4WBBB

Single turnover autophosphorylation cycle of the pka riib holoenzyme
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Single Turnover Autophosphorylation Cycle of the PKA RII beta Holoenzyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase type II-beta regulatory subuni
total genus 99
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4wbbB01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4wbbB02
3KF7A 3TUCA 3BHHA 5AR8A 5HE0A 4A4OA 2WTWA 2XVDA 3AC5A 2HOGA 3R01A 4C2WA 4H36A 4CXAA 4IHPA 4DBNA 3JR1A 3KFAA 3VS5A 3KREA 3VAPA 3FI3A 1WBOA 1PKGA 5C1QB 2C5VA 4PMSA 3R8ZA 2PVKA 1XH7A 5HO6A 3QYZA 3RHKA 3BE9A 2XM8A 5ETCA 4E4MA 5IDNA 3TKUA 4FTQA 3F3WA 3O17A 1YOJA 5LMKA 4BICA 4L8MA 5FLFA 3F3VA 4G3CA 2J0MB 1WVXA 2WB8A 2CKQA 3Q6WA 3EOCA 4C8BA 3I81A 3CE3A 5LMAA 2BHHA 4AT4A 4DTAA 4JNWA 5CVFA 3FXWA 3LHJA 2CN8A 3QLFA 2V5QA 4TYJA 3CY2A 4FK6A 4R7BA 3THBA 4JL9A 5K0KA 2BZIB 3HMOA 2B9FA 2R3GA 1YHSA 4EK8A 4FNYA 5GHVA 2OF4A 3LJ2A 2F7XE 2JLDA 1OI9A 4XG8A 3QCQA 4U40A 2YM4A 2WNTA 2Z7SA 3GB2A 3GNIB 4WHZA 5D41A 3UZTA 5HBHA 4PNIA 4TNBA 4RZVA 1XH9A 2PZRA 3RM6A 4GFGA 4C4IA 2BAKA 1WVYA 3V5LA 3VS1A 2OFUA 4QQTA 4ACHA 3IK3A 2LGCA 3PJCA 2BKKA 2CLXA 4Y5HA 1OL1A 4IM3A 4XG6A 3QZFA 4HYUA 4CZUA 4BY9E 1P14A 3DBFA 4BI0A 2BDJA 3TKIA 3DDQA 2BDFA 4PP9A 1M2PA 4YNOA 5CU0A 1TQIA 3H30A 5JFWA 5JZNA 3QD4A 1T45A 2W4JA 4QP9A 5ANDA 4I21A 4F70A 3I5ZA 3NW5A 4PX6A 2ZM4A 2PPQA 4Y46A 1Q3WA 2WIPA 3GUBA 1VYWA 2OK1A 2IVTA 3IG7A 3OEZA 3V8TA 5HKMA 4YURA 5HX8A 1H8FA 2ZOQA 3G6HA 3UVRA 4FSTA 1Z57A 1F0QA 4RJ8A 5EYCA 1SZMA 5LVMA 2IZUA 4FICA 4O84A 2J5FA 2ZM1A 3ZH8A 1V0OA 2XP2A 3A8XA 4Y73A 3DXNA 4LUDA 4Q5HA 3ET7A 3RCJA 3W2CA 1JWHA 1YOLA 3LOKA 4O0UA 3KMMA 4DFNA 3KU2A 4IX6A 3BWFA 1BUHA 2R3MA 3GFWA 3HYHA 3P86A 4UXLA 5G1XA 3TJDA 3U87A 4O7VA 1NA7A 1UKHA 4UWBA 4BC6A 2R3QA 2VX0A 3DBDA 4C57A 4QMNA 5JFXA 4CG8A 3RHXA 5DE2A 4K77A 4OR5A 3ENMA 3MI9A 3MJ1A 4UEUA 4F6UA 4X21A 5BUIA 3EQGA 4O7NA 3SGCA 4P90A 4S33A 3KEXA 3BIZA 2V7OA 4Z7GA 5LXMA 1QCFA 3DS6A 3W32A 5CF6A 4I5CA 2XYUA 3HP5A 2PUPA 2H96A 1Q8TA 5AV0A 3QQHA 3OFMA 1J3HA 1Q3DA 4PMPA 2GFSA 2C0IA 3IPHA 3VQHA 2BPMA 4CMOA 3CGOA 3ZLWA 4OTIA 5AIKA 3E64A 4FTOA 3BGZA 2PYWA 4OTWA 1GIJA 1U5RA 1YVJA 3QAME 4OLIA 4YLKA 4QTAA 2BUJA 3HGKA 4FVRA 3D7ZA 3GVUA 1M52A 5IMXA 2B53A 3TV4A 5I9YA 4DF3A 2EXEA 4FIHA 3D2IA 4GIIA 2BVAA 3R02A 3ZXZA 2RKUA 3NYVA 3UVQA 4XG2A 3DGKA 4UMPA 5IQIA 2HZ4A 1UNGA 3C4XA 4R3RA 2GHGA 2JD5A 4DFLA 3QL8A 3UC3A 3UNZA 5CWZA 1E9HA 4FSNA 3LMGA 3WBLA 2VTTA 2X2KA 3QGWA 4C36A 4G6LA 2UVYA 2ETKA 1Q62A 5F1ZA 3LAUA 3UDBA 3O8PA 5I0BA 1P2AA 3RK7A 2BCJA 4G31A 4KIQA 3BBTB 4TYIA 3QXOA 4G17A 2E9VA 1PXOA 1H00A 2OJJA 2XBJA 5E8TA 5AR3A 2F49A 3R63A 2X1NA 5KHWA 1KUTA 4RT7A 4TY1A 4F7NA 3NPCA 4FZ7A 5DA3A 4CTBA 3CR0A 2XK9A 2Y0AA 4O2PA 1ZY5A 4EQMA 3QF9A 3G0FA 2YFXA 4NJ3A 3VVHA 3WIGA 3L1SA 1H1QA 3HV7A 4M7IA 2WTVA 4D4SA 2WQEA 2X7GA 2I1MA 4K2RA 3REPA 2YLFA 4YLJA 4FKJA 3PSCA 4HYHA 1PJKA 4MTAA 5AWMA 3UO5A 5IQCA 2QCSA 3QD3A 4O1OA 2WO6A 4Y5QA 2JIUA 3VHKA 5GIPE 3ID6C 4XV9A 3NCZA 5C03A 4DTBA 2VTIA 5J1WA 3OY3A 5BVKA 4D1ZA 1ZWSA 4EOSA 4XYFA 1YKRA 2J2IB 4USDA 3QQJA 2GQRA 4ZZNA 5AP3A 4DT9A 4FOCA 5KNJA 3TDWA 4HGLA 3GCPA 3H0ZA 5DNRA 4RIYB 3R9NA 3JS2A 4ZP5A 2XJ0A 4QNAA 2QOLA 3DB6A 4LMUA 3W1FA 3O96A 3EL8A 3MH3A 4LYNA 2OICA 4RFZA 3NNXA 3FDNA 3ULIA 2E9UA 3ZBXA 2OZAB 1Q8YA 2WEVA 3BX5A 3HECA 1IR3A 2VTQA 2QKRA 1XO2B 3BBWA 3Q3BA 3EB0A 3AC4A 4FTIA 4D2SA 3CTQA 4AW0A 2W0JA 1MUOA 1SNXA 3VS6A 4QMTA 2XM9A 3R2BA 2ZMCA 2WMBA 4RIXB 3FLZA 2BHEA 3QYWA 1FQ1B 2Y4IC 4NCTA 5DVRA 3ACKA 4EJNA 4I4FA 3PVGA 1WVWA 3JXWA 2X8IA 3MVHA 4PRJA 4EWQA 4KKEA 3PP0A 4GEOA 1YXSA 1CMKE 1OBDA 4YSMA 2OXXA 5AR4A 3C1XA 2R0UA 3R0TA 1WBVA 4BF2A 4EH7A 4ZSAA 3RPSA 4DE4A 2ONLC 2WELA 4U8ZA 2W1GA 4U79A 1KV2A 2QLUA 2ITZA 3OTVA 4H3PA 3QD2B 2O65A 4MQ1A 1FGIA 1FVRA 2HY81 3DQWA 2JKKA 3P23A 4JDJA 1GZKA 2XZSA 5AV1A 4WNKA 4YP8A 4RJ3A 3SRVA 3RWQA 4FSMA 3BWJA 1H1PA 4BIEA 5EQYA 3NEWA 4FG8A 4K9YA 4S34A 3KXMA 3DAJA 3ENHA 3SG8A 5AR2A 4C4JA 1PXIA 4YMJA 4JS8A 4O38A 1BYGA 4DEGA 3COIA 2GFCA 3VUHA 2QKWB 1H28A 1WBWA 2CN5A 4O0SA 5DN3A 2W1FA 4M68A 4IE9A 4G9CA 4KIPA 2GPHA 1MQ4A 3OXTA 2RIOA 2ZMDA 4ONAA 4WO5A 2ITPA 1Q8ZA 3TIYA 2PUNA 4I4EA 1CSNA 2HZ0A 4IFCA 4AW2A 2WMVA 3DQXA 5C01A 3RPVA 4Z3VA 2GS6A 3C50A 4FGBA 4DA5A 5EOLA 4L9IA 2C3IB 3JYAA 4FL3A 3E92A 5C8NA 4IADA 4QQJA 4MHAA 3BE2A 1WBSA 5EK7A 4CFNA 4ZMFA 2OBJA 3WYXA 3WZUA 1BLXA 4PV0A 4BCJA 4WG3A 3P7CA 4XG9A 4FV9A 2CLQA 3EHAA 2CGXA 2ETMA 2YACA 5HCYA 2G9XA 4ANBA 4AN9A 4UY9A 3SG9A 3VS3A 3UO4A 3RTPA 3KL8A 2W4KA 2OI4X 2FO0A 4G3DA 4WRSA 4BBEA 2PULA 3WZDA 4EL9A 4YHTA 3DKCA 3DNDA 4IM0A 5L2QA 1AQ1A 3SX9A 2QHMA 4O91A 3K54A 3CBLA 2IVUA 4CFVA 4AN3A 5I5ZA 2V55A 3Q2MA 4G1WA 4FBXA 2W9FB 4RFMA 4TL0A 3KGAA 4RWLA 3ZSIA 4Q9SA 1Y8YA 4FTKA 4OBQA 4YZ9A 3TIZA 4J98A 4B7TA 4XP3A 2CNQA 2PWLA 4CKIA 2VWWA 4EOOA 2ITWA 2OJIA 2XRUA 3I1AA 3TT0A 3NUAA 5FP5A 4GCJA 3PIZA 2VTOA 4H3QA 4FTNA 3UPZA 4M8TA 4X3FB 2VTHA 3M1SA 5A46A 2RGPA 3COMA 5M44A 5J1VA 3BGPA 5E90A 3BQRA 2ITNA 2P2HA 4H1JA 4CRSA 3AXWA 1JBPE 3OMVA 3F2AA 4R5YA 1R0PA 4K18A 3WARA 4FVQA 2RFSA 4NL0A 2CGWA 5C26A 4FIJA 4MK0A 5IA0A 3TM0A 2QONA 3FI4A 3UPXA 4J96A 4ZSGA 4IVAA 5E8UA 1V0PA 2C6TA 3QQLA 4AA5A 4JRVA 1UU9A 5HBJA 3NNVA 5AX3A 5HVYA 4UZDA 4E73A 2GS2A 4NW5A 5I3OA 4R7HA 5DR9A 4EYMA 4D2TA 3FQHA 1MRYA 5GJFA 2GHMA 1IA9A 3DAEA 2YM7A 5EM5A 4DYMA 2I0HA 2JDOA 3DY7A 4U3YA 4TWPA 3GXLA 4JI9A 1B39A 2YZLA 5EOBA 3RCDA 4A06A 3PJ1A 1XJDA 2JAMA 3VUDA 2O2UA 3N4VA 3LQ5A 4AT5A 4EZ3A 4OTDA 5AP7A 1ZMVA 5AUXA 4C4HA 2JKOA 3AD5A 4FEQA 4GT3A 2VRXA 5GNKA 4XG7A 5AX9A 3I5NA 4NTTA 1ZAOA 2H34A 4QNYA 4RVKA 1TQPA 3TUBA 1QPCA 1J7IA 1SVHA 3CQEA 1GIIA 3C4CA 3QRUA 4QYHA 1CKIA 1ZZLA 3V5JA 4H58A 3ZUTA 4CV9A 4F7LA 4FK3A 2YZAA 3IDCA 5KX8A 2P3GX 2XCHA 4ANOA 3C13A 4GSBA 4EONA 3BYOA 5CI7A 4ZMEA 4FSUA 3PJ3A 4FV5A 5JEBA 3FYJX 3FY2A 3MYGA 4MXZA 5EFQA 4LV8A 4B4LA 3LFFA 1S9IA 3P5KA 3LM0A 4IDVA 4FZ6A 4BVUA 3W8QA 4DCEA 1IG1A 4IM2A 1XKKA 2VO6A 4I0RA 4IW0A 4TN6A 3JVSA 5TF9A 4AGUA 1SMHA 2XNMA 4OTQA 4ZZOA 2EXMA 3TDVA 5KMKA 5IQHA 4AFEA 4AU8A 4G2FA 2VX1A 5M53A 2AC5A 2RSVA 4F1OA 1XH6A 5BVEA 3MIAA 1YOMA 3UG1A 2PZYA 3TWJA 3EN6A 3E5AA 3NYNA 2RG5A 4QMZA 1Y91A 2C3LA 5HVJA 4F7SA 1MQBA 1LP4A 2I0EA 2IZSA 3LXLA 4IDTA 4X3JA 5EW3A 3HAMA 3I6WA 3IDPA 4CLJA 3IW8A 4WNMA 3JY9A 2H8HA 1OKZA 3CJGA 4EOIA 3FMDA 4FV0A 3WIKA 5AP5A 3FXXA 5EHYA 5LQFA 3B8RA 4ANQA 5E8YA 1T46A 4QTBA 5FXQA 4NFNA 1Q8UA 2B9JA 2WQBA 2YDJA 3I60A 4FNXA 4YJOA 5F95A 5JRSA 4FIGA 5TR6A 2WTDA 4TXCA 4YJNA 1NT2A 4MAOA 5CF8A 1O6KA 4UALA 3RPYA 2C6IA 4DGGA 2JEDA 3O23A 3VN9A 3PJ8A 4XBUA 3VRZA 2UZTA 4FKIA 4HNIA 4N70A 2J9MA 4X2JA 2ITOA 5E9EA 1IAJA 3G9NA 4X6QC 4XEYA 3WF7A 5AFVA 5CT7A 4BDJA 4ZZMA 2HZNA 1PMEA 5EYKA 1FVVA 2XMYA 3WILA 1UA2A 2F9GA 4BI1A 3CSVA 4FTMA 4C02A 3IGOA 2VO0A 4BKYA 4QPSA 2BR1A 2XYNA 4HOKA 2X4ZA 4RZWA 2R64A 4NM5A 3R9DA 2B9IA 1RE8A 1UU8A 3A62A 5CSVA 4JRNA 3S00A 3ANRA 3BPRA 4YHJA 5DT0A 4W4VA 2QHNA 3ZO2A 1U46A 4H39A 3VUTA 4LOPA 1R39A 2JGZA 5B0XA 3U51A 5A4CA 4L7FA 4QTCA 1GNGA 4KSQA 3NDMA 5A6OA 3OXIA 4XOZA 1UVRA 1SYKA 3JPVA 5HGIA 2ITYA 4CFWA 3FMKA 4HVGA 3S1HA 1V0BA 4NKSA 4PTCA 2HYYA 3M42A 2GSFA 4BTMA 3UGCA 3CC6A 3UQCA 4L3PA 4WA9A 2GNJA 3QFVA 4C59A 3U6IA 3DFCB 3C4EA 3W16A 5HEZA 4O0TA 5BVWA 3T3UA 3E3BX 2IVVA 3LLAA 4M0ZA 2ZM3A 3AG9A 4P2KA 1OM1A 4YO6A 3VQUA 3VUIA 2RFDA 5EW9A 3C9WA 2C6EA 3QU0A 4OTPA 3QQUA 5BUJA 1SNUA 3DKOA 3ERKA 4YJUA 3P4KA 4ID7A 3BRBA 3MSSA 4FKWA 1M2QA 2WD1A 4EK3A 2QLQA 2WGJA 2PMIA 3FAAA 3MY0A 4FZFB 4UB7A 4OTHA 2BFYA 4O1PA 3A61A 3R7IA 4CQGA 4DG2E 4EUUA 1IASA 2ZV7A 5HE2A 4LGDA 4OUCA 4B99A 3NUYA 4AG8A 5AUWA 4RC2A 3GFEA 4ZY6A 5HD4A 4Y72A 5T3QA 3Q53A 5D10A 3VS4A 1B6CB 3S4QA 2VO3A 4DH8A 5IA1A 4CCBA 3P9JA 4AP7A 1YRPA 1R1WA 1G3NA 4M13A 1JPAA 1KV1A 3DTWA 3F82A 3F88A 4BCNA 5GZ8A 5CXHA 1NW1A 2BRGA 3MESA 2WKMA 3F3TA 3I0OA 5EM8A 5AP6A 3MPMA 3QUPA 4HYSA 2PVJA 4RIWA 4FT0A 3T9IA 4RA5A 1REKA 3K5VA 2J0LA 4KBAA 3R21A 4BTJA 3EYGA 5L2SA 2HCKA 3PSDA 4G34A 1M17A 4D55A 4TWNA 1LEZA 3QBNA 2B9HA 4DGOA 2WFYA 3N4TA 4PPCA 5EDQA 4B8LA 4BDBA 5CEPA 3A7HA 4I3ZA 5AIRA 3NSZA 3VBQA 1QPDA 3PZEA 4C2VA 1ZOHA 4JQEA 3R7VA 4CCUA 5IDPA 3UIUA 1Z9XA 2QD9A 3DBCA 2YA9A 4F65A 3P0MA 4QMVA 5ANIA 2GQGA 3LCDA 3LFSA 3LJ0A 3EN4A 4AE9A 4BZNA 5BVFA 3KXXA 3ALOA 4MBIA 4DEHA 3OY1A 1XR1A 4HPUE 3C5IA 2R3RA 3BV2A 5CXZA 5L3AA 3Q9YA 5ANEA 5FD2A 3O2MA 5CQWA 4CQEA 4D1XA 4I1ZA 4DGLC 5CAOA 2C6OA 2VV9A 3AMYA 4XNEA 4NSTA 4LGGA 3PG3A 4E4LA 1FVTA 4MXYA 5D1JA 4U45A 2E9OA 4WSYA 3WYYA 3NUSA 3AGLA 3EN7A 3ZUUA 4BTKA 4AW1A 3D5WA 3WF6A 5CEMA 3DDPA 1U54A 4FIFA 4RX7A 5FG8A 4CRLA 5CYIA 1XBAA 2OGVA 4O21A 4F4PA 4EH8A 2PZPA 1Q8WA 3OVVA 4YU2A 3C0GA 4I23A 5KMMA 2BAJA 4L3JA 4ZJVA 3PZHA 3E88A 3EQPA 4Y85A 4O7ZA 5EM6A 1OIQA 4LQMA 5HCXA 5KMIA 3PPKA 4U41A 2XKDA 1YWRA 3MH1A 4LRMA 2BRNA 2PVMA 3OC1A 3MPAA 4CT1A 5A4QA 3OW3A 1OIRA 2GCDA 3MPTA 3UYSA 4HVSA 2XF0A 2X7OA 3NLBA 3BLRA 4WRGA 3KRJA 4AZTA 3VS0A 2Y6OA 3MB7A 4NUSA 4ANMA 5IH6A 3BHVA 4NM7A 3T3VA 4NYEA 4EH2A 4O83A 4R77A 2PU8A 1M14A 3V5QA 3FPMA 4D2PA 3W2SA 3QQFA 3VWAA 3W2PA 3ZZEA 3FYKX 4ZTRA 2O0UA 3KN6A 3AQVA 4HCTA 3R8LA 1UNHA 4F0IA 3BYUA 4FV3A 4RGJA 5TT7A 2R3NA 5AAEA 5IQDA 3LIJA 4C3PA 4FR4A 5JKGA 5CTPA 2XNGA 5ETAA 3ZRLA 3BZ3A 1P5EA 3H10A 3R73A 4IH8A 3SV0A 4DGNA 4EKLA 2XK4A 3F61A 4KBKA 2CNUA 2C4GA 1H4LA 2Y4PA 4G16A 2DQ7X 2XKEA 4JAIA 3W55A 3CTJA 3HVCA 4AOTA 4O22A 1H1RA 3ZEPA 4QP3A 2GDOA 2JC6A 2HWOA 4CZYB 3FLQA 3D83A 4EZ5A 2BZJA 3ORXA 4ZTSA 4D0XA 4UMRA 3NYXA 4QT1A 4G9RA 5K4JA 2C6MA 2FYSA 4UMUA 5DG5A 4YZDA 4QMLA 3WE8A 3FSFA 3IW5A 3NS9A 3C4FA 5HU3A 3DTCA 2V62A 2DWBA 5C4KA 1OL6A 3PSBA 5FP6A 4ZTMA 5CAPA 5IISA 2QG7A 3ZO1A 5LCKA 2J90A 4FTCA 3T8OA 3TZ9A 4F6SA 1YDTE 2XNEA 3RINA 4BIBA 1ZYDA 3DBEA 4QMSA 2QR8A 4X2FA 4AS0A 4EH6A 4CTCA 3F5UA 4HCUA 4K33A 3TI1A 2A2AA 5AUUA 4LRJA 4E5WA 2P0CA 4XLIA 1Y8GA 3KA0A 3TACA 3OTUA 4JX3A 3R8UA 3CPBA 3OD6X 3WF8A 3UZRA 5ANJA 4FSZA 3N9XA 5BMSA 2WU7A 3QUDA 4X2GA 4KKGA 3CIKA 4OBPA 4CSVA 3BGQA 4FV8A 5DEYA 3KRWA 3NGAA 2AUHA 4FL1A 1QL6A 2VTLA 2QODA 4L01A 4JQ7A 4BTFA 3E7VA 5EHLA 4AZSA 4JBPA 1ZOGA 5BQ0A 2VTJA 4FYNA 5C27A 4C4GA 3MY5A 4Y95A 4E6AA 5IA5A 1H01A 3NAYA 2CKEA 3BYSA 1Q41A 2YM6A 2W05A 4I0SA 4FC0A 5HIBA 5K5XA 3GU5A 3CS9A 4OT5A 3IGGA 4XRJA 3ZDIA 4ENYA 1JKKA 3PLAE 2LAVA 3MV5A 2R0IA 1UNLA 4IZYA 4L46A 4MH7A 1V1KA 3MVLA 5AA8A 4FT3A 1W84A 4EHGA 3P78A 3UIBA 5KHXA 2F7EE 1A48A 1O6YA 4FTAA 5TO8A 4UWCA 4NM3A 1JQHA 3Q5IA 2A19B 1B38A 5DT3A 2C30A 4LOOA 3ZSGA 1Q4LA 1BKXA 3LCOA 4AQCA 4GK2A 3PJ2A 2ZDTA 5FBNC 2YAKA 5I9VA 3R1QA 5A3XA 3SOCA 3ROYA 4A9TA 4HPTE 2YIQA 4IXPA 3KMWA 1OL2A 4PQNA 4GYGA 3IONA 1QPEA 2UZBA 3AD4A 3WZKA 4M69A 4ERWA 3R7GA 5IEXA 2PE2A 3R8VA 4RQKA 5CU3A 3UODA 3UIMA 3F3UA 2PVHA 3IW4A 2ITUA 2UZVA 2XKFA 4L68A 5IQEA 2I0YA 3A7JA 4EK5A 2CNVA 4JIAA 1JSTA 2F57A 2R5TA 3E93A 4FYOA 5EI2A 5C8KA 2XRWA 3MH2A 4QMMA 2QO2A 3Q60A 3TV7A 2W4OA 4MNEA 3CY3A 2YWPA 1OL7A 4YJSA 1S9JA 2WMRA 1OBGA 2ITVA 3KY2A 4FV1A 1GZOA 3NIZA 5JGAA 4TWOA 1IRKA 1H1SA 2W1ZA 3SW4A 4P5ZA 4AOJA 4Z16A 3DKGA 3ATSA 2QI8A 1XH8A 4IZ5A 1PXKA 2J6MA 4DFXE 2BMCA 4ZK5A 3F5XA 2HIWA 5HI2A 1HCKA 3OOMA 3ROCA 5E8WA 3ZLSA 5B2MA 2UW5A 4EKKA 3JVRA 4AWIA 1PY5A 4XV3A 3VS2A 1WMKA 3RZFA 3GQLA 2YDIA 4JG7A 3QZHA 2DYLA 3UZPA 4X3FC 5IQFA 1MRVA 5CEKA 2CHLA 1PYXA 4ERKA 2DS1A 4CGAA 4QOXA 4RVLA 3ORTA 2XB7A 3F69A 3I79A 3MTLA 4F99A 3F2RA 1QPJA 5CVHA 3SA0A 4KAOA 4BHZA 5FRIA 4D4YA 3CCNA 4TRLA 2VWIA 4CV8A 2OLCA 4QP2A 4RMZA 3VUKA 2OZAA 4O0XA 4D2RA 3CQUA 4DN5A 3KXZA 1FMKA 3NWWA 2NNWB 3VJOA 4ORKA 2XCKA 5E8ZA 4UMTA 5J8IA 2RFNA 3HUBA 2NRUA 3GEQA 5DR2A 4XX9A 4MWIA 4DEAA 2Z02A 4IJ9A 5JFVA 2W99B 3FC1X 4FSWA 5J87A 4ASZA 2XK7A 3R28A 3FZSA 3N51A 4I6QA 2WTJA 3V5WA 5HTIA 2YCQA 4X0MA 4X3FA 2ZB0A 2R3OA 4W9WA 4ZAUA 5EQPA 5M07A 5DH3A 5KMLA 5CAQA 4C35A 4FF8A 2JFLA 3KXGA 4MQ2A 1Q5KA 3G5DA 3UOJA 2OWBA 2OO8X 4AZWA 4USEA 5JQ5A 2E9NA 4DC2A 4F1TA 3FPQA 3G6GA 3UIXA 3K3JA 4YBKA 1L3RE 3RJCA 5LWMA 5AMNA 2JDVA 4G5JA 4YTHA 4A4LA 3Q4TA 2C47A 3IKAA 3OW4A 3PA5A 3I0QA 4V04A 5CANA 3CP9A 2OH0E 3ZCLA 1PMNA 4JJRA 4U43A 4CEGA 3L9LA 3HP2A 4YPDA 2WMSA 2IZTA 3FI2A 3GC9A 3GP0A 4GV1A 4U3ZA 5IUGA 4ZLYA 1HOWA 4A7CA 2EUFB 5FEDA 4EHEA 4EH3A 2R7BA 5FM2A 4R7IA 1YQJA 4GL9A 3F5PA 3IDBA 5FTOA 3UNJA 3F3ZA 4TYGA 4YHFA 1NY3A 1JKLA 1KWPA 1LUFA 2UVZA 3UBDA 5AM7A 3VBVA 4EH4A 3O8TA 3PVBA 4JX7A 3VO3A 4AF3A 1KOAA 2DUVA 5FDXA 2GNHA 2UW8A 3D5UA 4JOAA 2FSMX 2QOFA 4YC6A 4ZEGA 4ASDA 1J7LA 3HZTA 4OTRA 4PTEA 3D7TA 2WAJA 4FKPA 3W2RA 2ESMA 4IQ6A 3UC4A 3OCBA 4TKSA 1BMKA 4LGHA 1KE9A 5LCJA 1WZYA 2QU6A 4IAYA 3R9OA 3PUPA 4G3EA 5GJDA 1CTPE 2IPXA 3LFBA 2A1AB 2GNLA 3RM7A 4M69B 3MTFA 5AUTA 4ASXA 3PXFA 2YERA 3QX4A 4MF0A 5JZJA 4E26A 2UZLA 4FV7A 4J95A 4NTSA 1M7QA 2X81A 4H1MA 1YWVA 3NZ0A 2OU7A 4D0WA 5JQ8A 4FKUA 4CT2A 5J9ZA 4AUAA 4I5PA 3FLYA 2ERKA 2JAVA 5CU4A 3AT3A 3AMBA 2B52A 2J0JA 5L4QA 2HELA 4ZIMA 4ZJJA 4AOIA 2QR7A 3HRBA 3NCGA 5D11A 4XMOA 2XIZA 3GC8A 3QZGA 4CKJA 3ETAA 3L8XA 4DTKA 4RC4A 1O6LA 2ZB1A 3W10A 2P4IA 3RNYA 2PMOX 2ITXA 5F4NA 2VGOA 2FGIA 2WMAA 1YHWA 3DJ7A 4J99A 4U5JA 3LQ8A 5J7HA 2I0VA 3KK8A 4D4RA 5HCZA 4YO4A 5BMMA 4ZY4A 4K8AA 5LMKC 4OGRA 1ZXEA 2JBPA 4FNZA 4JDIA 2ZV8A 4FV2A 3LFAA 4XV1A 3RPRA 2VTMA 4BDAA 5LVNA 2G2HA 4M84A 4UYNA 3FLNC 3KCFA 5CASA 3PDTA 4RA4A 2C5XA 3C51A 5ACKA 3N4UA 2XIRA 3R9RA 3E8CA 3FMNA 5I4NA 2UW3A 5HX6A 2HW6A 2VUWA 4C34A 3H3CA 4EC9A 2B54A 4KKHA 4OBOA 3R22A 3NNUA 3UQFA 5F9EA 3D9VA 3GU6A 3ZHPC 3A4OX 2YIYA 5EKOA 4O0YA 4C3RA 5KKRC 3EQFA 4DCAA 3FV8A 5L6OA 3S3IA 3ZSHA 3RAIA 4WSQA 3EQCA 5ACBC 2Q0BA 3DT1A 5J5TA 3NAXA 3ZM9A 2FA2A 4CG9A 4JR3A 2J4ZA 2HXLA 4G3GA 2B1PA 2B55A 1H07A 4AACA 4LFIA 5E1EA 5FGKA 5BUEA 4RLLA 4ALVA 2QU5A 1DI8A 4U9AA 3OWPA 3PWYA 2F4JA 2OFVA 3COHA 3QTZA 5AV3A 4C3FA 4PL5A 1YWNA 4FVPA 1NXKA 4FT5A 4I93A 2YDKA 2QG5A 4BN1A 1P4FA 3QQGA 1OZ1A 3U4UA 2Y6MA 3ZO3A 2C6KA 2Z7LA 5CNNA 4O7WA 1URCA 2WTKB 3SOAA 4X2KA 1W7HA 4PY1A 3SD0A 3WZEA 3QCSA 1UKIA 3R1NA 3BQCA 4EOMA 4O81A 3GI3A 4DEIA 4OAVB 5BYZA 3ZONA 4YZMA 1CKPA 4BR3A 1JKTA 4NW6A 4UV0A 4ZSJA 5CVGA 5HG7A 3DKFA 5IA2A 3QKKA 1U4DA 3QGYA 5I9UA 3DNEA 3AGMA 4KIOA 4IC7A 4HVHA 4EI4A 2HZIA 2YN8A 4FNWA 5K0XA 3UYTA 2XNPA 4L53A 3L8VA 5DRBA 4KIKA 2JKQA 5I9ZA 4WD5A 2R2PA 4DAWA 3EZVA 2NPQA 3PE2A 3ZEWA 3V3VA 5KMJA 2R3IA 2W17A 5KKRB 5C8MA 3RVGA 4FIEA 2E2BA 2C1BA 2A4LA 3PY3A 2VU3A 3RAHA 2PTKA 3WI6A 1OKWA 4WBBB 5E7RA 3ZU7A 3U54A 4DFUA 4OW8A 3V6SA 2XK8A 2VWYA 3FMMA 4U0IA 5JSMA 4QMPA 2FB8A 4DITA 5H2UA 3EN5A 3LFDA 3ZTXA 2X2MA 2WOUA 4PPAA 3ZRKA 4BBMA 5FDPA 2R3HA 4K11A 5AV4A 4BWXA 3DLSA 3RGFA 3H9RA 2ZJWA 5AP0A 4E7WA 4O6LA 5L6WL 4MXOA 5TKDA 1FGKA 4IAAA 4PDYA 2Z7QA 2O5KA 3KKVA 4IC8A 3VW6A 2CGUA 1E1XA 5HTCA 2UW0A 3OEFX 5IG1A 1SM2A 4JBOA 3QZIA 5KE0A 4BIDA 4XH6A 4EK4A 3EKKA 3CD3A 2WU6A 2OKRA 4E20A 3KK9A 2W1CA 3PYYA 2F2UA 5HBEA 2B4SB 3QA8A 1JSVA 5CENA 5M4FA 4DFBA 3O0GA 5T6KA 3OXZA 3BEAA 1XBCA 4NK9A 4B0GA 2H9VA 5CAUA 1VZOA 3HA6A 4O0VA 4CNHA 2JFMA 2XS0A 5CSHA 4BL1A 5E91A 4B8MA 2C69A 3EQBA 5AM6A 3UOKA 2GQSA 4RLKA 4GW8A 4UYAA 4R78A 4WUAA 4YJTA 3DK6A 2PK9A 4IVCA 4RJ5A 3DXQA 4XS2A 4DLIA 4HZSA 3QTUA 5B2KA 4TYEA 5IUIA 3P08A 4B6LA 4MCVA 4QMYA 3CJFA 1H0WA 2WMTA 3WF9A 4YZCA 3NIEA 1OITA 4FTTA 5JT2A 3OWKA 1OPLA 4QP4A 4JQ8A 1NVQA 3R71A 3C0IA 4JBQA 2YCRA 3TZ7A 3ODZX 4U42A 4P7EA 4R3CA 1HCLA 3A4PA 3R1SA 4QYEA 4DG0E 4QQ5A 4IB5A 4DH7A 2GMXA 4PUZA 3IOKA 4V01A 3Q4UA 1H08A 5HO7A 3GC7A 4FEUA 4WG5A 2YJRA 3NUUA 2IO6A 4FKSA 3FKNA 2VGPA 4HGSA 4HVIA 1OUYA 3H0YA 2RF9A 3EZRA 2XA4A 3A99A 3D0EA 5CAVA 2W9ZB 4U7ZA 3NUPA 2X8EA 3CGFA 3FQSA 4FMQA 3D5XA 1W0XC 3VBWA 4BZDA 1YXVA 3A7GA 2PL0A 3OF0A 5FEQA 4N57A 3E7OA 3G51A 5AP2A 4IVDA 3NUXA 4AA4A 2WPAA 3OCSA 4I94A 5EI6A 5HLWA 3Q4CA 3PXRA 3G0EA 2B0QA 3W8LA 1W98A 3C4ZA 2AC3A 5FBOA 2PE1A 3CLYA 3C7QA 3BU6A 4RX9A 4FG9A 3ZLXA 2Q83A 2V7AA 4L44A 4RBLA 3NVMB 3SQQA 1TVOA 2IW8A 3SXFA 2UV2A 4N0SA 1ZY4A 4J8NA 5ITAA 3S0OA 2VN9A 2X39A 4IACA 5CF4A 4BDCA 3KB7A 3QRJA 4L67A 5IQBA 3NRMA 3TG1A 2WQOA 2PVFA 2QC6A 2IVSA 4D2WA 5A4EA 5CALA 5HLPA 4FZAB 1WBNA 1OECA 3COKA 2VAGA 4IFGA 4WKQA 2PVLA 4P4CA 2F7ZE 4F9YA 4FI1A 5HIDA 3WOWA 4MF1A 3TL8A 2JBOA 2O64A 4BCHA 4ZY5A 1I09A 3OS3A 5L2TA 3F9NA 5L8JA 3Q5ZA 3JUHA 5GINE 5K3YA 3EFJA 4GU9A 1AD5A 4ZXTA 1LEWA 1BL6A 3LLTA 4R8QA 3II5A 2C68A 4O7LA 1ZMWA 2FSOX 4FSRA 4MVFA 3I7CA 5E8XA 4FE2A 2WTKC 4BBFA 2WXVA 3ZFYA 4UZHA 1JAMA 3A60A 1H1WA 1FPUA 2PE0A 2VTNA 3DXPA 4QPAA 5HORA 1G8SA 2O8YA 1WFCA 4RIXA 4U6RA 2YAAA 3SLSA 3RZBA 1XQZA 3E3PA 1MP8A 4O82A 2OIBA 3B2WA 3V8SA 1LPUA 3IW7A 4AZEA 4LG4A 2P55A 3V5PA 4QO9A 4DH3A 5A4LA 5BYLA 4FT7A 2OIQA 2XIKA 4GUEA 5M4IA 1AGWA 2GNGA 5E92A 4RWKA 3HNGA 2C1AA 5FXSA 4BWKA 3A7IA 3GU4A 3ZBFA 4E5AX 5HE1A 4ZLZA 4IWOA 4FSYA 4C58A 2XK3A 3PP1A 5M51A 4ITHA 2W5BA 4GU6A 4O86A 2YITA 4JDKA 2BKZA 2BTSA 1YHVA 4I0TA 3V5TA 4BDDA 3FEGA 3A2CA 1J7UA 5ETIA 4BKZA 3HKOA 2WMXA 1W8CA 3GBZA 5KCVA 4GYIA 3QHRA 2VWVA 4WOVA 5AP4A 4G5PA 4IANA 5LVLA 3U4WA 5HG9A 3MFRA 1JSUA 4Y8DA 3VNTA 2Y4IB 4E5BA 3ITZA 1XWSA 3HRFA 4GKIA 4XHKB 2OSCA 3ORMA 2BRMA 5JGDA 1WCCA 4JG8A 4FG7A 4NM0A 5G6VA 3GCSA 3H9OA 4ITIA 1BI7A 4F0FA 4A9YA 3TZ8A 4O7YA 1Z5MA 4RIYA 2C3KA 1OPJA 4N6ZA 2R3FA 3VRYA 5M06A 4QMWA 5A54A 2YIWA 4R3PA 4EOPA 5BNJA 5AUYA 4KA3A 4ACMA 4AA0A 2JKMA 1YXXA 2EVAA 3PRFA 3QWJA 4FUYA 2I40A 1H25A 3EWHA 4HZRA 5HNIX 5DYJA 1PXLA 4R1YA 2P2IA 1GOLA 1GIHA 3D2KA 3QRIA 1DS5A 5AR5A 5IPJA 4EJ7A 1M2RA 4JIKA 3K3IA 2XJ2A 4UXQA 4UWYA 5CX9A 1PXNA 4MX9A 3VJNA 5JMSA 5LARA 1YI3A 3DJ5A 3S95A 1YXTA 1U5QA 1WBPA 2C0OA 3PIXA 4FTUA 5EHOA 3RMFA 3VIDA 4F9AA 5KMNA 5H8BA 5DMZA 3FHIA 2GS7A 3MH0A 1Y6BA 4HCVA 4GFMA 4GG7A 4IEBA 4ZSEA 5B7VA 5LWNA 1GJOA 5DFPA 5AAFA 4DBXA 1E1VA 4BCKA 2J0IA 2EXCX 4DH1A 2OW3A 4NWMA 5FXRA 5GZ9A 2B7AA 5LJJA 4BCOA 5D9HA 5HU9A 5EM7A 5JGBA 4DGMA 4D1SA 3QRTA 2BZKB 3SRVB 3EKNA 2ZV2A 3ORKA 2G15A 3BCEA 3I4BA 3EIDA 1GZNA 4KBCA 3U6JA 4ZTQA 2ITTA 1KSWA 2UZEA 3ORIA 4MBJA 2GNFA 3Q9WA 3FZTA 5D7VA 5E8SA 3FLSA 3F2NA 5BYYA 1APME 3MFTA 4KRDA 4CVAA 1ZOEA 3F5GA 4ENXA 5HVKA 3PPJA 3QUEA 2BDWA 4XV2A 5CNOA 3G15A 5CQUA 5IMEA 3QTXA 3FZ1A 1XH5A 3MA3A 4KRCA 4DINA 3QTQA 2EU9A 1J1BA 4O7TA 1STCE 4GRBA 3FWQA 4WUNA 1PXMA 1CDKA 3G33A 4PF4A 2WZJA 3OROA 2FSLX 3VBTA 5FQDC 3AC3A 3HDMA 3IOPA 3O7LB 3R00A 3TXOA 4ANLA 4MEDA 4F7JA 2Y9QA 3KRLA 3C4WA 3L8SA 4I5MA 4FKGA 4ZS4A 3LXPA 4NIFA 3M11A 3LFQA 1IEPA 4RWIA 2JDRA 5M55A 4L6QA 5HTBA 3FZOA 5L8LA 1KOBA 5DT4A 2BFXA 3R7EA 3OCGA 2W5AA 3IO7A 4G6OA 5KZIA 2UZNA 4MXAA 4WT6A 2C6DA 4ZSLA 2PMLX 4FOBA 1Q97A 4L43A 2WTIA 2W1EA 3ORPA 2QOHA 5LVPA 4BCPA 4CFMA 4MXXA 4F0GA 4YR8A 5LMBA 3LFEA 4C4FA 2UW4A 3FSKA 3KXNA 1X8BA 2CCIA 3QTSA 3MJ2A 5DWRA 1RQQA 2G2FA 4YNEA 2O63A 3H9FA 2YCSA 4EOJA 4G3FA 4C33A 1VYZA 1Y57A 4GMYA 4PDSA 4BCIA 3ORNA 4YTCA 2VO7A 4FEVA 1J91A 3P79A 5GIOE 1QMZA 4GT4A 4EORA 4EQUA 2AYPA 5HIEA 2G2IA 4Z55A 3GCQA 1OMWA 4BGHA 2J50A 4A9SA 1L8TA 3CD8A 5GJGA 3EH9A 3O71A 3PXQA 3R7UA 3MVJA 2X9FA 1OVEA 3LJ1A 4KWPA 3ZS5A 2WEIA 3ACJA 1GY3A 3FUPA 4IB3A 4AXAA 3ZC5A 3ZYAA 5L2IA 1XBBA 3D94A 1SVEA 4F64A 3R8PA 5EQEA 4TYHB 4LM5A 4CYIA 4JXFA 3NR9A 2QNJA 1O9UA 3PY1A 4IZAA 1OB3A 2OZOA 4EH9A 3UVPA 4QMUA 4EH5A 3DFAA 5IA4A 3KF4A 3HMMA 3MFUA 1ZZ2A 4V0GB 3F66A 3BHTA 3U9NA 3DK3A 4N4SA 5DPVA 4BDFA 3LKMA 2ERZE 4BDKA 1J1CA 2G1TA 3KMUA 1W83A 3VBXA 2VX3A 2QQ7A 4WIHA 3T9TA 3POOA 4W8EA 1W82A 2W7XA 3VW8A 4BGQA 2WOTA 5J95A 3HMNA 5J9LA 4BCFA 1REJA 4ZTHA 2QO7A 3WE4A 2QOKA 3DAKA 4J8MA 5M09A 3P7BA 3VS7A 3IS5A 1XH4A 2XJ1A 2JDTA 4PDOA 3KVWA 3VUGA 2YJSA 4C38A 3CKWA 4TW9A 2GHLA 4XCUA 3MIYA 4J53A 3R8MA 4U44A 4E6DA 3QKLA 5J5SA 4D9UA 3AD6A 3UNKA 4I41A 5CSPA 4CKRA 2BROA 2R4BA 3AC8A 2HXQA 3POZA 1R78A 2UZDA 2W06A 5E1SA 4DEEA 2QURA 5DGZA 2H6DA 4RC3A 2XK6A 3SW7A 2RG6A 4GG5A 4ACCA 1RDQE 5CEQA 4PWNA 2QOIA 3FMEA 3TN8A 3EQHA 3ZUVA 1JVPP 1H26A 3DCVA 2VD5A 1VJYA 5CY3A 1PMUA 4O27B 3LZBA 4XJ0A 4UBAA 5DEWA 4DG3E 3CTHA 2R7IA 3ORZA 2Z60A 3SDJA 4BDEA 4EOKA 4KS7A 2UZUE 3O7LD 2VTRA 4WG4A 4KNBA 1JOWB 3DPKA 4K6ZA 1ERKA 4LI5A 1OKYA 4GFOA 3RK5A 3ZC6A 4GK3A 4PMTA 4LMNA 3ZRMA 2R9SA 4RJ4A 4AZFA 5CEOA 2IJMA 5FWKK 4PL4A 3TNHA 2VNYA 4O96A 5M56A 4FTJA 3SVVA 1ZYSA 5DHJA 3TEIA 4CMUA 1URWA 2QO9A 3C0HA 4TT7A 5IU2A 4C0TA 5IEVA 4QMQA 1FBNA 2CDZA 3ZM4A 3QRKA 4ZS0A 1VEBA 3SC1A 4EBWA 4GJ3A 1BX6A 5TOZA 4L7SA 2HY0A 3O50A 3GOKA 4LRKA 3MS9A 4K1BA 4QMOA 3ZZWA 1K9AA 2OH4A 3F7WA 4HGTA 2HAKA 2O3PA 3DZQA 5D7AA 4CFUA 4F9CA 3LMIA 4APCA 2Q0NA 2RFEA 3TUDA 4FEWA 5DRDA 4AGWA 2UW7A 3AOXA 5EYMA 1PW2A 2CSNA 2X4FA 1FOTA 4BCMA 5KZ0A 3TNPC 4OT6A 2PUIA 1NVSA 4IJPA 5BPYA 4F08A 3OHTA 3R9HA 1H27A 3Q9XA 3R6XA 3UOLA 1G5SA 3NNWA 4I6FA 4BCGA 5CF5A 4AGDA 3NMUF 2YWVA 2PHKA 4BDGA 4BB4A 4RVMA 5IH4A 5M57A 4FV6A 3ATTA 3LQ3A 5H3QA 4IAKA 3MVMA 2OF2A 3R7YA 3L9MA 5AA9A 3QKMA 4GVJA 2CKOA 3HLLA 3SXRA 4L42A 4JR7A 3TNIA 2WMWA 3VUMA 2W5HA 3ZOSA 4EQCA 3FZPA 4BGGA 5JFSA 2OIDA 3FMHA 3OUKA 3PFQA 4HW7A 3HMPA 4J1RA 5HG8A 4CD0A 4RIWB 2VWZA 1Q61A 2YIRA 1R3CA 4IB0A 3W2OA 4AZVA 5A4TA 1H0VA 3LE6A 4ZJIA 3VULA 3E62A 2F2CB 1OIYA 2IW6A 3RAWA 4ARKA 4D5HA 1CKJA 4GKHA 2NRYA 4L3LA 5J7BA 3D15A 1KE6A 3KULB 3OT3A 4EUTA 2BILB 3RK9A 5A14A 2JIVA 2Y8OA 3C5UA 3QX2A 3HEGA 4FT9A 5CLPA 4A4XA 4YLLA 3U55A 3GQIA 4AT3A 3RBWA 4I92A 4JT3A 3AC2A 2C5YA 3HV4A 4GT5A 3QTIA 4M97A 4YZBA 2PY3A 1UU7A 3LCSA 3MFSA 3UO6A 4I5HA 4NIFB 3MW1A 4BI2A 2P33A 4I20A 1UWHA 4EWHA 3KCKA 3AMAA 3RAKA 1UV5A 2V22A 3NX8A 5AUVA 4WBOA 1OPKA 5LVOA 1G8AA 3Q9ZA 4E4XA 5DI1A 2X6EA 4F9WA 5H9BA 1UU3A 3PY0A 2QOCA 4GVAA 3EFKA 4HJOA 2OXDA 4MWHA 4XP0A 5ANOA 4IX5A 4C37A 2X6DA 1SVGA 2RL5A 2EB3A 2PZ5A 1VR2A 3BU3A 4NJDA 4OAUC 3GENA 4QD6A 2C6LA 2SRCA 1K3AA 4I6BA 2I6LA 3FJQE 4XG4A 3FL5A 2I7QA 2KTYA 3GU8A 1ZYLA 2PVYA 3Q96A 1DAYA 3G9LX 5EYDA 2VZ6A 3NVKI 3EYHA 3R1YA 4ANSA 3CKXA 2CKPA 4M3QA 5HOAA 2BALA 4UN0C 2EB2A 2VTPA 3MWUA 1KE7A 4AAAA 4E8AA 2ONLA 3MBLA 4YJPA 2PMNX 5T68A 4ASEA 4M15A 4FGRA 5IQGA 3TNQB 4J52A 4F63A 4MD7E 1PYEA 4UX9A 5DLSA 4O7SA 3ZDUA 3E8NA 3ELJA 3EQRA 3K5UA 5EKNA 5LOHA 2YLEA 4IAZA 1OGUA 3LCKA 2WQMA 3PG1A 3Q04A 5CS6A 4DEDA 4FA2A 5AAGA 3V6RA 4C61A 2XBAA 2WMUA 3FY0A 4BKJA 3BHYA 3OBGA 4O2ZA 4E6CA 4GIHA 4C7TA 2PZIA 3EFWA 2UZWE 2ZYBA 3I7BA 1GAGA 4O0RA 3LPBA 3A8WA 3PXZA 3PE1A 4CYJA 4MD9E 3PVWA 4IX3A 4QTEA 3HUCA 4D2VA 3BU5A 3IECA 2XIYA 2ACXA 1DAWA 3R7OA 3UP7A 1IA8A 4DFZE 3FE3A 3D14A 4U81A 4JAJA 3FKLA 3V01A 5FTGA 4C62A 4FIIA 2ZVAA 3QA0A 2UW9A 2IG7A 4ACDA 4FKVA 4W9XA 5FM3A 3BYVA 4Z7HA 3PWDA 3ORLA 4PMMA 4C4EA 5BVNA 3PIYA 4YGAA 2BRBA 4DT8A 3OG7A 2XIXA 2KULA 2R3LA 4M67A 1PKDA 4I6HA 3U9CA 3DK7A 5AP1A 4FKOA 4MYGA 3TCPA 4R6VA 3U8WA 5FUTA 3KQ7A 3L9PA 2UW6A 5F20A 3BELA 3QTRA 3ZFXA 2WIHA 3L8PA 3SKCA 3KXHA 4NT4A 1Q24A 3RP9A 4YSJA 2VWXA 3LM5A 1A06A 3QQKA 4RRVA 1Y6AA 1ND4A 5KMOA 1FINA 2J51A 2OJGA 2IW9A 4CZTA 4E6QA 4E93A 4J97A 3OP5A 4FKRA 4L00A 3IQ7A 2X9EA 4KSPA 3FL4A 4G6NA 4LOQA 5HICA 4BYJA 2WHBA 4QYYA 4D5KA 5DR6A 1OIUA 4MD8E 3NW6A 2JDSA 4IWDA 4IMYA 1RJBA 4ZTLA 3TV6A 2IWIA 3OBJA 3UMWA 5A9UA 5L2WA 4Q5EA 3UQGA 5JK3A 4UMQA 5HD7A 5HHWA 2PVRA 4MNFA 4D4VA 3Q32A 3KRXA 3GU7A 3FKOA 3RPOA 4PDPA 2CJMA 4DHFA 3GCUA 2BRHA 3F6XA 3W2QA 3FHRA 3HDNA 4J7BA 2C3JA 3EQIA 3GCVA 3UE4A 2NP8A 3HX4A 2Y7JA 1CM8A 4QP6A 3TZMA 1YDRE 3WF5A 3E8DA 5FEEA 5AADA 3HAVA 3DA6A 4ALUA 4W4YA 4MNEB 3MY1A 1ZLTA 3LCTA 4LL0A 5CSXA 4CFFA 4WNPA 2VTAA 3QCYA 4IIRA 1R0EA 1ZYJA 2ITQA 4AX8A 4JG6A 4JLCA 4FKTA 3PLSA 2R3KA 2BTRA 3L9NA 5CT0A 4B9DA 2W1IA 3PVUA 4CLIA 2XUUA 2ZV9A 4NCTC 3PXYA 4EEVA 4EBVA 4QP7A 5KBQA 2XNOA 5J79A 3FBVA 3PTGA 4AFJA 2XKCA 4ZTNA 2R3PA 3CPCA 4W4WA 4NH1A 5IQAA 2FSTX 2QOQA 2ZDUA 3LXKA 4IVBA 1OKVA 2YISA 4DEBA 3QWKA 4EOQA 4YJRA 3PA3A 1MRUA 3OWJA 4JDHA 2V0DA 5M4CA 3W33A 4KIKB 4RJ6A 1F5QA 4HYIA 5IEYA 4EHVA 5JN2A 4XBRA 5AV2A 2EWAA 4IB1A 4Z9LA 5HLNA 4RWJA 5ETFA 4H3BA 3OT8A 5EI8A 3MN3A 4TNDA 3S2PA 4YC3A 2VTSA 2VWBA 1F3MC 3B8QA 4FL2A 2PSQA 4RG0A 4S30A 3DBQA 3NUNA 3RKBA 4RVTA 4FX3A 4XP2A 2JITA 4IBMA 5CEIA 4KUJA 4N6YA 4YPSA 2J7TA 4ACGA 5BX0A 4NEUA 4E4NA 5IF1A 1PHKA 3KN5A 4U97A 1LR4A 3UG2A 3E63A 4V05A 4MBLA 5E4HA 3O8UA 3EMGA 3A7FA 3QC4A 3QCXA 5EH0A 4OTGA 4ZOGA 2ZAZA 4BZOA 2G01A 4FV4A 4HVDA 3HA8A 5K9IA 3NW7A 5C9CA 2XNNA 3H4JA 5KBRA 4D28A 4NFMA 4DLJA 4XUFA 3Q4ZA 5ANKA 4E3CA 2YIXA 3PRIA 4EYJA 1ZARA 4U80A 2HWPA 5HZNA 3FLWA 4IAIA 2GTNA 4S31A 2WQNA 3EJ1A 3OZ6A 2Z2WA 4R5SA 5HO8A 5TE0A 2YABA 1PXJA 5I9WA 4A9RA 3KULA 4OTFA 1PF8A 3TNWA 3DZOA 5JRQA 3BYMA 2XEYA 4F1MA 4XG3A 4D9TA 2C5OA 4APPA 2R3JA 3HV5A 3UJGA 4X6RA 1DI9A 2FVDA 4M66A 3VF9A 4BDHA 3KC3A 2BIYA 4F6WA 3FMJA 2BIKB 4GH2A 1Q99A 4YUQA 2YHVA 3DU8A 3E8EA 5ICPA 4WNOA 3TTIA 1YI4A 3VC4A 5I3RA 2FH9A 2PUUA 1M7NA 4IWQA 3LFNA 5L6PA 4ITJA 2ETRA 5DIAA 4EOLA 3UP2A 3MA6A 4IWPA 5ANGA 1WAKA 3GOPA 1KE8A 2CMWA 4AGCA 4ALWA 2XEZA 5EG3A 3VF8A 4DH5A 3DB8A 5FTQA 4AE6A 4I24A 5IKWA 5L8KA 4BFMA 4BRXA 1XHAA 3DV3A 3BI6A 1K2PA 4USFA 5KO1A 3O51A 4W4XA 3AT2A 4E1ZA 4EK6A 3RALA 1YI6A 4YTIA 3QLGA 2X0GA 3MB6A 4HGEA 5EDPA 4RQVA 5A6NA 2HW7A 2UVXA 3W18A 2E9PA 3DJ6A 3FQEA 5B2LA 1NVRA 3OWLA 3R30A 1ATPE 4GUBA 4J71A 3D7TB 4XRLA 3QC9A 4D58A 5CSWA 5H8EA 4YTFA 2NO3A 2OG8A 4FKLA 3R83A 4YJVA 2HENA 5AJQA 2YM3A 4A07A 5IA3A 4M14A 3WZJA 4RJ7A 3DOGA 2CPKE 2W1DA 3SXSA 3SAYA 3UTOA 4YBJA 3ZMMA 5HNBA 4DFYA 4FODA 2BAQA 5AUZA 3PPZA 3VBYA 1JNKA 5HESA 4QRCA 4I22A 4QQCA 1YXUA 4GK4A 5CU6A 5KUPA 4M12A 5J9YA 5EW8A 5M08A 2XNBA 5E8VA 3TJCA 3HMIA 3UOHA 1JKSA 4KINA 3EL7A 3LW0A 4KS8A 3PXKA 2X8DA 4M0YA 3QTWA 3FZRA 3RWPA 1TKIA 3HV3A 3JY0A 4MKCA 4S32A 3DLZA 2XH5A 3TTJA 4BWPA 3P1AA 4PPBA 2REIA 3G2FA 5CZIA 3V04A 1UWJA 4RSSA 2W96B 3GGFA 2YM8A 4FTLA 1OUKA 5CI6A 4RPVA 5K4IA 4EZ7A 4YJQA 4EHZA 2QOBA 5HE3A 3QHWA 2W1HA 3G90X 2JIIA 3OCTA 5HG5A 3SHEA 4IX4A 4KB8A 4TZRA 4GJ2A 3Q2JA 3V51A 4MXCA 2PVNA 4FKQA 3K2LA 3LFCA 5AR7A 5BVOA 3LXNA 5GZAA 3FC2A 4Q9ZA 2OJFE 4P5QA 2BZHB 3HV6A 4FUXA 2YM5A 4F9BA 2GNIA 4XOYA 4HNFA 3MDYA 4AN2A 4FSQA 4LL5A 2OXYA 4NU1A 4QMXA 4IAFA 5F94A 1U59A 4X2NA 1RW8A 4XLVA 3V8WA 2IN6A 3BLHA 4QTDA 1PXPA 3VHEA 5HQ0A 2A0CX 1WBTA 1U54B 4PP7A 4RIOA 2VNWA 3B2TA 3HL7A 3EN9A 1YW2A 4KD1A 4AW5A 4BDIA 4A9UA 4R1VA 2IZRA 3RI1A 2Z8CA 4II5A 5IUHA 1PRYA 4JBVA 3ANQA 3RNIA 3F7ZA 5BVDA 4GS6A 3CEKA 1PMVA 4TPTA 2YEXA 3LVPA 2CCHA 2J5EA 4LV5A 4FEXA 1ZMUA 3CXWA 2VWUA 4ANNA 5I9XA 4BYIA 2UZOA 2X7FA 3Q6UA 4Y83A 2OJ9A 3ULZA 3ZO4A 3R2YA 3HRCA 2X2LA 5H8GA 3P7AA 4EC8A 3QALE 3FI8A 4RFYA 5IH5A 2Z7RA 1ZRZA 4F09A 3EQDA 4TYHA 3ZLYA 1DM2A 1H24A 2QVSE 2UUEA 4LUEA 3EFLA 4BCQA 1BL7A 3PA4A 5EDRA 3E87A 3U6HA 4O7RA 5HNGA 2YCFA 5IZFA 4V0GA 5DBXA 2WTCA 4FZDB 3ODYX 4H05A 4NZWB 3TKHA 3IW6A 3R04A 3AT4A 5C4LA 3BHUA 3FMLA 4IZ7A 4K0YA 4QYFA 3OOGA 4TTHB 2J0KA 4TWCA 4BHNA 4RX8A 1JLUE 5JH6A 2FUMA 3ZXTA 5M4UA 1ZYCA 1YDSE 3BEGA 3I6UA 4L52A 3M2WA 4PTGA 4X7QA 2WMQA 5AEPA 4RX5A 1FMOE 2GU8A 2QOOA 5CZHA 4JVGA 3ZFMA 3OUNB 2C5NA 5CU2A 1BI8A 5DOSA 2CGVA 3FXZA 3D5VA 3GT8A 4YZNA 3KVXA 2HK5A 4L45A 1GZ8A 1A9UA 4Q2AA 3QD0A 4QPMA 3QXPA 1P4OA 3MGYA 5K5NA 2C0TA 4S2ZA 4CFXA 4CMTA 4FTRA 4NKAA 4YC8A 3LMHA 4O0WA 3BKBA 1OL5A 3CQWA 3AC1A 3Q52A 4O6EA 5D12A 4PNKA 1IAHA 2GTMA 3NYOA 3ALNA 4PL3A 4QP8A 1KE5A 3GC0A 2A27A 4QP1A 4W8DA 3BLQA 1I44A 3D4QA 1TQMA 4KABA 3BV3A 1EH4A 4QYGA 3KRRA 4ZLOA 3UMXA
chains in the Genus database with same CATH superfamily
3KF7A 3TUCA 3BHHA 5AR8A 5HE0A 4A4OA 3PFYA 2WTWA 2XVDA 3AC5A 2HOGA 3R01A 4C2WA 4H36A 4CXAA 4IHPA 4DBNA 3JR1A 3KFAA 3VS5A 3KREA 3VAPA 3FI3A 1WBOA 1PKGA 5C1QB 2C5VA 4PMSA 3R8ZA 2PVKA 1XH7A 5HO6A 3QYZA 3RHKA 3BE9A 2XM8A 5ETCA 4E4MA 5IDNA 3TKUA 4FTQA 3F3WA 3O17A 1YOJA 5LMKA 4BICA 4L8MA 5FLFA 3F3VA 4G3CA 2J0MB 1WVXA 2WB8A 2CKQA 3Q6WA 3EOCA 4C8BA 3I81A 3CE3A 5LMAA 2BHHA 4AT4A 4DTAA 4JNWA 5CVFA 3FXWA 3LHJA 2CN8A 3QLFA 2V5QA 4TYJA 3CY2A 4FK6A 4R7BA 1TFFA 3THBA 4JL9A 5K0KA 2BZIB 3HMOA 2B9FA 2R3GA 1YHSA 4EK8A 4FNYA 5GHVA 2OF4A 3LJ2A 2F7XE 2JLDA 1OI9A 4XG8A 3QCQA 4U40A 2YM4A 2WNTA 2Z7SA 3GB2A 3GNIB 4WHZA 5D41A 3UZTA 5HBHA 4PNIA 4TNBA 4RZVA 1XH9A 2PZRA 3RM6A 4GFGA 4C4IA 2BAKA 1WVYA 3V5LA 3VS1A 2OFUA 4QQTA 4ACHA 3IK3A 2LGCA 3PJCA 2BKKA 2CLXA 4Y5HA 1OL1A 4IM3A 4XG6A 3QZFA 4HYUA 4CZUA 4BY9E 1P14A 3DBFA 4BI0A 2BDJA 3TKIA 3DDQA 2BDFA 4PP9A 1M2PA 4YNOA 5CU0A 1TQIA 3H30A 5JFWA 5JZNA 3QD4A 1T45A 2W4JA 4QP9A 5ANDA 1XMLA 4I21A 4F70A 3I5ZA 3NW5A 4PX6A 2ZM4A 2PPQA 4Y46A 1Q3WA 2WIPA 3GUBA 1VYWA 2OK1A 2IVTA 3IG7A 3OEZA 3V8TA 5HKMA 4YURA 5HX8A 1H8FA 2ZOQA 3G6HA 3UVRA 4FSTA 1Z57A 1F0QA 4RJ8A 5EYCA 1SZMA 5LVMA 2IZUA 4FICA 4O84A 1G8JA 2J5FA 2ZM1A 3ZH8A 1V0OA 2XP2A 3A8XA 4Y73A 3DXNA 4LUDA 4Q5HA 3ET7A 3RCJA 3W2CA 1JWHA 1YOLA 3LOKA 4O0UA 3KMMA 4DFNA 3KU2A 4IX6A 3BWFA 1BUHA 2R3MA 3GFWA 3HYHA 3P86A 4UXLA 5G1XA 3TJDA 3U87A 4O7VA 1NA7A 1UKHA 4UWBA 4BC6A 2R3QA 2VX0A 3DBDA 4C57A 4QMNA 5JFXA 4CG8A 3RHXA 5DE2A 4K77A 4OR5A 3ENMA 3MI9A 3MJ1A 4UEUA 4F6UA 4X21A 5BUIA 3EQGA 4O7NA 3SGCA 4P90A 4S33A 3KEXA 3BIZA 2V7OA 4Z7GA 5LXMA 1QCFA 3DS6A 3W32A 5CF6A 4I5CA 2XYUA 3HP5A 2PUPA 2H96A 1Q8TA 5AV0A 3QQHA 3OFMA 1J3HA 1Q3DA 4PMPA 2GFSA 2C0IA 3IPHA 3VQHA 2BPMA 4CMOA 3CGOA 3ZLWA 4OTIA 5AIKA 3E64A 4FTOA 3BGZA 2PYWA 4OTWA 1GIJA 1U5RA 1YVJA 3QAME 4OLIA 4YLKA 4QTAA 2BUJA 3HGKA 4FVRA 3D7ZA 3GVUA 1M52A 5IMXA 2B53A 3TV4A 5I9YA 4DF3A 2EXEA 4FIHA 3D2IA 4GIIA 2BVAA 3R02A 3ZXZA 2RKUA 3NYVA 3UVQA 4XG2A 3DGKA 4UMPA 5IQIA 2HZ4A 1UNGA 3C4XA 4R3RA 2GHGA 2JD5A 4DFLA 3QL8A 3UC3A 3UNZA 5CWZA 1E9HA 4FSNA 3LMGA 3WBLA 2VTTA 2X2KA 3QGWA 4C36A 4G6LA 2UVYA 2ETKA 1Q62A 5F1ZA 3LAUA 3UDBA 3O8PA 5I0BA 1P2AA 3RK7A 2BCJA 4G31A 4KIQA 3BBTB 4TYIA 3QXOA 4G17A 3NFFB 2E9VA 1PXOA 1H00A 2OJJA 2XBJA 5E8TA 5AR3A 2F49A 3R63A 2X1NA 5KHWA 1KUTA 4RT7A 4TY1A 4F7NA 3NPCA 4FZ7A 5DA3A 3TMOA 4CTBA 3CR0A 2XK9A 2Y0AA 4O2PA 1ZY5A 4EQMA 3QF9A 3G0FA 2YFXA 4NJ3A 3VVHA 3WIGA 3L1SA 1H1QA 3HV7A 4M7IA 2WTVA 4D4SA 2WQEA 2X7GA 2I1MA 4K2RA 3REPA 2YLFA 4YLJA 4FKJA 3PSCA 4HYHA 1PJKA 4MTAA 5AWMA 3UO5A 5IQCA 2QCSA 3QD3A 4O1OA 2WO6A 4Y5QA 2JIUA 3VHKA 5GIPE 3ID6C 4XV9A 3NCZA 5C03A 4DTBA 2VTIA 5J1WA 3OY3A 5BVKA 4D1ZA 1ZWSA 4EOSA 3W0QA 4XYFA 1YKRA 2J2IB 4USDA 3QQJA 2GQRA 4ZZNA 5AP3A 4DT9A 4FOCA 5KNJA 3TDWA 4HGLA 3GCPA 3H0ZA 5DNRA 4RIYB 3R9NA 3JS2A 4ZP5A 2XJ0A 4QNAA 2QOLA 3DB6A 4LMUA 3W1FA 3O96A 3EL8A 3MH3A 4LYNA 2OICA 4RFZA 3NNXA 3FDNA 3ULIA 2E9UA 3ZBXA 2OZAB 1Q8YA 2WEVA 3BX5A 3HECA 1IR3A 2VTQA 2QKRA 1XO2B 3BBWA 3Q3BA 3EB0A 3AC4A 4FTIA 4D2SA 3CTQA 4AW0A 2W0JA 1MUOA 1SNXA 3VS6A 4QMTA 2XM9A 3R2BA 2ZMCA 2WMBA 4RIXB 3FLZA 2BHEA 3QYWA 1FQ1B 2Y4IC 4NCTA 5DVRA 3ACKA 4EJNA 4I4FA 3PVGA 1WVWA 3JXWA 2X8IA 3MVHA 4PRJA 4EWQA 4KKEA 3PP0A 4GEOA 1YXSA 1CMKE 1OBDA 4YSMA 2OXXA 5AR4A 3C1XA 2R0UA 3R0TA 1WBVA 4BF2A 4EH7A 4ZSAA 3RPSA 4DE4A 2ONLC 2WELA 4U8ZA 2W1GA 4U79A 1KV2A 2QLUA 2ITZA 3OTVA 4H3PA 3QD2B 2O65A 4MQ1A 1FGIA 1FVRA 2HY81 3DQWA 2JKKA 3P23A 4JDJA 1GZKA 2XZSA 5AV1A 4WNKA 4YP8A 4RJ3A 3SRVA 3RWQA 4FSMA 3BWJA 1H1PA 4BIEA 5EQYA 3NEWA 4FG8A 4K9YA 4S34A 3KXMA 3DAJA 3ENHA 3SG8A 5AR2A 4C4JA 1PXIA 4YMJA 4JS8A 4O38A 1BYGA 4DEGA 3COIA 2GFCA 3VUHA 2QKWB 1H28A 1WBWA 2CN5A 4O0SA 5DN3A 2W1FA 4M68A 4IE9A 4G9CA 4KIPA 2GPHA 1MQ4A 3OXTA 2RIOA 2ZMDA 4ONAA 4WO5A 2ITPA 1Q8ZA 3TIYA 2PUNA 4I4EA 1CSNA 2HZ0A 4IFCA 4AW2A 2WMVA 3DQXA 5C01A 3RPVA 4Z3VA 2GS6A 3C50A 4FGBA 4DA5A 5EOLA 4L9IA 2C3IB 3JYAA 4FL3A 3E92A 5C8NA 4IADA 4QQJA 4MHAA 3BE2A 1WBSA 5EK7A 4CFNA 4ZMFA 2OBJA 3WYXA 3WZUA 1BLXA 4PV0A 4BCJA 4WG3A 3P7CA 4XG9A 4FV9A 2CLQA 3EHAA 2CGXA 2ETMA 2YACA 5HCYA 2G9XA 4ANBA 4AN9A 4UY9A 3SG9A 3VS3A 3UO4A 3RTPA 3KL8A 2W4KA 2OI4X 2FO0A 4G3DA 4WRSA 4BBEA 2PULA 3WZDA 4EL9A 4YHTA 3DKCA 3DNDA 4IM0A 5L2QA 1AQ1A 3SX9A 2QHMA 4O91A 3K54A 2IEWA 3CBLA 2IVUA 4CFVA 4AN3A 5I5ZA 2V55A 3Q2MA 4G1WA 4FBXA 2W9FB 4RFMA 4TL0A 3KGAA 4RWLA 3ZSIA 4Q9SA 1Y8YA 4FTKA 4OBQA 4YZ9A 3TIZA 4J98A 4B7TA 4XP3A 2CNQA 2PWLA 4CKIA 2VWWA 4EOOA 2ITWA 2OJIA 2XRUA 3I1AA 3TT0A 3NUAA 5FP5A 4GCJA 3PIZA 2VTOA 4H3QA 4FTNA 3UPZA 4M8TA 4X3FB 2VTHA 3M1SA 5A46A 2RGPA 3COMA 4O4BB 5M44A 5J1VA 3BGPA 5E90A 3BQRA 2ITNA 2P2HA 4H1JA 4CRSA 3AXWA 1JBPE 3OMVA 3F2AA 4R5YA 1R0PA 4K18A 3WARA 4FVQA 2RFSA 4NL0A 2CGWA 5C26A 4FIJA 4MK0A 5IA0A 3TM0A 2QONA 3FI4A 3UPXA 4J96A 4ZSGA 4IVAA 5E8UA 1V0PA 2C6TA 3QQLA 4AA5A 4JRVA 1UU9A 5HBJA 3NNVA 5AX3A 5HVYA 4UZDA 4E73A 2GS2A 4NW5A 5I3OA 4R7HA 5DR9A 4EYMA 4D2TA 3FQHA 1MRYA 5GJFA 2GHMA 1IA9A 3DAEA 2YM7A 5EM5A 4DYMA 2I0HA 2JDOA 3DY7A 4U3YA 4TWPA 3GXLA 4JI9A 1B39A 2YZLA 5EOBA 3RCDA 4A06A 3PJ1A 1XJDA 2JAMA 3VUDA 2O2UA 3N4VA 3LQ5A 4AT5A 4EZ3A 4OTDA 5AP7A 1ZMVA 5AUXA 4C4HA 2JKOA 3AD5A 4FEQA 4GT3A 2VRXA 5GNKA 4XG7A 5AX9A 3I5NA 4NTTA 1ZAOA 2H34A 4QNYA 4RVKA 1TQPA 3TUBA 1QPCA 1J7IA 1SVHA 3CQEA 1GIIA 3C4CA 3QRUA 4QYHA 1CKIA 1ZZLA 3V5JA 4H58A 3ZUTA 4CV9A 4F7LA 4FK3A 4QDVA 2YZAA 3IDCA 5KX8A 2P3GX 2XCHA 4ANOA 3C13A 4GSBA 4EONA 3BYOA 5CI7A 4ZMEA 4FSUA 3PJ3A 4FV5A 5JEBA 3FYJX 3FY2A 3MYGA 4MXZA 5EFQA 4LV8A 4B4LA 3LFFA 1S9IA 3P5KA 3LM0A 4IDVA 4FZ6A 4BVUA 3W8QA 4DCEA 1IG1A 4IM2A 1XKKA 2VO6A 4I0RA 4IW0A 4TN6A 3JVSA 5TF9A 4AGUA 1SMHA 2XNMA 4OTQA 4ZZOA 2EXMA 3TDVA 5KMKA 5IQHA 4AFEA 4AU8A 4G2FA 2VX1A 5M53A 2AC5A 2RSVA 4F1OA 1XH6A 5BVEA 3MIAA 1YOMA 3UG1A 2PZYA 3TWJA 3EN6A 3E5AA 3NYNA 2RG5A 4QMZA 1Y91A 4DDGA 2C3LA 5HVJA 4F7SA 1MQBA 1LP4A 2I0EA 2IZSA 3LXLA 4IDTA 4X3JA 5EW3A 3HAMA 3I6WA 3IDPA 4CLJA 3IW8A 4WNMA 3JY9A 2H8HA 1OKZA 3CJGA 4EOIA 3FMDA 4FV0A 3WIKA 5AP5A 3FXXA 5EHYA 5LQFA 3B8RA 4ANQA 5E8YA 1T46A 4QTBA 5FXQA 4NFNA 1Q8UA 2B9JA 2WQBA 2YDJA 3I60A 4FNXA 4YJOA 5F95A 5JRSA 4FIGA 5TR6A 2WTDA 4TXCA 4YJNA 1NT2A 4MAOA 5CF8A 1O6KA 4UALA 3RPYA 2C6IA 4DGGA 2JEDA 3O23A 3VN9A 3PJ8A 4XBUA 3VRZA 2UZTA 4FKIA 4HNIA 4N70A 2J9MA 4X2JA 2ITOA 5E9EA 1IAJA 3G9NA 4X6QC 4XEYA 3WF7A 5AFVA 5CT7A 4BDJA 4ZZMA 2HZNA 1PMEA 5EYKA 1FVVA 2XMYA 3WILA 1UA2A 4F78A 2F9GA 4BI1A 3CSVA 4FTMA 4C02A 3IGOA 2VO0A 4BKYA 4QPSA 2BR1A 2XYNA 4HOKA 2X4ZA 4RZWA 2R64A 4NM5A 3R9DA 2B9IA 1RE8A 1UU8A 3A62A 5CSVA 4JRNA 3S00A 3ANRA 3BPRA 4YHJA 5DT0A 4W4VA 2QHNA 3ZO2A 1U46A 4H39A 3VUTA 4LOPA 1R39A 2JGZA 5B0XA 3U51A 5A4CA 3ML1A 4L7FA 4QTCA 1GNGA 4KSQA 3NDMA 5A6OA 3OXIA 4XOZA 1UVRA 1SYKA 3JPVA 5HGIA 2ITYA 4CFWA 3FMKA 4HVGA 3S1HA 1V0BA 4NKSA 4PTCA 2HYYA 3M42A 2GSFA 4BTMA 3UGCA 3CC6A 3UQCA 4L3PA 4WA9A 2GNJA 3QFVA 4C59A 3U6IA 3DFCB 3C4EA 3W16A 5HEZA 4O0TA 5BVWA 3T3UA 3E3BX 2IVVA 3TYKA 3LLAA 4M0ZA 2ZM3A 3AG9A 4P2KA 1OM1A 4YO6A 3VQUA 3VUIA 2RFDA 5EW9A 3C9WA 2C6EA 3QU0A 4OTPA 3QQUA 5BUJA 1SNUA 3DKOA 3ERKA 4YJUA 3P4KA 4ID7A 3BRBA 3MSSA 4FKWA 1M2QA 2WD1A 4EK3A 2QLQA 2WGJA 2PMIA 3FAAA 3MY0A 4FZFB 4UB7A 4OTHA 2BFYA 4O1PA 3A61A 3R7IA 4CQGA 4DG2E 4EUUA 1IASA 2ZV7A 5HE2A 4LGDA 4OUCA 4B99A 3NUYA 4AG8A 5AUWA 4RC2A 3GFEA 4ZY6A 5HD4A 4Y72A 5T3QA 3Q53A 5D10A 3VS4A 1B6CB 3S4QA 2VO3A 4DH8A 5IA1A 4CCBA 3P9JA 4AP7A 1YRPA 1R1WA 1G3NA 4M13A 1JPAA 1KV1A 3DTWA 3F82A 3F88A 4BCNA 5GZ8A 5CXHA 1NW1A 2BRGA 3MESA 2WKMA 3F3TA 3I0OA 5EM8A 5AP6A 3MPMA 3QUPA 4HYSA 2PVJA 4RIWA 4FT0A 3T9IA 4RA5A 1REKA 3K5VA 2J0LA 4KBAA 3R21A 4BTJA 3EYGA 5L2SA 2HCKA 3PSDA 4G34A 1M17A 4D55A 4TWNA 1LEZA 3QBNA 4DHZA 2B9HA 4DGOA 2WFYA 3N4TA 4PPCA 5EDQA 3BLAA 4B8LA 4BDBA 5CEPA 3A7HA 4I3ZA 5AIRA 3NSZA 3VBQA 1QPDA 3PZEA 4C2VA 1ZOHA 4JQEA 3R7VA 4CCUA 5IDPA 3UIUA 1Z9XA 2QD9A 3DBCA 2YA9A 4F65A 3P0MA 4QMVA 5ANIA 2GQGA 3LCDA 3LFSA 3LJ0A 3EN4A 2AQXA 4AE9A 4BZNA 5BVFA 3KXXA 3ALOA 4MBIA 4DEHA 3OY1A 1XR1A 4HPUE 3C5IA 2R3RA 3BV2A 5CXZA 5L3AA 3Q9YA 5ANEA 5FD2A 3O2MA 5CQWA 4CQEA 4D1XA 4I1ZA 4DGLC 5CAOA 2C6OA 2VV9A 3AMYA 4XNEA 4NSTA 4LGGA 3PG3A 4E4LA 1FVTA 4MXYA 5D1JA 4U45A 2E9OA 4WSYA 3WYYA 3NUSA 3AGLA 3EN7A 3ZUUA 4BTKA 4AW1A 3D5WA 3WF6A 5CEMA 3DDPA 1U54A 4FIFA 4RX7A 5FG8A 4CRLA 5CYIA 1XBAA 2OGVA 4O21A 4F4PA 4EH8A 2PZPA 1Q8WA 3OVVA 4YU2A 3C0GA 4I23A 5KMMA 2BAJA 4L3JA 4ZJVA 3PZHA 3E88A 3EQPA 4Y85A 4O7ZA 5EM6A 2A98A 1OIQA 4LQMA 4AXEA 5HCXA 5KMIA 3PPKA 4U41A 2XKDA 1YWRA 3MH1A 4LRMA 2BRNA 2PVMA 3OC1A 3MPAA 4CT1A 5A4QA 4O4DA 3OW3A 1OIRA 2GCDA 3MPTA 3UYSA 4HVSA 2XF0A 2X7OA 3NLBA 3BLRA 4WRGA 3KRJA 4AZTA 3VS0A 2Y6OA 3MB7A 4NUSA 4ANMA 5IH6A 3BHVA 4NM7A 3T3VA 4NYEA 4EH2A 4O83A 4R77A 2PU8A 1M14A 3V5QA 3FPMA 4D2PA 3W2SA 3QQFA 3VWAA 3W2PA 3ZZEA 3FYKX 4ZTRA 2O0UA 3KN6A 3AQVA 4HCTA 3R8LA 1UNHA 4F0IA 3BYUA 4FV3A 4RGJA 5TT7A 2R3NA 5AAEA 5IQDA 3LIJA 4C3PA 4FR4A 5JKGA 5CTPA 2XNGA 5ETAA 3ZRLA 3BZ3A 1P5EA 3H10A 3R73A 4IH8A 3SV0A 4DGNA 1XMMA 4EKLA 2XK4A 3F61A 4KBKA 2CNUA 2C4GA 1H4LA 2Y4PA 4G16A 2DQ7X 2XKEA 4JAIA 3W55A 3CTJA 3HVCA 4AOTA 4O22A 1H1RA 3ZEPA 4QP3A 2GDOA 2JC6A 2HWOA 4CZYB 3FLQA 3D83A 4EZ5A 2BZJA 3ORXA 4ZTSA 4D0XA 4UMRA 3NYXA 4QT1A 4G9RA 5K4JA 2C6MA 2FYSA 4UMUA 5DG5A 4YZDA 4QMLA 3WE8A 3FSFA 3IW5A 3NS9A 3C4FA 5HU3A 3DTCA 2V62A 2DWBA 5C4KA 1OL6A 3PSBA 5FP6A 4ZTMA 2XANA 5CAPA 5IISA 2QG7A 3ZO1A 5LCKA 1OGYA 2J90A 4FTCA 3T8OA 3TZ9A 4F6SA 1YDTE 2XNEA 3RINA 4BIBA 1ZYDA 3DBEA 4QMSA 2QR8A 4X2FA 4AS0A 4EH6A 4CTCA 3F5UA 4HCUA 4K33A 3TI1A 2A2AA 5AUUA 4LRJA 4E5WA 2P0CA 4XLIA 1Y8GA 3KA0A 3TACA 3OTUA 4JX3A 3R8UA 3CPBA 3OD6X 3WF8A 3UZRA 5ANJA 4FSZA 3N9XA 5BMSA 2WU7A 3QUDA 4JMQA 4X2GA 4KKGA 3CIKA 4OBPA 4CSVA 3BGQA 4FV8A 5DEYA 3BL9A 3KRWA 3NGAA 2AUHA 4FL1A 1QL6A 2VTLA 2QODA 4L01A 4JQ7A 4BTFA 3E7VA 5EHLA 4AZSA 4JBPA 1ZOGA 5BQ0A 1G8KA 2VTJA 4FYNA 5C27A 4C4GA 3MY5A 4Y95A 4E6AA 5IA5A 3UDTA 1H01A 3NAYA 2CKEA 3BYSA 1Q41A 2YM6A 2W05A 4I0SA 4FC0A 5HIBA 5K5XA 3GU5A 3CS9A 4OT5A 3IGGA 4XRJA 3ZDIA 4ENYA 1JKKA 3PLAE 2LAVA 3MV5A 2R0IA 1UNLA 4IZYA 4L46A 4MH7A 1V1KA 3MVLA 5AA8A 4FT3A 1W84A 4EHGA 3P78A 3UIBA 5KHXA 2F7EE 1A48A 1O6YA 4FTAA 5TO8A 4UWCA 4NM3A 1JQHA 3Q5IA 2A19B 1B38A 5DT3A 2C30A 4LOOA 3ZSGA 1Q4LA 1BKXA 3LCOA 4AQCA 4GK2A 3PJ2A 2ZDTA 5FBNC 2YAKA 5I9VA 3R1QA 5A3XA 3SOCA 3ROYA 4A9TA 4HPTE 2YIQA 4IXPA 3KMWA 1OL2A 4PQNA 4GYGA 3IONA 1QPEA 2UZBA 3AD4A 3WZKA 4M69A 4ERWA 3R7GA 5IEXA 2PE2A 3R8VA 4RQKA 5CU3A 3UODA 3UIMA 3F3UA 2PVHA 3IW4A 2ITUA 2UZVA 2XKFA 4L68A 5IQEA 2I0YA 3A7JA 4EK5A 2CNVA 4JIAA 1JSTA 2F57A 2R5TA 3E93A 4FYOA 5EI2A 5C8KA 2XRWA 3MH2A 4QMMA 2QO2A 3Q60A 3TV7A 2W4OA 4MNEA 3CY3A 2YWPA 1OL7A 4YJSA 1S9JA 2WMRA 1OBGA 2ITVA 3KY2A 4FV1A 1GZOA 3NIZA 5JGAA 4TWOA 1IRKA 1H1SA 2W1ZA 3SW4A 4P5ZA 4AOJA 4Z16A 3DKGA 3ATSA 2QI8A 1XH8A 4IZ5A 1PXKA 2J6MA 4DFXE 2BMCA 4ZK5A 3F5XA 2HIWA 5HI2A 1HCKA 3OOMA 3ROCA 5E8WA 3ZLSA 5B2MA 2UW5A 4EKKA 3JVRA 4AWIA 1PY5A 4XV3A 3VS2A 1WMKA 3RZFA 3GQLA 2YDIA 4JG7A 3QZHA 2DYLA 3UZPA 4X3FC 5IQFA 1MRVA 5CEKA 2CHLA 1PYXA 4ERKA 2DS1A 4CGAA 4QOXA 4RVLA 3ORTA 2XB7A 3F69A 3I79A 3MTLA 4F99A 3F2RA 4QEBA 1QPJA 5CVHA 3SA0A 4KAOA 4BHZA 5FRIA 4D4YA 3CCNA 4TRLA 2VWIA 4CV8A 2OLCA 4QP2A 4RMZA 3VUKA 2OZAA 4O0XA 4D2RA 3CQUA 4DN5A 3KXZA 1FMKA 3NWWA 2NNWB 3VJOA 4ORKA 2XCKA 5E8ZA 4UMTA 5J8IA 2RFNA 3HUBA 2NRUA 3GEQA 5DR2A 4XX9A 4MWIA 4DEAA 2Z02A 4IJ9A 5JFVA 2W99B 3FC1X 4FSWA 5J87A 4ASZA 2XK7A 3R28A 3FZSA 3N51A 4I6QA 2WTJA 3V5WA 5HTIA 2YCQA 4X0MA 4X3FA 2ZB0A 2R3OA 4W9WA 4ZAUA 5EQPA 5M07A 5DH3A 5KMLA 5CAQA 4C35A 4FF8A 2JFLA 3KXGA 4MQ2A 1Q5KA 3G5DA 4O4CA 1W2FA 3UOJA 2OWBA 2OO8X 4AZWA 4USEA 5JQ5A 2E9NA 4DC2A 4F1TA 3FPQA 3G6GA 3UIXA 3K3JA 4YBKA 1L3RE 3RJCA 5LWMA 5AMNA 2JDVA 4G5JA 4YTHA 4A4LA 3Q4TA 2C47A 3IKAA 3OW4A 3PA5A 3I0QA 4V04A 5CANA 3CP9A 2OH0E 3ZCLA 1PMNA 4JJRA 4U43A 4CEGA 2AEGA 3L9LA 3HP2A 4YPDA 2WMSA 2IZTA 3FI2A 3GC9A 3GP0A 4GV1A 4U3ZA 5IUGA 4ZLYA 1HOWA 4A7CA 2EUFB 5FEDA 4EHEA 4EH3A 2R7BA 5FM2A 4R7IA 1YQJA 4GL9A 3F5PA 3IDBA 5FTOA 3UNJA 3F3ZA 4TYGA 4YHFA 1NY3A 1JKLA 1KWPA 1LUFA 2UVZA 3UBDA 5AM7A 3VBVA 4EH4A 3O8TA 3PVBA 4JX7A 3VO3A 4AF3A 1KOAA 2DUVA 5FDXA 2GNHA 2UW8A 3D5UA 4JOAA 2FSMX 2QOFA 4YC6A 4ZEGA 4ASDA 1J7LA 3HZTA 4OTRA 4PTEA 3D7TA 2WAJA 4FKPA 3W2RA 2ESMA 4IQ6A 3UC4A 3OCBA 4TKSA 1BMKA 4LGHA 1KE9A 5LCJA 1WZYA 3W0OA 2QU6A 4IAYA 3R9OA 3PUPA 4G3EA 5GJDA 1CTPE 2IPXA 3LFBA 2A1AB 2GNLA 3RM7A 4M69B 3MTFA 5AUTA 4ASXA 2X0PA 3PXFA 2YERA 3QX4A 4MF0A 5JZJA 4E26A 2UZLA 4FV7A 4J95A 4NTSA 1M7QA 2X81A 4AXCA 4H1MA 1YWVA 3NZ0A 2OU7A 4D0WA 5JQ8A 4FKUA 4CT2A 5J9ZA 4AUAA 4I5PA 3FLYA 2ERKA 2JAVA 5CU4A 3AT3A 3AMBA 2B52A 2J0JA 5L4QA 2HELA 4ZIMA 4ZJJA 4AOIA 2XAOA 2QR7A 3HRBA 3NCGA 5D11A 4XMOA 2XIZA 3GC8A 3QZGA 4CKJA 3ETAA 3L8XA 4DTKA 4RC4A 1O6LA 2ZB1A 3W10A 2P4IA 3RNYA 2PMOX 2ITXA 5F4NA 2VGOA 2FGIA 2WMAA 1YHWA 3DJ7A 4J99A 4U5JA 3LQ8A 5J7HA 2I0VA 3KK8A 4D4RA 5HCZA 4YO4A 5BMMA 4ZY4A 4K8AA 1TZDA 5LMKC 4OGRA 1ZXEA 2JBPA 4FNZA 4JDIA 2ZV8A 4FV2A 3LFAA 4XV1A 3RPRA 2VTMA 4BDAA 5LVNA 2G2HA 4M84A 4UYNA 3FLNC 3KCFA 5CASA 3PDTA 4RA4A 2C5XA 3C51A 5ACKA 3N4UA 2XIRA 3R9RA 3E8CA 3FMNA 5I4NA 2UW3A 5HX6A 2HW6A 2VUWA 4C34A 3H3CA 4EC9A 2B54A 4KKHA 4OBOA 3R22A 3NNUA 3UQFA 5F9EA 3D9VA 3GU6A 3ZHPC 3A4OX 2YIYA 5EKOA 4O0YA 4C3RA 5KKRC 3EQFA 4DCAA 3FV8A 5L6OA 3S3IA 3ZSHA 4O4FA 4WSQA 3RAIA 3EQCA 5ACBC 2Q0BA 3DT1A 5J5TA 3NAXA 3ZM9A 2XAMA 2FA2A 2X0QA 4CG9A 4JR3A 2J4ZA 2HXLA 4G3GA 2B1PA 2B55A 1H07A 4AACA 4LFIA 5E1EA 5FGKA 5BUEA 4RLLA 4ALVA 2QU5A 1DI8A 4U9AA 3OWPA 3PWYA 2F4JA 2OFVA 3COHA 3QTZA 5AV3A 4C3FA 4PL5A 1YWNA 4FVPA 1NXKA 4FT5A 4I93A 2YDKA 2QG5A 4BN1A 1P4FA 3QQGA 1OZ1A 3U4UA 1ST0A 2Y6MA 3ZO3A 2C6KA 2Z7LA 5CNNA 4O7WA 1URCA 2WTKB 3SOAA 4X2KA 1W7HA 4PY1A 3SD0A 3WZEA 3QCSA 1UKIA 3R1NA 3BQCA 4EOMA 4O81A 3GI3A 4DEIA 4OAVB 5BYZA 3ZONA 4YZMA 1CKPA 4BR3