRA 4U45A 4WG4A 4NZWB 4B6LA 4OBOA 5KMNA 2VO7A 2XCKA 3LE6A 2VX3A 1KOAA 3FMJA 3CGFA 3HP5A 2UZVA 4L42A 4L8MA 5A14A 3DQWA 5EHYA 2PYWA 3EIDA 4I5HA 4IM3A 2BRMA 1YVJA 4QTBA 4ONAA 3ZUTA 4K0YA 3UYSA 3DXNA 2VTAA 3C9WA 1WBSA 2X4ZA 4HGLA 5LMKA 2ETMA 2YN8A 4RVKA 4ZTRA 3TKUA 3CP9A 2OJIA 4LG4A 4HGEA 5H8GA 4O7NA 3I7BA 4O21A 1Q62A 4YBKA 2JKMA 2P0CA 5K3YA 2C6TA 5IA3A 4M69A 4KA3A 2ZDTA 3DB6A 3EFLA 4CZYB 1E1XA 1H1WA 1ZLTA 5I0BA 3P08A 3WARA 5FDPA 2IW8A 2XEZA 4Z7HA 4FL2A 3E63A 2F2UA 3P86A 4I5PA 4AZVA 4LOPA 5FTOA 4NUSA 3R9OA 4HOKA 3ROYA 1W84A 2J90A 3VUKA 3BYUA 4FA2A 5FGKA 5AAEA 4IE9A 3L9LA 3Q4ZA 5EFQA 4R6VA 4IMYA 5BYZA 4JQEA 4PDSA 3F2NA 3DAEA 4O27B 3G0FA 1PXLA 2PMOX 4QQ5A 3VVHA 5HX6A 4L46A 4AZSA 4O7SA 4CGAA 2FO0A 3LFDA 2BKKA 4W4XA 2AC3A 3GFWA 3D7TA 5I9XA 5CXZA 4JNWA 1J7IA 2QLUA 2UW6A 4WNKA 3DZOA 5EYDA 1KE6A 4GU9A 4BHZA 5EQYA 1BLXA 4BGQA 2HAKA 3CCNA 3ZLWA 3O7LD 3ZLSA 4HZSA 2BHHA 4ZOGA 3ZOSA 4GW8A 4GH2A 2GTNA 3MB7A 4OR5A 4XS2A 2QO2A 4B8MA 5IA1A 2VTSA 3SG9A 2XBAA 2XK7A 3MVHA 4O0VA 4UB7A 3ITZA 4EJNA 4ALUA 3U55A 3F82A 2CSNA 5A4EA 3RAWA 3ATSA 4D5KA 3F69A 4CRSA 4GG7A 5HG5A 1K3AA 1U5QA 5IQCA 2NRUA 2LAVA 2VWWA 5HHWA 2QLQA 2REIA 4FICA 4AW2A 3LFCA 5BVDA 3O71A 5CSVA 3FWQA 2JAMA 1NT2A 1H1PA 3LQ5A 3WBLA 3EN4A 4CQGA 3FQHA 4F08A 4CG9A 3PG1A 3ZBXA 2EU9A 3PJ3A 3Q96A 3HMMA 2ZV9A 3FMKA 1NY3A 4XRLA 2CHLA 1S9IA 4JR3A 2PVYA 1Q5KA 2A19B 4IQ6A 4R5SA 2BILB 3FE3A 4YC3A 2W17A 3Q6WA 3V5JA 3WZKA 4CZTA 3SLSA 3PFQA 3ODZX 2B0QA 4IDVA 2Y8OA 5D9HA 2CN8A 4DT8A 2EVAA 1V0PA 3NUXA 4C4GA 4JQ7A 5KKRB 4AGUA 4ASDA 3F3UA 3GFEA 1ZYJA 2CKPA 4FZAB 2UVYA 3NIEA 1UU7A 2YM7A 5DN3A 4H3QA 3GT8A 3LXKA 3QYZA 1PRYA 5EI8A 4C62A 5ITAA 3EQFA 4DH7A 4FV4A 3VAPA 5CY3A 3ZRLA 3GC0A 4HVIA 3MJ1A 3PP1A 3VUGA 3NWWA 4XG4A 4PL5A 3MDYA 5L4QA 3D7TB 4XG7A 3L9NA 1OKYA 2C4GA 4GVJA 4C38A 3H9RA 5E8VA 4B8LA 5LQFA 3QRKA 1GNGA 4TTHB 3C7QA 2WTDA 1KSWA 4FV9A 2V7OA 3CTHA 2YISA 2CGWA 4WT6A 4YC6A 2BZJA 3DAJA 3FY2A 5IUGA 2GNIA 4TW9A 2GS7A 3QUEA 4BBMA 3RWQA 4WIHA 3E5AA 5LVLA 4UYAA 2WTVA 5M08A 4ZTMA 4CKIA 3ORKA 4R7IA 4YLKA 4FUXA 2FB8A 4FKLA 3ZRMA 4AA4A 5DR6A 2E2BA 3DLZA 4Z16A 2OZAA 4QP9A 4HVDA 2GTMA 4QP6A 4IX4A 5I9UA 3A99A 3LIJA 3MN3A 3NUSA 3WILA 3MA6A 5HKMA 4O0SA 4ZMEA 4FKRA 3PLAE 4YTHA 2P4IA 2W1IA 3HYHA 2PHKA 4IX6A 5CSPA 4IX5A 4B0GA 2BPMA 5AUTA 2C3IB 3RP9A 4BDIA 2PWLA 2XJ0A 5A4QA 4LV5A 3KXHA 5G1XA 4A9UA 4LMUA 4DBXA 2A2AA 3PG3A 4D0WA 1W83A 4X2FA 4BDCA 3FC1X 4YNOA 3PRIA 1LP4A 3I7CA 2P33A 2XKDA 3O96A 4IAYA 4C2WA 3EQDA 1FMKA 4XG9A 2UZBA 3R1SA 4YSJA 3ATTA 2ZOQA 2JKQA 1BYGA 2VX0A 3S1HA 3HX4A 4J1RA 1H28A 2W5AA 3IONA 5LCJA 2WHBA 2JFMA 4N0SA 2FSLX 4M3QA 4RBLA 2XJ1A 4YZBA 3DFAA 3FZPA 3MY0A 4PUZA 4W4VA 3GXLA 1B6CB 4ZLOA 4MNFA 5EDQA 3BWJA 4UWBA 2F7EE 4DFZE 2C6EA 2YACA 3DJ5A 4ZSAA 4YLJA 3O2MA 3EN7A 4BL1A 4ANOA 2ITZA 4V05A 4FEUA 2WTKC 4CVAA 4GYGA 1KE8A 4GL9A 3POZA 4OW8A 4GUEA 3QZIA 1O9UA 5AX3A 3SXFA 5CEPA 4IWOA 1M52A 2W1ZA 3RZBA 3Q6UA 2PL0A 4FV5A 3LQ8A 4PNIA 5CU2A 3VS4A 5LOHA 4DE4A 3PJCA 4W4YA 3Q5IA 1UNGA 2PVNA 5D7AA 4WKQA 4FT3A 1O6KA 5TE0A 3DJ6A 5L2TA 2R4BA 3NUAA 5CI7A 3GGFA 5IQGA 3JPVA 4C7TA 3K54A 4I4EA 1J91A 1REKA 2YLFA 3LFBA 4C4FA 4JLCA 1KWPA 2W1EA 3ORZA 3OCSA 2QG7A 2WNTA 4R3PA 5L2WA 4EWQA 2ZB0A 3D14A 4P2KA 4TYGA 2BFYA 1HCLA 4YJNA 3FQEA 3UIXA 4D55A 2YZAA 4EWHA 4M67A 2BZIB 2C1BA 3SHEA 3AT3A 3H10A 2DWBA 3LFQA 3WIGA 2YZLA 5D11A 2Y6OA 3V5TA 2Y7JA 2OG8A 1R0PA 3I0OA 2V7AA 2CNVA 3FZRA 3SC1A 3R8VA 2EUFB 3JY0A 4FSTA 2GQRA 1SZMA 4CCBA 4WRSA 1W7HA 3NCGA 5E1SA 5TKDA 2WFYA 2H34A 5M09A 4O22A 4EKKA 2C6IA 3GU7A 2GHLA 2OJJA 2W0JA 2GQGA 4Q5HA 4S34A 2X2MA 3KA0A 3QGYA 4I0SA 4AXAA 4YJOA 3KF7A 4FKIA 2ZJWA 3H4JA 3KREA 2ZM1A 5HGIA 3U9CA 3FLQA 5DRBA 2R3IA 4O6EA 1FINA 1OUYA 4JJRA 3PIYA 4NEUA 3I1AA 3C0HA 4QMQA 3EOCA 4KKEA 4XOZA 3P4KA 5AWMA 3R7IA 4CD0A 1M7NA 3KXXA 1REJA 2BKZA 5IPJA 5I9YA 5KMOA 2H9VA 3Q5ZA 3EYGA 4XEYA 3DTWA 3UTOA 3I0QA 3WZJA 4W4WA 3OEFX 3SXSA 3K2LA 4EJ7A 2SRCA 2XK9A 4ACHA 3O8UA 4IAKA 3HRBA 3DK7A 1QMZA 2GCDA 3E3BX 4FIIA 5AR3A 2IWIA 3C4CA 5AUWA 5KCVA 2XKCA 2W05A 4O7ZA 2HZ0A 3TWJA 4FSYA 3DAKA 1VJYA 3E8CA 5GZ9A 3FLZA 4FC0A 3CE3A 5AM7A 3OXTA 1H27A 4D9UA 4USFA 4X2GA 4XG3A 4F7SA 4O0UA 4CZUA 2E9NA 4IZYA 2ITTA 4Y5QA 4BBFA 2QONA 2F2CB 2J5EA 3DOGA 2WELA 3GP0A 4OTQA 5CU6A 3UODA 3KMUA 3JS2A 4R77A 5BYLA 4M14A 1FGKA 2HELA 2OSCA 1GIHA 3FBVA 1IASA 3H9OA 1YDSE 3QUPA 4BIBA 1BMKA 3FLSA 5FDXA 4DEGA 2OH0E 4E6CA 2CJMA 4RFMA 2PVLA 3AMBA 2XM9A 5AV2A 4AA5A 5JT2A 2WMUA 3PJ8A 4C2VA 3ORPA 3BYSA 5M4UA 4EH8A 3LMGA 3EQHA 3R2YA 5AUXA 4N70A 1M2RA 5DEWA 4N4SA 3NYOA 1FVTA 2IZTA 4FNXA 4BZOA 3EZRA 4BTFA 3FAAA 3QLFA 3LMHA 4IVDA 3NSZA 5K9IA 4HYIA 3ALNA 4D2VA 4RVLA 4F6SA 2CLXA 4O7LA 4FL3A 4A9TA 4C59A 3PZEA 4E6AA 3FL5A 4MTAA 2HOGA 2IPXA 2UW3A 3T9IA 3SD0A 4D5HA 3QU0A 4D4RA 5DGZA 4WD5A 2X9EA 4U5JA 4Y83A 2JAVA 5DFPA 2C68A 4IB1A 4FSMA 4XP3A 1PXKA 3DKFA 5IMEA 3AC4A 1J1BA 3PJ1A 4QP7A 3HNGA 4WA9A 4X21A 4FKPA 3SAYA 2BDWA 2QKWB 4D28A 3CY2A 5ANEA 1RJBA 3ZFMA 4RX9A 4EH5A 5JH6A 5K4JA 4FGBA 4L53A 2QR7A 4GV1A 1H1SA 1ZY4A 3O8TA 3QUDA 4R3RA 3QLGA 3ZMMA 3I60A 3KRLA 3Q2MA 3UC3A 4BKZA 2X81A 3IDCA 4M0ZA 4WG5A 4BCIA 4UMPA 4FODA 3KQ7A 5HE0A 4Q9SA 3AT4A 1MRUA 4OTPA 5EI2A 1Q3WA 5HLWA 2J0KA 5DHJA 3TUBA 4GEOA 3S0OA 2R3QA 4OLIA 5GJDA 5CI6A 3TV4A 1OL6A 4OTHA 1OKVA 2YIYA 4JAIA 4NM7A 1K9AA 4CYJA 2A27A 3HRFA 1W0XC 3BV3A 3EQCA 4I6HA 4BICA 5FUTA 4C36A 2GHMA 3IO7A 1OB3A 4JX3A 3PIZA 4ITHA 4J52A 3QQLA 4APCA 2ITVA 5E8XA 4Y73A 3ZEWA 4RIWA 2DYLA 4QTAA 4BCQA 4ORKA 3PA3A 2G9XA 5HORA 1IG1A 3C0GA 3PZHA 4V04A 4YZDA 4QMYA 4O0YA 4FIHA 2YDJA 5B2MA 3UQGA 2PUUA 4BR3A 3HL7A 2IZSA 4GVAA 4YGAA 2IJMA 4FMQA 3NR9A 4KBKA 1U4DA 5AV1A 3NMUF 3Q52A 3AOXA 4MBLA 3CD8A 3I6UA 4LRMA 4ERWA 3R8LA 5BVFA 2J2IB 3A7HA 1GAGA 4KSPA 3KRWA 4QP1A 2X4FA 2RFNA 3HP2A 2BZKB 3NPCA 5M06A 1QPJA 4EC9A 4YJVA 5LMKC 1MUOA 5HE2A 4FEWA 4RWKA 2UW0A 3QD2B 3QWKA 3WYYA 4DH1A 2CNUA 3FMMA 4MXYA 2BVAA 2E9VA 4JDJA 3FI2A 4ZJJA 3SV0A 3KCKA 4D2RA 4GFGA 2WMSA 5AP5A 2WO6A 2OW3A 2WU6A 4EOMA 5GZ8A 1Q8WA 2C0OA 3LJ1A 4X6RA 4FKGA 3F2AA 3COMA 3FPMA 3RAKA 4EH7A 2VTRA 2X6EA 5KKRC 3SVVA 5KHXA 3P5KA 3KRXA 1YI3A 3LXNA 1UNLA 3HECA 3UO5A 3M1SA 3O50A 4Q9ZA 4CFNA 2ZAZA 2QODA 4JG7A 5AR2A 2R2PA 4E20A 3ZZWA 3ETAA 5TO8A 2OO8X 3BWFA 5CAQA 4KRDA 2PK9A 1UWJA 2GU8A 4KBCA 3FZOA 4MWIA 1FQ1B 1BUHA 5ANOA 4F9YA 1ZXEA 5HO6A 4IDTA 1IAJA 2C0TA 2CCHA 1Q3DA 3A7JA 5AADA 1SNXA 3CQUA 2YFXA 1KUTA 1ERKA 4AW0A 4Y5HA 4W9XA 1ZMWA 3P78A 3MH0A 2QHNA 3KXMA 3OF0A 3N51A 1U54B 5CU3A 2DUVA 4FTTA 2GNJA 1ZYDA 3NW7A 2QO9A 4IAZA 5HBJA 3D15A 4JIKA 4RIWB 4RVMA 2GS6A 5A4TA 2QOHA 4C58A 4F9BA 4GKIA 3FJQE 3RALA 3RJCA 4R78A 2J7TA 4JG8A 4BDJA 4DFBA 3MTLA 3BE2A 2QVSE 3COIA 3QQHA 3GQIA 4MXOA 4O0XA 4F99A 2QC6A 5DLSA 4I41A 3R02A 5HTIA 5F4NA 3E3PA 5CENA 3CXWA 5FWKK 5BYYA 3FQSA 3BGPA 2OF2A 2H6DA 1WMKA 4F9WA 4EZ7A 1VR2A 4QQTA 3DV3A 1YXSA 5AV4A 1ZYLA 3OT3A 4RSSA 4FTUA 4IJPA 4QYFA 4XLVA 3CTJA 3LCKA 3ZFXA 1OBDA 3T9TA 3BLHA 4YZCA 5E8TA 2XK3A 3SA0A 4PL4A 4GUBA 2I7QA 3BEAA 5FM3A 2VWXA 2W7XA 5DT3A 3C13A 3QBNA 3ALOA 4G3CA 4WNPA 4AP7A 3PXYA 3DU8A 4Q5EA 4RFZA 4J8MA 3OROA 4ASEA 4USEA 2QOOA 2VTNA 3BU6A 5BVEA 2BZHB 3RAHA 3W18A 4GK3A 4F6UA 2X7OA 2C3JA 2ITWA 4YJUA 4ZXTA 4EL9A 4EH9A 4G5JA 2XIXA 3RI1A 4YLLA 5B2LA 5JGAA 1Y8GA 4QMPA 5KBQA 5AV0A 5HE1A 4C4JA 3BYOA 4GIIA 2WTJA 3KY2A 2O3PA 3UVRA 4NH1A 3SRVA 4ACCA 4G5PA 5JFVA 5E8ZA 1CM8A 2BAQA 3G5DA 3TTJA 2BDFA 5DA3A 2OZOA 4DFXE 3CBLA 3IOPA 1UKHA 4DFLA 4ZY5A 5A3XA 5JFWA 3CD3A 3EH9A 1CSNA 2AYPA 1G8SA 2GSFA 4FG7A 4ZZOA 2C6OA 4NL0A 2ITNA 5B7VA 1JLUE 4FKVA 4RIOA 2EXMA 5HG7A 1WVYA 2R3LA 3BGQA 3UVPA 4C8BA 3QTZA 2HIWA 2Y4IB 4O7TA 3TV6A 1AQ1A 4NKSA 3NDMA 3OFMA 4DT9A 1RDQE 2RFSA 4NM0A 1H24A 5JMSA 4H1MA 4CFVA 5TR6A 3TEIA 4I4FA 5L8KA 2J0JA 1XO2B 2YCFA 5LARA 2UZTA 5K0XA 4PDYA 4BIEA 3UO4A 3ANRA 1Y8YA 4UXQA 5KHWA 4TYHA 5CEIA 1NW1A 4KIQA 2B55A 3N4TA 4XG2A 1XQZA 2YCSA 2IVSA 3R30A 4MF1A 2OF4A 4FTKA 2VRXA 5DVRA 3KF4A 3CS9A 4EOJA 3MIAA 4EHEA 5LVOA 4K77A 4C0TA 4QMTA 4FSNA 3UZPA 1XH4A 3SOAA 3QYWA 4XCUA 1JSUA 4J7BA 3R7YA 3EN5A 1DM2A 2UZWE 3JYAA 3C50A 4OUCA 4XV1A 2X7FA 3VWAA 3LKMA 3LFAA 2C3LA 4QMUA 2W1HA 3R7UA 1OIRA 3TG1A 2UZOA 4JBQA 4L44A 4AE9A 5IH6A 1GY3A 2P2IA 4EZ5A 3ULIA 4NW6A 3VS3A 4FGRA 4O0RA 3ZBFA 5BUIA 1YOJA 2R0IA 5L2QA 5KX8A 3VW6A 4L6QA 2VO3A 1Y57A 5C03A 1BKXA 2X7GA 4J8NA 3R7OA 5EOBA 4E7WA 4M97A 3RPOA 5IQBA 4C37A 5I3RA 2I0EA 5D1JA 5IQFA 3CLYA 5E91A 3UO6A 3JVSA 3QZHA 4O7VA 5KMLA 4LOOA 3C4FA 4FK3A 3KGAA 1UU8A 3HMPA 2JDRA 3CJFA 5FEQA 3VS0A 3U87A 2BRHA 1ZYCA 3Q4CA 4I23A 4XYFA 3V8SA 3FXWA 4HPTE 2W1FA 2FGIA 4GSBA 3PXFA 4AU8A 4MNEA 5KNJA 3WYXA 3Q04A 5AP0A 3A4PA 2XRWA 4F1MA 3W8LA 4OTIA 4DTKA 4OAUC 2X39A 2V0DA 3QXOA 3S4QA 3NYXA 1DI8A 2ITUA 3D0EA 3UNZA 3F66A 2C5YA 4I6FA 4KIPA 5DNRA 2WMAA 3LXLA 3UNJA 3ZC6A 4ANMA 4DITA 3LJ2A 2PVJA 4CLJA 2X6DA 1JSTA 3RVGA 1B38A 4RFYA 3WF9A 2PVFA 2OJFE 3L8PA 4WSYA 4A06A 3E92A 4CT2A 3TUDA 2O5KA 5HU9A 1ATPE 4RG0A 4D4VA 4PMPA 3HV4A 3G51A 3ZHPC 3QTXA 1YXXA 1XH8A 2PE1A 1ZMVA 2YM3A 3AC5A 2BIKB 4HGTA 3EWHA 2C30A 4H39A 3OWKA 4ANNA 3GU5A 3MPAA 5ETFA 5AAFA 1VZOA 5G6VA 3OXZA 5FM2A 3RCJA 5C1QB 4FI1A 5IKWA 4XNEA 2J50A 1PKDA 4YJQA 3C0IA 2GNHA 1WBVA 3PWDA 4AZTA 3MH1A 2W06A 5HIEA 5AUUA 5AA9A 2Z7QA 3NNWA 2JD5A 4QMVA 3OUNB 2OGVA 3QZGA 4PV0A 2PUPA 1Z57A 3GCQA 2O65A 3E64A 3LCTA 4IVAA 3TZ7A 4KB8A 5JEBA 1IA9A 5HCZA 3AC3A 4YC8A 2H8HA 3TZ9A 2WMBA 4E26A 3GU6A 3IK3A 4WOVA 3D7ZA 4L45A 5JK3A 3QL8A 4UMQA 3D94A 3MFUA 2BRGA 3DBCA 3EJ1A 4EUUA 3TDWA 4MNEB 2JDOA 3F6XA 4AN9A 4QRCA 5H2UA 4LL0A 1I09A 4NM5A 4DFYA 3F3ZA 4PDOA 4AGDA 3DBEA 3V8WA 3QCQA 4APPA 2UV2A 3PA4A 4EBWA 3VIDA 2XNBA 4C4IA 1MP8A 4L3PA 3D5WA 4YHFA 5BMMA 1OVEA 5KMKA 4XV3A 3DKCA 3NNVA 4K6ZA 1WBWA 2PY3A 5FXSA 3W2PA 5J5SA 4BC6A 4MD7E 5ANKA 3QCYA 4CQEA 5ACBC 1OUKA 1BL7A 5KZ0A 3CPCA 3RK9A 3LLAA 3HGKA 4FKWA 4PNKA 1XHAA 1SVEA 3W8QA 5HTCA 5EG3A 1IR3A 2VTPA 1F3MC 3GVUA 5EDPA 2W4OA 3ZUVA 2E9UA 3E8NA 4M69B 4BI2A 5KMMA 4BWXA 1YI6A 4RIYA 3ACJA 4D9TA 4AW1A 3NEWA 1M2PA 4RVTA 5FEEA 5FQDC 4BB4A 5CANA 1Z5MA 2EWAA 4BCHA 1PY5A 3D5UA 2CDZA 1MRYA 2GMXA 1G5SA 4CFXA 4RLLA 1Q97A 3K3IA 3MPMA 2YITA 5HG8A 3FKLA 1A06A 2W9FB 4LUDA 4WNOA 2RG6A 5E7RA 2ITPA 4GT3A 5CZHA 4FZFB 5CTPA 5DIAA 2IO6A 2UW7A 3DKOA 3ET7A 4UBAA 5AIRA 4DCEA 5M44A 3PVUA 1SVGA 4JQ8A 4O96A 4LUEA 4U44A 1OPKA 3FLWA 3LW0A 4F63A 4RZWA 2PZ5A 2ZDUA 2F7ZE 3NIZA 4W9WA 3PLSA 4KRCA 3QALE 3OHTA 3PXRA 1PW2A 4U3YA 4DLJA 3G9NA 2VTIA 4EKLA 5CT7A 4WBOA 5LWMA 1ZWSA 4MF0A 5IQHA 2ETRA 5EW8A 3S2PA 2XB7A 3C4EA 4ZY4A 3VHKA 3DBFA 5HVYA 2Y9QA 2I0VA 4I6BA 5CAPA 4G9RA 3KULA 3HDMA 1H00A 3HDNA 3EQIA 4ARKA 2Z7LA 3C5UA 3GQLA 4QMOA 1XH7A 4NIFA 4FT9A 3U8WA 4L3JA 3TUCA 2WQMA 3ZS5A 4CYIA 4QPSA 3DLSA 4I92A 4GRBA 5L6WL 4FTRA 3FY0A 3QXPA 3O7LB 2XS0A 4GK2A 2WIHA 3A2CA 4TYIA 4QMNA 3QQUA 4TNDA 3FMEA 4MYGA 2OBJA 4FV6A 2GNLA 3UMXA 5FP5A 1Q24A 4EYMA 2NPQA 3OG7A 3UE4A 4MK0A 4DGMA 2CLQA 3ZSHA 4FTCA 4PRJA 3SOCA 3RHXA 1YDTE 1TQMA 4FV8A 2RFEA 3DA6A 3NYNA 5ACKA 4Y8DA 4YSMA 4FSZA 3NVKI 3NYVA 3OCGA 3MGYA 1ZOGA 2YDIA 3TNWA 4IM2A 3C4WA 4XV2A 3SKCA 1WVWA 5JZJA 3TDVA 4FG8A 3TKIA 3D83A 4FTOA 5H9BA 3KRJA 2QCSA 3E8EA 4WUAA 3OZ6A 4QPMA 4E4NA 5AEPA 5L6OA 5M4IA 1KV2A 2F49A 3FXZA 1LR4A 3ZRKA 2UW5A 2XBJA 1SNUA 4RQKA 3ZDIA 1YWNA 4JG6A 4FEVA 2XUUA 4D2SA 4AN3A 3CR0A 3R0TA 4KKGA 5JFXA 3UYTA 1P4FA 3PXQA 4HYUA 2XNOA 3PPKA 2WQNA 4R3CA 5KE0A 4ZIMA 3FPQA 3F3TA 4HYHA 4PL3A 1APME 4XBRA 4D1ZA 4CV8A 3UVQA 2X1NA 4L43A 3TKHA 4MVFA 5CEQA 4NT4A 2R3OA 4LV8A 3HV7A 4Z7GA 3UQFA 4BTMA 4GFMA 1UU9A 3N9XA 3UOHA 1WBTA 4ACGA 4EUTA 4CKRA 4EBVA 3DZQA 3ZLYA 5CF6A 3KULB 3UOKA 4X0MA 4N6ZA 2V62A 2RKUA 4R7BA 2XNPA 2XKFA 3UZRA 2FSMX 2WMVA 4LFIA 4QMWA 2OZAB 4RZVA 2WPAA 4E4LA 3QAME 4G31A 3FMLA 4HYSA 2QOLA 3DBDA 4MXXA 4I0RA 4XG6A 5FG8A 3ORLA 4E5WA 2Y4IC 3MVLA 3OWJA 4GMYA 3MVJA 4IAFA 4QNYA 1JKSA 4BN1A 4DTBA 4HW7A 5EHOA 2FA2A 3S00A 4TXCA 2C6LA 1Q99A 1ZARA 2BAKA 4G3FA 1KE7A 3JXWA 5EM6A 1NA7A 4FT5A 4KS7A 3JUHA 4LGGA 3IW4A 4ZTQA 5IISA 3EFKA 4NTSA 4FVQA 4FOBA 3DK6A 5E8UA 3RM7A 2FH9A 2JDVA 2QOBA 4CFWA 2FSOX 4QO9A 4DG0E 4FZDB 2ZM4A 4CSVA 4TPTA 5AAGA 3KEXA 1XH5A 5I9ZA 2ESMA 4K8AA 3KC3A 4EK5A 2PVMA 2VTLA 3EN6A 3FLYA 3P7CA 1G8AA 1ZRZA 4C3RA 3QKMA 4CG8A 1VEBA 1WFCA 4IZ7A 3EQBA 3VF8A 3E93A 2OIDA 3WZEA 2UZEA 3TNHA 5CU0A 4UMUA 4GJ2A 5FTGA 5J9LA 4X3FA 5KUPA 2YCRA 4R1VA 2Z8CA 3LZBA 2VGOA 4FVRA 4QMZA 4UZHA 3Q3BA 4FOCA 3F9NA 3QC9A 1YXTA 5FBOA 5L3AA 3Q4UA 2HY0A 3PDTA 4FTJA 3ZCLA 4EI4A 4JBVA 3ZO2A 1XBAA 3U6IA 4DINA 3Q32A 2KTYA 2RF9A 4XMOA 3ULZA 1YHSA 4XOYA 2ERZE 5A46A 1H08A 3QTIA 2R3KA 4G16A 4K11A 4O38A 4IFCA 5AUVA 2BTSA 2Z7RA 4C35A 5DEYA 5HLPA 1PXMA 3R8ZA 3VBTA 4GJ3A 4U97A 3AC2A 4ZJVA 3EHAA 5J7HA 2VTHA 5M07A 2OLCA 2VGPA 2HENA 1M7QA 4KIOA 3ZTXA 3QRJA 4IZ5A 2ZVAA 1DAWA 5GINE 2IW6A 1VYZA 4E1ZA 5EHLA 2YWVA 2C0IA 2CGXA 2HWOA 4GS6A 5T68A 3TI1A 3NW5A 4X2KA 1R3CA 4DBNA 3AD5A 4ACMA 3PA5A 3SQQA 4YZNA 2RGPA 4IVCA 3WF8A 3ZO1A 2PSQA 3EZVA 2XNGA 4PMTA 2QO7A 5I5ZA 3UNKA 4MHAA 4J95A 1ZAOA 2R3HA 1EH4A 4EK3A 4L3LA 2Y4PA 2XYUA 2C5NA 4QNAA 4K18A 1DAYA 3RTPA 5HU3A 3W2CA 3Q2JA 3VS6A 3QQKA 5HICA 3BELA 3MWUA 5F1ZA 3GENA 3MY5A 4NFNA 2I1MA 3ZEPA 1P2AA 5BVOA 4R7HA 5DMZA 2J6MA 4CFFA 3RKBA 4Q2AA 4GT4A 3OTVA 2B9IA 2JFLA 5DRDA 5DPVA 5IDPA 4CV9A 4NYEA 4BYIA 4AOTA 2BTRA 4YJSA 3RK5A 2W96B 2WEIA 3F5XA 5FXQA 1R39A 3O23A 2J9MA 5JQ8A 3R21A 4X3FB 1OIYA 3F5GA 4J97A 3TNQB 3BLRA 1R1WA 4U7ZA 4OTWA 3S3IA 3OBJA 3AMAA 4FTMA 3VQHA 2QOKA 5T6KA 1OM1A 2R9SA 2UZLA 2YAAA 4JS8A 4NK9A 3W10A 4IBMA 3OW4A 4BCMA 2HW7A 2YJSA 2W5BA 2CGUA 3PTGA 3R63A 2XA4A 1JQHA 3B2WA 3PE2A 3W33A 4CRLA 2QR8A 3L9PA 4TYEA 5D10A 3CSVA 4E73A 3OUKA 3RHKA 4IB5A 5A6OA 3OOGA 3BX5A 3CIKA 3D5VA 4M68A 4DEIA 1YXVA 4O7YA 5I4NA 4G3DA 1YQJA 2J0MB 5E8SA 3PSDA 3LCOA 3CJGA 3IW6A
chains in the Genus database with same CATH superfamily
5CEKA 4JI9A 4PDPA 4DEAA 4ZJIA 4C4EA 4PPBA 5M4FA 3G6HA 3UIBA 3FUPA 3RCDA 3G6GA 4MH7A 2A1AB 4DFNA 3AC8A 4RWJA 3AT2A 1CTPE 4LI5A 3OCBA 5CEOA 3NRMA 3CKWA 3Q9ZA 3BBTB 5CAUA 3VF9A 2W9ZB 3VS5A 2QOIA 3P7AA 2XM8A 3E62A 3OS3A 4NW5A 3UMWA 3L8SA 1V1KA 3O17A 3T8OA 5EYKA 4L7FA 1GZNA 1Q41A 2IZUA 2OICA 2R7IA 3W55A 4E4XA 2VTTA 4IAAA 1OL5A 3LM0A 3NAYA 4FSUA 1STCE 3NW6A 4FX3A 4M13A 4E3CA 4BIDA 2X8DA 4FTIA 4AA0A 4YJRA 4U42A 3VNTA 4DEEA 4J71A 4M0YA 2C6MA 4GCJA 4PPCA 4ZTNA 4O1PA 5DR9A 4WG3A 2WQOA 5FEDA 3JY9A 1H4LA 1PMUA 3JVRA 3CY3A 3MTFA 4HNIA 1WBNA 2YIXA 3QQGA 4FKJA 4RA4A 4BDGA 2ZB1A 3QQFA 3TXOA 1HCKA 5I9VA 2G2IA 2B4SB 5LMAA 4IAIA 4XX9A 4BTJA 1LEWA 2XF0A 5AUYA 4I93A 4NTTA 1Z9XA 4QP4A 2W5HA 4O91A 4DH5A 3LM5A 5JRQA 4FIGA 4XP2A 5AMNA 4CMUA 2IW9A 5CVFA 3UG2A 4IC7A 3C1XA 3MFSA 3TT0A 3DT1A 4QQJA 1TVOA 3GUBA 4U3ZA 2XAMA 3TM0A 3F5UA 5JZNA 1NVRA 3AKKA 5J5TA 2CGVA 1ST0A 3DB8A 1OKWA 4KWPA 2V5QA 3DDQA 3BBWA 4L7SA 5E9EA 4YTFA 3AC1A 3IOKA 2JBPA 4NM3A 3RPYA 3L8XA 2YCQA 3BHTA 4TT7A 5EW9A 3D2KA 3QF9A 4FYNA 3R22A 5B2KA 3BLAA 4G6LA 1OI9A 2QD9A 5GJFA 2Y6MA 3I81A 5FP6A 3LMIA 4O0WA 4FL1A 3KCFA 4BDEA 4DAWA 4U79A 3VO3A 4RIXA 3AMYA 3OWPA 5ETIA 4A9RA 3R71A 3PPZA 4FBXA 3QTUA 4GKHA 4JMQA 3ZH8A 4NSTA 5IA5A 4D1XA 2Q83A 2WMTA 4DCAA 3W2OA 3E7OA 3R04A 2Y0AA 4I20A 4C57A 1F0QA 2OXDA 4IEBA 3GEQA 4PX6A 4RC3A 4CEGA 3VJOA 4JX7A 4WRGA 2VWBA 3NZ0A 1K2PA 3PVGA 3BQRA 4RJ7A 5HEZA 1T46A 3HKOA 2CNQA 4BY9E 4O82A 3W0RA 2GDOA 5AM6A 1E9HA 2I0YA 1LPUA 5J9YA 5TF9A 4O2PA 3DJ7A 4DHIB 4TWPA 3GCSA 4F0IA 3COKA 5C26A 3OXIA 4F1TA 2IZRA 3H9FA 4IFGA 3TCPA 4RLKA 4NJDA 3RWPA 1URCA 4G2FA 3VJNA 5JGBA 3PY3A 4RC4A 2Z7SA 3NS9A 3VUTA 4WBBB 3U6JA 4FYOA 4AXFA 2X0PA 3PXZA 3VONA 4BBEA 4UZDA 4EQMA 3JR1A 4F0GA 1RE8A 4YO6A 2PUIA 3W0OA 3CKXA 3NUPA 5HOAA 3FDNA 4Z55A 1WCCA 4KBAA 5M51A 1H0WA 2IVVA 1H1QA 3GNIB 1IA8A 1IAHA 4M84A 4TWCA 5K0KA 4G9CA 4HNFA 3D4QA 4AS0A 1Q8YA 4UWYA 4QP2A 2XIZA 3PIXA 3NX8A 5A6NA 2ITOA 4UWCA 2JKOA 2WU7A 5C8NA 4EHVA 2GFCA 3R9NA 4A9YA 5HQ0A 2F4JA 4RX8A 3M11A 3SDJA 1X8BA 3V8TA 1M2QA 3NGAA 4IZAA 1Q4LA 4PTGA 4RJ5A 1UKIA 4O4DA 2Z60A 3HV3A 5AX9A 1OIQA 4BFMA 4M7IA 3I5ZA 2BALA 3FYJX 4XH6A 1ZZ2A 2NO3A 2VTMA 4RIXB 2JC6A 3VBVA 4J96A 4CNHA 3EKKA 1JBPE 3QKLA 4EORA 4FZ6A 1WVXA 3PP0A 1XKKA 2WB8A 1PHKA 2YLEA 4RMZA 4E6DA 4F64A 3ENMA 1P5EA 3NNXA 4ZTHA 3TJDA 5J8IA 5CVGA 1G8JA 4BI0A 4W8EA 1A9UA 4H36A 2PVHA 2WGJA 1NXKA 2VWUA 1CKPA 2C69A 2V22A 4QTDA 4JR7A 1XH9A 2G2FA 5DI1A 5F20A 3V6RA 4XG8A 3KKVA 5J87A 3ZSGA 4F9CA 4HVGA 1J7LA 4ZS4A 3FMNA 3LAUA 5F94A 5C4KA 1LEZA 1NVSA 2WTCA 3AG9A 5EKOA 4N57A 4L68A 4MKCA 5J9ZA 2BMCA 1M14A 1GOLA 5AP4A 4FNYA 5DT0A 1H8FA 1H0VA 5CYIA 2ZV2A 3DBQA 5IH4A 2HK5A 1DI9A 1G8KA 4KIKA 2IG7A 3UIUA 2CKEA 1J3HA 3NUUA 4A4LA 4D0XA 1JSVA 4H3PA 1H01A 2R3GA 3WZDA 5J95A 2PMLX 4TRLA 2GHGA 3LOKA 4HVHA 2WMQA 3SGCA 1JKLA 2R5TA 2UW8A 3GU4A 4LRJA 4ASZA 3DXPA 2ACXA 2RFDA 2YM4A 4U0IA 5ANGA 4EOKA 5IA4A 5KMIA 2XYNA 4DHFA 1FPUA 4F9AA 3DNDA 3C5IA 3V5WA 3MS9A 4ITIA 3QTWA 3A61A 4C61A 5A4LA 5IEVA 3KVWA 4ZEGA 1AGWA 3EYHA 4EK6A 1BI8A 3PPJA 4K33A 2UW9A 2VN9A 5DYJA 4O6LA 4JDHA 2EXEA 4AE6A 3P5JC 3C4XA 4FVPA 1QL6A 3RINA 5HVKA 4ZSEA 3WF7A 4NFMA 1J7UA 3MVMA 3SRVB 3EL7A 3A7FA 4QOXA 4AN2A 3Q9WA 3TIYA 1P4OA 4FE2A 3MH3A 4JBOA 3BYVA 2PE2A 3BRBA 3MFRA 3QRUA 2QHMA 3A4OX 4NWMA 1KOBA 3WE8A 5F9EA 1J1CA 5IF1A 4GYIA 4IB0A 2CKOA 4MXCA 5C4LA 1PYEA 5L2SA 1ND4A 4RA5A 3TMOA 5J79A 3CQWA 4QMMA 5A4CA 5HLNA 4LV7A 4L67A 3FI3A 4A9SA 3G33A 4IVBA 3LCSA 3GC9A 4BTKA 3UJGA 4DN5A 5LVNA 3HMOA 3BYMA 3ACKA 4D2WA 3NLBA 4DEHA 4DH3A 3QC4A 1JNKA 4O81A 3BI6A 4LYNA 4BKJA 1P14A 4U8ZA 4QYEA 2B52A 3E87A 3R1YA 4D4YA 4F7NA 1QPEA 4RPVA 5J1WA 5DR2A 4USDA 4BZDA 3IGOA 5BPYA 3UGCA 5GZAA 4FIJA 5E92A 4P5QA 4EONA 2FVDA 3GU8A 3NAXA 4BCGA 3PSCA 4EH4A 4G3EA 2ONLA 3K5UA 4LDTA 3MPTA 3PUPA 5HI2A 4BCPA 4EOLA 4TYHB 4D2PA 4UXLA 1GIIA 5CU4A 5BVNA 2OFUA 3BLQA 2BCJA 3BU5A 1YKRA 3ORXA 4OTFA 2X8IA 5EQEA 4KIKB 2OFVA 4JXFA 3OEZA 4UEUA 1OL7A 2DQ7X 5IQAA 3CPBA 3FSKA 3IW8A 2BRBA 3WF5A 3OW3A 4DLIA 5CF5A 1OBGA 4MD9E 3H30A 1CKIA 2H96A 5L8JA 4TL0A 2O2UA 3T3UA 1QCFA 3B2TA 3GOKA 4J98A 3BE9A 3NUNA 2WTIA 3E88A 3R9DA 5KMJA 1OZ1A 3IPHA 5CLPA 1PXNA 4QD6A 1QPCA 5EH0A 3RBWA 1U59A 3P23A 3M2WA 4O7WA 1H07A 3A8XA 4UY9A 3BHHA 3QD3A 2GS2A 4EOQA 4NCTA 5GHVA 4BDFA 4FKOA 1H25A 2YA9A 3PFYA 1UWHA 3DXQA 2NRYA 4AACA 2X8EA 3Q60A 4IWPA 4ANSA 5DH3A 2XVDA 3UPXA 4CKJA 5LMBA 3VQUA 4IM0A 2XIYA 4PTEA 4EOOA 4EEVA 3HVCA 5BQ0A 2GPHA 3ENHA 4U41A 4F4PA 3CGOA 1PJKA 2RG5A 3QX4A 2ZMDA 1PXPA 3FZSA 4X3FC 4AFJA 2YM5A 3HUBA 4ID7A 1BX6A 2YEXA 5HBEA 3ZLXA 1GZOA 4C3PA 5FLFA 5IEXA 4B9DA 4KKHA 3KVXA 3LFSA 4B4LA 3EQGA 1XH6A 4DG2E 4S32A 3KMMA 1L3RE 4FF8A 4QYHA 2VZ6A 4BCNA 3IGGA 4BI1A 2BFXA 4GU6A 4ERKA 4AWIA 3RGFA 3LFEA 2R3JA 3EMGA 3F3WA 4IADA 3R7EA 4FUYA 5HTBA 3G9LX 2OIQA 4C4HA 5CQWA 5IEYA 4DEDA 1JKTA 3QRTA 4F7JA 2O64A 3IW7A 3SXRA 2JEDA 4FTNA 3DS6A 3F88A 3HA6A 3K3JA 3MIYA 5IA0A 5LJJA 3FEGA 1H26A 2F7XE 3ZO4A 1BI7A 3VRYA 2R7BA 4UALA 2C3KA 4WUNA 4IANA 5ANJA 2HZNA 5HCYA 5BVWA 5JGDA 4OT6A 4F6WA 3H3CA 3BHUA 5CNNA 4A07A 5EYCA 3I6WA 4YJTA 4ENYA 2E9OA 4YJPA 4C02A 3ZC5A 1UA2A 2ITQA 2JDTA 2XK8A 4LOQA 3P1AA 4AT3A 3UOJA 3EFJA 3HV5A 3OTUA 3M42A 4DEBA 2GNGA 5EM5A 5HO7A 3FKOA 3U9NA 5KBRA 1AD5A 3ZDUA 2RIOA 3GI3A 3PE1A 4MBJA 2WTWA 3DQXA 4MQ1A 2XP2A 4S31A 2UUEA 4L52A 3FYKX 4FV1A 5AV3A 4PY1A 4QT1A 3V01A 2G01A 3EB0A 3FHIA 4TWOA 4BZNA 4AT4A 4EHGA 1XMLA 2W4JA 3QD0A 2YAKA 2PUNA 4FSQA 3MESA 5IQIA 1Q8TA 2YIWA 3R73A 1IEPA 2YM8A 2I0HA 4S30A 2R3FA 2HY81 3DNEA 2VNYA 3CC6A 4AQKA 3ML1A 4PPAA 4DH8A 4YBJA 3PJ2A 5IG1A 2UZDA 4PP7A 2R3PA 1U46A 3P79A 3TIZA 3KXGA 2PZYA 4YZ9A 5M56A 4FT0A 4PMMA 3AGLA 4M15A 4K9YA 3MA3A 1FGIA 4QDVA 2HXQA 2P55A 4RT7A 4EK8A 5E8WA 3R8MA 1VYWA 5E90A 3RPSA 2JDSA 2ITXA 4CCUA 4MXAA 3PWYA 5DG5A 3V6SA 1YDRE 2XCHA 2X2LA 2W1DA 4ANLA 4G6OA 4MWHA 3WZUA 4FEXA 3KMWA 4UX9A 2CN5A 1JAMA 4RJ4A 4IWDA 2HZ4A 5HVJA 3B8QA 3BEGA 4P4CA 2XK6A 2C6DA 4MCVA 4L01A 3REPA 4O84A 3OMVA 3FC2A 2OIBA 4EHZA 4RQVA 3UG1A 2BDJA 3KB7A 3OWLA 5EM7A 4C34A 2R3MA 3ERKA 3BU3A 4HCTA 5CSHA 5AR5A 1O6LA 2E9PA 3NCZA 3TNIA 1GZKA 2KULA 1ZMUA 2I6LA 2JLDA 5FBNC 1SM2A 4BKYA 3BKBA 2C5XA 4AT5A 4FJVA 4J99A 3E8DA 5CAOA 4E6QA 4QP3A 4U43A 3TV7A 4TYJA 3UP2A 4J53A 3RZFA 3G15A 2ZM3A 3FKNA 3QWJA 3KFAA 3GBZA 4ZZNA 1W2DA 4AQCA 2YIRA 3TZ8A 5IUIA 2YHVA 2G15A 4RIYB 1SYKA 2XEYA 3IG7A 3R2BA 4N6YA 5C8MA 4EH6A 2Q0NA 3FZ1A 3QTQA 4RWLA 4EZ3A 1ZY5A 3P0MA 4I21A 4HJOA 4O0TA 4YTCA 3G0EA 4ZLYA 3R01A 4R1YA 1XR1A 3ORIA 2WMWA 5TT7A 4KAOA 2PU8A 4EC8A 4OAVB 3MV5A 1E1VA 2LGCA 2NP8A 3ZYAA 5CSWA 4EK4A 1KV1A 4CMOA 3GC8A 4OBQA 1CKJA 4V0GA 4AX8A 3F7WA 2OXXA 3QHRA 4GK4A 3KXNA 5M4CA 4H05A 2BROA 3POOA 4BDBA 1XWSA 4BJJA 4G3GA 3FHRA 3DY7A 2PMIA 4ZTSA 5CEMA 4EOPA 2JKKA 2B1PA 3V3VA 5BX0A 3UQCA 3TACA 4YU2A 2EB3A 2XNEA 5IZFA 2UVXA 1Y6AA 4FV2A 5AP7A 4GFOA 4LMNA 4QTCA 2AUHA 2J0IA 3H0ZA 3DGKA 4RRVA 5CASA 3VC4A 1MQ4A 4ZLZA 3VBYA 3ODYX 4AOIA 4D1SA 2DS1A 3BV2A 1YWVA 4IIRA 3SG8A 4D58A 3FZTA 4P5ZA 3BCEA 2HWPA 3A62A 4FNZA 4KSQA 4DC2A 3VS7A 4YR8A 2R0UA 3OD6X 1I44A 4IXPA 4I22A 4YUQA 3ZO3A 5FXRA 4NIFB 2R64A 3HMIA 4G17A 1LUFA 1KE9A 4AZFA 3MI9A 3KN6A 1WAKA 2YM6A 3F7ZA 4JDKA 3ANQA 4R8QA 2PZRA 3A7IA 1OIUA 2IVTA 4G34A 4ZK5A 4AG8A 1XJDA 3B8RA 4TKSA 1UNHA 2WQBA 3QQJA 4M66A 4I6QA 3COHA 4HPUE 3QZFA 5KO1A 1YRPA 4RGJA 3C4ZA 5LWNA 2RSVA 4RX7A 2HYYA 5L2IA 3D9VA 2OU7A 1YHVA 3ELJA 4ZZMA 1YWRA 3TL8A 4CT1A 2IVUA 4ALVA 5JRSA 5HNIX 3KU2A 3BPRA 2JIIA 3F3VA 5JSMA 4ZS0A 4QMLA 4BCOA 3LFFA 4ALWA 4LQMA 3FI4A 2BAJA 2WOUA 3G2FA 3FL4A 1T45A 4YO4A 3N4VA 3D5XA 3OY1A 4IH8A 1R78A 2UZNA 2EXCX 4LM5A 4QPAA 5ANDA 4DA5A 4FKUA 5E8YA 3ORTA 5HIBA 4GG5A 3OC1A 5DT4A 1DS5A 3ZXTA 3DK3A 3GC7A 3IS5A 2ERKA 4H58A 2CPKE 4JT3A 5GIOE 4ZTLA 3VBXA 3L8VA 3CEKA 3QHWA 3VN9A 5I9WA 4V0GB 3MW1A 2XALA 1PKGA 1R0EA 2X9FA 3ZXZA 2VWVA 4YNEA 4BJJB 4Y95A 5LCKA 3R7VA 4GT5A 3PYYA 2QURA 4E8AA 2VO0A 4ANBA 1ZOHA 4AZEA 3MB6A 4D2TA 3VBQA 2G2HA 4F70A 3LPBA 5L8LA 4FKQA 4YTIA 4FG9A 4PTCA 3VUHA 4BDHA 1YW2A 5H8BA 4CTBA 1RQQA 4G1WA 4AW5A 4EOSA 2QU6A 2CCIA 5BNJA 2WMXA 1PF8A 4FEQA 2A4LA 4FV0A 4LRKA 2FYSA 3ORNA 4JBPA 2IN6A 1XBCA 3HAMA 4FTLA 5CQUA 4RJ6A 4PWNA 2AQXA 3V5QA 2WMRA 3EQPA 2WAJA 2ETKA 2GNFA 3ORMA 5E1EA 4CXAA 3UDSA 1WBOA 5AP3A 2C5VA 3WI6A 2BR1A 2PZIA 2XKEA 3KK8A 4LGHA 1CMKE 4L9IA 2PZPA 3A8WA 3FMHA 3LLTA 3R9RA 3BQCA 3MY1A 2X0GA 1V0BA 1PMVA 2XMYA 4BHNA 2OI4X 5HCXA 4AUAA 2HXLA 3AQVA 4TY1A 4ASXA 2OXYA 2ZV8A 5H3QA 4S2ZA 1PXOA 5M53A 1QPDA 3AD4A 4Y46A 4L00A 4X6QC 3IW5A 1UV5A 1OMWA 2B9FA 2G1TA 3PXKA 3W2QA 3FMDA 5GJGA 4BDAA 3W32A 2PMNX 3MFTA 2PULA 3R6XA 3VS2A 2UW4A 4TWNA 4DYMA 4X2NA 3RK7A 2J5FA 5CS6A 1OL2A 5DBXA 4MAOA 4WO5A 2VO6A 4E5BA 5LXMA 4CLIA 1YHWA 4FIEA 1YI4A 2A0CX 3RNYA 5DE2A 5L6PA 3DDPA 4FIFA 3UP7A 1A48A 5C9CA 4FKSA 3EFWA 3V5PA 3ZSIA 2W1CA 4RWIA 5HE3A 2J4ZA 2XK4A 2VX1A 3PRFA 5DOSA 4RJ8A 5HZNA 2XAOA 3R83A 1Q8ZA 5FD2A 3TN8A 1TKIA 3GCUA 5A54A 4JAJA 4EQUA 1Q8UA 5BMSA 3P9JA 3R1NA 5AIKA 3QGWA 2R3RA 2VWIA 4KS8A 3LFNA 3DTCA 4CTCA 3OBGA 4ANQA 4E5AX 2XH5A 3L9MA 4KINA 4IB3A 3R8UA 3V04A 4DGOA 4UMTA 4YZMA 3RMFA 2J0LA 4I6LA 3LQ3A 4IACA 3PY0A 4XV9A 5DWRA 5HNBA 3QFVA 3TJCA 3VW8A 4M8TA 4FR4A 2VD5A 5EK7A 5ETAA 2BIYA 3KL8A 2CKQA 3UDTA 1JKKA 4NU1A 2QI8A 2QG5A 1GIJA 1OECA 4HGSA 4FZ7A 4ZSGA 2ZMCA 4FSRA 5EM8A 4ENXA 5JN2A 3KIOC 3HZTA 5AP6A 3W2RA 4PP9A 2BUJA 5M57A 3SW7A 3W0QA 3QA0A 3WOWA 3Q9YA 4RC2A 3DKGA 2JBOA 4UN0C 2QOCA 4O2ZA 4UV0A 1G3NA 4HCUA 3R28A 2OH4A 4K2RA 1PMEA 1M17A 2VWYA 4PQNA 3VS1A 2YERA 4ZSLA 3W1FA 2QOQA 4I0TA 2WKMA 2XZSA 3EL8A 3R00A 3UOLA 4DGLC 2R3NA 3KXZA 4F1OA 2ONLC 2VV9A 2YIQA 5EW3A 3ZZEA 2JITA 4G6NA 1ZZLA 2C1AA 3MH2A 3I4BA 2NNWB 1ZOEA 3GCPA 3IDBA 5IQEA 2B54A 3HEGA 2XNNA 4CMTA 3TTIA 4MXZA 1URWA 5LVPA 5E4HA 3OCTA 1U54A 1W98A 3UIMA 3R1QA 2VWZA 4OTDA 1BL6A 4MBIA 5D12A 2VAGA 1PXJA 3LJ0A 3W16A 5HNGA 1JPAA 2C6KA 1Q61A 3AXWA 4JRNA 4QQCA 4B7TA 3HA8A 4IW0A 3BZ3A 2B53A 4Y72A 4HCVA 5FRIA 4DTAA 2O8YA 4QMSA 5AR7A 2BRNA 4QMXA 4I94A 5AR8A 3VUMA 5HG9A 2F57A 4RJ3A 3S95A 4P7EA 4EH3A 3K5VA 4P90A 5EI6A 5BUEA 4MQ2A 1FMOE 4JIAA 4X7QA 1OL1A 3CTQA 3GCVA 4JL9A 4OTGA 3O8PA 4XBUA 5I3OA 5JKGA 5GIPE 1OGYA 4O86A 1UU3A 3FSFA 4NCTC 1OPLA 3U4WA 1FVRA 3HAVA 5HIDA 2QU5A 4JRVA 2JIUA 5BUJA 3BHYA 5M55A 3OY3A 4I5CA 4YP8A 3EN9A 3GOPA 3R8PA 2O0UA 3NNUA 3PVWA 3G90X 2ZV7A 1OITA 2CMWA 4O7RA 5HX8A 2VNWA 1SVHA 4JDIA 1F5QA 3GB2A 3QD4A 4AF3A 4A4XA 3AKJA 4DG3E 5ICPA 3BGZA 4GIHA 4U80A 2QKRA 5CT0A 5CSXA 1TFFA 4KUJA 1YXUA 4E4MA 1GZ8A 3VRZA 3AGMA 4AZWA 3SW4A 3O51A 1IRKA 4WNMA 2XJ2A 1O6YA 4BCKA 4EYJA 3CQEA 4XLIA 4W8DA 2QOFA 5AJQA 3ZUUA 4AAYA 5K4IA 1MQBA 3OP5A 5HO8A 4ZY6A 4BGGA 3EKNA 4X2JA 3P7BA 2B9HA 5C01A 2VU3A 3Q53A 1Y6BA 4NJ3A 5IDNA 3C51A 3II5A 3F5PA 1TQPA 4KABA 2RL5A 1YOMA 4ZSJA 3OOMA 1U5RA 2YJRA 4OT5A 4WSQA 3UPZA 3THBA 4FTQA 3UBDA 3QCXA 3UZTA 1ZYSA 1PXIA 2F9GA 2HZIA 2PVRA 5CZIA 3V5LA 5JQ5A 1JOWB 1MRVA 3DPKA 5F95A 5HESA 4XP0A 3VUIA 4ACDA 2YABA 4A7CA 3FLNC 3AKLA 2VTOA 2J51A 2C47A 2OJ9A 2V55A 4O4CA 3VUDA 3WF6A 2B7AA 2BHEA 5C27A 4C3FA 3VULA 4MEDA 3QRIA 3ID6C 3U54A 4II5A 1PYXA 2WOTA 5LVMA 1B39A 2IEWA 3IQ7A 1HOWA 2VTJA 4CFUA 4U6RA 3U51A 4YMJA 5A9UA 5BVKA 5D41A 3T3VA 5HD4A 4DF3A 2PE0A 4TNBA 5AFVA 5AUZA 1W82A 1XBBA 5EQPA 1SMHA 5IQDA 4AGWA 4O1OA 3RNIA 4EOIA 4FV7A 2OWBA 3ZM9A 3QX2A 3Q4TA 5B0XA 4D4SA 3Q9XA 1YOLA 1UVRA 2B9JA 4AGCA 3V51A 4I24A 4B99A 3U6HA 4I5MA 4F65A 4TZRA 5CF4A 5AP1A 3PSBA 5K5NA 1H1RA 5EOLA 5CALA 4U81A 3HRCA 4HZRA 5GNKA 4BDKA 3SX9A 3D2IA 1WZYA 5AR4A 3MSSA 5KZIA 2WTKB 2W99B 4YPDA 3R9HA 1JVPP 4YHTA 4XJ0A 4DGGA 2W1GA 5EDRA 3U4UA 3F61A 4U40A 2PVKA 5C8KA 4H3BA 5T3QA 4Z3VA 4OBPA 1FOTA 1JWHA 4BVUA 3OT8A 5CX9A 1WBPA 3FI8A 2JIVA 4AFEA 3MBLA 3RPRA 3HUCA 3E7VA 4BCJA 3ZONA 4F0FA 1FBNA 1TQIA 1S9JA 3IDPA 4JOAA 2YWPA 1XMMA 2OJGA 5HD7A 4FTAA 5IU2A 3UDBA 4FNWA 3HLLA 4PMSA 1FVVA 5AA8A 4E93A 4PF4A 4KNBA 3QTSA 4AOJA 3QKKA 1GJOA 2XIRA 2WIPA 4FKTA 4UYNA 5HBHA 5FTQA 5K5XA 4BCFA 1W8CA 4DFUA 4WHZA 4BYJA 4BRXA 4BWPA 4F7LA 3RPVA 4JVGA 4BWKA 4ITJA 4HVSA 5IA2A 4OGRA 4XHKB 4MX9A 1CDKA 4BDDA 3IKAA 2JGZA 5JFSA 3LHJA 4BF2A 3FXXA 3O0GA 3ZM4A 5ETCA 4V01A 4C33A 5ANIA 4ZP5A 4FV3A 3F2RA 2OKRA 4TN6A 3O5AA 4FT7A 3FV8A 2FUMA 4OTRA 3KK9A 2ITYA 1NVQA 3BHVA 2QNJA 4QP8A 3KRRA 3QA8A 4DHZA 4XUFA 4QTEA 3LXPA 3VBWA 2OK1A 5IMXA 5CXHA 2WQEA 3I5NA 4IWQA 4FK6A 1V0OA 5H8EA 2X0QA 2AC5A 2PTKA 4AAAA 5EKNA 2I40A 2VTQA 3MYGA 5CF8A 5CVHA 4CFMA 2VUWA 2A98A 2HCKA 4FSWA 3A60A 4U9AA 5J1VA 2GFSA 1Y91A 2WXVA 4MD8E 5CWZA 3MJ2A 4A4OA 2WD1A 4O83A 4LGDA 2EB2A 4NKAA 3ZFYA 1RW8A 2HW6A 5TOZA 3WIKA 4LL5A 4EQCA 3AD6A 4ZAUA 2X2KA 2Z02A 1OGUA 4RX5A 2XNMA 4YURA 2WZJA 4ZMFA 4EH2A 3RAIA 5EYMA 4M12A 3ROCA 2GQSA 3NVMB 4F78A 1KE5A 2P3GX 4KD1A 5CNOA 3TZMA 2FSTX 5D7VA 4K1BA 4Z9LA 2WEVA 4S33A 3UDZA 3HMNA 2C5OA 2UZUE 4UMRA 3DCVA 4XRJA 2UVZA 3HV6A 3UC4A 4H1JA 3H0YA 4DDGA 4IHPA 4QYYA 4Y85A 4BGHA 4F09A 3KN5A 3N4UA 4YPSA 4I3ZA 2Z2WA 2O63A 3ZU7A 1OKZA 2P2HA 3W2SA 2Q0BA 4QYGA 3TNPC 3VHEA 4R5YA 5AP2A 5IH5A 3IECA 4I1ZA 2PPQA 1L8TA 2YDKA 4IX3A 4IC8A 5IUHA 3R7GA 3I79A 3PY1A 3DFCB 3L1SA 2XIKA 3A7GA 3LCDA 3LVPA 4YHJA 3WE4A 2XRUA 5CAVA 5J7BA 2QQ7A 3OVVA 4DGNA 1OPJA 3PVBA 3QCSA 4X3JA 4IJ9A 1PMNA 3BIZA 2W4KA 3RM6A 3NUYA 2ZYBA 3EQRA 3QTRA 4U45A 4WG4A 4NZWB 4B6LA 4OBOA 5KMNA 2VO7A 2XCKA 3LE6A 2VX3A 1KOAA 3FMJA 3CGFA 3HP5A 2UZVA 4L42A 4L8MA 5A14A 3DQWA 5EHYA 2PYWA 3EIDA 4I5HA 4IM3A 2BRMA 1YVJA 4QTBA 4ONAA 3ZUTA 4K0YA 3UYSA 3DXNA 2VTAA 3C9WA 1WBSA 2X4ZA 4HGLA 5LMKA 2ETMA 2YN8A 4RVKA 4ZTRA 3TKUA 3CP9A 2OJIA 4LG4A 4HGEA 5H8GA 4O7NA 3I7BA 4O21A 1Q62A 4YBKA 2JKMA 2P0CA 5K3YA 2C6TA 5IA3A 4M69A 4KA3A 2ZDTA 3DB6A 3EFLA 4CZYB 1E1XA 1H1WA 1ZLTA 5I0BA 3P08A 3WARA 5FDPA 2IW8A 2XEZA 4Z7HA 4FL2A 3E63A 2F2UA 3P86A 4I5PA 4AZVA 4LOPA 5FTOA 4NUSA 3R9OA 1VLRA 4HOKA 3ROYA 1W84A 2J90A 3VUKA 3BYUA 4FA2A 5FGKA 5AAEA 4IE9A 3L9LA 3Q4ZA 5EFQA 4R6VA 4IMYA 5BYZA 4JQEA 4PDSA 3F2NA 3DAEA 4O27B 3G0FA