4WBBB

Single turnover autophosphorylation cycle of the pka riib holoenzyme
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase type II-beta regulatory subuni
publication title Single Turnover Autophosphorylation Cycle of the PKA RII beta Holoenzyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 99
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2014-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4wbbB01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4wbbB02
1YI3A 3R1QA 4RIXB 5HE3A 5M09A 2PVNA 3EKKA 4G1WA 4M97A 3H9FA 3CD3A 2OXDA 2W17A 3LMGA 5A4EA 5K0XA 4O7YA 3GQIA 4QP9A 5HGIA 3U9CA 5AJQA 1BLXA 1J91A 3OP5A 4TNDA 5HICA 2W1GA 4DH1A 2OH0E 5CLPA 5B2MA 4A9UA 4LGDA 3W2QA 3P08A 2C0TA 4FV0A 4O0SA 3BZ3A 5TE0A 4AU8A 3ZSGA 4NKSA 4EOOA 5JZJA 2Z7RA 1H27A 4M14A 1E1VA 4F7JA 2X6DA 3VW6A 3F3VA 1U59A 4GRBA 3FHIA 3AOXA 2ITXA 4Y83A 4E20A 4EOLA 3DDPA 4UMUA 3HV3A 3KCKA 1JKLA 3A60A 4YBJA 3FXZA 3VHEA 5AP5A 2X7OA 4LOOA 4DINA 2YA9A 2BZIB 4A9YA 4AZTA 2R3PA 5AV3A 3POOA 4Y72A 2QODA 2R3RA 4QYYA 3GCUA 3N51A 3BEGA 2ZVAA 3HGKA 4MQ1A 4MVFA 1Q4LA 2UZDA 1OM1A 1ZY5A 3LJ2A 4HCVA 3UO5A 4FKIA 3UP2A 2W4OA 3DTWA 5CENA 4G34A 3BWJA 4U81A 2FO0A 4CZUA 3WZKA 3UMXA 5JFWA 3A61A 4KA3A 4IX4A 2GCDA 2CSNA 4N6ZA 5KMKA 4IJPA 3NUNA 4EOSA 4A4OA 3F2NA 3G5DA 3NAYA 2P2HA 5JRSA 4D58A 2GHLA 5HBEA 4BICA 3OY3A 3F5GA 4L43A 2XJ0A 5GJDA 4IH8A 1B39A 2YIWA 2XCHA 3V5JA 2BIYA 2YFXA 2V55A 2WOTA 2UZVA 4QPAA 2XIYA 3LXNA 4G16A 4RJ5A 3OCGA 4OW8A 4W8EA 5AX9A 4YTCA 1NW1A 4HCTA 5J1WA 1GJOA 1ZMWA 3O7LB 2X6EA 1Q97A 4MTAA 1LR4A 4B6LA 3ETAA 4HVDA 5IU2A 4B99A 4BC6A 4KD1A 3W2CA 4U7ZA 2BCJA 2CLQA 4UXLA 2XA4A 3CXWA 5ANEA 3IG7A 3U54A 3DAKA 5CU6A 5M55A 3VUIA 4PL5A 2VX3A 3F82A 1RQQA 3OC1A 4AE9A 4BBEA 4EI4A 3LJ1A 1QPDA 5IQFA 2YCRA 3E92A 4WBOA 2I0HA 4F0FA 5L4QA 4FG9A 4Z9LA 3GOPA 3FHRA 4NCTC 4KINA 5LVOA 4GVJA 5FM2A 5JQ5A 4DLIA 4BRXA 4IAYA 3EMGA 3LCOA 4O21A 2IZRA 1KV1A 1H1PA 3V3VA 5K4JA 5EM5A 4YBKA 5J95A 4FSUA 2C6DA 3QXOA 4ACCA 2C6OA 3DNEA 4BCHA 4DGMA 3R2BA 3BQCA 4L00A 5D9HA 1XBBA 4S34A 3L1SA 2OFVA 4G3FA 4X2KA 3FKLA 3PXZA 2ZV2A 4H3BA 5ANDA 2QG5A 3TZ9A 3RPRA 1LEZA 4DFUA 3VS0A 4TL0A 5CI6A 3OF0A 4IZAA 4GEOA 4PP7A 4XHKB 3BELA 1JBPE 4F7SA 4RFZA 1A06A 3QGWA 5HESA 5FDPA 3IQ7A 2BAJA 4LMUA 3ORZA 2PVJA 3BU3A 3DFAA 1FINA 3PA4A 4R7BA 3I81A 4MWHA 4EOKA 5AP0A 1M14A 4FV7A 2ONLA 5E8ZA 5FEQA 4ASDA 4CTBA 5H8BA 1GIHA 5EM7A 4CVAA 5DI1A 3QTZA 2G15A 3R00A 3NW5A 4LQMA 1WZYA 2HZ0A 3CTQA 4J1RA 1XKKA 4XP2A 4BL1A 5LVMA 1OI9A 4OTPA 4ANSA 2X39A 4FMQA 3HAMA 3LJ0A 1SVEA 4FTTA 4XS2A 4CQEA 1PMVA 3B8RA 3O96A 4TYHB 2WB8A 3DFCB 4CFNA 4OTIA 5HLNA 4WNPA 4M12A 3CTHA 3R83A 2WAJA 2IVUA 2RG5A 2Y9QA 4TYIA 4MX9A 3IPHA 1STCE 1ND4A 4QQ5A 5IUIA 4RJ8A 2NRYA 4XEYA 3DXNA 3AT2A 5E8SA 2JKMA 3ZUUA 3I5NA 4A7CA 1I09A 3EYGA 3QKLA 4FUYA 2ZDTA 3RHXA 1T45A 3RAKA 3MN3A 4FL1A 5EYDA 3ORMA 3FXXA 5HCZA 4D2SA 3FQSA 4O7SA 5CALA 1GIIA 2KTYA 2CGXA 4AGUA 3QTXA 2PZ5A 4FL3A 4LI5A 4RVKA 1Q8TA 4NWMA 4V04A 4B0GA 3GU7A 4FNWA 2O2UA 4IC8A 3MI9A 5HEZA 3H4JA 4WD5A 5CX9A 5J7BA 2QO9A 4E7WA 4EJ7A 1PXPA 2QG7A 4GMYA 4FV1A 3UC4A 4RLKA 3FMEA 3QQUA 1YWVA 3BYVA 1Q62A 3QRUA 4I24A 5L8LA 2YZLA 2JFMA 2QKWB 4AP7A 2B9JA 4UWYA 4XMOA 5AP1A 4C0TA 2XM8A 3GQLA 3F9NA 4JAIA 2A1AB 2J0LA 5HIBA 4TRLA 5J79A 3DCVA 4ZTSA 4UB7A 3C1XA 4QTEA 5E8UA 4BYJA 4B8LA 2HENA 4OT5A 2YHVA 3KXNA 3PXQA 2PVHA 5L6WL 5BX0A 2C5YA 3U55A 3RK5A 5KBQA 3UBDA 2IVTA 1JNKA 2UZWE 2WQBA 1W7HA 4BZDA 2ZB1A 4HVIA 3SGCA 5IISA 2C1BA 2ZAZA 4FNYA 4BFMA 2PE2A 3HDMA 3C13A 2XIXA 4QMVA 3OMVA 4E6DA 4CNHA 3MYGA 3P5KA 3LQ5A 3UIUA 4ASEA 4YJQA 2JIVA 3EFWA 4ZTRA 3V5TA 3NWWA 1P4OA 3OWKA 2X8IA 3HZTA 3BHTA 3PY1A 4FIIA 5FQDC 4DH7A 3TTIA 2V5QA 4E5BA 4IAZA 4AOJA 3KCFA 4YLJA 5LCJA 4J99A 2X0GA 3G9NA 4XLIA 2Y8OA 5F20A 3EWHA 4OGRA 3VJNA 2ERZE 4C4JA 4MD7E 4ONAA 2C3LA 3TNIA 2XM9A 4AT5A 4BTKA 4FTKA 3D15A 4R3CA 4D0XA 3VIDA 4BKYA 4FTIA 5M4IA 4AGDA 4CTCA 4HYIA 4BTJA 2ZMDA 5HO8A 4FZAB 5IA4A 3QLFA 4FI1A 2BKKA 5EYCA 4PDPA 4F9CA 4QNYA 5CT7A 3RCJA 1H28A 5CNNA 2O64A 3GGFA 3LFFA 5FEDA 4PPBA 5IDPA 4BGHA 3MVJA 4FKTA 4CSVA 4DEHA 4FKLA 3WZEA 4C02A 4MF1A 5EQPA 3OZ6A 3HAVA 2XIZA 2RFSA 3ENMA 4KRCA 3CS9A 4GU9A 1JKSA 5EDRA 3P79A 1Q8WA 3QTSA 4MD8E 4E4LA 3HKOA 3L9LA 3WBLA 3CE3A 4S30A 4FT7A 2RIOA 2VNWA 4C34A 3I60A 4U9AA 2XKFA 4KIPA 4AW0A 4ZTNA 5HG7A 4ACMA 3EQGA 4TTHB 3F3TA 2R3IA 3FKOA 3KK9A 3OOMA 1H24A 2WQMA 4XOYA 3RWQA 3U87A 4EK5A 4QP8A 5I3OA 4BDAA 3C4ZA 3BHVA 3QD4A 3LLAA 3OTVA 2HY0A 2PVMA 3NUUA 1UU3A 4LFIA 2PZYA 2IO6A 3R1SA 3L9PA 3ZRKA 4QMOA 5GZAA 2WU7A 3UG1A 2IN6A 2C69A 4JDHA 4FTMA 2OI4X 4GKHA 3DAJA 3P7AA 4IE9A 5TO8A 4RC4A 3BU5A 5HNGA 4ZMEA 4TWPA 2R0IA 1M7NA 2WMQA 4UMTA 3G15A 4FVRA 4KBKA 2P55A 5LMKA 4G2FA 3MH2A 3PY3A 2YABA 4A4XA 5HVKA 3ULIA 3HV6A 4EWHA 5IQBA 3R71A 3C7QA 4L46A 3D4QA 4QYFA 1W84A 1ZMUA 3NCZA 3TNHA 3FLQA 3RHKA 5BVWA 3OVVA 2XVDA 4IWQA 4M7IA 3ODZX 3Q4UA 4QP1A 1CSNA 2QNJA 3BHUA 4HCUA 4IM2A 2PUNA 1Q41A 5CVFA 3R9OA 2XF0A 3H0YA 2O8YA 4M0ZA 4DFZE 2R5TA 4TW9A 4EKKA 3SA0A 1VJYA 4R1YA 5HQ0A 4BN1A 1MRVA 4UZDA 2I0EA 4O7RA 1IEPA 4EL9A 4JDKA 4BDGA 2HWPA 2F4JA 4FZ6A 3RPOA 4ACGA 5F4NA 4B9DA 4C57A 4YR8A 3TUDA 4CCBA 4QQTA 3GB2A 5IEVA 3BKBA 4YZMA 4DFBA 4L3JA 4QT1A 5ANOA 3AQVA 4HZRA 5CZIA 4YP8A 4HJOA 3HRBA 4X7QA 3VAPA 5M07A 3BIZA 4GYIA 5KMOA 3DZOA 3ZZWA 2Y4IC 3Q5IA 4CKIA 4TWOA 4GIHA 2QHNA 4KIKA 3B2TA 2OJJA 5FEEA 1PKDA 2RKUA 3NUYA 4L68A 5T68A 4KRDA 2QU6A 3OWLA 2YIXA 4FIEA 4IC7A 4O91A 5HIDA 3K3JA 4CG9A 2R64A 4NL0A 1S9JA 4PL3A 4UWCA 2RF9A 1PXJA 4JDIA 2ZM3A 3H9RA 5EOLA 2P33A 5CQWA 4FYOA 2C5OA 1JPAA 5EDQA 4ALUA 3W55A 4GK2A 2FA2A 4FZDB 2C6TA 3A7JA 3Q53A 1K9AA 4O27B 4XG7A 3ORKA 2XMYA 5JQ8A 1LP4A 3A7HA 5IA3A 3UQCA 1AQ1A 1FQ1B 2QLQA 3CJGA 4FKSA 5JZNA 5C03A 4UN0C 4WIHA 4XV3A 2I0VA 2G01A 4FSWA 2BHHA 4OBQA 5CI7A 4JL9A 1SNXA 2WELA 5DRDA 3E8CA 2PZRA 2ZV7A 5CU3A 4C4HA 3FZOA 3OT8A 1OPLA 5BYLA 2W9FB 4NH1A 3BLQA 4DEGA 4FIJA 3CY3A 2VO0A 3F7ZA 4K9YA 5K5XA 3AXWA 3JVSA 2PZPA 3COHA 2RG6A 3II5A 5FXQA 2PL0A 4NK9A 3A4PA 3NX8A 3Q9YA 5LWNA 1M17A 1M2QA 4L9IA 1UNLA 3WZDA 4F9AA 3MFRA 4AFJA 2R4BA 3UC3A 2Z8CA 5AP6A 2OZOA 4USFA 2OG8A 1GAGA 3GFEA 2XNMA 2YM4A 3ITZA 3KXZA 2JEDA 4CZYB 2ITVA 3KXXA 5KMMA 3QZHA 3QF9A 4XRJA 5DEWA 4ERKA 3Q2JA 3QC4A 3F61A 3DPKA 3DK3A 4M66A 4WUAA 5DIAA 2FVDA 2PSQA 2J4ZA 4FF8A 4AS0A 2C6LA 5HX6A 4JS8A 2W06A 2UZLA 3H30A 2W99B 5LOHA 2PPQA 3QQLA 3QX2A 3BQRA 3ZM9A 2XKCA 5IQHA 4QMUA 5LQFA 1YXXA 3G6GA 1O6YA 2VO7A 3OEFX 4L7SA 1TQIA 3GCSA 3TKHA 2WQEA 5DR2A 5C8MA 3W10A 3BI6A 2YIYA 4WSYA 4XV1A 1CKPA 4FG7A 4FV9A 2ESMA 3A7IA 2OLCA 3SG9A 2BIKB 4ZTLA 4ANQA 3RTPA 3JVRA 4YGAA 3HV7A 3Q32A 3BX5A 1CKIA 4R7IA 3PJ2A 4QNAA 5AUWA 4RX8A 3ZC6A 5CF8A 5IQDA 3UODA 3ZFYA 2F49A 2OZAA 2YWVA 4K1BA 4D2PA 4EOMA 1BX6A 3LAUA 4BBMA 2BROA 5D7AA 5BVEA 4FV4A 3LFSA 3QCQA 4C4IA 4ZLYA 5E8YA 2EB2A 4IFGA 3U6JA 4TPTA 4JNWA 3WILA 1SMHA 4E6AA 4BIEA 3OD6X 4O38A 4GH2A 3KVXA 4QQJA 2VWBA 3R1NA 4RJ4A 2R3FA 4AF3A 4O0UA 4D55A 2VWYA 4G3GA 4O96A 4C58A 2VWXA 3ZU7A 3Q9ZA 3G2FA 3ZM4A 4CFWA 4J8MA 4Z55A 3W2PA 4KKHA 2XCKA 5L2SA 4IW0A 4I41A 3Q6WA 5AIRA 3PTGA 2RGPA 3SDJA 2BTRA 1KSWA 3KMUA 3MB7A 3NIEA 2PVFA 3CLYA 3SW7A 3FZPA 4OR5A 3TZ8A 3P7BA 3D7TB 2VTJA 2CGVA 4JRVA 4U5JA 3NPCA 4FZFB 3VWAA 4B8MA 1L8TA 5DYJA 3FWQA 3UOKA 1JOWB 2IVSA 4ZXTA 2YM8A 4RC3A 5FLFA 4QMMA 5CQUA 4JR3A 3FJQE 2JAVA 3BLHA 5DR6A 4BB4A 4G17A 3VS6A 5AAFA 2C1AA 1KE7A 1OPJA 5IA1A 3ULZA 4XLVA 3FE3A 5JMSA 4PTGA 3ZO2A 2CPKE 3Q9XA 3RM7A 1TVOA 2V7OA 4FK3A 3FYKX 3MH3A 4FTLA 3A8XA 3SC1A 3IK3A 5C26A 3KKVA 1J7LA 5D11A 4EC8A 3DKOA 4RIXA 1YDSE 2LGCA 4IX5A 3NUXA 4MXOA 3K5UA 4DTAA 4GS6A 2X7GA 3AD4A 3O50A 1ZARA 2QOLA 3QL8A 4WO5A 5G6VA 4J53A 4U42A 3MA6A 4ERWA 4O7WA 1YXSA 3ZMMA 3CCNA 4X0MA 3ENHA 4ZSAA 4QQCA 3D0EA 2I0YA 2W1ZA 2OBJA 4FV5A 2HXLA 2BRHA 4RG0A 3QRJA 1U4DA 4W4VA 4E6QA 4IZYA 3BCEA 4LV5A 3KMMA 3TT0A 3IOKA 4KNBA 3CQUA 1AGWA 3QWJA 2OO8X 4HYHA 4JBPA 4QYHA 4QYGA 1IAHA 5C4LA 3KRLA 4QMLA 2V22A 4IWOA 4BGQA 3FMLA 4AZFA 3R30A 4GT5A 4DEIA 4G6NA 3A99A 3EIDA 3LIJA 4GJ2A 4CXAA 3S3IA 1WAKA 1J3HA 4PDSA 3UDBA 5CF6A 2CCIA 3EJ1A 1TKIA 5CEMA 4K77A 3PDTA 4X6RA 5EQEA 4L52A 2PMLX 1Q8UA 2RSVA 4LRMA 3LMIA 3HLLA 5I4NA 5JK3A 2ZV9A 5CAQA 2QI8A 4D28A 4MXYA 2FSOX 5HNIX 4XOZA 4FG8A 2IW6A 1G8SA 2BKZA 3FDNA 4FR4A 3MFSA 3SRVB 4EZ3A 4F6UA 3PJ3A 4O83A 5LCKA 3C0HA 1R0EA 4DA5A 2B4SB 2UV2A 5E8XA 3EYHA 2HW7A 3F7WA 2XS0A 3G51A 4O6EA 5AFVA 3E5AA 2WQNA 4BR3A 4PMSA 3E3PA 3FLZA 5AMNA 5HU3A 5GZ8A 3AC8A 3FLWA 1FBNA 1GZKA 3KEXA 3AMYA 3O8UA 3NMUF 4TWNA 4QP2A 5TT7A 3VBWA 1J1CA 3CPBA 5CEPA 5EH0A 4C61A 3PP1A 2BZJA 2QOKA 2XBJA 3QZFA 4Q5EA 3V01A 1XBCA 3BHHA 4R78A 5DG5A 3QBNA 3Q52A 3VUGA 3AGMA 3GCQA 4ZJIA 2XK3A 4I5MA 3A62A 3P86A 3PY0A 3ZH8A 1DAWA 1OL5A 3EZRA 3CIKA 2BFXA 2OJ9A 2ITNA 1PXOA 3PXFA 2H34A 4Q9SA 4BDEA 3Q3BA 4XX9A 3MJ1A 5BVKA 3SAYA 2YJRA 4IAIA 3QAME 3N4UA 4NUSA 4DFXE 1QPEA 1YDTE 4JR7A 4AGCA 1ATPE 3GI3A 4OTFA 4GT4A 2XBAA 5AR3A 2OXYA 5J8IA 1RE8A 3ELJA 3LM5A 1YDRE 2HOGA 4XG3A 3NW7A 4BCPA 1XH5A 2R3JA 3GU8A 2BTSA 4CD0A 3MV5A 3BWFA 5AAGA 1G5SA 5FDXA 2GFCA 3Q2MA 1BI7A 1REKA 3OHTA 4K2RA 3PXKA 4NFNA 5A54A 3NS9A 4CMUA 3LOKA 4MHAA 5A9UA 4PX6A 1P14A 2I40A 4F63A 3NNWA 3C9WA 3HUCA 5HIEA 3M1SA 3VUHA 3QYWA 5J5TA 3ORLA 3KMWA 5KX8A 2VNYA 4L8MA 3CQWA 2NNWB 5F1ZA 1XH7A 1YHWA 3LPBA 4FIGA 4MAOA 4DLJA 4CLJA 3DZQA 2PTKA 3FSFA 4BWXA 4P7EA 5DT4A 3FSKA 4UY9A 1CM8A 3NUSA 4FL2A 4DYMA 2X8EA 4TWCA 3NUAA 4KKEA 1BYGA 3EB0A 3KULB 3GU6A 5CS6A 2JKQA 3AC3A 4ENYA 4IAKA 3NVMB 3GNIB 3I0OA 4ZIMA 5EW8A 2I1MA 2YN8A 2C0IA 2GFSA 2C30A 3MTLA 1J7IA 1W0XC 2GNIA 3SKCA 3SVVA 2QO2A 2C5XA 2VTSA 3EQBA 2XJ2A 4ZSJA 4WRGA 4RA5A 4UYAA 4AW2A 4FKWA 2UW5A 1H1RA 1DI9A 4CRSA 5AUTA 5LXMA 2O0UA 2VTTA 3BEAA 4E26A 5K9IA 1PMEA 2PK9A 3T9TA 4TYHA 3IDCA 3NW6A 3U4UA 4UV0A 3FZTA 2GNLA 3AT3A 3R8ZA 3TJDA 4FKOA 2JDTA 5CAPA 4YZBA 3WYYA 4D2TA 4U80A 3RP9A 1E9HA 4CKJA 2WU6A 2VWWA 4MD9E 3R8MA 3UZRA 2ACXA 3RM6A 2Z7SA 4NTSA 5E8WA 4G9CA 2XKDA 4O7LA 4KS7A 5J87A 4ASXA 3PPKA 4JQ7A 3VS4A 1Q99A 4USEA 4V05A 1IAJA 2EUFB 2QU5A 1WMKA 4PTCA 5DR9A 1UA2A 4IMYA 1PYEA 3SOCA 1URCA 4Z3VA 4L01A 4GK4A 3FPQA 2WMAA 5AM6A 2VUWA 4FGBA 5AV2A 1PMNA 4BZNA 4RRVA 5AUUA 3PJCA 2OH4A 5IG1A 4JG8A 3QD2B 4FTQA 2B9HA 3R02A 3VHKA 1JLUE 3FZRA 4Y5HA 2BR1A 3D9VA 4U41A 4UYNA 3DXQA 4M67A 4IWPA 5IZFA 4JRNA 5BUJA 2GQRA 2IWIA 2BZKB 3W8QA 2W1IA 1UNHA 2JDVA 3BV2A 3KXGA 4LG4A 4QYEA 4W4XA 5IA5A 2IZTA 4BDDA 2QOOA 4O84A 3R9NA 4LL0A 4KUJA 3HMMA 1JWHA 2WMTA 5DGZA 3UOLA 1R1WA 2GU8A 2WEIA 2QR7A 4IVCA 2YCFA 4AA5A 5E91A 5GJGA 2ITZA 2HCKA 3UTOA 2WGJA 5AAEA 3PJ1A 3NYOA 5L2IA 4U8ZA 4FV2A 2BFYA 4FIFA 3BYOA 3CP9A 3AD5A 3R8PA 1GOLA 2ZM1A 3QA8A 4HZSA 1YHSA 3NDMA 1UWJA 4JQEA 1APME 2UW4A 2WXVA 4ZOGA 4RA4A 1CMKE 2WMUA 5CSVA 3ZXTA 3PJ8A 4BF2A 2IPXA 2X4ZA 2XYUA 3HYHA 5HI2A 4F4PA 4IDTA 5AEPA 2R7BA 5FBOA 1UU7A 2X2KA 3OXZA 3WIKA 3V6SA 4A4LA 3JYAA 1JVPP 4M13A 4WRSA 4XBUA 3MA3A 4EHVA 3R01A 4OTWA 5LMBA 2VZ6A 4D9UA 4WOVA 3PRFA 1SYKA 2OICA 3L8PA 4X2JA 3IS5A 3IW5A 5TR6A 3KVWA 1XJDA 3JY9A 3SV0A 4E4NA 1Y8GA 2ETMA 3SHEA 4KBCA 2JIIA 4YHJA 2ETRA 3LCSA 4FGRA 4RX7A 1PF8A 3FXWA 2G1TA 4FYNA 2XUUA 4F0GA 2VO3A 4ORKA 1WBVA 2WMRA 2WFYA 2H6DA 2XYNA 3DKFA 4R7HA 5HO6A 5LVNA 2WMBA 4TNBA 1OIUA 3KXHA 3PA5A 5HORA 5KHXA 3RZFA 1MRUA 4RFMA 3ZLXA 2CKQA 4BI1A 4DCAA 1UNGA 2VU3A 4DN5A 4TY1A 2ETKA 4U43A 4YC6A 2W5BA 2H9VA 5EYMA 4E4MA 2BRGA 2OIQA 3IW4A 4JXFA 1M7QA 3QQHA 2VTAA 3DAEA 4NCTA 5DOSA 5DRBA 2W1CA 4Q9ZA 1BKXA 2W7XA 4K33A 1DM2A 4D9TA 2PUUA 4QD6A 5C27A 1PY5A 4F99A 1WVXA 3FBVA 1MQBA 2FSMX 4BCGA 3KRRA 3QQFA 4MF0A 4AW5A 3BGZA 4MBLA 5EOBA 4A9RA 4JIAA 2SRCA 1GIJA 5FD2A 5LJJA 5EQYA 3MPAA 2DYLA 1KOBA 4IZ7A 4OLIA 3DB6A 2VWUA 2H96A 2GS6A 3ORNA 3VS7A 4D2RA 5BPYA 3D14A 4F64A 2RFDA 3PLSA 5HD4A 4FEQA 5AUYA 2GTNA 3PP0A 5J5SA 5DT3A 4DEBA 5CEOA 2C5VA 2UW9A 1H01A 5HHWA 1H26A 3KU2A 4U40A 4JLCA 5DBXA 4EYMA 1YXVA 1XH6A 2XK6A 4PUZA 4OBPA 4BCQA 3OCTA 4PMMA 5L2QA 3ZDUA 3DJ5A 5LARA 5CANA 2HXQA 3ATSA 2WNTA 1H07A 3R8UA 2VTMA 3KGAA 2BDWA 4JBQA 4NSTA 4CRLA 3EFLA 4PL4A 5IF1A 2PMIA 4AFEA 3JPVA 3GC0A 3ZONA 3TTJA 3SW4A 2PU8A 3BGPA 2YDJA 3NYVA 2ERKA 4AZEA 3ZUTA 3I6UA 4J96A 4V0GB 2YAKA 3A2CA 2OKRA 1PJKA 2C0OA 3UO6A 4EH4A 5IA0A 3E8NA 3KRXA 3A8WA 3I0QA 2GNGA 3PXRA 3VRYA 3QHWA 4OAUC 4DFNA 2GNHA 2W1HA 3V6RA 2I6LA 2W4KA 4PP9A 4HNIA 3D2KA 1BUHA 4U44A 3UPXA 4O0VA 5HD7A 1OPKA 4XP0A 4U97A 1NVSA 2ITQA 3UNZA 3ZLWA 1YWNA 5DVRA 2GQSA 2Q83A 4CFXA 4QRCA 2HIWA 4CCUA 4JX3A 3K2LA 4F9BA 3CBLA 3QYZA 5HNBA 3OWJA 2UZOA 3IONA 1GZOA 1M2PA 3CKXA 1ZWSA 1CTPE 4FVPA 3QA0A 4RWJA 3PIXA 3ZCLA 4O0RA 4I6FA 1Z5MA 5C9CA 3RGFA 4DC2A 5J9YA 1YOJA 3EQHA 3Q4TA 5ACBC 4MXAA 4BCOA 4WG3A 4BWPA 4XBRA 3Q4ZA 2EU9A 4FT5A 4RJ7A 2GQGA 3C4WA 2PYWA 3CEKA 3M42A 2JBOA 3ORXA 2QKRA 4GSBA 4ID7A 3CSVA 4N57A 3CQEA 1FGIA 4GKIA 3OS3A 2YISA 4H1JA 4NT4A 3SG8A 4E73A 1H25A 5IH6A 4BDJA 3U8WA 4J98A 4ITHA 2XNPA 4XV9A 2Z2WA 4FX3A 4L42A 4YJRA 4CGAA 3ZBXA 2WMVA 5HG5A 1V1KA 2WMSA 3ZTXA 3ZYAA 5FP6A 4DITA 3MB6A 3AMAA 5IQGA 3CJFA 5BUIA 4GUBA 1ZYDA 4FE2A 2OF4A 1YKRA 3EN9A 3IDBA 2YM3A 5FRIA 2CMWA 1MP8A 3FY2A 4I22A 3VS3A 3QFVA 3WZUA 3FC1X 4F0IA 3ALNA 4MQ2A 5H2UA 3TUBA 4G5PA 5CSWA 2A0CX 4XG8A 2O63A 5EHLA 4V01A 4DEEA 1PXKA 1RW8A 2JDSA 3A7FA 2QLUA 4Y8DA 4EOQA 2X2LA 3OXIA 1SZMA 2W96B 4BHNA 1M2RA 1VR2A 3LW0A 4MXZA 4WNMA 4XV2A 4F7NA 4OAVB 5E9EA 3F3UA 2W5AA 4YJVA 2YIRA 2XK7A 2DUVA 4AA4A 2B53A 4AN3A 1Q24A 3MWUA 3TM0A 1YHVA 3N4TA 5HVYA 4ZZMA 4Y5QA 3TG1A 2F2CB 5FP5A 2V7AA 1XQZA 3BV3A 3MS9A 4FNXA 4YC8A 4BGGA 4BWKA 1QCFA 1XWSA 3DDQA 3DLSA 1V0BA 3DNDA 4IEBA 4H3QA 2B54A 5KKRC 2VTQA 2VWVA 3CD8A 3HDNA 2JBPA 3M2WA 4Z7HA 4M69B 3OW4A 2Z60A 1OKVA 2BHEA 3CR0A 3KB7A 2XKEA 2XRWA 4L7FA 5DWRA 1OIRA 3LM0A 2UUEA 4BCJA 1W83A 3KL8A 4CZTA 2FH9A 5L6PA 2ZJWA 2WTDA 1ZYLA 3DK7A 2OF2A 2F9GA 3G0FA 4L53A 4EOIA 2PMOX 3F5UA 3FMJA 2HZNA 4FK6A 3PSDA 3E93A 4EOJA 2HELA 2CKPA 4B7TA 5J9LA 3WYXA 3HV5A 3FEGA 3LCTA 3IOPA 4H39A 4QMQA 4MWIA 4YJPA 4N4SA 4IVDA 4EORA 1OGUA 2C6MA 5CNOA 3SLSA 4C2VA 2AUHA 4ZJVA 4ZJJA 5AV4A 4NTTA 4M8TA 1SVGA 2OJIA 3E7VA 3PRIA 3FLNC 3T9IA 5HZNA 2GMXA 1WBTA 3MJ2A 5FUTA 3HA8A 5AR5A 3QX4A 4ANBA 1Z57A 3FC2A 3VS2A 2UW7A 1T46A 1V0OA 4O0TA 1PRYA 3EN4A 2Z02A 3DU8A 3I1AA 4BI2A 3VO3A 3QZIA 3W33A 5CXZA 3RAIA 4G6LA 5M4CA 1U5QA 4R5SA 1KE6A 2OW3A 3TV4A 3GFWA 4OTHA 2XNNA 4EUUA 1RJBA 4GG7A 5ACKA 5K4IA 3I7CA 3A4OX 4DFYA 4AZSA 3AGLA 4LUEA 2BDJA 3FZ1A 3GENA 4FC0A 3JS2A 3KC3A 3LCDA 1OB3A 4RC2A 5ETCA 4YZNA 2EXEA 1Y91A 3OCBA 2XK8A 3QTQA 1GY3A 3HRCA 4JDJA 4LGHA 3PVBA 2W1FA 1DS5A 2RFEA 3NR9A 2AC3A 2EXCX 5AR4A 4PDYA 2JD5A 4FKUA 3HP2A 1IR3A 5GZ9A 1KE5A 1QL6A 3ZDIA 4AW1A 4F7LA 5IH5A 4BIBA 1LUFA 3BRBA 4FV6A 2ITYA 4D1ZA 1LPUA 4IADA 4RIOA 2C6KA 5JKGA 3MVMA 3WI6A 5EG3A 3ANRA 1OECA 3DBQA 3SXFA 4ENXA 3ZEWA 4BI0A 3QWKA 3UVPA 2VTOA 2OIDA 1F3MC 5DFPA 2CHLA 4G3DA 2YERA 1FVVA 5KMNA 1Q3DA 2O65A 3DY7A 4O6LA 3MVLA 2ITPA 3T3VA 3D7TA 5CT0A 1UKHA 4QP6A 5AR7A 3W2SA 3ZLYA 3UO4A 4NM3A 5D1JA 3FLYA 4E5WA 4DEDA 3S2PA 3R7GA 3UIXA 2PZIA 4GIIA 3W32A 4YHFA 4DHFA 3HA6A 4UWBA 2I7QA 4YO4A 3NNXA 2YAAA 1OIQA 2E2BA 5HE1A 3U9NA 4ARKA 4EK4A 1OUKA 3DBFA 5DPVA 1CDKA 4EC9A 5E4HA 2C5NA 3Q6UA 2OWBA 4LUDA 4W4WA 4AOIA 2WMXA 4FT3A 2X8DA 4YJOA 5CVGA 5L2WA 2YZAA 5HG8A 3DJ7A 3I79A 4IBMA 3UQFA 4IAFA 3R2YA 2FB8A 3WIGA 3R9HA 3FI8A 3QTRA 4FTAA 4C62A 1P5EA 2VX1A 4MYGA 1Y57A 2E9PA 5T6KA 3PSCA 3TV7A 4PMPA 2QO7A 2XNGA 2YITA 5KO1A 2B9IA 3KFAA 4FTNA 2UVXA 3L8XA 5HVJA 4NYEA 3L8VA 3PVWA 5BVFA 3GT8A 2XEZA 1PXMA 3L9MA 4I0TA 4EH3A 2VO6A 3COMA 2B7AA 2WTKC 4J97A 1E1XA 4GG5A 4J95A 4YC3A 5A4QA 4F9WA 3C5IA 2JDOA 3JXWA 5AUZA 5DLSA 5L8KA 5FXRA 5EDPA 2F57A 2YLFA 3NGAA 2BMCA 3FQHA 3PXYA 3S4QA 2R3MA 4WNKA 4CYJA 3F2RA 4CV8A 2VTLA 1SM2A 5BYZA 4K11A 3BU6A 4S32A 5CU4A 3P4KA 1OL7A 5H8GA 4YTHA 5CSHA 2R3OA 4G9RA 4ZEGA 4HGLA 4BBFA 4LMNA 4MNEA 5AWMA 3PZHA 4EWQA 3MPMA 4QTAA 3C5UA 5JFSA 3H0ZA 1QMZA 4RIYB 2VGPA 2YM5A 5FWKK 3V5PA 4ALWA 3OEZA 4MXCA 4HGTA 1R3CA 4Q2AA 4WT6A 2CNQA 2PY3A 3E87A 4NZWB 2GNJA 2RL5A 4JJRA 3C4XA 5KKRB 4YSJA 5KE0A 4P5QA 3SRVA 4C2WA 1UKIA 3HX4A 3DS6A 4EUTA 4NJDA 2WO6A 4RVMA 4UBAA 2G2HA 4X3FC 5FG8A 3UYTA 3UE4A 1IG1A 2JDRA 4Q5HA 4TYJA 1OMWA 3C0IA 3IW6A 3PE1A 5A46A 5A4LA 4JT3A 5DN3A 4Y95A 1NXKA 3R9RA 2C6EA 4DBNA 3GBZA 2X2MA 5CU0A 3BHYA 4P90A 5JGAA 2PVLA 4PNKA 4U6RA 5CEQA 4D4RA 4G3CA 2HW6A 4FTJA 5JEBA 3LFNA 2RFNA 4TT7A 3LFCA 3D83A 3OUKA 4NKAA 4G3EA 2VTPA 4FVQA 2Y4IB 4ZY5A 2QOIA 3OCSA 3D2IA 3V5QA 3PFQA 1WVWA 1I44A 3ZFXA 4FODA 3EFKA 2J0IA 5IUHA 1O6LA 2VV9A 2CKOA 3MY0A 4M84A 4PRJA 2PWLA 4WNOA 4I0SA 5T3QA 2IG7A 1WBWA 4XYFA 3VJOA 4I4EA 3VUMA 3NVKI 4HNFA 4F6SA 2E9NA 4IZ5A 3JR1A 4HVHA 5ANKA 1Q5KA 2WZJA 2Z7LA 3MY5A 4C37A 2A19B 5IEXA 4YJNA 4R8QA 3DBDA 3WARA 3HEGA 1OL6A 5FBNC 2WMWA 5DA3A 3UIBA 3H3CA 3MPTA 3VN9A 3F66A 3JY0A 3TIYA 5M44A 2BUJA 4QTDA 5AX3A 5A14A 3ZC5A 4FTCA 4U45A 4F08A 2UVYA 1TQPA 3UZPA 4FIHA 3C50A 5D12A 1IA8A 3U51A 4JI9A 2WD1A 3P0MA 3HMNA 4D4VA 4QMXA 3O8TA 1FGKA 4W4YA 4J52A 2QOBA 2R7IA 5E90A 5FTQA 1OIYA 3SOAA 4EK3A 4EYJA 4LRKA 1JKTA 1FOTA 3AC4A 2A2AA 5IEYA 4FSNA 2XNEA 5DHJA 4I5PA 2KULA 4MNEB 3QTIA 5GJFA 3KN6A 3GCVA 4AG8A 2C47A 5ANJA 4C3FA 4AA0A 4MBIA 3KULA 4U3YA 4CV9A 4F6WA 1JQHA 2PUIA 2R0UA 3JUHA 2DWBA 3RPSA 1OUYA 2EWAA 4FKPA 3HVCA 3C4EA 4AWIA 4KWPA 4YMJA 2G9XA 5JGDA 1ZOGA 1FPUA 3NSZA 4WHZA 3BPRA 3DQXA 4QMWA 4PMTA 2YDKA 5E92A 4EZ5A 1NVQA 3NNVA 3H9OA 4YZ9A 3ZLSA 1BMKA 1OKZA 4IM0A 3VQUA 3GXLA 3LHJA 3RZBA 1O9UA 1PMUA 4TZRA 4YU2A 2CN8A 4O2PA 4NEUA 2WPAA 3V8TA 1IA9A 1FVRA 2VN9A 4ZLOA 2E9UA 1AD5A 4ZS4A 4IB3A 4XP3A 5CEIA 4C59A 4XH6A 4F1TA 1IRKA 5KNJA 3PYYA 2QQ7A 2HWOA 3VQHA 3F3ZA 5ANIA 2VRXA 4YJSA 1OL2A 5B0XA 3MTFA 3NYXA 2WIHA 3IDPA 3FMMA 4AAAA 1HCLA 5FTOA 3TNQB 5BQ0A 4HPUE 4ANNA 2VTRA 3B2WA 3R7OA 2WTKB 4G6OA 1Q8YA 3ZSIA 4L3LA 4KSPA 5I3RA 2WTCA 1Q8ZA 5KMJA 4LL5A 5HO7A 4MBJA 3GEQA 1SNUA 5J9ZA 4X6QC 5HBJA 1KUTA 3UYSA 4AX8A 4HGSA 4I0RA 2GNFA 2WOUA 2F7EE 3LCKA 3QUPA 1XO2B 4RIWB 4FSTA 3CPCA 4LYNA 5I9YA 4ZSGA 4ZTHA 3KA0A 4NFMA 3V51A 3TN8A 3RINA 2BRMA 3LFQA 4YNEA 4JIKA 2C68A 2QC6A 3SXSA 4D0WA 2CGUA 4JX7A 4PWNA 3VUKA 2CNUA 4O82A 4IACA 4EHEA 5CAVA 4DTBA 2WKMA 2XEYA 5AUXA 5FM3A 4FSQA 3EQDA 1KWPA 5M08A 5EI2A 5KHWA 3THBA 4A07A 4GL9A 4NIFB 3WF6A 3CKWA 4UEUA 4U0IA 3VBVA 3T3UA 3P78A 5CF4A 3SX9A 5L8JA 2UZEA 4Y85A 3R21A 4GYGA 4R3PA 1VEBA 4RBLA 3O8PA 1K3AA 2BDFA 3KK8A 1VZOA 3CGFA 2C3KA 1U54B 4X3FB 3FMDA 4K6ZA 4HYUA 4YTFA 5KMLA 4KIQA 3ORPA 1FMKA 1L3RE 2JFLA 3AT4A 3BYUA 3KF4A 5GIOE 5EI6A 1XR1A 3G33A 3R6XA 4ZAUA 3ZRLA 4II5A 3HECA 3ODYX 4BCKA 2ZMCA 5CU2A 4E3CA 5L2TA 4YPSA 3WE4A 1P4FA 3KF7A 3HNGA 3LQ3A 5K5NA 4FA2A 2ZDUA 4ZK5A 3S95A 2WTJA 3Q60A 2HYYA 2GHMA 5J7HA 5JFXA 1BL6A 3E88A 5TF9A 3IW8A 3VS1A 3F6XA 3TACA 4PQNA 4AT4A 3G9LX 2HK5A 3TCPA 4FSMA 1PXIA 3BBTB 3D94A 5BVDA 3KY2A 4QMPA 3ZOSA 4HVGA 4JBVA 2ITWA 2R9SA 4I6BA 3EQRA 4QTBA 3E64A 3UVQA 3FLSA 3T8OA 3AMBA 5JSMA 4OT6A 4YNOA 1PHKA 2PULA 3KQ7A 3PPZA 4H3PA 4IB5A 4MEDA 5HCXA 2QONA 2W1EA 3O23A 4JQ8A 3VS5A 4AN2A 4DAWA 5G1XA 4YJTA 3D5WA 5EHOA 4QP4A 3UQGA 3ZS5A 4D4YA 2CNVA 3ZRMA 3ID6C 1MQ4A 1Y6AA 3LMHA 4I5HA 1UV5A 3QCXA 3HRFA 1PW2A 2CDZA 3PVGA 4RX9A 3KN5A 5AADA 3TKIA 5CSXA 3C51A 5I9WA 5ETIA 3QTWA 1XH4A 4A9SA 2ONLC 3W2RA 4ANMA 2C4GA 3EOCA 3MH1A 3VF9A 4X3JA 4R1VA 2XRUA 3VC4A 4WBBB 3K5VA 4Z7GA 4QP7A 3TNWA 5I0BA 1H08A 2VX0A 4GFGA 1WBSA 5M4FA 3S1HA 4NW5A 3QRKA 4APPA 1KE8A 3PWYA 2H8HA 1NA7A 3ROYA 1WBOA 3R73A 3ZO4A 2CGWA 3V8SA 3O71A 2EVAA 4BZOA 3FYJX 4DFLA 4BY9E 4WUNA 1Y8YA 3WE8A 4APCA 4FUXA 3RCDA 3IO7A 5BVNA 4DBXA 3BBWA 3SQQA 3PUPA 5E1SA 4DH8A 4O22A 3RWPA 3W8LA 5JRQA 3MGYA 3DBCA 2YDIA 3FY0A 4HGEA 4YZCA 4BDFA 5IDNA 2YM6A 3EQIA 2GSFA 3Q4CA 4RJ6A 2O3PA 2A4LA 4K0YA 1NT2A 2OFUA 2XB7A 5EYKA 1Y6BA 2REIA 1KV2A 1OVEA 3LXLA 2DS1A 4XCUA 4I23A 4L3PA 3QALE 4WG5A 1Z9XA 1WFCA 5HBHA 4CMOA 4V0GA 1ZOEA 3PE2A 4CLIA 4X2GA 3PLAE 2W1DA 5TOZA 3GUBA 4BCIA 3TV6A 5I9ZA 1XH9A 3NYNA 4D2VA 1X8BA 4DCEA 1OBGA 2PVKA 5C01A 1REJA 1WBPA 3GP0A 4GJ3A 4C4GA 4CT2A 2ZM4A 1W98A 3FI4A 1MUOA 4I6QA 3P1AA 2Y6OA 5HCYA 5CF5A 1UVRA 3QUDA 3FL5A 1JSTA 4DGNA 4J8NA 4MXXA 5C8KA 3S0OA 4IB0A 4DH3A 2ZYBA 4I94A 3BE9A 3O17A 5A6NA 2YLEA 4GT3A 5TKDA 4QTCA 2X7FA 5AUVA 2R3NA 5LWMA 2P0CA 4OUCA 4EHGA 3O7LD 5CAOA 3TXOA 1R39A 2J5EA 1OITA 3UNKA 4DGGA 2J9MA 3LQ8A 3DV3A 4FKJA 5CSPA 4W9WA 4ITIA 2IJMA 3V04A 4I3ZA 4AOTA 4C33A 1CKJA 4XRLA 4NM7A 1OKYA 4RFYA 2W0JA 4F9YA 4YJUA 4S33A 3DOGA 5IKWA 4CG8A 4H05A 5IQAA 4EOPA 4AGWA 4EZ7A 5AV1A 2CN5A 4G31A 1KE9A 1H0VA 4YO6A 4EJNA 4O7VA 3LFAA 4E93A 5IMXA 4EONA 4ACDA 2IW9A 4YPDA 3HL7A 4FV8A 5BYYA 5GNKA 4U3ZA 4K8AA 1H1QA 4C4FA 5AP3A 4DT8A 2HY81 4RVTA 1M52A 2VWIA 3QD0A 2UW0A 2B55A 4GW8A 5HLPA 3TZ7A 3UG2A 4BDIA 4AN9A 4EQMA 5CAUA 2W05A 4OTGA 1KOAA 3MBLA 3F5PA 3H10A 1H4LA 3D5UA 4BKJA 5IH4A 3P7CA 3RPYA 1YXTA 3UMWA 5HTIA 3DJ6A 2QR8A 3QQGA 3R28A 4FTOA 2VD5A 1EH4A 3DKGA 4FT9A 2QVSE 4HYSA 2XK9A 3OROA 4C3PA 5H3QA 4RQKA 4WSQA 4E4XA 2J50A 5EK7A 1YW2A 5BMMA 4EEVA 5BNJA 4RWLA 2R2PA 3NAXA 2CJMA 4XNEA 2UW8A 4DG2E 2P2IA 3O51A 3VBXA 2XZSA 4JAJA 5HG9A 1ZZLA 3CC6A 4ASZA 1DAYA 4AXAA 2PE1A 4F1MA 1FVTA 3RPVA 3VUTA 4QPSA 2E9VA 4UX9A 2GHGA 2YCQA 1ZMVA 2J90A 3DBEA 5KZ0A 2EB3A 4AE6A 3W2OA 3C4CA 1YI4A 2O5KA 4CKRA 5EKOA 5GHVA 1Q61A 2Q0NA 1OZ1A 3TNPC 5E8TA 2G2IA 2UW3A 3VULA 5CASA 5F94A 4UMQA 4UZHA 4JBOA 4OTRA 3DA6A 3R8VA 4M69A 4R5YA 4BDBA 3DQWA 3KRWA 2PE0A 1JSUA 4BIDA 4L44A 4C35A 4FKRA 1BI8A 4RWIA 4O1OA 5A4CA 4QOXA 5AM7A 4Y73A 3OFMA 3LKMA 3DB8A 4FTUA 3ANQA 3FI2A 3O2MA 1U5RA 2J51A 3EFJA 4J71A 3DT1A 4XG9A 4DT9A 3E8EA 3GC9A 1O6KA 1G8AA 4GK3A 2XH5A 3NNUA 4FTRA 4M0YA 1G3NA 1MRYA 1JSVA 2WTVA 5J1VA 2R3HA 2C3IB 3P9JA 4TN6A 4W9XA 3OUNB 4QMZA 5LMKC 3WF8A 4QMNA 3E62A 4MH7A 3FMNA 3R7UA 3MESA 2EXMA 3CGOA 5E1EA 4P4CA 4O1PA 4IJ9A 3O0GA 2GS2A 2X81A 2V62A 3ACKA 4EBVA 3TI1A 3EN7A 4KS8A 2WTWA 4I20A 5CWZA 3WF7A 4RT7A 5ANGA 4IX3A 3NRMA 3TJCA 3F88A 4L45A 4ITJA 1GZ8A 1PKGA 4X21A 3UVRA 1NVRA 5HTCA 4NJ3A 4RSSA 2F7XE 4BDCA 4C8BA 2OIBA 2IZUA 2GTMA 3DK6A 4FSZA 4FSYA 5ETAA 3VBQA 4O0WA 4F65A 2BAQA 4JOAA 3TIZA 5B7VA 2PHKA 4IWDA 3EHAA 3RAWA 5BUEA 5JT2A 3OW3A 4LM5A 4OTDA 5ITAA 2HZ4A 5FXSA 4C38A 3OG7A 4WA9A 4CQGA 4RX5A 4YLKA 5M51A 2GS7A 3SXRA 4I1ZA 4GV1A 1K2PA 4DGLC 4C3RA 2CCHA 2VTIA 3HP5A 3LXPA 3PG3A 3PA3A 3ZBFA 3G6HA 4AZVA 2Y6MA 4NM0A 5IQIA 4BCMA 4HVSA 2OXXA 4I4FA 4KAOA 3ZHPC 3OBJA 1YOLA 3N4VA 5KCVA 5ETFA 3ET7A 4ZSEA 4YURA 5KBRA 4FICA 1DI8A 1W82A 2YEXA 3Q96A 3R7IA 4FNZA 4BVUA 4GUEA 3ACJA 4UALA 3GU5A 4PDOA 4YUQA 4E6CA 3NCGA 4KKGA 1GZNA 1ZYJA 4R6VA 3RK7A 4P5ZA 3EQPA 2QOFA 3ORIA 4CFVA 3RBWA 4CFMA 2R3QA 3LZBA 4GVAA 5DNRA 3VVHA 4C7TA 5EM8A 3EL8A 1PXLA 5GIPE 3PZEA 1ZY4A 3BE2A 1YOMA 2PVYA 3QD3A 3U6HA 1F0QA 4NW6A 4ZSLA 4EH2A 5CVHA 2JAMA 4OBOA 1B38A 5DEYA 5M4UA 4P2KA 4S31A 2ITOA 5BMSA 2C6IA 4QO9A 4I92A 4ZS0A 2JGZA 4FT0A 2ITUA 1WCCA 5JN2A 4DG3E 2ZV8A 4EHZA 4FEWA 4FBXA 4F70A 2B0QA 3F69A 3PIZA 4RWKA 1ZYSA 4EBWA 1SVHA 3UPZA 4EH6A 3MVHA 4M15A 4D1XA 2J0KA 3EN6A 4X2FA 5A4TA 3LFEA 3FL4A 4LGGA 4DGOA 3MY1A 4XG4A 4DTKA 3FMHA 3R7YA 1HCKA 3LFDA 4O7ZA 3QHRA 4FV3A 1IASA 3V5WA 4O7NA 3EL7A 3SD0A 4EKLA 2IVVA 3IECA 5CY3A 2X1NA 2R3GA 5KMIA 1NY3A 3OBGA 3QUEA 3NLBA 4TKSA 4MNFA 3VNTA 3IW7A 2F2UA 4NU1A 3TWJA 5EKNA 3A7GA 4IVAA 1YQJA 4IAAA 3VF8A 3QU0A 3KXMA 4M68A 1XHAA 4W8DA 4GCJA 4EH9A 3I7BA 5AA8A 3RKBA 1ZZ2A 2FSTX 4I93A 3ZO3A 5FTGA 2FSLX 3R1YA 4RIYA 4XG2A 3QXPA 4YSMA 3MH0A 4BYIA 5E8VA 1ERKA 3BGQA 4FEVA 5DT0A 2VTHA 5LVLA 4ANOA 3NZ0A 3ZXZA 3REPA 3FKNA 5KUPA 3QQJA 4IB1A 4JG7A 3GVUA 4G5JA 4UMRA 4RLLA 2BILB 3P23A 3KRJA 2W4JA 5K3YA 4D5HA 2X4FA 5ICPA 3R9DA 4PF4A 4CT1A 3DKCA 4FEUA 2B52A 3E3BX 5C1QB 5IUGA 1URWA 2OK1A 1WBNA 2BZHB 4CFUA 1H00A 1LEWA 3CTJA 3FV8A 2FYSA 2WQOA 1YVJA 2BRBA 3EN5A 3QLGA 4FOCA 2WEVA 4KB8A 5AIKA 5K0KA 5B2KA 3BYMA 4QMTA 1ZOHA 3ZFMA 3NIZA 4RMZA 3UOHA 2P4IA 1Q3WA 2AC5A 4EH7A 4H36A 1BL7A 2J2IB 3D7ZA 4MK0A 3HMPA 4I21A 1YWRA 3GOKA 2YCSA 3FUPA 3R0TA 4BKZA 5I9XA 3ALOA 5CYIA 2HZIA 4ZY6A 4O0XA 5EM6A 4U79A 4CEGA 5FGKA 4O86A 4GFOA 4XJ0A 4E1ZA 4BTMA 1PYXA 2WHBA 3NUPA 3QZGA 2YWPA 2YM7A 5EHYA 1ZRZA 2Z7QA 3R8LA 3DLZA 3I5ZA 3RALA 2XIRA 3N9XA 4C36A 1OBDA 1WVYA 3AC1A 3MFUA 4QPMA 3I4BA 4UXQA 3FI3A 5HE2A 5AR8A 1TQMA 3ROCA 5L3AA 4AQCA 2UVZA 1RDQE 3EKNA 3RJCA 5BVOA 1FMOE 3G0EA 5JH6A 4DF3A 3PSBA 2Q0BA 3Q04A 2NP8A 3VUDA 2UZNA 2VGOA 2ZB0A 3DGKA 2JIUA 1P2AA 4HOKA 4JG6A 5KZIA 4J7BA 4N70A 3PWDA 4BDKA 3IGOA 4MKCA 2B1PA 1J1BA 3AC2A 5AP7A 3QCYA 3U4WA 5LVPA 4Z16A 3PVUA 3QRIA 2QOHA 3AD6A 3ZEPA 2B9FA 4LRJA 4EQUA 5IA2A 3COKA 3ZO1A 4KSQA 2E9OA 1VYZA 3PG1A 3UP7A 4RPVA 4IHPA 3CY2A 4E8AA 2QHMA 4M3QA 5H9BA 3ORTA 4USDA 3RNIA 2P3GX 4AZWA 5A6OA 3MSSA 5CEKA 3MDYA 4WG4A 4F09A 2IZSA 5GINE 1XBAA 2JKOA 2OJFE 3TDWA 3EH9A 4KIKB 2X9EA 2YIQA 3F5XA 1VYWA 3HV4A 4PV0A 1OKWA 2C3JA 3D5XA 4HW7A 1YI6A 5I5ZA 4H1MA 3W16A 3VBYA 3BYSA 2FUMA 3HUBA 3QKKA 2W5HA 3TEIA 1ZLTA 3OT3A 4LV8A 2OJGA 4I5CA 3K54A 5EW3A 4YTIA 4AUAA 4O7TA 5I9VA 3QCSA 1ZAOA 1ZYCA 2ZOQA 3IGGA 3OOGA 4YHTA 2J5FA 3DXPA 1H0WA 2BPMA 4PPCA 2UZBA 3HMIA 4DG0E 2CKEA 4EK8A 1H1SA 1QPCA 2ITTA 2X9FA 5L6OA 2GDOA 4FKGA 3R22A 4PNIA 2XJ1A 4ZLZA 3UZTA 1JKKA 3W1FA 2NPQA 5HU9A 5C8NA 2PVRA 2JITA 3PIYA 4A06A 3QGYA 2PMNX 5M53A 2IW8A 3E63A 3QRTA 4IIRA 4L67A 4R77A 3WOWA 4DEAA 2A27A 4RJ3A 2J6MA 3B8QA 4D5KA 4IXPA 2BAKA 4FZ7A 5HLWA 2YJSA 3ZUVA 3UOJA 4H58A 5EFQA 4O81A 4ZP5A 2QCSA 2AYPA 2XIKA 2CLXA 3AC5A 3FPMA 1B6CB 4IFCA 4Y46A 5CXHA 3V5LA 4BDHA 5IMEA 5AV0A 4RZWA 2VTNA 2Y4PA 4FSRA 3WZJA 2QD9A 3KREA 4B4LA 3Q9WA 1A9UA 4LOPA 5F95A 4RQVA 1XH8A 5LMAA 3V8WA 3FZSA 4WKQA 2WTIA 4MCVA 4R3RA 3BLRA 3IKAA 3E8DA 3D5VA 1W8CA 3RK9A 5B2LA 5DMZA 5HTBA 4RIWA 4IVBA 4X2NA 4E5AX 2PUPA 5M06A 2HAKA 5F9EA 3RVGA 2XNOA 5EW9A 4D4SA 3AG9A 1JAMA 3MIYA 3TL8A 2LAVA 3NEWA 3UGCA 4F1OA 3S00A 4QMYA 2OGVA 4PY1A 4IM3A 4YLLA 2QURA 4LOQA 4C4EA 2XP2A 5IQCA 2BVAA 3QKMA 5D41A 5DE2A 4DE4A 5CZHA 1U46A 5EI8A 2FGIA 5HKMA 3LXKA 4D2WA 4N6YA 4NIFA 2V0DA 4S2ZA 3GCPA 3R04A 3RI1A 4ZTMA 5HOAA 4N0SA 3G90X 3OWPA 2OU7A 5AP2A 3OY1A 4EH8A 3ZSHA 4IX6A 4K18A 4BCFA 3TZMA 4CFFA 4BHZA 3LE6A 2QOQA 3EZVA 3RNYA 4UMPA 4X3FA 1F5QA 1U54A 4O0YA 3UJGA 3VW8A 3QQKA 5HX8A 4OTQA 1V0PA 1S9IA 1GNGA 4FKVA 2UZUE 2XK4A 3L9NA 1R0PA 4FOBA 5IPJA 5M56A 5AP4A 3UNJA 2NO3A 4ZMFA 5M57A 3C4FA 3POZA 4ZZOA 3F3WA 5C4KA 2OZAB 3GU4A 3I6WA 4TXCA 3R7EA 2J7TA 5H8EA 3MFTA 4KIOA 3L8SA 4TYGA 4EH5A 3FAAA 4O2ZA 4XG6A 3QC9A 3RMFA 4EQCA 1UU9A 3M11A 4KBAA 4PTEA 2JLDA 2F7ZE 1YXUA 4QMSA 4RVLA 3TUCA 2NRUA 4RZVA 4L6QA 4JVGA 5AR2A 2R3KA 3Q5ZA 4DH5A 4HPTE 1J7UA 4TYEA 4NM5A 3LFBA 1H8FA 3C0GA 2JKKA 4IQ6A 3F2AA 3UIMA 2W9ZB 2XNBA 2YACA 4ALVA 2OSCA 3EQFA 4ZTQA 5IQEA 1OL1A 3VRZA 2G2FA 4ZZNA 3FMKA 2UZTA 3ATTA 4BTFA 3PPJA 4YZDA 3COIA 4ANLA 3WF9A 3HMOA 3TKUA 1HOWA 3ERKA 3LVPA 1R78A 3MW1A 4QP3A 3OXTA 5D7VA 5JFVA 1UU8A 2GPHA 4A9TA 1PXNA 4CYIA 5A3XA 2BRNA 2Y0AA 2R3LA 5CTPA 4BCNA 4EK6A 5D10A 1A48A 4IDVA 3GC7A 3R63A 3U6IA 4I6HA 1UWHA 4ACHA 4AT3A 2UW6A 3E7OA 3EQCA 3GC8A 3K3IA 2J0MB 3R7VA 5E7RA 5JGBA 2QOCA 2JC6A 4PPAA 2DQ7X 3VBTA 4D1SA 3WF5A 4ZY4A 2Y7JA 2VAGA 4GU6A 4FEXA 3TDVA 3DTCA 3RAHA 3QTUA 4IANA 5HE0A 3OTUA 3LLTA 4RGJA 5DH3A 1ZXEA 3W18A 5I9UA 4XUFA 4CMTA 3FQEA 3MIAA 1H1WA 2WIPA 3ZZEA 4GFMA 1QPJA 4FKQA 4KABA 4AACA 2J0JA 5AA9A 1YRPA 2VWZA 2BALA
chains in the Genus database with same CATH superfamily
1YI3A 3R1QA 4RIXB 5HE3A 5M09A 2PVNA 3EKKA 4G1WA 4M97A 3H9FA 3CD3A 2OXDA 2W17A 3LMGA 5A4EA 5K0XA 4O7YA 3GQIA 4QP9A 3P5JC 5HGIA 3U9CA 5AJQA 1BLXA 1J91A 3OP5A 4TNDA 5HICA 2W1GA 4DH1A 2OH0E 5CLPA 5B2MA 4A9UA 4LGDA 3W2QA 3P08A 2C0TA 4FV0A 4O0SA 3BZ3A 5TE0A 4AU8A 3ZSGA 4NKSA 4EOOA 5JZJA 2Z7RA 1H27A 4M14A 1E1VA 4F7JA 2X6DA 3VW6A 3F3VA 1U59A 4GRBA 3FHIA 3AOXA 2ITXA 4Y83A 4E20A 4EOLA 4I6LA 3DDPA 4UMUA 3HV3A 3KCKA 1JKLA 3A60A 4YBJA 3FXZA 3VHEA 5AP5A 2X7OA 4LOOA 4DINA 2YA9A 2BZIB 4A9YA 4AZTA 2R3PA 5AV3A 3POOA 4Y72A 2QODA 2R3RA 4QYYA 3GCUA 3N51A 3BEGA 2ZVAA 3HGKA 4MQ1A 4MVFA 4FJVA 1Q4LA 2UZDA 1OM1A 1ZY5A 3LJ2A 4HCVA 3UO5A 4FKIA 3UP2A 2W4OA 3DTWA 5CENA 4G34A 3BWJA 4U81A 2FO0A 4CZUA 3WZKA 3UMXA 5JFWA 3A61A 4KA3A 4IX4A 2GCDA 2CSNA 4N6ZA 5KMKA 4IJPA 3NUNA 4EOSA 4A4OA 2XALA 3F2NA 3G5DA 3NAYA 2P2HA 5JRSA 4D58A 2GHLA 5HBEA 4BICA 3OY3A 3F5GA 4L43A 2XJ0A 5GJDA 4IH8A 1B39A 2IF8A 2YIWA 2XCHA 3V5JA 2BIYA 2YFXA 2V55A 2WOTA 2UZVA 4QPAA 2XIYA 3LXNA 4G16A 4RJ5A 3OCGA 4OW8A 4W8EA 5AX9A 4YTCA 1NW1A 4HCTA 5J1WA 1GJOA 1ZMWA 3O7LB 2X6EA 1Q97A 4MTAA 1LR4A 4B6LA 3ETAA 4HVDA 5IU2A 4B99A 4BC6A 4KD1A 3W2CA 4U7ZA 2BCJA 2CLQA 4UXLA 2XA4A 3CXWA 5ANEA 3IG7A 3U54A 3DAKA 5CU6A 5M55A 3VUIA 4PL5A 2VX3A 3F82A 1RQQA 3OC1A 4AE9A 4BBEA 4EI4A 3LJ1A 1QPDA 2XARA 5IQFA 2YCRA 3E92A 4WBOA 2I0HA 4F0FA 5L4QA 4FG9A 4Z9LA 3GOPA 3FHRA 4NCTC 4KINA 5LVOA 4GVJA 5FM2A 5JQ5A 4DLIA 4BRXA 4IAYA 3EMGA 3LCOA 4O21A 2IZRA 1KV1A 1H1PA 3V3VA 5K4JA 5EM5A 4YBKA 5J95A 4FSUA 2C6DA 3QXOA 4ACCA 2C6OA 3DNEA 4BCHA 4DGMA 3R2BA 3BQCA 4L00A 5D9HA 1XBBA 4S34A 3L1SA 2OFVA 4G3FA 4X2KA 3FKLA 3PXZA 2ZV2A 4H3BA 5ANDA 2QG5A 3TZ9A 3RPRA 1LEZA 4DFUA 3VS0A 4TL0A 5CI6A 3OF0A 4IZAA 4GEOA 4PP7A 2IEWA 4XHKB 3BELA 1JBPE 4F7SA 4RFZA 1A06A 3QGWA 5HESA 5FDPA 3IQ7A 2BAJA 4LMUA 3ORZA 2PVJA 3BU3A 3DFAA 1FINA 3PA4A 4R7BA 3I81A 4MWHA 4EOKA 5AP0A 1M14A 4FV7A 2ONLA 5E8ZA 5FEQA 4ASDA 4CTBA 5H8BA 1GIHA 5EM7A 4CVAA 5DI1A 3QTZA 2G15A 3R00A 3NW5A 4LQMA 1WZYA 2HZ0A 3CTQA 4J1RA 1XKKA 4XP2A 4BL1A 5LVMA 1OI9A 4OTPA 4ANSA 2X39A 4FMQA 3HAMA 3LJ0A 1SVEA 4FTTA 4XS2A 4CQEA 1PMVA 3B8RA 3O96A 4TYHB 2WB8A 3DFCB 4CFNA 4OTIA 5HLNA 4WNPA 4M12A 3CTHA 3R83A 2WAJA 2IVUA 2RG5A 2Y9QA 4TYIA 4MX9A 3IPHA 1STCE 1ND4A 4QQ5A 5IUIA 4RJ8A 2NRYA 4DHIB 4XEYA 3DXNA 3AT2A 5E8SA 2JKMA 3ZUUA 3I5NA 4FRFA 4A7CA 1I09A 4O4CA 3EYGA 3QKLA 4FUYA 2ZDTA 3RHXA 1T45A 3RAKA 3MN3A 4FL1A 5EYDA 3ORMA 3FXXA 5HCZA 4D2SA 3FQSA 4O7SA 5CALA 1GIIA 2KTYA 2CGXA 4AGUA 3QTXA 2PZ5A 4FL3A 4LI5A 4RVKA 1Q8TA 4NWMA 4V04A 4B0GA 3GU7A 4FNWA 2O2UA 4IC8A 3MI9A 5HEZA 3H4JA 4WD5A 5CX9A 5J7BA 2QO9A 4E7WA 4EJ7A 1PXPA 2QG7A 4GMYA 4FV1A 3UC4A 4RLKA 3FMEA 1TZDA 1YWVA 3BYVA 1Q62A 3QQUA 3QRUA 4I24A 5L8LA 2JFMA 2QKWB 4AP7A 2B9JA 4UWYA 4XMOA 5AP1A 4C0TA 2XM8A 3GQLA 3F9NA 4JAIA 2A1AB 2J0LA 5HIBA 4TRLA 5J79A 3DCVA 4ZTSA 4UB7A 3C1XA 4QTEA 5E8UA 4BYJA 4B8LA 2HENA 4OT5A 2YHVA 3KXNA 3PXQA 2PVHA 5L6WL 5BX0A 2C5YA 3U55A 3RK5A 5KBQA 3UBDA 2IVTA 1JNKA 2UZWE 2WQBA 1W7HA 4BZDA 2ZB1A 4HVIA 3SGCA 5IISA 2C1BA 2ZAZA 4FNYA 4BFMA 2PE2A 3HDMA 3C13A 2XIXA 4QMVA 3OMVA 4E6DA 4CNHA 3MYGA 3P5KA 3LQ5A 3UIUA 4ASEA 4YJQA 2JIVA 3EFWA 4ZTRA 3V5TA 3NWWA 1P4OA 3OWKA 2X8IA 3HZTA 3BHTA 3PY1A 4FIIA 5FQDC 4DH7A 3TTIA 2V5QA 4E5BA 4IAZA 4AOJA 3KCFA 4YLJA 5LCJA 4J99A 2X0GA 3G9NA 4XLIA 2Y8OA 5F20A 3EWHA 4OGRA 3VJNA 2ERZE 4C4JA 4MD7E 1XMMA 4ONAA 2C3LA 3TNIA 2XM9A 4AT5A 4BTKA 4FTKA 3D15A 4R3CA 4D0XA 3VIDA 4BKYA 4FTIA 5M4IA 4AGDA 4CTCA 4HYIA 4BTJA 2ZMDA 5HO8A 4FZAB 5IA4A 3QLFA 4FI1A 2BKKA 5EYCA 4PDPA 4F9CA 4QNYA 5CT7A 3RCJA 1H28A 5CNNA 2O64A 3GGFA 3LFFA 5FEDA 4PPBA 5IDPA 4BGHA 3MVJA 4FKTA 4CSVA 4DEHA 4FKLA 3WZEA 4C02A 4MF1A 5EQPA 3OZ6A 3HAVA 2XIZA 2RFSA 3ENMA 4KRCA 3CS9A 4GU9A 1JKSA 5EDRA 3P79A 1Q8WA 3QTSA 4MD8E 4E4LA 3HKOA 3L9LA 3WBLA 3CE3A 4S30A 4FT7A 2RIOA 2VNWA 4C34A 3I60A 4U9AA 2XKFA 4KIPA 4AW0A 4ZTNA 5HG7A 4ACMA 3EQGA 4TTHB 3F3TA 2R3IA 3FKOA 3KK9A 3OOMA 1H24A 2WQMA 4XOYA 3RWQA 3U87A 4EK5A 4QP8A 5I3OA 4BDAA 3C4ZA 3BHVA 3QD4A 3LLAA 3OTVA 2HY0A 2PVMA 3NUUA 1UU3A 4LFIA 3AKJA 2PZYA 2IO6A 3R1SA 3L9PA 3ZRKA 4QMOA 5GZAA 2WU7A 3UG1A 2IN6A 2C69A 4JDHA 4FTMA 2OI4X 4GKHA 3DAJA 3P7AA 4IE9A 5TO8A 4RC4A 3BU5A 5HNGA 4ZMEA 4TWPA 2R0IA 1M7NA 2WMQA 4O4BB 4UMTA 3G15A 4FVRA 4KBKA 2P55A 5LMKA 4G2FA 3MH2A 3PY3A 2YABA 4A4XA 5HVKA 3ULIA 3HV6A 4EWHA 5IQBA 3R71A 3C7QA 4L46A 3D4QA 4QYFA 1W84A 1ZMUA 3NCZA 3TNHA 3FLQA 3RHKA 5BVWA 3OVVA 2XVDA 4IWQA 4M7IA 3ODZX 3Q4UA 4QP1A 1CSNA 2QNJA 3BHUA 4HCUA 4IM2A 2PUNA 1Q41A 5CVFA 3R9OA 2XF0A 3H0YA 2O8YA 4M0ZA 4DFZE 2R5TA 4TW9A 4EKKA 3SA0A 1VJYA 4O4EA 4R1YA 4BN1A 1MRVA 4UZDA 5HQ0A 2I0EA 4O7RA 1IEPA 4EL9A 4JDKA 4BDGA 2HWPA 2F4JA 4FZ6A 3RPOA 4ACGA 5F4NA 4B9DA 4C57A 4YR8A 3TUDA 4CCBA 4O4FA 4QQTA 3GB2A 5IEVA 3BKBA 4YZMA 4DFBA 4L3JA 4QT1A 5ANOA 3AQVA 4HZRA 5CZIA 4YP8A 4HJOA 3HRBA 4X7QA 3VAPA 5M07A 3BIZA 4GYIA 5KMOA 3DZOA 3ZZWA 2Y4IC 3Q5IA 4CKIA 4TWOA 4GIHA 2QHNA 4KIKA 3B2TA 2OJJA 5FEEA 1PKDA 2RKUA 3NUYA 4L68A 5T68A 4KRDA 2QU6A 3OWLA 2YIXA 4FIEA 4IC7A 4O91A 5HIDA 3K3JA 4CG9A 2R64A 4NL0A 1S9JA 4PL3A 4UWCA 2RF9A 1PXJA 4JDIA 2ZM3A 3H9RA 5EOLA 2P33A 5CQWA 4FYOA 2C5OA 1JPAA 5EDQA 4ALUA 3W55A 4GK2A 2FA2A 4FZDB 2C6TA 3A7JA 3Q53A 1K9AA 4O27B 4XG7A 3ORKA 2XMYA 5JQ8A 1LP4A 3A7HA 5IA3A 3UQCA 1AQ1A 1FQ1B 2QLQA 3CJGA 4FKSA 5JZNA 5C03A 4UN0C 4WIHA 4XV3A 2I0VA 2G01A 4FSWA 2BHHA 4OBQA 5CI7A 4JL9A 1SNXA 2WELA 5DRDA 3E8CA 2PZRA 2ZV7A 5CU3A 4C4HA 3FZOA 3OT8A 1OPLA 5BYLA 2W9FB 4NH1A 3BLQA 4DEGA 4FIJA 3CY3A 2VO0A 3F7ZA 4K9YA 5K5XA 3TMOA 3AXWA 3JVSA 2PZPA 3COHA 2RG6A 3II5A 5FXQA 2PL0A 4NK9A 3A4PA 3NX8A 3Q9YA 5LWNA 1M17A 1M2QA 4L9IA 1UNLA 3WZDA 4F9AA 3MFRA 4AFJA 2R4BA 3UC3A 2Z8CA 5AP6A 2OZOA 4USFA 2OG8A 1GAGA 3GFEA 2XNMA 2YM4A 3ITZA 3KXZA 2JEDA 4CZYB 2ITVA 3KXXA 5KMMA 3QZHA 3QF9A 4XRJA 5DEWA 4ERKA 3Q2JA 3QC4A 3F61A 3DPKA 3DK3A 4M66A 4WUAA 5DIAA 2FVDA 2PSQA 2J4ZA 4FF8A 4AS0A 2C6LA 5HX6A 4JS8A 2W06A 2UZLA 3H30A 2W99B 5LOHA 2PPQA 3QQLA 3QX2A 3BQRA 3ZM9A 2XKCA 5IQHA 4QMUA 5LQFA 1YXXA 3G6GA 1O6YA 2VO7A 3OEFX 4L7SA 1TQIA 3GCSA 3TKHA 2WQEA 5DR2A 5C8MA 3W10A 3BI6A 2YIYA 4WSYA 4XV1A 1CKPA 4FG7A 4FV9A 2ESMA 3A7IA 2OLCA 3SG9A 2BIKB 4ZTLA 4ANQA 3RTPA 3JVRA 4YGAA 3HV7A 3Q32A 3BX5A 1CKIA 4R7IA 3PJ2A 4QNAA 5AUWA 4RX8A 3ZC6A 5CF8A 5IQDA 3UODA 3ZFYA 2F49A 2OZAA 2YWVA 4K1BA 4D2PA 4EOMA 1BX6A 3LAUA 4BBMA 2BROA 5D7AA 5BVEA 4FV4A 3LFSA 3QCQA 4C4IA 4ZLYA 5E8YA 2EB2A 4IFGA 3U6JA 4TPTA 4JNWA 4F78A 3WILA 1SMHA 4E6AA 3W0QA 4BIEA 3OD6X 4O38A 4GH2A 3KVXA 4QQJA 2VWBA 3R1NA 4RJ4A 2R3FA 4AF3A 4O0UA 4D55A 2VWYA 4G3GA 4O96A 4C58A 2VWXA 3ZU7A 3Q9ZA 3G2FA 3ZM4A 4CFWA 4J8MA 4Z55A 3W2PA 4KKHA 2XCKA 5L2SA 4IW0A 4LV7A 4I41A 3Q6WA 5AIRA 3PTGA 2RGPA 3SDJA 2BTRA 1KSWA 3KMUA 3MB7A 3NIEA 2PVFA 4AQKA 3CLYA 3SW7A 3FZPA 4OR5A 3TZ8A 3P7BA 3D7TB 2VTJA 2CGVA 4JRVA 4U5JA 3NPCA 4FZFB 3VWAA 4B8MA 1L8TA 2YZLA 3FWQA 5DYJA 3UOKA 1JOWB 2IVSA 4ZXTA 2YM8A 4RC3A 5FLFA 4QMMA 5CQUA 4JR3A 3FJQE 2JAVA 3BLHA 5DR6A 4BB4A 4G17A 3VS6A 5AAFA 2C1AA 1KE7A 1OPJA 5IA1A 3ULZA 4XLVA 3FE3A 4O4DA 5JMSA 4PTGA 3ZO2A 2CPKE 3Q9XA 3RM7A 1TVOA 2V7OA 4FK3A 3FYKX 3MH3A 4FTLA 3A8XA 3SC1A 3IK3A 5C26A 3KKVA 1J7LA 5D11A 4EC8A 3DKOA 4RIXA 1YDSE 2LGCA 4IX5A 3NUXA 4QDEA 4MXOA 3K5UA 4DTAA 4GS6A 1W2DA 2X7GA 3AD4A 3O50A 1ZARA 2QOLA 3QL8A 4WO5A 5G6VA 4J53A 4U42A 3MA6A 4ERWA 4O7WA 1YXSA 3ZMMA 3TYKA 3CCNA 4X0MA 3ENHA 4ZSAA 4QQCA 3D0EA 2I0YA 2W1ZA 2OBJA 4FV5A 2HXLA 2BRHA 4RG0A 3QRJA 1U4DA 4W4VA 4E6QA 4IZYA 3BCEA 4LV5A 3KMMA 3TT0A 3IOKA 4KNBA 3CQUA 1AGWA 3QWJA 2OO8X 4HYHA 4JBPA 4QYHA 4QYGA 1IAHA 1TFFA 5C4LA 3KRLA 4QMLA 2V22A 4IWOA 4BGQA 3FMLA 4AZFA 3R30A 4GT5A 4DEIA 4G6NA 3A99A 3EIDA 3LIJA 4GJ2A 4CXAA 3S3IA 1WAKA 1J3HA 4PDSA 3UDBA 5CF6A 2CCIA 3EJ1A 1W2CA 1TKIA 5CEMA 4K77A 3PDTA 4X6RA 5EQEA 4L52A 2PMLX 1Q8UA 2RSVA 4LRMA 3LMIA 3HLLA 5I4NA 5JK3A 2ZV9A 5CAQA 2QI8A 4D28A 4MXYA 2FSOX 5HNIX 4XOZA 4FG8A 2IW6A 1G8SA 2BKZA 3FDNA 4FR4A 3MFSA 3SRVB 3BL9A 4EZ3A 4F6UA 3PJ3A 4O83A 5LCKA 3C0HA 1R0EA 4DA5A 2B4SB 2UV2A 5E8XA 3EYHA 2HW7A 3F7WA 2XS0A 3G51A 4O6EA 5AFVA 3E5AA 2WQNA 4BR3A 4PMSA 3E3PA 3FLZA 5AMNA 5HU3A 5GZ8A 3AC8A 3FLWA 1FBNA 1GZKA 3KEXA 3AMYA 3O8UA 3NMUF 4TWNA 4QP2A 5TT7A 3VBWA 1J1CA 3CPBA 5CEPA 5EH0A 4C61A 3PP1A 2BZJA 2QOKA 2XBJA 3QZFA 4Q5EA 3V01A 1XBCA 3BHHA 4R78A 5DG5A 3QBNA 3Q52A 3VUGA 3AGMA 3GCQA 4ZJIA 2XK3A 4I5MA 3A62A 3P86A 3PY0A 3ZH8A 1DAWA 1OL5A 3EZRA 3CIKA 2BFXA 2OJ9A 2ITNA 1PXOA 3PXFA 2H34A 4Q9SA 4BDEA 3Q3BA 4XX9A 3MJ1A 5BVKA 3SAYA 2YJRA 4IAIA 3QAME 3N4UA 4NUSA 4DFXE 1QPEA 1YDTE 4JR7A 4AGCA 1ATPE 3GI3A 4OTFA 4GT4A 2XBAA 5AR3A 2OXYA 5J8IA 1RE8A 3ELJA 3LM5A 1YDRE 2HOGA 4XG3A 3NW7A 4BCPA 1XH5A 2R3JA 3GU8A 2BTSA 4CD0A 3MV5A 3BWFA 5AAGA 1G5SA 5FDXA 2GFCA 3Q2MA 1BI7A 1REKA 3OHTA 4K2RA 3PXKA 4NFNA 5A54A 3NS9A 4CMUA 3LOKA 4MHAA 5A9UA 4PX6A 1P14A 2I40A 4F63A 3NNWA 3C9WA 3HUCA 5HIEA 3M1SA 3VUHA 3QYWA 5J5TA 3ORLA 3KMWA 5KX8A 2VNYA 4L8MA 3CQWA 2NNWB 5F1ZA 1XH7A 1YHWA 3LPBA 4FIGA 4MAOA 4DLJA 4CLJA 3DZQA 2PTKA 3FSFA 4BWXA 4P7EA 5DT4A 3FSKA 4UY9A 1CM8A 3NUSA 4FL2A 4DYMA 2X8EA 4JMQA 4TWCA 3NUAA 4KKEA 1BYGA 3EB0A 3KULB 3GU6A 5CS6A 2JKQA 3AC3A 4ENYA 4IAKA 3NVMB 3GNIB 3I0OA 4ZIMA 5EW8A 2I1MA 2YN8A 2C0IA 2GFSA 2C30A 3MTLA 1J7IA 1W0XC 2GNIA 3SKCA 3SVVA 2QO2A 2C5XA 2VTSA 3EQBA 2XJ2A 4ZSJA 4WRGA 4RA5A 4UYAA 4AW2A 4FKWA 2UW5A 1H1RA 1DI9A 4CRSA 5AUTA 5LXMA 2O0UA 2VTTA 3BEAA 4E26A 5K9IA 1PMEA 2PK9A 3T9TA 4TYHA 3IDCA 3NW6A 3U4UA 4UV0A 3FZTA 2GNLA 3AT3A 3R8ZA 3TJDA 4FKOA 2JDTA 5CAPA 4YZBA 3WYYA 4D2TA 4U80A 3RP9A 1E9HA 4CKJA 2WU6A 2VWWA 4MD9E 3R8MA 3UZRA 2ACXA 3RM6A 4AAYA 2Z7SA 4NTSA 5E8WA 4G9CA 2XKDA 4O7LA 4KS7A 5J87A 4ASXA 3PPKA 4JQ7A 3VS4A 1Q99A 4USEA 4V05A 1IAJA 2EUFB 2QU5A 1WMKA 4PTCA 5DR9A 1UA2A 4IMYA 1PYEA 3SOCA 1URCA 4Z3VA 4L01A 4GK4A 3FPQA 2WMAA 5AM6A 2VUWA 4FGBA 5AV2A 1PMNA 4BZNA 4RRVA 5AUUA 3PJCA 2OH4A 5IG1A 4JG8A 3QD2B 4FTQA 2B9HA 3R02A 3VHKA 1JLUE 3FZRA 4Y5HA 2BR1A 3D9VA 4U41A 4UYNA 3DXQA 4M67A 4IWPA 5IZFA 4JRNA 5BUJA 2GQRA 2IWIA 2BZKB 3W8QA 2W1IA 1UNHA 2JDVA 3BV2A 3KXGA 4LG4A 4QYEA 4W4XA 5IA5A 2IZTA 4BDDA 2QOOA 4O84A 3R9NA 4LL0A 4KUJA 3HMMA 1JWHA 2WMTA 5DGZA 3UOLA 1R1WA 2GU8A 2WEIA 2QR7A 4IVCA 2YCFA 4AA5A 5E91A 5GJGA 2ITZA 2HCKA 3UTOA 2WGJA 5AAEA 3PJ1A 3NYOA 5L2IA 4U8ZA 4FV2A 2BFYA 4FIFA 3BYOA 3CP9A 3AD5A 3R8PA 3NFFB 1GOLA 2ZM1A 3QA8A 4HZSA 1YHSA 3NDMA 3AKLA 1UWJA 4JQEA 1APME 2UW4A 2WXVA 4ZOGA 4RA4A 1CMKE 2WMUA 5CSVA 3ZXTA 3PJ8A 4BF2A 2IPXA 2X4ZA 2XYUA 3HYHA 5HI2A 4F4PA 4IDTA 5AEPA 2R7BA 5FBOA 1UU7A 2X2KA 3OXZA 3WIKA 3V6SA 4A4LA 3JYAA 1JVPP 4M13A 4WRSA 4XBUA 3MA3A 4EHVA 3R01A 4OTWA 5LMBA 2VZ6A 4D9UA 4WOVA 3PRFA 1SYKA 2OICA 3L8PA 4X2JA 3IS5A 3IW5A 5TR6A 3KVWA 1XJDA 3JY9A 3SV0A 4E4NA 1Y8GA 2ETMA 3SHEA 4KBCA 2JIIA 4YHJA 2ETRA 3LCSA 4FGRA 4RX7A 1PF8A 3FXWA 2G1TA 4FYNA 2XUUA 4F0GA 2VO3A 4ORKA 1WBVA 2WMRA 2WFYA 2H6DA 2XYNA 3DKFA 4R7HA 5HO6A 5LVNA 2WMBA 4TNBA 1OIUA 3KXHA 3PA5A 5HORA 5KHXA 3RZFA 1MRUA 4RFMA 3ZLXA 2CKQA 4BI1A 4DCAA 1UNGA 2VU3A 4DN5A 4TY1A 2ETKA 4U43A 4YC6A 2W5BA 2H9VA 5EYMA 4AXCA 4AXFA 4E4MA 2BRGA 2OIQA 3IW4A 4JXFA 1M7QA 3QQHA 2VTAA 3DAEA 4NCTA 5DOSA 5DRBA 2W1CA 4Q9ZA 1BKXA 2W7XA 4K33A 1DM2A 4D9TA 2PUUA 4QD6A 5C27A 1PY5A 4F99A 1WVXA 3FBVA 1MQBA 2FSMX 4BCGA 3KRRA 3QQFA 4MF0A 4AW5A 3BGZA 4MBLA 5EOBA 4A9RA 4JIAA 2SRCA 1GIJA 5FD2A 5LJJA 5EQYA 3MPAA 2DYLA 1KOBA 4IZ7A 4OLIA 3DB6A 2VWUA 2H96A 2GS6A 3ORNA 3VS7A 4D2RA 5BPYA 3D14A 4F64A 2RFDA 3PLSA 5HD4A 4FEQA 5AUYA 2GTNA 3PP0A 5J5SA 5DT3A 4DEBA 5CEOA 2C5VA 2UW9A 1H01A 5HHWA 1H26A 3KU2A 4U40A 4JLCA 3KIOC 5DBXA 4EYMA 1YXVA 1XH6A 2XK6A 4PUZA 4OBPA 4BCQA 3OCTA 4PMMA 5L2QA 3ZDUA 3DJ5A 5LARA 5CANA 2HXQA 3ATSA 2WNTA 1H07A 3R8UA 2VTMA 3KGAA 2BDWA 4JBQA 4NSTA 4CRLA 3EFLA 4PL4A 5IF1A 2PMIA 4AFEA 3JPVA 3GC0A 3ZONA 3TTJA 3SW4A 2PU8A 3BGPA 2YDJA 3NYVA 2ERKA 4AZEA 3ZUTA 3I6UA 4J96A 4V0GB 2YAKA 3A2CA 2OKRA 4BJJB 1PJKA 2C0OA 3UO6A 4EH4A 5IA0A 3E8NA 3KRXA 3A8WA 3I0QA 2GNGA 3PXRA 3VRYA 3QHWA 4OAUC 4DFNA 2GNHA 3PUFC 2W1HA 3V6RA 2I6LA 2W4KA 4PP9A 4HNIA 3D2KA 1BUHA 4U44A 3UPXA 4O0VA 5HD7A 1OPKA 4XP0A 4U97A 1NVSA 2ITQA 3UNZA 3ZLWA 1YWNA 5DVRA 2GQSA 2Q83A 4CFXA 4QRCA 2HIWA 4CCUA 4JX3A 3K2LA 4F9BA 3CBLA 3QYZA 5HNBA 3OWJA 2UZOA 3IONA 1GZOA 1M2PA 3CKXA 1ZWSA 1CTPE 4FVPA 3QA0A 4RWJA 3PIXA 3ZCLA 4O0RA 4I6FA 1Z5MA 5C9CA 3RGFA 4DC2A 5J9YA 1YOJA 3EQHA 3Q4TA 5ACBC 4MXAA 4BCOA 4WG3A 4BWPA 4XBRA 3Q4ZA 2EU9A 4FT5A 4RJ7A 2GQGA 3C4WA 2PYWA 3CEKA 3M42A 2JBOA 3ORXA 2QKRA 4GSBA 4ID7A 3CSVA 4N57A 3CQEA 1FGIA 4GKIA 3OS3A 2YISA 4H1JA 4NT4A 3SG8A 4E73A 3BL7A 1H25A 5IH6A 4BDJA 3U8WA 4J98A 4ITHA 2XNPA 4XV9A 2Z2WA 4FX3A 4L42A 4YJRA 4CGAA 3ZBXA 2WMVA 5HG5A 1V1KA 2WMSA 3ZTXA 3ZYAA 5FP6A 4DITA 3MB6A 3AMAA 5IQGA 3CJFA 5BUIA 4GUBA 1ZYDA 4FE2A 2OF4A 1YKRA 3EN9A 3IDBA 2YM3A 5FRIA 2CMWA 1MP8A 3FY2A 4I22A 3VS3A 3QFVA 3WZUA 3FC1X 4F0IA 3ALNA 4MQ2A 5H2UA 3TUBA 4G5PA 5CSWA 2A0CX 4XG8A 2O63A 5EHLA 4V01A 4DEEA 1PXKA 1RW8A 2JDSA 3A7FA 2QLUA 4Y8DA 4EOQA 2X2LA 3OXIA 1SZMA 2W96B 4BHNA 1M2RA 1VR2A 3LW0A 4MXZA 4WNMA 4XV2A 4F7NA 4OAVB 5E9EA 3F3UA 2W5AA 4YJVA 2YIRA 2XK7A 2DUVA 4AA4A 2B53A 4AN3A 1Q24A 3MWUA 3TM0A 1YHVA 3N4TA 5HVYA 4ZZMA 4Y5QA 3TG1A 2F2CB 5FP5A 2V7AA 1XQZA 3BV3A 3MS9A 4FNXA 4YC8A 4BGGA 4BWKA 4AXEA 1QCFA 1XWSA 3DDQA 3DLSA 1V0BA 3DNDA 4IEBA 4H3QA 2B54A 5KKRC 3W0MA 2VTQA 2VWVA 3CD8A 3HDNA 2JBPA 3W0RA 3M2WA 4Z7HA 4M69B 3OW4A 2Z60A 1OKVA 2BHEA 3CR0A 3KB7A 2XKEA 2XRWA 4L7FA 5DWRA 1OIRA 3LM0A 2UUEA 4BCJA 1W83A 3KL8A 4CZTA 2FH9A 5L6PA 2ZJWA 2WTDA 1ZYLA 3DK7A 2OF2A 2F9GA 3G0FA 4L53A 4EOIA 2PMOX 3F5UA 3FMJA 2HZNA 4FK6A 3PSDA 3E93A 4EOJA 2HELA 2CKPA 4B7TA 5J9LA 3WYXA 3HV5A 3FEGA 3LCTA 3IOPA 4H39A 4QMQA 4MWIA 2XANA 4YJPA 4N4SA 4IVDA 4EORA 1OGUA 2C6MA 5CNOA 3SLSA 4C2VA 2AUHA 4ZJVA 4ZJJA 5AV4A 4NTTA 4M8TA 1SVGA 2OJIA 3E7VA 3PRIA 3FLNC 3T9IA 5HZNA 2GMXA 1WBTA 3MJ2A 5FUTA 3HA8A