5C8KA

Egfr kinase domain mutant "tmlr" with compound 1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
322
structure length
300
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYEEDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Noncovalent Mutant Selective Epidermal Growth Factor Receptor Inhibitors: A Lead Optimization Case Study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 300
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5c8kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c8kA01
2YJRA 3CY2A 3I79A 4K8AA 2I0HA 3R7OA 5CZIA 3VW8A 4MEDA 4KRDA 4RZWA 5CWZA 3F69A 3E8DA 3ZC6A 2UZUE 3L9NA 2CSNA 4FTRA 2OXXA 4K77A 2BPMA 2VNWA 4ZY5A 4IXPA 3ORZA 3OXIA 2WEIA 2HY0A 4YO4A 1YOJA 4X21A 2OU7A 4ZIMA 3NUAA 3ZRMA 3LIJA 3PPJA 1ZOEA 1OECA 4IVCA 3AOXA 3UJGA 3O8UA 3UIBA 3UOKA 4GSBA 1JKLA 5L2QA 3LVPA 4YHFA 4WT6A 1Y6AA 3UOHA 1SMHA 5EM8A 3L9MA 4EQUA 4Z7HA 1FINA 1H1SA 2QLQA 5ANGA 4FMQA 1ZAOA 4ASEA 4J7BA 4AF3A 1WBSA 4D2WA 4JDJA 4EI4A 3GCUA 3B8QA 5AAFA 3OG7A 4R7BA 3TUBA 3PXYA 3C5UA 4C33A 5CANA 3RKBA 2J5FA 5M51A 4JQEA 3QTUA 5LMKA 1YWRA 2ETKA 3KA0A 4U8ZA 2OXYA 1Y57A 1WBWA 4XP0A 2VTHA 4KKGA 1WBNA 4UZHA 3O23A 4H36A 3HMMA 4BCJA 5BYZA 3P5KA 5K4JA 2RL5A 4NIFB 5JQ8A 4EK3A 4U80A 3T8OA 2VRXA 4L7SA 4QNYA 4ASZA 1ZYLA 5KNJA 5DR9A 4L68A 4I5CA 3P23A 1QPEA 3W33A 4D28A 3I6UA 4FA2A 5HE3A 2QCSA 5FTQA 4L00A 2GS2A 4BB4A 5CQUA 2QKRA 2C6MA 4GS6A 5DN3A 2GNFA 4NYEA 3TM0A 4WBOA 4F6SA 2GQGA 4UEUA 2VWVA 3ALOA 3IOPA 3PJCA 3QTSA 4F70A 5DVRA 5HIEA 2ETMA 2XCHA 5BVDA 4X2JA 4LMUA 4E5WA 4JNWA 5DT0A 3I0OA 2BAJA 4EOJA 3LFDA 3CTJA 3V6RA 1OVEA 3G9LX 1Q62A 4HNFA 3VHEA 4AFJA 4GL9A 4ALWA 1Q61A 2UZNA 4WA9A 3O17A 4OTGA 4C7TA 1YVJA 5CY3A 2YZLA 2QOHA 2ZAZA 4GKHA 4QMYA 5K0XA 4FIIA 2W9ZB 4J71A 1YXSA 5DRDA 1ZOGA 4GMYA 4IHPA 4USDA 3KXGA 3JXWA 5CENA 5IEYA 3A7IA 2XP2A 3DKOA 4BGQA 2R3HA 5G6VA 4EH8A 3A2CA 4FV1A 4XG9A 3L8XA 4NM5A 2ZDUA 3H9RA 4M3QA 4E20A 4CSVA 4G6NA 2WELA 4JS8A 2UUEA 4HGSA 4BZNA 3PWYA 3H30A 2W5BA 3JUHA 3PFQA 5AFVA 3C4CA 3RPRA 4IB1A 4Z55A 4FT9A 4HYIA 1OIQA 1XH5A 4D2SA 5CEPA 2UZEA 4F63A 2FSOX 4L3PA 3AT3A 2VTIA 1OL7A 4IB0A 4K33A 3D7TA 4IWPA 4R77A 4ITHA 3K3JA 4NU1A 2XNNA 1YRPA 1P14A 1WBPA 3FZOA 4NJ3A 4L46A 4L45A 5BUIA 4PWNA 5BNJA 3ET7A 3BELA 2UW7A 4N4SA 2XJ1A 3T9TA 1FQ1B 3DXNA 3POZA 4YO6A 3BHHA 3HV6A 1URCA 4XLIA 3IDPA 4FSMA 4FZFB 3AXWA 4FIHA 5J1VA 3PXQA 2IVSA 2YWPA 4U3YA 3VVHA 3U8WA 5M08A 3FY0A 3POOA 2W1EA 4ZY4A 3FBVA 2Z7LA 4YURA 2YN8A 3DV3A 2QOBA 3FUPA 4TL0A 3BGZA 5DIAA 5HE2A 4N70A 4BIBA 4YBKA 2HWPA 4FTIA 4PNIA 2XIRA 2ITZA 2PVMA 2VGPA 5EQPA 4YR8A 5DH3A 2ZM3A 4O22A 4AT3A 1K3AA 4M14A 4QMMA 3DDQA 5IPJA 5E4HA 1LR4A 2ZV2A 3NYVA 4BCIA 1ZMWA 5I9ZA 2Y0AA 3JVSA 2BIKB 1H27A 2CN8A 2PK9A 4ERWA 5HG5A 3DXQA 3VBWA 2CNUA 4PNKA 4EQCA 3UQGA 3AGLA 4PTGA 3EL7A 3ZH8A 4ZTRA 1GIHA 2UVZA 3HMOA 4S32A 4GT4A 3F6XA 3F3UA 5EG3A 3VUMA 5B2LA 2WU6A 2GS7A 3NWWA 1PF8A 4OBOA 4EOQA 4JAJA 2GHGA 4RX9A 4QT1A 4HGTA 2C69A 5A9UA 5GZAA 2ZM4A 3CC6A 3CGFA 4JRNA 1P2AA 5C8NA 4ZS0A 3BGQA 4F7LA 1HCKA 3DXPA 1MRVA 2W4KA 3MS9A 3TEIA 4BTJA 4M8TA 3SA0A 3D5WA 3NYXA 2YM8A 2YJSA 3KXMA 4GFMA 5HBJA 1XQZA 2RG6A 4O6EA 4R3RA 3NUSA 2VU3A 2X6EA 4YC6A 3KXNA 3WYXA 3RTPA 1H1RA 1ZYSA 2C68A 1XR1A 3IOKA 2R3OA 5FRIA 5GIOE 3LXNA 2GNGA 4FSQA 4AN2A 4B4LA 4O0WA 4EONA 3WF8A 2W06A 3NW5A 2BDWA 2ERZE 4FTAA 4WOVA 3E7VA 5CI6A 3ITZA 3SQQA 3KN5A 3ZFMA 3R9NA 1YOMA 4RIXA 1E1VA 1VZOA 5AUTA 3BWFA 3G9NA 5CVHA 3U87A 5EM7A 4LI5A 5CVFA 4E6QA 4K1BA 3VRZA 2GNHA 4FL3A 4XNEA 5HVKA 4QQTA 4BDKA 3NZ0A 3OCSA 4FV3A 3ZLWA 3QL8A 5KKRC 1J7UA 3OBJA 4R5YA 3UYTA 4ENXA 3KY2A 5M4UA 2X4FA 3PVBA 4YJSA 3AG9A 3OTUA 4D1ZA 4PMSA 3R8UA 4OTFA 4Y72A 1Y8YA 3HUCA 4I20A 5BVFA 2YLEA 1AQ1A 5D7VA 3EN4A 3IW6A 1IA8A 3P79A 5EI6A 2WOTA 3UVPA 5BUJA 3RAWA 3BCEA 3MJ1A 1XBBA 2XK8A 2XJ0A 1F0QA 3MY5A 2P33A 4C62A 1MQ4A 4MH7A 3R63A 4TN6A 3FI4A 3PPZA 3NMUF 4RVLA 5AP4A 3TT0A 4LRKA 2BCJA 4FVQA 3UC3A 3QALE 4X0MA 4IEBA 3HA8A 5JSMA 3EYHA 4PDSA 1UKHA 3ANQA 1NXKA 4HNIA 4B9DA 1CDKA 5BVWA 4EUTA 2G2IA 5A6OA 2W05A 1Z9XA 3PTGA 5FD2A 2YCSA 2YAKA 3UOJA 3QYZA 1SYKA 1JSUA 4R8QA 4ANMA 1URWA 2UZBA 4XS2A 3BGPA 1V0BA 5BMSA 1YDSE 2C6LA 4ZP5A 4JAIA 5D9HA 3LFFA 4F9BA 4ZAUA 4O6LA 3GOKA 3WZUA 5C27A 3VN9A 3OEZA 4JBPA 1R78A 3NCZA 4PX6A 3UP7A 4HPUE 4DFLA 5JGAA 4IAZA 3BEGA 5FXRA 4D1SA 3TUDA 4ANSA 1WVXA 3R7GA 3AT2A 2IW9A 4W4WA 1GOLA 1OPKA 4F0GA 3GB2A 3PIZA 3Q9WA 3V01A 4FTTA 4WNMA 1JQHA 4C4JA 2OZAB 2WEVA 2QR8A 4V04A 3PA5A 2PU8A 5LVLA 3ZLSA 4DT9A 1REJA 2YIWA 4RSSA 2XEYA 3D7ZA 2XKEA 4AA4A 2VV9A 3IW4A 3LCDA 4JG6A 3FLYA 3R8LA 1KV2A 4H58A 2PVKA 4U7ZA 5J7HA 4ZMEA 3RAKA 4IX5A 4PDOA 4A9UA 4WRGA 1CM8A 4LGHA 2EXEA 4FNWA 3FPQA 2F7XE 4UXLA 2WXVA 2IJMA 3IW5A 3SD0A 2YITA 4F08A 3UVRA 5HTBA 1H25A 5DYJA 2HAKA 5TR6A 2YERA 3KU2A 3R01A 3SV0A 3UMWA 4YZCA 5FBOA 2VWIA 3HX4A 2P2HA 3BX5A 4I21A 2R3QA 4CG9A 1JNKA 3UTOA 1H1WA 4FV7A 1PMVA 4FF8A 4JJRA 5H9BA 2BFXA 4E3CA 5CF8A 4M69B 5HHWA 4MWHA 4IADA 1UV5A 4BYJA 4EYMA 3FV8A 3Q9ZA 1BL6A 3HLLA 4FKPA 5JT2A 3TIYA 4M13A 3I4BA 3ATSA 5L2IA 1Q5KA 4DEIA 4K6ZA 3ZONA 4O1OA 4BN1A 2OLCA 4I5HA 2WU7A 1OKWA 5EH0A 5EOBA 4XCUA 3GCVA 4G5JA 4IZYA 3HV3A 3MA6A 4U5JA 2EU9A 3RAIA 3QRJA 4H39A 3GP0A 4WNOA 2VTJA 5CU2A 1KE9A 3K5UA 3MH0A 5IEVA 3F88A 3DA6A 5IUGA 5KMIA 1TQIA 3IQ7A 2QVSE 2UW0A 2CGWA 2WTWA 4IFCA 5IU2A 4MXAA 1OL1A 4NW6A 4C4EA 5LVMA 5AP1A 3FHRA 3S4QA 4F7NA 4DH7A 5IISA 5AR2A 1RDQE 4NTSA 4LUEA 3TDVA 1FVTA 1LEWA 1OI9A 3TTIA 4M0ZA 1KE6A 5IQIA 5A3XA 3GBZA 4FTLA 4FE2A 3DT1A 3HV5A 2WGJA 4BCGA 1OKVA 5FP5A 3ORMA 3UNJA 4LL0A 3QRTA 3ZLXA 5H8EA 1Q8ZA 4RJ5A 5JRSA 3VO3A 4LM5A 3O8PA 4RMZA 3MTFA 2Z2WA 4A06A 3PP1A 3ULZA 3VNTA 1O6LA 3EFWA 3IW7A 4JBVA 2ITVA 5K3YA 4AW5A 2A19B 5IH5A 1H26A 5I9UA 2ZDTA 5HGIA 2WMAA 3HRBA 5EW3A 1I09A 2R5TA 3D5UA 2ZB0A 1JKSA 2G9XA 2XMYA 4FICA 4TNBA 1OIRA 3FQHA 3ZUVA 1JVPP 2C6TA 3ZO3A 5M4IA 1YXTA 3E8CA 4ZSEA 1FVRA 4LOQA 2FO0A 3F3WA 3NW7A 3Q52A 3FEGA 2Z7RA 4C4GA 3H9OA 4ACDA 2OF4A 5AMNA 1CTPE 3VBTA 4EZ7A 3F82A 4WNPA 4XOZA 2QO7A 3K54A 4O2PA 3W16A 2PL0A 4ID7A 1TQPA 4FK6A 4O27B 4O7WA 5EHLA 4PMPA 2HZNA 2YFXA 2JIIA 3JPVA 2XKCA 2WKMA 2RG5A 4IJPA 5B0XA 3V5QA 4C0TA 3CEKA 5AAGA 2PE2A 5M07A 4DG2E 4AE9A 4FKVA 5ACKA 4I3ZA 2E9OA 1YWVA 2JFLA 2BALA 2HW6A 3ACJA 3FLZA 4OTPA 1FPUA 4BDGA 3CJGA 1MUOA 4FK3A 3RI1A 2W4OA 4NW5A 2VO6A 4MCVA 4PTCA 5AUYA 3G2FA 4XOYA 1REKA 1OL2A 2HW7A 4HYSA 4KBAA 5DA3A 3UO5A 5E92A 2E9UA 3EJ1A 3C4WA 2NP8A 5JZJA 4HGEA 1W98A 4PP9A 4R3PA 3P4KA 4MTAA 5TOZA 3WF5A 4RJ4A 3LMHA 4G17A 4RFMA 5M53A 3DPKA 3BE2A 3DQXA 4FKRA 2EXMA 4QD6A 3CQWA 3VUKA 2X7OA 2QU6A 3TUCA 3F5PA 3PIXA 4DHFA 1AD5A 2X39A 4E93A 4YPSA 2BKZA 2HOGA 3LMGA 4RX7A 2JKQA 3EQHA 3BYOA 3QGYA 4FNYA 2XNPA 4DEDA 2PUIA 3LLAA 4F99A 3A7FA 3QX2A 2V55A 2R7BA 2XK6A 5ETAA 3DY7A 5AX9A 2RFNA 5I9YA 3LXPA 5E1EA 4MHAA 4AZSA 3ZFYA 2E9PA 3TKUA 3K3IA 2RF9A 4FV5A 4Y73A 2GQRA 3ZM9A 2C6EA 4AGWA 5LWMA 3KRJA 1OB3A 4W9WA 3V5WA 4NKSA 1VYZA 5G1XA 4AA0A 3ELJA 3ZYAA 4XBUA 4IC8A 5AP0A 5BQ0A 3FI8A 2CCHA 3ORPA 5C26A 4JBOA 4O91A 1XKKA 1V0OA 2HZ4A 2J9MA 2YZAA 3FL5A 4RIWA 2JFMA 4G1WA 4BWKA 5KUPA 3R7YA 4QQCA 3UQFA 1PXKA 4I6QA 3VQHA 2B52A 5J5TA 4OAVB 2AYPA 1YQJA 2UW8A 4A07A 1W83A 3IKAA 2W9FB 3LM0A 2ESMA 4Y5HA 5IF1A 3NEWA 1GZKA 3LHJA 4LYNA 3ZO4A 3F9NA 4YJPA 3RHXA 4X3FB 4GH2A 4QQ5A 3PUPA 1V0PA 2Z60A 5AAEA 5IA1A 2VZ6A 2ITXA 3NR9A 3C9WA 4J98A 2DQ7X 4MXCA 2ITQA 3G6GA 2X8DA 3VUDA 3EQFA 3QXOA 1Z5MA 4M15A 4AZEA 3GQLA 5IDPA 4O7TA 4XJ0A 2CHLA 4V05A 5HD4A 3UZRA 5ANOA 1NY3A 2WZJA 1GAGA 5LARA 4O21A 1PXLA 5JZNA 2NNWB 5A46A 3F2AA 4YTIA 3U9NA 1UWHA 1Q8TA 2W5HA 3PY1A 4AZWA 3A60A 2BZHB 3FQEA 3HV7A 4O0VA 3FHIA 4OTHA 3DFCB 1RJBA 3Q6UA 2R3GA 4KAOA 4E26A 1IG1A 4GG5A 3UBDA 3BV3A 3MGYA 4I92A 3RBWA 3FKOA 3OEFX 5DNRA 3PA4A 3DBDA 3UNZA 4IWDA 3DAKA 4YU2A 2X2KA 5DT4A 2I0EA 4EKKA 1ATPE 4FV6A 5ANEA 3S1HA 2QHMA 5HD7A 2VTTA 2XNBA 2WMWA 3Q5IA 4QMZA 1PXOA 4KD1A 4WSQA 4NFNA 5I3RA 1YHWA 3DQWA 4BYIA 4WIHA 4WNKA 4KIKA 3ZCLA 1YWNA 4HVGA 4JT3A 4WG5A 1ZMUA 4IW0A 3R2BA 5CAUA 1NT2A 4CVAA 3U54A 5E7RA 2F9GA 2PE1A 1QCFA 1P4FA 3QXPA 1PXJA 4BBMA 4O83A 1P5EA 2W1IA 3NNVA 3VS5A 3ZXZA 1PXMA 4OTIA 3W2CA 3HMPA 4ZLOA 4BY9E 2YHVA 4NT4A 3R8PA 1WMKA 3KC3A 4UY9A 4U6RA 2CCIA 3HNGA 3EQPA 4YSMA 2YM5A 3KMUA 4C02A 4O7SA 4JOAA 4ZSJA 5ETCA 5J7BA 3SVVA 4I93A 2PZPA 2VO0A 3MFSA 4C57A 2AC3A 2UV2A 4IE9A 1OZ1A 4U0IA 4CNHA 3I1AA 4KABA 4PUZA 4D2RA 2OFVA 4B8LA 4BDEA 3UE4A 3L1SA 4AOIA 4XMOA 5K9IA 4F4PA 2CNVA 5FTOA 3TTJA 1KSWA 1Q8UA 1PY5A 4D5KA 4BKJA 1L8TA 5CVGA 5GINE 2E9VA 4J95A 2B9JA 3G6HA 4I0RA 2OH0E 4PPBA 4ZSGA 2A0CX 3NIEA 5HICA 3OC1A 5HQ0A 2I1MA 4RFZA 4FIJA 4RC4A 4CFUA 4DAWA 1OKZA 3C0GA 4Q9SA 4V01A 1LP4A 3DNEA 4OT6A 1Q97A 3KK8A 3R8ZA 4ALUA 2PMIA 3C1XA 2FH9A 3TN8A 4I6BA 4I41A 5FXQA 4CD0A 1NW1A 4NM3A 4FTCA 2HZIA 2JC6A 4YLJA 1H28A 1HOWA 4IX3A 5CTPA 3VUGA 4GU6A 4R3CA 3NX8A 4TYHB 3FSKA 5L3AA 2ZVAA 4GYIA 4KINA 4PP7A 5BYLA 2WQEA 4ACCA 2UW4A 3AMYA 5IA0A 5M06A 1WBVA 4IC7A 5E91A 5JKGA 1A9UA 2QI8A 4GVJA 1KE8A 3D5VA 4PMTA 2FSLX 5ETIA 5I4NA 3E8EA 2VTOA 3VS4A 2JAVA 3QZHA 4J52A 2GTNA 5CT7A 4UYNA 5CT0A 2R3KA 3FJQE 5FEDA 4ZZMA 3UOLA 2UZOA 4YUQA 4UB7A 2JBOA 2ZV8A 4FKWA 4C3RA 3C51A 2O0UA 3FSFA 5EQYA 4FKGA 3MH3A 3L8SA 1J3HA 1KV1A 4MD7E 5BUEA 3F2RA 3C4ZA 1FGKA 3KF7A 4JR3A 1ZY5A 4JDKA 2C5NA 3HDNA 2YCFA 4DINA 2YCRA 2BTRA 1ZZ2A 3BHUA 4WG3A 3KREA 1U54A 3DZOA 2XNEA 4DEAA 2Y8OA 4A9SA 4FC0A 3NS9A 4Y5QA 4BCQA 3MESA 4O82A 3B2TA 3PRIA 3CQUA 3REPA 3MY0A 1M14A 3PE2A 3RWPA 2C3LA 3NIZA 4F6WA 3SX9A 2J0IA 2UVYA 4U81A 5CASA 4S34A 4PRJA 3MH2A 3FDNA 3E5AA 3OXTA 3GOPA 1H07A 3WE4A 2O5KA 2QOOA 4CYJA 4HCVA 3R1SA 2XIXA 4YZ9A 4ZTLA 4GT5A 2PVRA 3GC7A 4EBVA 3V8SA 4HGLA 1RQQA 2GHLA 1OUYA 2VN9A 4OUCA 4XYFA 2WNTA 3R8VA 4NTTA 3NPCA 5DR2A 4DEHA 4BCFA 1UNHA 3C4XA 4BCNA 3N4VA 1R0PA 1Y8GA 2X7FA 4DYMA 3B8RA 3FMLA 5T3QA 5AA9A 4O86A 2AUHA 2OKRA 5AP6A 3R7VA 5IZFA 1W0XC 1WVYA 3KCFA 3UZTA 3CD8A 4L43A 4MD8E 3TKIA 2H6DA 3KKVA 4CKIA 3IG7A 3S00A 2IZRA 2JAMA 5CSXA 3R00A 3A7GA 1X8BA 3R0TA 4DT8A 4KUJA 1V1KA 4ORKA 1XWSA 3CCNA 3FZ1A 3QA0A 5CEMA 4U43A 4D2TA 4QMTA 3NNXA 5J79A 2GNLA 4PMMA 5ITAA 3U51A 4HVHA 4ZZNA 3G15A 2ITPA 5DOSA 2C47A 2O64A 3ZDUA 4F9WA 3E93A 2XBAA 1UU8A 4LV5A 4Y46A 4I6HA 5CSVA 3R7UA 3ZO2A 4A4OA 1QPDA 4B99A 5CLPA 2WPAA 4ACGA 4ZLZA 4IDVA 4BI0A 5HVJA 5CYIA 3QZGA 3BLRA 4FKSA 1J91A 2DS1A 3EN6A 4TNDA 4O7VA 4BZOA 1YI3A 3DKFA 3KCKA 3I81A 3R73A 1ZARA 4DGNA 4EOPA 1HCLA 3PSBA 2GFSA 2PYWA 2BDFA 3ZSHA 3ZDIA 2F7EE 3FI2A 3GT8A 4PL3A 4FEQA 1IEPA 3S2PA 2XK9A 3NCGA 3D5XA 4JQ7A 4H05A 2YIQA 4DFZE 4F1TA 2I6LA 4CFWA 1XH7A 2J50A 5AR8A 3ZTXA 5CU3A 2I40A 3CJFA 4FTJA 3RCJA 2J0JA 3MW1A 4F7JA 5KHXA 4Z16A 4UWBA 4WSYA 5LJJA 2GQSA 1DAYA 3ZS5A 2QURA 3RK5A 1PMUA 1ND4A 3VULA 4DEEA 2YLFA 2GTMA 4L52A 1TQMA 5K0KA 3CQEA 4LL5A 3UG1A 3CTQA 3P7CA 4KIOA 1UU9A 3H3CA 1XO2B 1OPLA 1STCE 4I4EA 1M2RA 4OTRA 5A4LA 1BL7A 4XV3A 2XUUA 3FE3A 4A4XA 3QUEA 3MIYA 4FYNA 4BCMA 1UA2A 3U4WA 4CT1A 1QL6A 2XRUA 5EOLA 4FT7A 5DWRA 5CNOA 4H1JA 4QMNA 4DN5A 3RM6A 5F4NA 2OJGA 1WBOA 3OWPA 5AV3A 3SLSA 1Q24A 3FY2A 4E4NA 5BPYA 4RWKA 4QTCA 2HYYA 3QCQA 3O7LD 1M2QA 5AADA 2W1DA 5DLSA 5DI1A 4JL9A 4FR4A 3VBYA 3UQCA 4QMVA 4ITJA 4JI9A 4K2RA 4RT7A 3D2KA 2QC6A 5ANDA 3ROCA 3VIDA 5M09A 2OI4X 5IA4A 3HECA 3E92A 4QMOA 4X2GA 2OW3A 2JIUA 3QTZA 5JEBA 1J7LA 2W17A 1PXIA 1WAKA 2A4LA 2JBPA 2G01A 3GU8A 1M17A 3O8TA 4QO9A 3V8WA 4EZ3A 3GFWA 5LWNA 3EFJA 4Y8DA 5FWKK 4S30A 4YJVA 3BBTB 3HEGA 2Z8CA 3HUBA 3Q9XA 3DJ5A 3FXZA 4GT3A 2QO9A 1JPAA 2RKUA 4KA3A 3HMNA 5LXMA 4FSZA 2CGUA 1ZYCA 2FGIA 3OFMA 2IZSA 1PKGA 4BDBA 5M44A 3BIZA 3LXKA 3KULB 4DBNA 4M0YA 2QG5A 3LOKA 4BI1A 5CEOA 2OO8X 4GRBA 3PLSA 3K5VA 4D58A 3PSDA 4EH4A 3EB0A 2RSVA 4BRXA 3BEAA 4IM2A 3PPKA 3VF9A 3A61A 4OT5A 2X81A 4IB3A 4BBFA 4IMYA 4C4HA 4EOKA 4DC2A 1A48A 4FTNA 3MA3A 4QP7A 2VGOA 3GU6A 1K9AA 2HK5A 3AT4A 4WRSA 5HO7A 4FZDB 3DDPA 1U5RA 4RLKA 2EB3A 5L2SA 3UPZA 4G3CA 2R2PA 3GXLA 3R1NA 4Q5HA 2E9NA 3EZRA 4RIYB 4AWIA 3KVWA 3SRVA 3KL8A 2ZV7A 3QTQA 4BDFA 4AS0A 1LUFA 3HMIA 3QD2B 2WIPA 4RGJA 4X2KA 3VUHA 3MB7A 3NAXA 4G3DA 2WTIA 3KXHA 3QX4A 3GCPA 1ZYJA 4DA5A 3I7CA 5FQDC 4USFA 5AA8A 5E8SA 3SC1A 3DGKA 4XG6A 5EDPA 3BU3A 3C13A 3QQFA 4BWXA 3UIMA 2VX0A 3PSCA 4FTKA 5C8KA 4Z3VA 3OD6X 2JDSA 2PHKA 3I6WA 4G5PA 4CFVA 4O7NA 4FKOA 1JKKA 3QKMA 3ANRA 2ZM1A 4FGBA 4EC9A 4DE4A 3HRCA 3BRBA 4RPVA 5AP2A 5CEQA 2BRMA 3GENA 3O50A 5CS6A 2Y7JA 2C0OA 2EVAA 3V5JA 1U46A 3PA3A 3VJOA 3PJ2A 2WMVA 2WMQA 3R9RA 3ZXTA 4QP8A 4QPMA 5JRQA 2CLQA 4D55A 4F7SA 2VAGA 2IZTA 3KFAA 4NM7A 4G3EA 3P86A 4IWQA 2GS6A 4MXXA 4DLJA 4EHEA 5AV0A 3PLAE 2PVHA 4UMQA 5L6WL 4FG9A 3S0OA 4FKQA 3OXZA 1PRYA 5J9LA 2ITTA 4QTBA 3RINA 4P5ZA 4EK5A 3OHTA 3OWJA 4OBPA 3ZZEA 4IB5A 4MNEA 4RG0A 1PYEA 2NO3A 5A6NA 5AIRA 3QLGA 4FSWA 4YBJA 5CU6A 3IGGA 3RCDA 4KSQA 1YI4A 1XH4A 2Q83A 1OUKA 3AMBA 4CV8A 3LFEA 3MPTA 2C0TA 3WZKA 3FAAA 4FV9A 3QQLA 2W99B 4I5MA 4O2ZA 3U6HA 3TCPA 2YM4A 4MXOA 4MX9A 3RAHA 2XKDA 3EMGA 3QD3A 2FSTX 5J9ZA 1BI8A 2OIQA 2YDKA 4C35A 3TG1A 4UALA 1WCCA 1K2PA 2C5XA 4A9TA 1H4LA 3WARA 4II5A 2O3PA 2JDVA 3UC4A 2QNJA 1KE5A 4FNZA 4J96A 3QWKA 4FKJA 1YXUA 4UXQA 4E5BA 2PULA 4RJ8A 4HZSA 3LZBA 1OBGA 2QONA 4YPDA 3O0GA 2HXQA 4C2WA 3BQRA 3PVGA 3PJ3A 4OLIA 5M55A 1MRYA 2LAVA 2BRHA 4D9TA 3Q04A 4BCKA 1DI9A 2AC5A 4F6UA 1JBPE 2JDOA 5CSWA 4IVDA 3TNQB 4IM3A 3D7TB 2C0IA 4CCUA 4FZ7A 5HG9A 4BDHA 2X0GA 3HP5A 3WI6A 4L67A 2CPKE 4ASXA 4TPTA 4I0SA 3NAYA 2BTSA 4UMUA 3EHAA 5ETFA 1NVQA 3HGKA 3FKLA 3NUXA 3M2WA 2PWLA 4MF1A 3BHTA 4ITIA 4C4FA 2IG7A 3RNYA 4GW8A 3U9CA 4XHKB 2NRYA 2XF0A 4AU8A 4W9XA 2SRCA 4PDPA 3ZHPC 3Q53A 4RVKA 5FLFA 3COIA 3KF4A 2XZSA 3QRIA 5GJFA 4GK3A 5HLNA 4U3ZA 4DH3A 2PVYA 3QLFA 4DFNA 2Y4PA 3EOCA 2W1GA 4J53A 4AOTA 3PXKA 1NVSA 3R7IA 3UYSA 2P3GX 4ZSLA 3WZEA 3V51A 3SG9A 4DH5A 4NUSA 3AGMA 1H8FA 4TT7A 1JLUE 4X6RA 1W7HA 3RK9A 5L4QA 3BYMA 3QAME 4RQKA 2FYSA 4QMSA 5IQGA 2A27A 4YZBA 5HLPA 5J95A 2BFYA 5FM3A 3R1QA 1B6CB 2OK1A 4FT5A 4KB8A 2W96B 4H3BA 2WTJA 2W0JA 3QQUA 4O0TA 4FVRA 3A7HA 5L6OA 5EQEA 4Y95A 3QQJA 4CMOA 2P0CA 4Q9ZA 3MY1A 4BCOA 5M57A 3LFQA 2CJMA 4G6OA 4RWJA 4ZJVA 5H3QA 5HOAA 4DFXE 4QPSA 2JDTA 4JVGA 5C03A 4RWLA 2Y4IB 3PY3A 5HCXA 4CZTA 5KMJA 3ZU7A 2FB8A 4AW0A 4BCPA 4AFEA 4CMUA 3KMMA 3R22A 4I22A 3S3IA 4QP1A 3PJ8A 3R28A 4YGAA 5HE1A 1E1XA 5J87A 2PE0A 3CXWA 2R0UA 4C8BA 1UNGA 2LGCA 3DKCA 5LCKA 3GC9A 3LXLA 1UKIA 4L6QA 4F0FA 5CU0A 1OPJA 2BIYA 5HCYA 3P0MA 4GVAA 4FTOA 2WMSA 3EL8A 4BR3A 4FKIA 4TWOA 4I5PA 4UN0C 4D5HA 4RIXB 4YNOA 4O7RA 4E73A 3KXXA 4FG7A 3KB7A 5DR6A 3CE3A 4DH8A 4CFMA 3QTRA 3RWQA 3FXWA 4L44A 4N57A 3MPMA 3OF0A 4B7TA 3GU4A 4KKHA 2B4SB 4MBLA 2JGZA 4CLIA 1ZLTA 1Y6BA 3O51A 5I9VA 2CKPA 2CKEA 4YJQA 4XV2A 2OBJA 5EW9A 5AUUA 2G2HA 5CSHA 4FL1A 3LMIA 4FGRA 2BKKA 5CEIA 4BCHA 3D14A 5HIDA 3I5NA 5JGDA 4CTCA 2ZMDA 2JITA 4ZOGA 5AWMA 5AUXA 3FZSA 4BDJA 5EW8A 1B38A 2PZRA 3IECA 1F5QA 4TWNA 1VYWA 4N6ZA 5CXHA 3EN7A 3LE6A 5D7AA 3D9VA 3G5DA 3UPXA 2O63A 3V04A 4BKZA 4FI1A 3EFKA 3OBGA 3PVWA 1YW2A 3SXSA 4L9IA 4HVIA 2B55A 3Q3BA 3UZPA 4F1OA 4KS8A 3G0FA 1GNGA 4FOCA 3AC4A 3L8PA 5CAOA 2YM6A 3RGFA 1W82A 2V62A 4AGDA 5B7VA 5AP7A 3R30A 4GK2A 5HZNA 3SG8A 4NKAA 3TI1A 5KX8A 2X8EA 3JYAA 3CPBA 2VTLA 4ZXTA 2A2AA 1Q99A 5IQBA 5CAVA 2DWBA 3CIKA 3QC9A 3V5TA 2OXDA 5LVPA 2RFDA 4B6LA 4FSYA 4G16A 4APCA 1XBAA 4CRLA 4U41A 2CLXA 5HG8A 1ZY4A 3EN9A 3MFRA 1IASA 3OW3A 2WQBA 5EI8A 4U40A 3EN5A 3W2RA 3MBLA 2PSQA 5DEYA 3TZMA 4V0GA 3UODA 4EHGA 2Z02A 5EYKA 4Z7GA 4G3FA 2WFYA 4DFYA 3NYNA 5IA5A 2PVNA 3FMKA 3ATTA 1A06A 3O7LB 1ZZLA 2IW6A 3FMHA 3Q6WA 4F9AA 2OZOA 3ZSGA 2BILB 4CCBA 5AR3A 3NDMA 2B53A 2J0KA 5GIPE 4YNEA 5TKDA 3R83A 1OMWA 2WIHA 4KBCA 2B54A 4HOKA 4AUAA 3OT3A 4EJNA 2V5QA 3NVMB 5AR7A 4FEVA 3KGAA 4E6AA 3TZ7A 4EJ7A 1YHVA 5J5SA 3I60A 4CKJA 4HCTA 4F1MA 1YXXA 3MVHA 2R3JA 4LOOA 4QTEA 3N51A 5ACBC 2C5YA 1OITA 2F4JA 5CF5A 5KO1A 3QHWA 1SZMA 3TJCA 1G8SA 4JX3A 4DGMA 4BHZA 5IMEA 2B9FA 2ZV9A 4CLJA 4O0XA 5L8JA 4YSJA 4FBXA 4MBIA 4DGGA 4IFGA 3RPYA 5JN2A 4K18A 4QYEA 3I0QA 3II5A 2Z7QA 1H0WA 2C3KA 3KVXA 4XUFA 3VBQA 5ICPA 4CQGA 4YTCA 3BYVA 3CKXA 4P4CA 4W8EA 3A4PA 3V3VA 2QOCA 3QF9A 4PQNA 3GC8A 3EIDA 1H00A 3COMA 4ZSAA 3BLHA 3LCKA 4WG4A 4DGOA 1SVEA 5HNBA 2H34A 1JSVA 3OW4A 3PJ1A 4I1ZA 5KHWA 2OJIA 3GCSA 5F1ZA 3VS2A 4FTUA 5HEZA 2BRNA 4WUAA 5EYDA 4ZTMA 3R71A 5L8KA 3U4UA 2PMOX 3ZOSA 4HVSA 3MH1A 5B2KA 4UMPA 1YKRA 4UWYA 3W2OA 1KE7A 3UO4A 1YHSA 2WTKB 3FMMA 4X2FA 3VS3A 2DYLA 4G9CA 3M42A 4BDDA 4CZYB 5FDPA 5IG1A 5ANJA 4J99A 4GEOA 5E1SA 3TNIA 1RE8A 3EQDA 4C2VA 1CKJA 5M4CA 4EBWA 2BRGA 3DBEA 1JSTA 5HBHA 3CLYA 2QHNA 3IGOA 5HX8A 4APPA 2PMLX 3B2WA 4AXAA 5CALA 4XX9A 5EDQA 5EHOA 4AT5A 1J7IA 2IZUA 4PL5A 4D4SA 5CZHA 4PL4A 3AD4A 3O71A 2PUPA 4E7WA 4Q2AA 4A4LA 3BZ3A 4PTEA 2YABA 2WD1A 4NWMA 2C5OA 5B2MA 3ORIA 3U6IA 5AEPA 1OIUA 1MRUA 4J8MA 4DF3A 4Q5EA 4U45A 1QMZA 3NUNA 3DAEA 4JIAA 3W10A 3UO6A 2GU8A 4O1PA 2YEXA 5LCJA 4JX7A 3I5ZA 2OSCA 3L9PA 4M68A 4ERKA 4HJOA 4XP3A 1UU3A 5CAPA 4WO5A 5CI7A 3LLTA 3I7BA 3F7ZA 4FV2A 3R02A 3PYYA 4NIFA 3LJ0A 3DTWA 3LFSA 4DLIA 4S2ZA 4E8AA 3MIAA 5JFWA 3HKOA 4J1RA 4AX8A 2F2CB 4BIEA 5HTCA 1E9HA 4A9RA 4CTBA 4D4YA 1IAHA 1CMKE 2GFCA 3M11A 4I6FA 4X3FC 4ZTQA 1XH9A 5H8GA 5KCVA 3TDWA 2ACXA 2JKOA 3AC2A 2HZ0A 3GFEA 3FQSA 2GNIA 2JIVA 4ARKA 1FMOE 3RPOA 4EC8A 3R7EA 2R9SA 1W84A 2UZTA 1Z57A 3IONA 3LCOA 4R5SA 4UV0A 3VUIA 4K9YA 5C1QB 4GIHA 4CXAA 4GFOA 5HTIA 3NRMA 2GNJA 3MI9A 3F2NA 5GHVA 4GKIA 5IQDA 3COKA 5DHJA 4F9YA 2YIYA 4BTFA 5TT7A 4TY1A 1ERKA 3BU6A 5A4TA 4HVDA 2Q0BA 5F20A 4ANNA 1QPJA 4HCUA 4YLLA 1I44A 5A14A 2CGVA 3HYHA 3FKNA 5DFPA 3FWQA 2I0VA 2R64A 3FYKX 3KRWA 4O0YA 4UMTA 4JLCA 4C4IA 5K5XA 1OL5A 4UZDA 4R6VA 5CSPA 4IJ9A 2R3RA 1G3NA 4IACA 4RRVA 3NNUA 4P2KA 4BIDA 4ZLYA 3CBLA 5D12A 4CQEA 4C3PA 3QRUA 2UW5A 3ZM4A 3BBWA 4PV0A 3VS7A 2G15A 3FZPA 3NLBA 4BDCA 5CQWA 4FV8A 3GQIA 2XEZA 5HIBA 4XG8A 4JIKA 5E90A 4NM0A 2ERKA 4DBXA 2XRWA 3OP5A 2UW9A 3FMDA 5BMMA 4TTHB 3W1FA 2UZLA 4FZ6A 4M84A 2IW8A 4AAAA 4ONAA 4E6CA 5GZ9A 4TYIA 4RC2A 4YJUA 1BX6A 3QUPA 3WILA 4C59A 3R8MA 2VWUA 4UYAA 2XNGA 3H10A 2PZ5A 1YOLA 2A1AB 4QP6A 5H2UA 3A99A 3TACA 3DCVA 3TJDA 4F0IA 5AV4A 2B9IA 4RVMA 4RBLA 4CV9A 4LMNA 4JQ8A 4AN3A 4UX9A 4RIWB 2HY81 4XG7A 4XLVA 3THBA 3AD5A 3BV2A 3ZEPA 4C36A 4QYHA 2BZIB 1NA7A 2FVDA 3ZLYA 1L3RE 1UU7A 4IIRA 4O7ZA 3KULA 4TWCA 4BHNA 1R1WA 2W1FA 4HYHA 4CZUA 3KMWA 3ID6C 4OW8A 2R3PA 1IR3A 2CN5A 4WHZA 4TKSA 3E88A 4J8NA 4I94A 5AM6A 1G5SA 4GU9A 1BUHA 4YJNA 1O6KA 3E3BX 3Q2JA 2F7ZE 1F3MC 4JBQA 4KNBA 3UGCA 3ROYA 5IUHA 2WMRA 4BDAA 3DLSA 5F9EA 4DTBA 2XK3A 3D83A 1FOTA 4MYGA 1FBNA 5CF6A 4C58A 2HCKA 3O2MA 4AW2A 2YDIA 5IQFA 2X2MA 2UZWE 4RIYA 3WIGA 2F2UA 3RNIA 2C6IA 3PY0A 1MP8A 5CX9A 1BKXA 5JFXA 4YJRA 4IVBA 5HG7A 4NZWB 4R1YA 5HI2A 4I0TA 4C37A 3DNDA 3ZRLA 3ZBXA 3MYGA 4D4RA 3QZFA 3FMNA 4U42A 2WOUA 3TIZA 4FVPA 4MXZA 4QNAA 4AZVA 4ENYA 2KULA 1H01A 2C6DA 3MSSA 3OCTA 4FTMA 5AR5A 4BZDA 3TNPC 4L7FA 1S9JA 2C6KA 2J5EA 4G9RA 5E8YA 4O0UA 1VEBA 3OS3A 3QFVA 3WIKA 3LPBA 4QMLA 3W2SA 2CNQA 1GZNA 4KIKB 3ORLA 4FYOA 4NJDA 3W32A 3UIXA 4DTKA 5EHYA 1U5QA 3QD0A 4IX6A 1XH6A 3HP2A 2XNMA 4GG7A 3RZFA 3G0EA 3BI6A 3UP2A 4B8MA 4CFNA 4FX3A 3MDYA 3C7QA 3FLQA 3OY3A 3GI3A 4GUEA 4RFYA 4E4LA 5TO8A 2I7QA 3RJCA 4EH7A 4U44A 3PWDA 5CAQA 3ZEWA 1FVVA 1Q3DA 4AGCA 4MF0A 1Q8WA 2PUUA 4YZDA 4OR5A 5HKMA 1OIYA 3Q4UA 4EYJA 2XK7A 1GIIA 4IQ6A 4AQCA 5CNNA 3EH9A 2GDOA 4CRSA 3W8QA 4JR7A 4DEGA 2J7TA 4FIFA 4MK0A 4AN9A 1J1CA 2RIOA 5DRBA 3MPAA 2B1PA 5FP6A 3RPVA 3QKKA 4ZY6A 4TRLA 4QP9A 1XBCA 3OT8A 2WTVA 3H9FA 3P08A 3T3VA 4F9CA 5AV2A 4MBJA 4W4VA 3TNHA 5EK7A 3MV5A 4B0GA 3Q2MA 4LFIA 1R3CA 4XRJA 5FEEA 5EKOA 3F3TA 3TNWA 2QLUA 4QMXA 3WF9A 3EQCA 2Y6OA 2W1CA 2RFSA 5AUWA 2B9HA 4BKYA 4DH1A 1R39A 2OICA 2XYUA 3R2YA 3SW4A 3F7WA 5FG8A 3D15A 3RK7A 2V7AA 3EKNA 4FUYA 5BVOA 4FV4A 4OBQA 1BI7A 3OUKA 3QGWA 4BTMA 1FMKA 3A4OX 3D94A 1J1BA 4D9UA 5IH4A 1ZRZA 1PYXA 3SOCA 3UG2A 4M97A 2WQNA 3BYSA 4HPTE 4EK8A 3D2IA 3O96A 3R04A 4G2FA 2FSMX 2WQOA 4H3PA 2VD5A 4GJ3A 2ZOQA 2R3NA 3NSZA 3P7BA 5A4QA 5KZIA 3FYJX 3SDJA 2W1ZA 1DM2A 1DAWA 4DEBA 3IDBA 4GCJA 4YTFA 4PPCA 3SW7A 2YACA 3E3PA 5IQAA 4FOBA 2OIDA 1DS5A 2XCKA 4DFBA 5HU3A 3R9OA 5JQ5A 2XIZA 4AOJA 2QR7A 3TWJA 5D10A 3PZHA 1OBDA 5IQEA 1GZ8A 5EI2A 3QQGA 1SVHA 3QU0A 3NGAA 4YP8A 3ULIA 1H08A 4ALVA 5KMLA 4O81A 3CPCA 3EZVA 2OZAA 3QTIA 3EFLA 4MQ2A 4TYEA 3T9IA 3ZSIA 3CS9A 5DGZA 3JY0A 3DS6A 4O7YA 1TKIA 3U55A 3FC2A 3K2LA 4O0RA 5DBXA 3A62A 3ENHA 4G3GA 3A8XA 1U54B 3DFAA 3PE1A 4QYFA 4EZ5A 3SGCA 1ZOHA 2ETRA 1LEZA 2YISA 4XV9A 4Y85A 1AGWA 5A4EA 4RJ7A 4LGDA 2VNYA 3ORXA 3R9HA 4QRCA 4LOPA 4ZTHA 4AT4A 4DFUA 5AM7A 3ZZWA 2VTPA 5FTGA 4QOXA 2F57A 2HXLA 2QU5A 4EH2A 2YA9A 4MXYA 2JDRA 4ZTNA 3OWKA 2BROA 2XVDA 4FT0A 4DITA 4BL1A 4G34A 3LFAA 4JDIA 1YI6A 4W4XA 2HENA 5GZ8A 2H8HA 5KKRB 3C5IA 3KK9A 4M69A 2IWIA 3GVUA 4GIIA 5KMKA 3BHYA 3W8LA 4BWPA 5EKNA 4YZNA 4M66A 4PF4A 5D1JA 1FGIA 3DU8A 4FEWA 4TXCA 5ANIA 4DG0E 4O0SA 3CKWA 3G90X 3LKMA 3VS0A 2IVUA 4ZJJA 1CSNA 2HELA 3GU5A 3QD4A 5AUVA 2XM9A 2WMXA 3BLQA 3W2PA 5HE0A 3GC0A 3OMVA 4L53A 1NVRA 2UZDA 3ENMA 3TL8A 4QYGA 1Q8YA 1WVWA 1W8CA 3MFUA 4YJTA 3GCQA 1YDRE 3HDMA 3VHKA 3VUTA 4CFFA 2YCQA 4NFMA 3KEXA 3P7AA 3LFNA 2J0MB 4TWPA 3DBFA 2CGXA 4FSTA 4ACHA 5JMSA 4GK4A 2IN6A 5DMZA 2VWXA 5D11A 3HV4A 4YHTA 3LQ8A 1H1QA 3WZDA 2R3IA 3VBXA 3ACKA 5IDNA 3QCYA 2X2LA 4QMUA 3BYUA 4XV1A 2QOFA 2GSFA 4NCTC 3VS1A 3QQKA 2WB8A 4CT2A 5HNIX 1XH8A 5HX6A 2HWOA 5AR4A 4G6LA 2QO2A 1SNUA 3KXZA 4UBAA 5BVEA 3RVGA 4E4MA 2XH5A 5C4LA 1PW2A 1U59A 3D0EA 3QTWA 4LGGA 3SOAA 2X4ZA 3WBLA 3VC4A 1SVGA 4R7HA 5CU4A 3OROA 3EWHA 2WHBA 5F95A 4DCEA 5IQCA 4P7EA 3KRXA 3AC3A 5IEXA 3KRLA 1OM1A 4RC3A 4S31A 4HYUA 2XM8A 5EYMA 4GYGA 2R0IA 3MTLA 4IX4A 1PMNA 2PUNA 3PDTA 2ITNA 2OJ9A 4O84A 5GNKA 3VRYA 3Q96A 4M12A 1VR2A 4BI2A 4D2PA 3LFBA 1IRKA 4EOSA 3DJ7A 4ZJIA 4RLLA 4FV0A 3W55A 2V0DA 4I4FA 3KN6A 1ZWSA 2O65A 3E87A 4IWOA 5LMKC 4IAYA 3TZ8A 4N0SA 3ORNA 2VTQA 5KZ0A 1Q41A 4PPAA 1P4OA 2NPQA 5F94A 5HO8A 4XH6A 4PDYA 2P4IA 4KWPA 5I0BA 5FEQA 3Q4TA 4X6QC 2RFEA 3LQ3A 4GV1A 2J6MA 3F66A 4CG8A 1Y91A 4TYGA 2UW6A 1WBTA 4U9AA 3HVCA 2QOLA 3DTCA 3NUUA 5CEKA 3V5PA 2Y6MA 4BVUA 5LVNA 3GEQA 1IAJA 2G2FA 5AP3A 2EUFB 3PXFA 4L3LA 3MVJA 2VWZA 3A8WA 3CP9A 3E63A 3RALA 5AUZA 3E7OA 3W18A 5EDRA 3SXFA 4FIGA 1ZXEA 3NUPA 4ANOA 2JKMA 4FTQA 2VO3A 3MWUA 4EL9A 1WZYA 4EH3A 5FGKA 5KBQA 4M7IA 1ZYDA 4KRCA 3EQBA 4C61A 3G33A 4LRMA 4DG3E 1PKDA 1MQBA 2FA2A 4EWHA 5BVNA 3ORTA 2VTRA 1BYGA 3AD6A 3QBNA 3HAMA 3QYWA 5K4IA 2XS0A 2OH4A 3DKGA 2OJJA 3DLZA 4NSTA 3UMXA 3HRFA 1O6YA 4IZ7A 2XKFA 4F64A 1SNXA 4BFMA 2VWWA 3QHRA 2C1BA 3VWAA 4MNFA 2OGVA 2ITOA 3AC5A 5KBRA 2XBJA 1IA9A 1M52A 2R3FA 2C4GA 1XJDA 3WZJA 3LJ2A 3IS5A 4FSUA 4N6YA 5C9CA 2KTYA 2REIA 1OKYA 2Q0NA 5AP5A 4XP2A 4AW1A 3EQRA 4RZVA 1M2PA 2X9EA 4QMPA 4TYJA 3SRVB 3N9XA 1BLXA 3E62A 2GMXA 3CR0A 2BUJA 3FPMA 3OOGA 3V6SA 2VTMA 4K0YA 2QQ7A 4ZTSA 2C5VA 2XA4A 3NNWA 4CYIA 2YWVA 3DBCA 4JRVA 1T46A 5AJQA 1R0EA 2G1TA 3IDCA 4D0XA 2PTKA 5JH6A 3W2QA 2PVFA 1JWHA 3OWLA 4FIEA 4IAAA 3BQCA 4Z9LA 4JG7A 5FXSA 5IMXA 5KMNA 3GGFA 3TV6A 4G31A 2CMWA 5M56A 4HZRA 3H0ZA 2XNOA 3F3ZA 5D41A 5DE2A 3T3UA 4CMTA 4EQMA 3LAUA 4R78A 4X3FA 3DK6A 3F3VA 3FMEA 4RIOA 3ERKA 5C01A 2WMUA 4AP7A 4D1XA 4QP4A 4E6DA 5IH6A 3ODZX 5HBEA 5KMOA 2QODA 4L8MA 4FEUA 3DB6A 3BU5A 1QPCA 4M67A 3HA6A 2JEDA 5BVKA 3NYOA 5DEWA 1UWJA 4GFGA 1XHAA 2JLDA 1OL6A 2C30A 2ZJWA 4NL0A 2X8IA 1H0VA 3COHA 5EM5A 2DUVA 4FODA 4IANA 4XRLA 3CD3A 5J8IA 3H0YA 2ZB1A 2FUMA 1M7QA 1TVOA 2BHHA 3M1SA 3DB8A 3HZTA 4L3JA 5EFQA 1PHKA 5TE0A 3VQUA 3Q60A 2GPHA 2W5AA 3QCSA 3ZUUA 4F09A 3U6JA 3C0HA 1H24A 4RA4A 1S9IA 4KS7A 1JKTA 4DTAA 2YM7A 5JFSA 4WBBB 2CKQA 3JS2A 2QD9A 3Q32A 3ZBFA 4CFXA 4MNEB 2EWAA 3DAJA 5FUTA 1JOWB 5KMMA 1Q4LA 2C3IB 5HO6A 2ZYBA 4GJ2A 4CEGA 1UVRA 2QOKA 2BZJA 2R3LA 1JAMA 3QA8A 4HW7A 4ZMFA 1U4DA 4LQMA 3PRFA 4EKLA 3PG3A 4H3QA 3FZRA 3LM5A 4YLKA 3FXXA 4EH6A 5E8ZA 4YHJA 2ONLA 4RJ3A 4X7QA 4KIQA 5JFVA 4E5AX 5LMBA 2WO6A 2E2BA 4Y83A 3TXOA 4FKTA 5GJDA 2IVVA 2ITUA 4KIPA 4LV8A 2O8YA 2X7GA 3IPHA 3QUDA 3MVLA 4DGLC 2OG8A 3BE9A 3DK3A 4QYYA 3Q4ZA 2Y4IC 5E8VA 3VBVA 4S33A 4NH1A 4W4YA 2BAQA 3F5GA 4FSRA 1APME 4MD9E 5DT3A 3VW6A 3CSVA 2UW3A 4IDTA 4GUBA 3FC1X 1T45A 5EM6A 4A7CA 3DBQA 3AC8A 5CXZA 3ETAA 4YZMA 4EH5A 3KRRA 2QOQA 3FLWA 3MJ2A 5HORA 3MN3A 3FLSA 4OGRA 4EHZA 3F61A 4WUNA 3OTVA 3SAYA 3N4UA 3GNIB 4NEUA 3AC1A 3BKBA 3EQGA 2X6DA 2ITWA 3L8VA 3PXRA 4XG4A 4A9YA 3BWJA 3UVQA 3UNKA 2R4BA 5T6KA 3GU7A 2X1NA 3QCXA 4IZ5A 4LUDA 4QMQA 2J2IB 3FL4A 5I9XA 3BHVA 3WE8A 3WOWA 3OZ6A 2CKOA 1EH4A 2XK4A 2VUWA 4EOIA 3JVRA 3QWJA 4IAFA 3SXRA 3VF8A 2BHEA 3IO7A 4IM0A 1LPUA 3FI3A 4IBMA 4MQ1A 4TYHA 2IPXA 2JD5A 3JR1A 3H4JA 3QZIA 4BBEA 2F49A 5FDXA 1CKPA 4FZAB 4JDHA 4TW9A 2WTDA 3RMFA 4EWQA 4QP2A 4ZZOA 5FBNC 3EYGA 3F5XA 4ANQA 4RX8A 4F65A 3ZC5A 1GY3A 4OTQA 3A7JA 3Q5ZA 2UZVA 3TV7A 2BAKA 3P9JA 3VJNA 4MKCA 5DG5A 3V8TA 2XIKA 5E8UA 3SHEA 2QG7A 5ANKA 3TV4A 3Q9YA 4YMJA 4FT3A 2OJFE 4BC6A 3DK7A 4UWCA 3AMAA 5IA2A 2PY3A 4J97A 5HVYA 1B39A 4EOLA 4YC8A 3TZ9A 3UDBA 3OUNB 2VTSA 4FSNA 5C8MA 5J9YA 2RGPA 3R6XA 2J0LA 3FLNC 3CTHA 4TZRA 1ZMVA 2R3MA 3PZEA 4AG8A 3DJ6A 4K11A 3QTXA 1KOBA 3QRKA 2ZMCA 4D2VA 4H1MA 5EYCA 1VJYA 3TKHA 4QTDA 4IVAA 2PVJA 3LJ1A 3MB6A 3BPRA 1PXPA 3Q4CA 1UNLA 2W4JA 4P5QA 4RWIA 4ACMA 5L2WA 4DCAA 4ZS4A 1KUTA 4FL2A 3ODYX 4U79A 5CF4A 2WMTA 3LCSA 3ZRKA 2OIBA 2V7OA 5GJGA 3UIUA 3V5LA 4EH9A 4YC3A 5K5NA 4EK4A 3LFCA 4OAUC 1CKIA 2WTCA 3R9DA 3S95A 3MVMA 4BF2A 1H1PA 2XIYA 4BICA 3F5UA 3PVUA 2XJ2A 2ITYA 4XG3A 4EEVA 2H9VA 1PJKA 2P55A 3FMJA 3N4TA 1PMEA 2X9FA 1WFCA 5FM2A 1GJOA 4XG2A 3VS6A 4IAIA 3RHKA 4W8DA 3ZO1A 4X2NA 1SM2A 2BR1A 3NW6A 4IZAA 3AQVA 3LQ5A 4KBKA 2B7AA 5HLWA 5IA3A 3EQIA 4ASDA 4C3FA 4BGGA 4RA5A 3IK3A 4MVFA 4FNXA 4IAKA 4JG8A 1PXNA 3LW0A 5BX0A 4WD5A 4OTWA 1DI8A 2QOIA 3NVKI 2OWBA 2GCDA 2WQMA 3RPSA 2YM3A 3QQHA 4RVTA 4D4VA 5IUIA 3VAPA 3C4EA 5LVOA 4BGHA 4AE6A 2YDJA 2VWBA 4CGAA 5I3OA 5JK3A 4MAOA 4EUUA 4FG8A 3G51A 5E8TA 4C34A 5C4KA 4EOMA 5I5ZA 3P78A 4NK9A 5H8BA 3ZMMA 3E8NA 2C1AA 3PIYA 3HL7A 2VX3A 2PVLA 2VTNA 3C0IA 4L01A 5J1WA 2W7XA 5AX3A 4MWIA 3ZUTA 1RW8A 3C4FA 4U97A 4D0WA 5L6PA 2CDZA 3GUBA 3OY1A 3QC4A 4QTAA 3PXZA 1BMKA 2WTKC 4LRJA 3DZQA 5AIKA 2J90A 5HU9A 1M7NA 3OCGA 1GIJA 2BVAA 4YJOA 5BYYA 3ORKA 4EHVA 5LOHA 4QQJA 2P2IA 2YIRA 3ALNA 5IKWA 2PPQA 4EK6A 3IW8A 4XEYA 3KQ7A 4O38A 5E8XA 3JY9A 4ANBA 4E4XA 4RJ6A 4FUXA 5A4CA 2EXCX 3D4QA 2J4ZA 4QMWA 4AZFA 3HAVA 2H96A 2YAAA 4L42A 5AV1A 5HESA 2J51A 2PZYA 2PMNX 2R7IA 4AZTA 1OGUA 2XYNA 5HNGA 2C6OA 2WMBA 4I24A 4RX5A 2WAJA 3R21A 4QP3A 2VO7A 2IVTA 3R1YA 4UMRA 2V22A 4QPAA 5LQFA 2C3JA 2BRBA 3QKLA 4FKUA 1KWPA 2JKKA 2VX1A 4BDIA 2YIXA 2HIWA 4KKEA 2B0QA 2W1HA 3EKKA 4AA5A 4KSPA 3DOGA 4IH8A 4BTKA 5DPVA 4ANLA 5A54A 4V0GB 2UVXA 4R7IA 5JGBA 2EB2A 3OVVA 4AACA 3WF6A 2ONLC 2NRUA 2OFUA 2VTAA 1YXVA 1GZOA 3C50A 4JXFA 2GHMA 2OF2A 4P90A 5T68A 1G8AA 2O2UA 3ZFXA 1Q3WA 2BDJA 4FKLA 4LG4A 3OOMA 5KE0A 3SKCA 3CGOA 4X3JA 2I0YA 4OTDA 2IO6A 5E9EA 2Z7SA 2BZKB 3PG1A 5E8WA 4EORA 4RQVA 3RZBA 5I9WA 3WF7A 4XBRA 4CKRA 5IQHA 4EOOA 3RM7A 5M4FA 4R1VA 1O9UA 5L8LA 2PZIA 2XB7A 4ZEGA 5LMAA 4PY1A 3RP9A 3WYYA 3PP0A 3OCBA 3NUYA 4AGUA 4YTHA 4FEXA 5TF9A 4USEA 5L2TA 5HCZA 3E64A 3FZTA 4ZK5A 2Y9QA 3CY3A 4O96A 3LCTA 4WKQA 2QKWB 4O7LA 2VWYA 2BMCA 3P1AA 3MFTA 1KOAA 4I23A 4NCTA 4E1ZA 4C38A 1YDTE 3L9LA
chains in the Genus database with same CATH superfamily
2YJRA 3CY2A 3I79A 4K8AA 2I0HA 3R7OA 5CZIA 3VW8A 4MEDA 4KRDA 4RZWA 5CWZA 3F69A 3E8DA 3ZC6A 2UZUE 3L9NA 2CSNA 4FTRA 2OXXA 3UDZA 4K77A 2BPMA 2VNWA 4ZY5A 4IXPA 3ORZA 3OXIA 2WEIA 2HY0A 4YO4A 1YOJA 4X21A 2OU7A 4ZIMA 3NUAA 3ZRMA 3LIJA 3PPJA 1ZOEA 1OECA 4IVCA 3AOXA 3UJGA 3O8UA 3UIBA 3UOKA 4GSBA 1JKLA 5L2QA 3LVPA 4YHFA 4WT6A 1Y6AA 3UOHA 1SMHA 5EM8A 3L9MA 4EQUA 4Z7HA 1FINA 1H1SA 2QLQA 5ANGA 4FMQA 1ZAOA 4ASEA 4J7BA 4AF3A 1WBSA 4D2WA 4JDJA 4EI4A 3GCUA 3B8QA 5AAFA 3OG7A 4R7BA 3TUBA 3PXYA 3C5UA 4C33A 5CANA 3RKBA 2J5FA 5M51A 4JQEA 3QTUA 5LMKA 2AQXA 1YWRA 2ETKA 3KA0A 4U8ZA 2OXYA 1Y57A 1WBWA 4XP0A 2VTHA 4KKGA 1WBNA 4UZHA 3O23A 4H36A 3HMMA 4BCJA 5BYZA 3P5KA 3BL9A 5K4JA 2RL5A 4NIFB 5JQ8A 4EK3A 4U80A 3T8OA 2VRXA 4L7SA 4QNYA 4ASZA 1ZYLA 5KNJA 5DR9A 4L68A 4I5CA 3P23A 1QPEA 3W33A 4D28A 3I6UA 4FA2A 5HE3A 2QCSA 5FTQA 4L00A 2GS2A 4BB4A 5CQUA 2QKRA 2C6MA 4GS6A 5DN3A 2GNFA 4NYEA 3TM0A 4WBOA 4F6SA 2GQGA 4UEUA 2VWVA 3ALOA 3IOPA 3PJCA 3QTSA 4F70A 5DVRA 5HIEA 2ETMA 2XCHA 5BVDA 4X2JA 4LMUA 4E5WA 4JNWA 5DT0A 3I0OA 2BAJA 4EOJA 3LFDA 1G8JA 3CTJA 3V6RA 1OVEA 3G9LX 1Q62A 4HNFA 3VHEA 4AFJA 4GL9A 4ALWA 1Q61A 2UZNA 4WA9A 3O17A 4OTGA 4C7TA 1YVJA 5CY3A 2YZLA 2QOHA 2ZAZA 4GKHA 4QMYA 5K0XA 4FIIA 2W9ZB 4J71A 1YXSA 5DRDA 1ZOGA 4GMYA 4IHPA 4USDA 3NFGB 3KXGA 3JXWA 5CENA 5IEYA 3A7IA 2XP2A 3DKOA 4BGQA 2R3HA 5G6VA 4EH8A 3A2CA 4FV1A 4XG9A 3L8XA 4NM5A 2ZDUA 3H9RA 4M3QA 4E20A 4CSVA 4G6NA 2WELA 4JS8A 2UUEA 4HGSA 4BZNA 3PWYA 3H30A 3KIOC 2W5BA 3JUHA 3PFQA 5AFVA 3C4CA 3RPRA 4IB1A 4Z55A 4FT9A 4HYIA 1OIQA 1XH5A 4D2SA 5CEPA 2UZEA 4F63A 2FSOX 4L3PA 3AT3A 2VTIA 1OL7A 4IB0A 4K33A 3D7TA 4IWPA 3ML1A 4R77A 4ITHA 3K3JA 4NU1A 2XNNA 1YRPA 1P14A 1WBPA 3FZOA 4NJ3A 4L46A 4L45A 5BUIA 4PWNA 5BNJA 3ET7A 3BELA 2UW7A 4N4SA 2XJ1A 3T9TA 1FQ1B 3DXNA 3POZA 4YO6A 3BHHA 3HV6A 1URCA 4XLIA 3IDPA 4FSMA 4FZFB 3AXWA 4FIHA 5J1VA 4BJJA 3PXQA 2IVSA 2YWPA 4U3YA 3VVHA 3W0OA 3U8WA 5M08A 3FY0A 3POOA 2W1EA 4ZY4A 3FBVA 2Z7LA 4YURA 2YN8A 3DV3A 2QOBA 3FUPA 4TL0A 3BGZA 5DIAA 5HE2A 4N70A 4BIBA 4YBKA 2HWPA 4FTIA 4PNIA 2XIRA 2ITZA 2PVMA 2VGPA 5EQPA 4YR8A 5DH3A 2ZM3A 4O22A 4AT3A 1K3AA 4M14A 4QMMA 3DDQA 5IPJA 5E4HA 1LR4A 2ZV2A 3NYVA 4BCIA 1ZMWA 5I9ZA 2Y0AA 3JVSA 2BIKB 1H27A 2CN8A 2PK9A 4ERWA 5HG5A 3DXQA 3VBWA 2CNUA 4PNKA 4EQCA 3UQGA 3AGLA 4PTGA 3EL7A 3ZH8A 4ZTRA 1GIHA 2UVZA 3HMOA 4S32A 4GT4A 3F6XA 3F3UA 5EG3A 3VUMA 5B2LA 2WU6A 2GS7A 3NWWA 1PF8A 4OBOA 4EOQA 4JAJA 2GHGA 4RX9A 4QT1A 4HGTA 2C69A 5A9UA 5GZAA 2ZM4A 3CC6A 3CGFA 4JRNA 1P2AA 5C8NA 4ZS0A 3BGQA 4F7LA 1HCKA 3DXPA 1MRVA 2W4KA 3MS9A 3TEIA 4BTJA 4M8TA 3SA0A 3D5WA 3NYXA 2YM8A 2YJSA 3KXMA 4GFMA 5HBJA 1XQZA 2RG6A 4O6EA 4R3RA 3NUSA 2VU3A 2X6EA 4YC6A 3KXNA 3WYXA 3RTPA 1H1RA 1ZYSA 2C68A 1XR1A 3IOKA 2R3OA 5FRIA 5GIOE 3LXNA 2GNGA 4FSQA 4AN2A 4B4LA 4O0WA 4EONA 3WF8A 2W06A 3NW5A 2BDWA 2ERZE 4FTAA 4WOVA 3E7VA 5CI6A 3ITZA 3SQQA 3KN5A 3ZFMA 3R9NA 1YOMA 4RIXA 2XANA 1E1VA 1VZOA 5AUTA 3BWFA 3G9NA 5CVHA 3U87A 5EM7A 4LI5A 5CVFA 4E6QA 4K1BA 3VRZA 2GNHA 4FL3A 4XNEA 5HVKA 4QQTA 4BDKA 3NZ0A 3OCSA 4FV3A 3ZLWA 3QL8A 5KKRC 1J7UA 3OBJA 3O5AA 4R5YA 3UYTA 4ENXA 3KY2A 5M4UA 2X4FA 3PVBA 4YJSA 3AG9A 3OTUA 4D1ZA 4PMSA 3R8UA 4OTFA 4Y72A 1Y8YA 3HUCA 4I20A 5BVFA 2YLEA 1AQ1A 5D7VA 3EN4A 3IW6A 1IA8A 3P79A 5EI6A 2WOTA 3UVPA 5BUJA 3RAWA 3BCEA 3MJ1A 1XBBA 2XK8A 2XJ0A 1F0QA 3MY5A 2P33A 4C62A 1MQ4A 4MH7A 3R63A 4TN6A 3FI4A 3PPZA 3NMUF 4RVLA 5AP4A 3TT0A 3VONA 4LRKA 2BCJA 4FVQA 3UC3A 4DDIA 3QALE 4X0MA 4IEBA 3HA8A 5JSMA 3EYHA 4PDSA 1UKHA 3ANQA 1NXKA 4HNIA 4B9DA 1CDKA 5BVWA 4EUTA 2G2IA 5A6OA 2W05A 1Z9XA 3PTGA 5FD2A 2YCSA 2YAKA 3UOJA 3QYZA 1SYKA 1JSUA 4R8QA 4ANMA 1URWA 2UZBA 4XS2A 3BGPA 1V0BA 5BMSA 1YDSE 2C6LA 4ZP5A 4JAIA 5D9HA 3LFFA 4F9BA 4ZAUA 4O6LA 3GOKA 3WZUA 5C27A 3VN9A 3OEZA 4JBPA 1R78A 3NCZA 4PX6A 3UP7A 4HPUE 4DFLA 4AAYA 5JGAA 4IAZA 3BEGA 5FXRA 4D1SA 3TUDA 4ANSA 1WVXA 3R7GA 3AT2A 2IW9A 4W4WA 1GOLA 1OPKA 4F0GA 3GB2A 3PIZA 3Q9WA 3V01A 4FTTA 4WNMA 1JQHA 4C4JA 2OZAB 2WEVA 2QR8A 4O4BB 3PA5A 4V04A 5LVLA 3ZLSA 2PU8A 4DT9A 1REJA 2YIWA 4RSSA 2XEYA 3D7ZA 2XKEA 4AA4A 2VV9A 3IW4A 3LCDA 4JG6A 3FLYA 3R8LA 1KV2A 4H58A 2PVKA 4U7ZA 5J7HA 4ZMEA 3RAKA 4IX5A 4PDOA 4A9UA 4WRGA 1CM8A 4LGHA 2EXEA 4FNWA 3FPQA 2F7XE 4UXLA 2WXVA 2IJMA 3IW5A 3SD0A 2YITA 4F08A 3UVRA 1W2DA 1H25A 5HTBA 2HAKA 5TR6A 2YERA 3KU2A 3R01A 3SV0A 3UMWA 3W0QA 4YZCA 5FBOA 2VWIA 3HX4A 2P2HA 3BX5A 4I21A 2R3QA 4CG9A 1JNKA 3UTOA 1H1WA 4FV7A 1PMVA 4FF8A 4JJRA 5H9BA 2BFXA 4E3CA 5CF8A 4M69B 5HHWA 4MWHA 4IADA 1UV5A 4BYJA 4EYMA 3FV8A 3Q9ZA 1BL6A 3HLLA 4FKPA 5JT2A 3TIYA 4M13A 3I4BA 3ATSA 5L2IA 1Q5KA 4DEIA 4K6ZA 3ZONA 4O1OA 4BN1A 2OLCA 4I5HA 2WU7A 1OKWA 5EH0A 5EOBA 4XCUA 3GCVA 4G5JA 4IZYA 3HV3A 3MA6A 4U5JA 2EU9A 3RAIA 3QRJA 4H39A 3GP0A 4WNOA 2VTJA 5CU2A 1KE9A 3K5UA 3MH0A 5IEVA 3F88A 3DA6A 5IUGA 5KMIA 1TQIA 3IQ7A 2QVSE 2UW0A 2CGWA 2WTWA 4IFCA 5IU2A 4MXAA 1OL1A 4NW6A 4C4EA 5LVMA 5AP1A 3FHRA 3S4QA 4F7NA 4DH7A 5IISA 5AR2A 1RDQE 4NTSA 4LUEA 3TDVA 1FVTA 1LEWA 1OI9A 3TTIA 4M0ZA 1KE6A 5IQIA 5A3XA 3GBZA 4FTLA 4FE2A 3DT1A 3HV5A 2WGJA 4BCGA 1OKVA 5FP5A 3ORMA 3UNJA 4LL0A 3QRTA 3ZLXA 5H8EA 1Q8ZA 4RJ5A 5JRSA 3VO3A 3UDSA 4LM5A 3O8PA 4RMZA 3MTFA 2Z2WA 4A06A 3PP1A 3ULZA 3VNTA 1O6LA 3EFWA 3IW7A 4JBVA 2ITVA 5K3YA 4AW5A 2A19B 5IH5A 1H26A 5I9UA 2ZDTA 5HGIA 2WMAA 3HRBA 4FJVA 5EW3A 1I09A 2R5TA 3D5UA 2ZB0A 1JKSA 2G9XA 2XMYA 4FICA 4TNBA 1OIRA 3FQHA 3ZUVA 1JVPP 2C6TA 3ZO3A 5M4IA 1YXTA 3E8CA 4ZSEA 1FVRA 4LOQA 2FO0A 3F3WA 3NW7A 3Q52A 3FEGA 2Z7RA 4C4GA 3H9OA 4ACDA 3BL7A 2OF4A 5AMNA 1CTPE 3VBTA 4EZ7A 3F82A 4WNPA 4XOZA 2QO7A 3K54A 4O2PA 3W16A 2PL0A 4ID7A 1TQPA 4FK6A 4O27B 4O7WA 5EHLA 4PMPA 2HZNA 2YFXA 2JIIA 3JPVA 2XKCA 2WKMA 2RG5A 4IJPA 5B0XA 3V5QA 4C0TA 3CEKA 5AAGA 2PE2A 5M07A 4DG2E 4AE9A 4FKVA 5ACKA 4I3ZA 2E9OA 1YWVA 2JFLA 2BALA 2HW6A 3ACJA 3FLZA 4OTPA 1FPUA 4BDGA 3CJGA 1MUOA 4FK3A 3RI1A 2W4OA 4NW5A 2VO6A 4MCVA 4PTCA 5AUYA 3G2FA 4XOYA 1REKA 1OL2A 2HW7A 4HYSA 4KBAA 5DA3A 3UO5A 5E92A 2E9UA 3EJ1A 3C4WA 2NP8A 5JZJA 4HGEA 1W98A 4PP9A 4R3PA 3P4KA 4MTAA 5TOZA 3WF5A 4RJ4A 3LMHA 4G17A 4RFMA 5M53A 3DPKA 3BE2A 3DQXA 4FKRA 2EXMA 4QD6A 3CQWA 3VUKA 2X7OA 2QU6A 3TUCA 3F5PA 3PIXA 4DHFA 1AD5A 2X39A 4E93A 4YPSA 2BKZA 2HOGA 3LMGA 4RX7A 2JKQA 3EQHA 3BYOA 3QGYA 4FNYA 2XNPA 4DEDA 2PUIA 3LLAA 4F99A 3A7FA 3QX2A 2V55A 2R7BA 2XK6A 5ETAA 3DY7A 5AX9A 2RFNA 5I9YA 3LXPA 5E1EA 4MHAA 4AZSA 3ZFYA 2E9PA 3TKUA 3K3IA 2RF9A 4FV5A 4Y73A 2GQRA 3ZM9A 2C6EA 4AGWA 5LWMA 3KRJA 1OB3A 4W9WA 3V5WA 4DHZA 4NKSA 1VYZA 5G1XA 4AA0A 3ELJA 3ZYAA 4XBUA 4IC8A 5AP0A 5BQ0A 3FI8A 2CCHA 3ORPA 5C26A 4JBOA 4O91A 1XKKA 1V0OA 2HZ4A 2J9MA 2YZAA 3FL5A 4RIWA 2JFMA 4G1WA 4BWKA 5KUPA 3R7YA 4QQCA 3UQFA 1PXKA 4I6QA 3VQHA 2B52A 5J5TA 4OAVB 2AYPA 1YQJA 2UW8A 4A07A 1W83A 3IKAA 2W9FB 3LM0A 2ESMA 4Y5HA 5IF1A 3NEWA 1GZKA 3LHJA 4LYNA 3ZO4A 3F9NA 4YJPA 3RHXA 4X3FB 4O4EA 4GH2A 4QQ5A 3PUPA 3AKKA 1V0PA 2Z60A 5AAEA 5IA1A 2VZ6A 2ITXA 3NR9A 3C9WA 4J98A 2DQ7X 4MXCA 2ITQA 3G6GA 2X8DA 3VUDA 3EQFA 3QXOA 1Z5MA 4M15A 4AZEA 3GQLA 5IDPA 4O7TA 4XJ0A 2CHLA 4V05A 2X0OA 5HD4A 3UZRA 5ANOA 1NY3A 2WZJA 1GAGA 5LARA 4O21A 1PXLA 5JZNA 2NNWB 5A46A 3F2AA 4YTIA 3U9NA 1UWHA 3BLAA 1Q8TA 2W5HA 3PY1A 4AZWA 3A60A 2BZHB 3FQEA 3HV7A 4O0VA 3FHIA 4OTHA 3DFCB 1RJBA 3Q6UA 2R3GA 4KAOA 4E26A 1IG1A 4GG5A 3UBDA 3BV3A 3MGYA 4I92A 3RBWA 3FKOA 3OEFX 5DNRA 3PA4A 3DBDA 3UNZA 4IWDA 3DAKA 4YU2A 2X2KA 5DT4A 2I0EA 4EKKA 1ATPE 4FV6A 5ANEA 3S1HA 2QHMA 5HD7A 2VTTA 2XNBA 2WMWA 3Q5IA 4QMZA 1PXOA 4KD1A 4WSQA 4NFNA 5I3RA 1YHWA 3DQWA 4BYIA 4WIHA 4WNKA 4KIKA 3ZCLA 1YWNA 4HVGA 4JT3A 4WG5A 1ZMUA 4IW0A 3R2BA 5CAUA 1NT2A 4CVAA 3U54A 5E7RA 2F9GA 2PE1A 1QCFA 1P4FA 3QXPA 1PXJA 4BBMA 4O83A 1P5EA 2W1IA 3NNVA 3VS5A 3ZXZA 1PXMA 4OTIA 3W2CA 3HMPA 4ZLOA 4BY9E 2YHVA 4NT4A 3R8PA 1WMKA 3KC3A 4UY9A 4U6RA 2CCIA 3HNGA 3EQPA 4YSMA 2YM5A 3KMUA 4C02A 4O7SA 4JOAA 4ZSJA 5ETCA 5J7BA 3SVVA 4I93A 2PZPA 2VO0A 3MFSA 4C57A 2AC3A 2UV2A 4IE9A 1OZ1A 4U0IA 4CNHA 3I1AA 4KABA 4PUZA 4D2RA 2OFVA 4B8LA 4BDEA 3UE4A 3L1SA 4AOIA 4XMOA 5K9IA 4F4PA 2CNVA 5FTOA 3TTJA 1KSWA 1Q8UA 3NFFB 1PY5A 4D5KA 4BKJA 1L8TA 5CVGA 5GINE 2E9VA 4J95A 2B9JA 3G6HA 4I0RA 2OH0E 4PPBA 4ZSGA 2A0CX 3NIEA 5HICA 3OC1A 5HQ0A 2I1MA 4RFZA 4FIJA 4RC4A 4CFUA 1ST4A 4DAWA 1OKZA 3C0GA 4Q9SA 4V01A 1LP4A 3DNEA 4OT6A 1Q97A 3KK8A 3R8ZA 4ALUA 2PMIA 3C1XA 2FH9A 3TN8A 4I6BA 4I41A 5FXQA 4CD0A 1NW1A 4NM3A 4FTCA 2HZIA 2JC6A 4YLJA 1H28A 1HOWA 4IX3A 5CTPA 3VUGA 3W0RA 4GU6A 4R3CA 3NX8A 4TYHB 3FSKA 5L3AA 2ZVAA 4GYIA 4KINA 4PP7A 5BYLA 2WQEA 4ACCA 2UW4A 3AMYA 5IA0A 5M06A 1WBVA 4IC7A 5E91A 5JKGA 1A9UA 2QI8A 4GVJA 1KE8A 3D5VA 4PMTA 2FSLX 5ETIA 5I4NA 3E8EA 2VTOA 3VS4A 2JAVA 3QZHA 4J52A 2GTNA 5CT7A 4UYNA 5CT0A 2R3KA 3FJQE 5FEDA 4ZZMA 3UOLA 2UZOA 4YUQA 4UB7A 2JBOA 2ZV8A 4FKWA 4C3RA 3C51A 2O0UA 3FSFA 5EQYA 4FKGA 3MH3A 3L8SA 1J3HA 1KV1A 4MD7E 5BUEA 3F2RA 3C4ZA 1FGKA 3KF7A 4JR3A 1ZY5A 4JDKA 2C5NA 3HDNA 2YCFA 4DINA 2YCRA 2BTRA 1ZZ2A 3BHUA 4WG3A 3KREA 1U54A 3DZOA 2XNEA 4DEAA 2Y8OA 4A9SA 4FC0A 3NS9A 4Y5QA 4BCQA 3MESA 4O82A 3B2TA 3PRIA 3CQUA 3REPA 4DHJA 3MY0A 1M14A 3PE2A 3RWPA 2C3LA 3NIZA 4F6WA 3SX9A 2J0IA 2UVYA 4U81A 5CASA 4S34A 4PRJA 3MH2A 3FDNA 3E5AA 3OXTA 3GOPA 1H07A 3WE4A 2O5KA 2QOOA 4CYJA 4HCVA 3R1SA 2XIXA 4YZ9A 4ZTLA 4GT5A 2PVRA 3GC7A 4EBVA 3V8SA 4HGLA 1RQQA 2GHLA 1OUYA 2VN9A 4OUCA 4XYFA 2WNTA 3R8VA 4NTTA 3NPCA 5DR2A 4DEHA 4BCFA 1UNHA 3C4XA 4BCNA 3N4VA 1R0PA 1Y8GA 2X7FA 4DYMA 3B8RA 3FMLA 5T3QA 5AA9A 4O86A 2AUHA 2OKRA 5AP6A 3R7VA 5IZFA 1W0XC 1WVYA 3KCFA 3UZTA 3CD8A 4L43A 4MD8E 3TKIA 2H6DA 3KKVA 4CKIA 3IG7A 3S00A 2IZRA 2JAMA 5CSXA 3R00A 3A7GA 1X8BA 3R0TA 4DT8A 4KUJA 1V1KA 4ORKA 1XWSA 3CCNA 3FZ1A 3QA0A 5CEMA 4U43A 4D2TA 4QMTA 3NNXA 5J79A 2GNLA 4PMMA 5ITAA 3U51A 4HVHA 4ZZNA 3G15A 2ITPA 5DOSA 2C47A 2O64A 3ZDUA 4F9WA 3E93A 2XBAA 1UU8A 4LV5A 4Y46A 4I6HA 5CSVA 3R7UA 3ZO2A 4A4OA 1QPDA 4B99A 5CLPA 2WPAA 4ACGA 4ZLZA 4IDVA 4BI0A 5HVJA 5CYIA 3QZGA 3BLRA 4FKSA 1J91A 2DS1A 3EN6A 4TNDA 4O7VA 4BZOA 1YI3A 3DKFA 3KCKA 3I81A 3R73A 1ZARA 4DGNA 4EOPA 1HCLA 3PSBA 2GFSA 2PYWA 2BDFA 3ZSHA 1ST0A 3ZDIA 2F7EE 3FI2A 3GT8A 4PL3A 4FEQA 1IEPA 3S2PA 2XK9A 3NCGA 3D5XA 4JQ7A 4H05A 2YIQA 4DFZE 4F1TA 1XMLA 2I6LA 4CFWA 1XH7A 2J50A 5AR8A 2ZFYA 3ZTXA 5CU3A 2I40A 3CJFA 4FTJA 3RCJA 2J0JA 3MW1A 4F7JA 5KHXA 4Z16A 4UWBA 4WSYA 5LJJA 2GQSA 1DAYA 3ZS5A 2QURA 3RK5A 1PMUA 1ND4A 3VULA 4DEEA 2YLFA 2GTMA 4L52A 5DYJA 1TQMA 5K0KA 3CQEA 4LL5A 3UG1A 3CTQA 3P7CA 4KIOA 1UU9A 3H3CA 1XO2B 1OPLA 1STCE 4I4EA 1M2RA 4OTRA 5A4LA 1BL7A 4XV3A 2XUUA 3FE3A 4A4XA 3QUEA 3MIYA 4FYNA 4BCMA 1UA2A 3U4WA 4CT1A 1QL6A 2XRUA 5EOLA 4FT7A 5DWRA 5CNOA 4H1JA 4QMNA 4DN5A 3RM6A 5F4NA 2OJGA 1WBOA 3OWPA 5AV3A 3SLSA 2XAMA 1Q24A 3FY2A 4E4NA 5BPYA 4RWKA 4QTCA 2HYYA 3QCQA 3O7LD 1M2QA 5AADA 2W1DA 5DLSA 5DI1A 4JL9A 4FR4A 3VBYA 3UQCA 4QMVA 4ITJA 4JI9A 4K2RA 4RT7A 3D2KA 2QC6A 5ANDA 3ROCA 3VIDA 5M09A 2OI4X 5IA4A 3HECA 3E92A 4QMOA 4X2GA 2OW3A 2JIUA 3QTZA 5JEBA 1J7LA 2W17A 1PXIA 1WAKA 2A4LA 2JBPA 2G01A 3GU8A 1M17A 3O8TA 4QO9A 3V8WA 4EZ3A 3GFWA 5LWNA 3EFJA 4Y8DA 5FWKK 4S30A 4YJVA 3BBTB 3HEGA 2Z8CA 3HUBA 3Q9XA 3DJ5A 3FXZA 4GT3A 2QO9A 1JPAA 2RKUA 4KA3A 3HMNA 5LXMA 4FSZA 2CGUA 1ZYCA 2FGIA 3OFMA 2IZSA 1PKGA 4BDBA 5M44A 4QDEA 3BIZA 3LXKA 3KULB 4DBNA 4M0YA 2QG5A 3LOKA 4BI1A 5CEOA 2OO8X 4GRBA 3PLSA 3K5VA 4D58A 3PSDA 4EH4A 3EB0A 2RSVA 4BRXA 3BEAA 4IM2A 3PPKA 3VF9A 3A61A 4OT5A 2X81A 4IB3A 4BBFA 4IMYA 4C4HA 4EOKA 4DC2A 1A48A 4FTNA 3MA3A 4QP7A 2VGOA 3GU6A 1K9AA 2HK5A 3AT4A 4WRSA 5HO7A 4FZDB 3DDPA 1U5RA 4RLKA 2EB3A 5L2SA 3UPZA 4G3CA 2R2PA 3GXLA 3R1NA 4Q5HA 2E9NA 3EZRA 4RIYB 4AWIA 3UDTA 3KVWA 3SRVA 3KL8A 2ZV7A 3QTQA 4BDFA 1OGYA 4AS0A 1LUFA 3HMIA 3QD2B 2WIPA 4RGJA 4X2KA 3VUHA 5J1WA 3MB7A 3NAXA 4G3DA 2WTIA 3KXHA 3QX4A 3GCPA 1ZYJA 4DA5A 3I7CA 5FQDC 4USFA 5AA8A 5E8SA 3SC1A 3DGKA 4XG6A 5EDPA 2X0QA 3BU3A 3C13A 3QQFA 4BWXA 3UIMA 2VX0A 3PSCA 4FTKA 5C8KA 4Z3VA 3OD6X 2JDSA 1G8KA 2PHKA 3I6WA 4G5PA 4CFVA 4O7NA 4FKOA 1JKKA 3QKMA 3ANRA 2ZM1A 4FGBA 4EC9A 4DE4A 3HRCA 3BRBA 4RPVA 5AP2A 5CEQA 2BRMA 3GENA 3O50A 5CS6A 2Y7JA 2C0OA 2EVAA 3V5JA 1U46A 3PA3A 3VJOA 3PJ2A 2WMVA 2WMQA 3R9RA 3ZXTA 4QP8A 4QPMA 5JRQA 2CLQA 4D55A 4F7SA 2VAGA 2IZTA 3KFAA 4NM7A 4G3EA 3P86A 4IWQA 2GS6A 4MXXA 4DLJA 4EHEA 5AV0A 3PLAE 2PVHA 4UMQA 5L6WL 4FG9A 3S0OA 4FKQA 3OXZA 1PRYA 5J9LA 2ITTA 4QTBA 3RINA 4P5ZA 4EK5A 3OHTA 3OWJA 4OBPA 3ZZEA 4IB5A 4MNEA 4RG0A 1PYEA 2NO3A 5A6NA 5AIRA 3QLGA 4FSWA 4YBJA 5CU6A 3IGGA 3RCDA 4KSQA 1YI4A 4DDGA 1XH4A 2Q83A 1OUKA 3AMBA 4CV8A 3LFEA 3MPTA 2XAOA 2C0TA 3WZKA 3FAAA 4FV9A 3QQLA 2W99B 4I5MA 4O2ZA 3U6HA 3TCPA 2YM4A 4MXOA 4MX9A 3RAHA 2XKDA 3EMGA 3QD3A 2FSTX 5J9ZA 1BI8A 2OIQA 2YDKA 4C35A 3TG1A 4UALA 1WCCA 1K2PA 2C5XA 4A9TA 1H4LA 3WARA 4II5A 2O3PA 2JDVA 3UC4A 2QNJA 1KE5A 4FNZA 4J96A 3QWKA 4FKJA 1YXUA 4UXQA 4E5BA 2PULA 4RJ8A 4HZSA 3LZBA 1OBGA 2QONA 4YPDA 3O0GA 2HXQA 4C2WA 3BQRA 3PVGA 3PJ3A 4OLIA 5M55A 1MRYA 2LAVA 2BRHA 4D9TA 3Q04A 4BCKA 1DI9A 2AC5A 4F6UA 1JBPE 2JDOA 5CSWA 4IVDA 3TNQB 4IM3A 3D7TB 2C0IA 4CCUA 4FZ7A 5HG9A 4BDHA 2X0GA 3HP5A 3WI6A 4L67A 2CPKE 4ASXA 4TPTA 4I0SA 3NAYA 2BTSA 4UMUA 3EHAA 5ETFA 1NVQA 3HGKA 3FKLA 3NUXA 3M2WA 2PWLA 4MF1A 3BHTA 4ITIA 4C4FA 2IG7A 3RNYA 4GW8A 3U9CA 4XHKB 2NRYA 2XF0A 4AU8A 4W9XA 2SRCA 4PDPA 3ZHPC 2IEWA 3Q53A 4RVKA 5FLFA 3COIA 3KF4A 2XZSA 3QRIA 5GJFA 4GK3A 5HLNA 4U3ZA 4DH3A 2PVYA 3QLFA 4DFNA 2Y4PA 3EOCA 2W1GA 4J53A 4AOTA 3PXKA 1NVSA 3R7IA 4O4FA 3UYSA 2P3GX 4ZSLA 3WZEA 3V51A 3SG9A 4DH5A 4NUSA 3AGMA 1H8FA 4TT7A 1JLUE 4X6RA 1W7HA 3RK9A 5L4QA 3BYMA 3QAME 4RQKA 2FYSA 4QMSA 5IQGA 2A27A 4YZBA 2IF8A 5HLPA 5J95A 2BFYA 5FM3A 3R1QA 1B6CB 2OK1A 4FT5A 4KB8A 2W96B 4H3BA 2WTJA 2W0JA 3QQUA 4O0TA 4FVRA 3A7HA 5L6OA 5EQEA 4Y95A 3QQJA 4CMOA 2P0CA 4Q9ZA 3MY1A 3TMOA 4BCOA 5M57A 3LFQA 2CJMA 4G6OA 4RWJA 4ZJVA 5H3QA 5HOAA 4DFXE 4QPSA 2JDTA 4JVGA 5C03A 4RWLA 2Y4IB 3PY3A 5HCXA 4CZTA 5KMJA 3ZU7A 2FB8A 4AW0A 4BCPA 4AFEA 4CMUA 3KMMA 3R22A 4I22A