3DBDA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 094
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
287
structure length
261
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase 1
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 73
structure length 261
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbdA01
2CNVA 3VJOA 3PVWA 3ORLA 5ICPA 4BCOA 4R1VA 2BZHB 3C5IA 3R7YA 2C0OA 2ETKA 3BE9A 3BV3A 3BRBA 3HUCA 4GK2A 4YPSA 4FV1A 5DNRA 3ZUTA 4CZYB 3KREA 3ZM9A 5EK7A 4JRVA 4W9XA 2A1AB 3UOKA 5DEYA 5L8KA 3RZFA 3QA0A 4LRKA 5CX9A 5GIPE 3QU0A 1XH8A 4FKOA 4BCNA 3TNHA 2AYPA 2RKUA 4HGEA 4WBBB 4RFZA 5CEQA 2P4IA 3F3WA 3KULB 4FSNA 4Y5HA 2ITPA 3PSDA 5AAGA 5IUHA 3E5AA 4L43A 4KA3A 1LEZA 2F49A 2SRCA 3KXXA 4XMOA 2IWIA 3R28A 1XQZA 2RSVA 2VO0A 3DDQA 4FSRA 3C0HA 4L52A 4WBOA 3ORNA 2VTJA 2W5BA 5HLPA 1OPKA 5EI8A 5IQIA 5HX6A 2UW6A 2J0KA 5C9CA 2DS1A 3Q4ZA 5CF6A 4UEUA 2QOQA 2VTIA 3EQCA 2IPXA 3G6HA 3ULIA 3VBWA 4F1OA 2XNPA 5D11A 5IDPA 4LGHA 5EDPA 4F6WA 4FEVA 5JGAA 1HOWA 4DGMA 5LWNA 4AT3A 5A4EA 2XIZA 3V5LA 5EHLA 1JAMA 2XM8A 4FTUA 3UDBA 4L53A 2JDRA 3W18A 2WQEA 3NVMB 3GVUA 3RTPA 3MY1A 3R9NA 2VNYA 3HV3A 4ACGA 4GU9A 3UPZA 3KQ7A 4Z3VA 3BX5A 3KRXA 4R3PA 4PP9A 2YWPA 3TUCA 2WXVA 2C6TA 4JS8A 3BHTA 4QP1A 3H9FA 5AX9A 3VBYA 4AE9A 5J9ZA 3OY3A 3DBCA 3C4XA 3Q2JA 2J5EA 3LE6A 1MRUA 5KMMA 3KXHA 4XV1A 5DFPA 5HU9A 3FQEA 1FBNA 3H9RA 4IVCA 4FT5A 5EHYA 1JSUA 4IZ7A 4EOQA 3EFWA 2C30A 2BR1A 4J99A 4ZS4A 1LP4A 2OSCA 4G2FA 4HCTA 3VS5A 3KL8A 5ETCA 3AD4A 3LAUA 4WG4A 3PY0A 3VS6A 3MH3A 4FIEA 4OTFA 5HLWA 2YFXA 5CNOA 1YKRA 3Q9YA 1XH5A 3PPKA 4C4EA 2R3PA 4NZWB 3RBWA 2C6MA 2GS6A 4UB7A 3ELJA 3KCKA 3ANRA 3OWJA 2ZV2A 4E6QA 4WHZA 5EDRA 3GU5A 3KN5A 4C34A 4MKCA 4IWDA 1OIQA 2VTPA 2XNMA 2YM7A 3LCDA 5A6OA 5JH6A 3W32A 3E8NA 3MN3A 4ANBA 2W1DA 4MK0A 3NUSA 5HOAA 5CEPA 3P08A 4ZMEA 3QKKA 4RIYA 3PE1A 1UU3A 4IMYA 3BLQA 5C8MA 5J1VA 3KK9A 5BNJA 1WMKA 2OU7A 3L8VA 3AC8A 4YU2A 2FA2A 4Y85A 1JSVA 4FNXA 3FLQA 1HCKA 2QU6A 5LMKA 4UMPA 3GNIB 5HE2A 3MIAA 3C4ZA 3CEKA 3MSSA 2YISA 4NJDA 4MWIA 4FL1A 3LFEA 4BDKA 4R5SA 5LOHA 4FSQA 2UW7A 4UYNA 3PLSA 5HKMA 1VZOA 3AOXA 3D15A 3KF7A 2VTNA 4DH3A 2CGVA 3CKWA 4S34A 3UIBA 2UZNA 2XNGA 3Q53A 4ZTNA 2OICA 2OLCA 4O96A 3U55A 4ZK5A 4L46A 1UWJA 4ANLA 4BDAA 4YURA 5LVLA 2W05A 3R9RA 2WOUA 5EH0A 4ERKA 4U40A 4BIDA 1OL7A 4TT7A 3QUDA 2QI8A 3S4QA 3OXTA 4L8MA 4HVSA 3FDNA 2PZYA 5E91A 1CKPA 5DPVA 3E7VA 2VTOA 4L3PA 3RVGA 1ZYDA 4FOBA 1NY3A 1WFCA 3RPVA 4FKPA 3VQHA 3V5PA 3NLBA 5A9UA 4Y5QA 5DT4A 5IKWA 3ZRMA 4FKWA 4CD0A 4QMXA 3UC4A 4G3CA 4R3RA 3FSKA 3PLAE 3CPBA 4HYHA 4U44A 3MH1A 4J8MA 3WF5A 5EQPA 1R0PA 3I81A 3PXFA 5IQHA 3HLLA 3EQDA 3TNQB 2IJMA 3CD3A 3UPXA 3BLHA 4DEHA 5BMSA 3DK3A 4FKJA 4L6QA 3LXLA 3RNYA 1JPAA 5AADA 4BDFA 2QU5A 4DTKA 3OEZA 3R00A 4YTIA 3I7BA 5CSPA 5AUVA 4QRCA 1W0XC 1J1BA 5TR6A 3R2YA 4ACCA 3BWFA 4CG9A 3BI6A 3NUNA 5LVNA 2FO0A 4EOKA 5BYLA 4EH5A 5IG1A 5M4IA 4A4OA 3ZRLA 3TN8A 4CEGA 4FTLA 4CFNA 3VF9A 3I5NA 3U87A 1MRYA 4IB0A 2J7TA 3DTCA 5IQDA 3QCXA 4YBKA 3R8ZA 2CNQA 3MFUA 3VIDA 4W4YA 4ARKA 3Q5IA 2OIQA 4YPDA 4G5JA 4YO4A 5D41A 4RA5A 5CAVA 1JBPE 4GUEA 4IHPA 2ESMA 2VX0A 2H9VA 3MH2A 5K0XA 5IA1A 4QMSA 3G2FA 4BDIA 1SMHA 4WIHA 4DITA 4EOOA 1BI8A 4FG9A 5H8EA 5E4HA 4U5JA 1FPUA 2X7GA 4HZSA 4CT2A 4S2ZA 4FE2A 2QCSA 3ZZEA 3KXNA 4H1MA 3QTXA 3SOCA 5HLNA 1YQJA 4FKRA 1BI7A 3Q04A 3D83A 1Q3WA 1OGUA 3PJ2A 3UIMA 4E4XA 1URCA 3NDMA 4BHZA 4Z7GA 3MIYA 3DLSA 2EWAA 4TN6A 4D2TA 5J87A 1WBNA 3OF0A 5AA9A 1I44A 3JUHA 1OIUA 2HZ4A 4J71A 4PY1A 4XNEA 2BDWA 4Y95A 3V3VA 1ZYSA 4ZY6A 3KFAA 3NGAA 1PXLA 2R3GA 3QA8A 3QTIA 4WA9A 3MTLA 3KMMA 3VUHA 1Y8YA 3AG9A 4CT1A 2R7IA 3BIZA 3TTIA 4GS6A 2JBOA 3F2AA 3OBJA 4D1SA 1OPJA 2WU6A 4EK5A 2VNWA 5KX8A 1K3AA 3UYSA 2V22A 4GVAA 5AM7A 4R8QA 4TYJA 3TZ9A 4AA0A 4FKTA 3F3TA 3QTQA 4GT4A 4MWHA 4EOJA 3LCTA 4HNFA 4DFUA 3VF8A 2FGIA 4EZ7A 4EOMA 4E7WA 4K0YA 2JDOA 3IGOA 3OCGA 3R02A 2X2LA 1GIIA 5JZNA 5I9ZA 2CGWA 4HPUE 3EJ1A 3IW6A 3D5XA 4WKQA 4JJRA 4R78A 3L9PA 3UZRA 3HGKA 3QD3A 4DH5A 2VV9A 5A6NA 2YCQA 3GU7A 4HPTE 2CMWA 2OH0E 5EM5A 2PHKA 1PYEA 1J7LA 5TO8A 3QZGA 5GZ9A 4C4FA 3S1HA 4O86A 3Q4TA 5IMEA 2UW5A 2V7AA 3UBDA 4GJ3A 3UODA 4IX5A 5FTGA 1B6CB 3HP2A 3DY7A 4FUXA 4KIOA 3TACA 4MF1A 1H8FA 4OTGA 4ANQA 4PNIA 3IKAA 5HCZA 3FI2A 1ZYLA 3NIZA 5EHOA 1SYKA 4KIKA 3D9VA 4FV8A 5EW9A 4PMPA 4S32A 3C5UA 1AQ1A 2VD5A 3EZVA 5M51A 5FTOA 2JKQA 3GT8A 4L3JA 2WELA 3IDPA 4YTFA 2B52A 4AE6A 4QP4A 1OI9A 2VWYA 3Q2MA 5L6WL 4CQGA 2VTMA 2R3MA 5LVPA 4O81A 4ZTQA 5L2SA 2FVDA 3IG7A 4M66A 3RM7A 4NKSA 5JMSA 4Y46A 3KRLA 1P2AA 4MXCA 2IZTA 2W1FA 3PG3A 4F0GA 5EM7A 1PMUA 5HTBA 3UIXA 3F3UA 5CT0A 1Y8GA 3FL4A 4HGTA 2BAJA 5HD4A 3PXRA 3FAAA 3EQRA 4Q5HA 4G17A 2QOOA 4CMOA 2GSFA 5CEKA 2XCHA 4FVRA 3RWPA 4YR8A 3CBLA 3S2PA 2VO6A 4IB3A 2B55A 2C69A 4ZJIA 4USFA 1L3RE 1ZYJA 3NR9A 5AP7A 5A54A 1UU7A 3ODZX 2HK5A 1YDRE 3QRKA 4XOYA 5CXZA 4QTEA 1YXSA 4EC8A 4V04A 5KBRA 5FUTA 4JBQA 3HL7A 1RE8A 3EYGA 4OT6A 2DYLA 2J51A 2YM5A 3NPCA 4NTTA 4PMTA 4RC2A 4V01A 4JXFA 4DFNA 3ORZA 1H1PA 4DG3E 4EOSA 5F9EA 3D4QA 3O0GA 2YIXA 5HTIA 1YOMA 3ZSHA 2GNJA 4K8AA 2BIKB 3IDCA 4FKUA 5LMKC 3BYUA 4XLVA 4YSJA 5JFSA 4DEEA 4X2NA 4YHFA 5D9HA 3NUAA 1PXKA 4RGJA 4BZOA 2YLEA 4C35A 4JT3A 3COKA 3OW4A 2B54A 3RGFA 1JQHA 2XK7A 3P1AA 4BWPA 2GFSA 4FT0A 4U97A 3R7UA 5AR7A 3RPOA 4YHTA 3W2QA 2XF0A 4ITJA 4BGQA 4ASZA 2R7BA 3NX8A 3ZCLA 5K5NA 4G1WA 1OUYA 2BRNA 4JQ8A 4W4VA 5DHJA 3O2MA 5JSMA 2YLFA 2IZRA 4GH2A 4NSTA 5FEEA 4BCPA 1E1VA 2FB8A 4FSMA 3I0QA 4MEDA 3F88A 4ORKA 3M2WA 2J4ZA 5CAUA 2AC5A 4FTAA 2GPHA 3QC9A 3R7EA 4A4XA 3AGLA 3DLZA 3W10A 5CSVA 3FQHA 4QYFA 3D14A 1Q4LA 2IN6A 4F9BA 3FI4A 2IZUA 4XCUA 4HGSA 1ZOEA 1V0BA 1YWNA 4FOCA 2BMCA 3IO7A 4CZTA 3R7VA 5E8VA 4F7SA 4GG7A 2CKOA 3PE2A 4DINA 3CQEA 2Y7JA 3HUBA 3FKLA 4JBOA 3G0EA 2CGXA 1IA9A 2OJGA 3D0EA 5CALA 2CKPA 2R9SA 4YSMA 3V5WA 4DAWA 4A7CA 2BRHA 3GI3A 4IAKA 4NM0A 4V05A 4UXLA 3BEGA 1J3HA 3PWDA 4TYIA 4ASXA 1F0QA 4UXQA 4M8TA 3VUIA 4IANA 3SV0A 3ETAA 5AA8A 5H2UA 1WCCA 1CTPE 4RVTA 3D5VA 4ZZNA 4RIWB 4YHJA 1H24A 3KMWA 3QZIA 2YM6A 3BGZA 2VGOA 4YJRA 2R0UA 3DAKA 3P7BA 4PV0A 2F7EE 3WZJA 3TG1A 4E5AX 3LJ0A 5H3QA 1H08A 1IASA 3E63A 3D7TA 2UZEA 5HORA 4FEUA 2WKMA 2Z7RA 3B2WA 4OBOA 3JXWA 4ZSGA 3U4UA 2ERKA 4AZSA 3RPRA 3MV5A 5JRSA 1NA7A 3I5ZA 2GHLA 5IQFA 2B9JA 2C6EA 3R1QA 5AR2A 2IW6A 2GS7A 4BIEA 4EK8A 3WYYA 3LFBA 4X3FB 1FGIA 3VBQA 2PMOX 4BDCA 2GTMA 2WTWA 1Y57A 3KXMA 5JEBA 4BCQA 4BKJA 3A7HA 4APCA 4EWHA 3DU8A 5ACBC 4RA4A 2VTHA 3PSCA 1PYXA 3PIYA 5IUIA 4P5QA 4D2VA 1JKTA 3EL7A 3QCQA 4YNEA 3ZS5A 5DGZA 2QURA 1W7HA 4EH6A 4DCAA 4Z9LA 1SZMA 2C1AA 4OTRA 1Q3DA 3Q6UA 4M69A 4PL4A 2A0CX 4NU1A 5CF4A 1EH4A 2RF9A 1JSTA 3AD6A 3H0YA 4TWCA 4YC6A 2PZIA 2C5OA 4FV9A 5CVFA 2VWVA 5DR6A 2XK4A 3KGAA 4BF2A 4TNDA 4J1RA 4U79A 3FXZA 4GIHA 4GJ2A 5AR3A 2BCJA 1GZ8A 5CU0A 5HVKA 3HKOA 3BYMA 1PMEA 1U59A 4M14A 4BCFA 4LYNA 1K2PA 2ZVAA 4KKHA 3C50A 5EOLA 3JR1A 4L68A 4AUAA 3VS2A 4C58A 4GIIA 3EFJA 3RM6A 1H1WA 2X7FA 5FLFA 4XG4A 4EJNA 3FE3A 2IG7A 2OH4A 3VHEA 2W1HA 3H10A 3THBA 2G1TA 4BBMA 4RRVA 1H27A 3D5UA 2LGCA 4RZVA 4F65A 4EHZA 5BPYA 5I0BA 3TDWA 1XBCA 5HCXA 4KABA 4DH8A 3VBXA 4KB8A 4KUJA 5IQGA 3BWJA 3MJ1A 4CZUA 4C38A 3GENA 3U8WA 1FQ1B 4DFLA 4XP3A 4O7RA 1U54B 4FR4A 1UU9A 1B39A 1F3MC 1VEBA 3COIA 3AC4A 4DLJA 5CZHA 5GHVA 3O8TA 3RALA 1Q8UA 1H26A 4FIHA 4C0TA 2HAKA 2X8DA 1WBWA 2ITNA 3GQIA 4XBRA 5C03A 3GU8A 5L8LA 3FPMA 4R6VA 2RFEA 4IVAA 4FEXA 4O82A 5HE1A 3F2NA 4AZFA 3LFAA 5KMIA 5L2WA 5M4UA 4I0RA 2F57A 3CJGA 3QHWA 4QMWA 5DA3A 1ZZ2A 1OL5A 1QMZA 4O0RA 2FSTX 2VAGA 4BL1A 5KKRB 2PVKA 5LCJA 3PYYA 2JGZA 4FICA 4CRLA 3UNJA 2PUPA 2J5FA 4PDPA 2G2HA 2W4JA 4X2FA 3DJ6A 3Q6WA 1HCLA 1ZAOA 4FC0A 4IQ6A 4XG6A 3ALNA 4BDGA 2C5VA 4PPAA 1H1QA 4EZ3A 2JITA 4BCHA 5IA0A 2EXEA 4N4SA 4D55A 5J7BA 4EHVA 2C3IB 4FTMA 4RG0A 4AT4A 3SQQA 2BAKA 2WTCA 3MH0A 4BI1A 4E4LA 3SRVA 4IEBA 1YRPA 4RWJA 4F99A 1FMOE 4CKJA 5I9UA 1YWRA 5A4LA 2QC6A 4FTKA 1JKKA 2YDKA 3H0ZA 3QD2B 4J95A 5KBQA 1YXVA 3A4PA 1OKVA 3DAJA 4ZOGA 2ITWA 4QP9A 3FLZA 4FG8A 3GCUA 3FUPA 3MI9A 4HNIA 1R0EA 5C01A 4D0WA 3VBVA 1XH7A 2BZIB 2QHNA 3R01A 1ZMUA 3SA0A 2BRMA 3G15A 3OXIA 1V0OA 3PA5A 4XG9A 3I6WA 3M1SA 2J6MA 2JIIA 5HICA 4X2KA 1LPUA 4MD7E 2VU3A 4B8LA 4CNHA 2OZAA 4RVMA 4LRMA 3DGKA 4AOTA 2R2PA 4ZSJA 5ITAA 5J5SA 2JEDA 2PE0A 4JX3A 1H4LA 4NTSA 4QNAA 3TXOA 4DFYA 5IA4A 3ITZA 4D2RA 3R7GA 2V0DA 4F64A 3NEWA 5HIEA 4GV1A 2XIRA 4IFGA 3QQLA 3F82A 3UO6A 5C4LA 2BALA 2KTYA 4M97A 3C4CA 3SX9A 5BVDA 3NCZA 4AGUA 3F7ZA 3QCSA 3HYHA 5AUWA 5HU3A 3PRFA 3W1FA 1DS5A 4DGGA 1UV5A 3GQLA 3ZUUA 1GZOA 3EB0A 2B53A 4C02A 4X3JA 3CGOA 2XJ0A 4HCVA 3WOWA 2GNFA 4BDEA 4D2WA 4I20A 5LQFA 3KC3A 5A4QA 3R9DA 4EJ7A 2RL5A 3C51A 3V04A 3KCFA 3TKUA 3CS9A 4F70A 4IX6A 3QRJA 5BVNA 5M53A 3RK7A 2VO7A 1SVEA 3KVXA 4IVBA 3P23A 3WZEA 4I23A 4QMQA 2YJSA 3CTJA 3C4WA 4A9RA 1OM1A 5JKGA 3BU6A 3HV4A 5D1JA 4H3PA 4F0FA 2F9GA 4FTIA 2GTNA 3PXKA 1M2QA 3KN6A 4ID7A 2HZ0A 2X39A 4IVDA 4JQEA 1BL7A 4MYGA 1A9UA 3UOHA 5K4JA 4AFJA 5J9LA 3V5JA 4RJ8A 4A9YA 4AGWA 2C3JA 2YDJA 3LLTA 4MNFA 4JVGA 4J97A 1YDTE 2C68A 2I0HA 4Y73A 3SXFA 5ANOA 4BZDA 4MH7A 4FSWA 2QOHA 3R04A 2UZWE 1Q62A 1YHWA 4P4CA 5TKDA 4U42A 2R4BA 5FEDA 5DR9A 4QQ5A 4MXZA 5FWKK 3BU5A 3DBEA 3FMDA 3IDBA 4U41A 4KAOA 4OT5A 4XG8A 4RLKA 1VYWA 2UZBA 3E92A 3FMKA 3LFQA 4QQCA 4YZNA 3RKBA 4C4IA 4O6EA 3RZBA 4EYMA 5AV2A 3ZLSA 3O8UA 3TV7A 1Y91A 4I4FA 3LKMA 4GVJA 4NKAA 1OBGA 4KBAA 4O91A 2VO3A 4I41A 2JBPA 5FXRA 4LQMA 4UYAA 3VW8A 4IWPA 2EVAA 4H36A 3UVPA 1H01A 5IQCA 5T3QA 2OJ9A 2BIYA 3K3IA 3UTOA 2H6DA 4FUYA 2QVSE 3HDNA 4DG2E 4X2GA 2NRYA 2WTKC 4NCTA 4DTAA 4JIAA 2ZYBA 4W9WA 2UW0A 4L7FA 4P5ZA 4UALA 2WAJA 3CXWA 2BDJA 4AW5A 3HAVA 1YI3A 4FBXA 1JKLA 2ERZE 3NWWA 4FZAB 2JD5A 2BTSA 3U9NA 1CMKE 2VTSA 3FBVA 1SVHA 4ACHA 5CF8A 2J2IB 4AN9A 3SXRA 4K11A 3N51A 3RPSA 2WHBA 4XV9A 2WMUA 4C4HA 4LMUA 4ZSLA 4CFMA 4RX8A 1BL6A 1LR4A 3N4UA 1K9AA 1PJKA 5IH6A 5AIKA 3R1YA 2WMSA 3ZO2A 1MP8A 3QBNA 3VNTA 4E4NA 3I7CA 2HYYA 3DCVA 3ZRKA 2P0CA 4RPVA 2B9HA 2PSQA 3L8XA 3QX4A 3ORKA 3CJFA 4V0GA 4J52A 3VULA 4TYHA 1KE6A 2UZUE 2XKDA 3LM5A 3QQFA 3QTZA 5D7VA 3WZUA 4EKKA 4EL9A 2HZIA 3K54A 4ANNA 4IAYA 5M56A 3R8PA 4CV8A 5AUYA 1J7UA 4JAIA 3O71A 3TNIA 4GKIA 2YM3A 4E73A 4YZMA 3FY2A 2OJFE 3O96A 3BGQA 2PY3A 4EK3A 3Q4UA 3QXOA 2JIUA 1YW2A 5HZNA 5AM6A 3ZHPC 3A7FA 4ZIMA 5CVHA 5CU3A 4CMUA 4O7NA 2VTLA 4CTCA 2OJJA 4FSUA 3LCKA 5AR8A 5K0KA 2YZLA 1NXKA 2BHEA 4RT7A 4YBJA 4HOKA 5FXQA 2QO9A 3DBFA 1QPEA 3KK8A 3R7OA 5JFWA 2HIWA 2HWOA 4FV6A 4XEYA 1OKWA 2XMYA 3W2RA 4OTIA 3G6GA 4W8EA 3TIYA 3MTFA 2R64A 5B2KA 3VUTA 5LVMA 2PVNA 5M06A 2OF4A 5EYCA 1TQMA 2E9OA 3W8LA 1V0PA 3W55A 4BCMA 4KKGA 4TY1A 2XRWA 4XHKB 5E1SA 5E8WA 2P2IA 3RWQA 3GC7A 4CVAA 5CI7A 5C1QB 1Q41A 1KWPA 1FVTA 1WVXA 2W1ZA 4TNBA 3TNWA 4AN3A 1IR3A 5D12A 3SD0A 4QP8A 4IZ5A 5HI2A 4Z16A 2XCKA 4II5A 2QOIA 3GEQA 4ZS0A 2GNLA 4QD6A 3R8LA 3G0FA 3TT0A 5IZFA 3QHRA 3OG7A 3OMVA 2ACXA 2CDZA 4J7BA 3CPCA 4WG3A 1OZ1A 4BVUA 4CXAA 1H1SA 1XBAA 2XA4A 4B4LA 2X1NA 5GZ8A 4RFMA 3L9LA 2CNUA 4JQ7A 4U7ZA 2B0QA 3QAME 4DBXA 5BUIA 5I4NA 2PMIA 5AJQA 2ITXA 2GFCA 1TQIA 3WBLA 4A4LA 5HBJA 5CXHA 4BCKA 3R1SA 1IRKA 2W96B 5FP5A 1R1WA 4FZ6A 1BLXA 4FKGA 4JR7A 4NWMA 4YJNA 3T9IA 1MQBA 4A9SA 2QKWB 4GK4A 3OHTA 4G16A 4IJPA 4EQMA 4MD9E 4OGRA 1WVYA 3MGYA 4WNPA 3LMIA 1ZMWA 5TE0A 3TJCA 3REPA 4TWPA 4QQJA 1KE8A 3LMHA 3EYHA 4FKQA 4C59A 3IONA 4J96A 4E6AA 3WIKA 4KNBA 3LMGA 4MAOA 4M84A 4O0XA 4O0WA 5DBXA 2NO3A 3NYVA 3WF9A 4BCIA 5L3AA 2XZSA 4UZDA 2YACA 4O1OA 2PZ5A 3QL8A 1CKIA 2UW8A 5ETIA 2O65A 1OL2A 4CKRA 5I3RA 2B7AA 1W82A 2W1EA 2PZPA 3MYGA 4NK9A 2B9IA 5C27A 1OPLA 3FLSA 2X81A 5DT3A 4FZFB 5GNKA 3PP1A 3VC4A 4C36A 4NFMA 5FTQA 3FMLA 3V5QA 3QCYA 4ANSA 1WZYA 2C4GA 4XUFA 3DFCB 3FMMA 4EOIA 4RLLA 1YHVA 1CSNA 1FVRA 4CQEA 1PHKA 4GYIA 4JNWA 4DEGA 4BCGA 5EM6A 5FDPA 1I09A 3SW7A 3CLYA 3FKNA 3R8UA 5BVKA 2OXDA 1WBTA 4LGGA 4X7QA 1DI8A 4QP6A 1ATPE 4O0SA 4F7LA 5IA3A 2BAQA 4X21A 3BZ3A 4WRSA 4ALUA 3MWUA 4MQ2A 1U4DA 2NRUA 1G5SA 5DG5A 4CMTA 2Z02A 3VJNA 3QD4A 2CCHA 3F3ZA 3DAEA 2HZNA 4B99A 2XIXA 3EQBA 3PIZA 2I0EA 4H05A 1YWVA 1SM2A 5E8UA 3WIGA 5CSXA 4NM3A 1Q24A 5IA2A 1YOLA 3IPHA 4XRLA 4ALWA 5IF1A 4EH7A 1MUOA 3LPBA 4CFUA 3Q4CA 2OK1A 4FYOA 2ITUA 2Y6MA 2OZOA 4P90A 4PPBA 2GQSA 5AMNA 2XS0A 3QKMA 5FBNC 4QTDA 2W06A 2WU7A 5TT7A 1E1XA 2YEXA 2REIA 3FY0A 4QPSA 5E8XA 3F66A 2RFDA 1OKZA 3F61A 4LMNA 4RJ4A 5CU6A 3DZQA 3AT4A 5FP6A 3COMA 4GMYA 2EXMA 5TF9A 3CR0A 2R5TA 3PUPA 4MXOA 5CQUA 3NVKI 5A4TA 4QP3A 1ERKA 3NNVA 3BEAA 2YA9A 3DTWA 3PRIA 5AX3A 3TEIA 3W16A 3HRFA 1YI4A 2BUJA 1YVJA 2CCIA 2ITZA 4AW2A 3FKOA 3PA4A 4OR5A 4OTDA 2NP8A 3A7IA 3JVRA 4XV3A 1MQ4A 1OMWA 3QF9A 4I94A 4BTFA 1DM2A 2HW6A 4FNYA 4Y8DA 5F1ZA 2IW8A 5E9EA 1GOLA 4XRJA 4DEDA 4G6LA 3CY3A 4HZRA 4BFMA 4U80A 4G3FA 2P3GX 3NYNA 3NCGA 3KA0A 3SLSA 4AS0A 5HO8A 2VZ6A 3KULA 4FYNA 5FQDC 2YN8A 1NVRA 1KUTA 5CT7A 3NW5A 4PDSA 4ZLYA 3ODYX 4FX3A 2G2IA 3ROYA 4P2KA 5AV3A 2J9MA 3FC1X 4ZTLA 2GCDA 4BKYA 5CF5A 4RZWA 5KHXA 4OTWA 4ZJVA 2E9UA 4M7IA 2C5YA 3UE4A 3HA6A 4O0VA 2XKCA 4EYJA 5DMZA 3GC9A 3GGFA 5ANJA 3S95A 1G8AA 1IAHA 3EN7A 1GZKA 2ETMA 4G3GA 4FT3A 4K33A 5CEIA 4AZTA 4F7NA 4XP0A 3ANQA 4EI4A 2XK9A 4QMVA 1M7NA 1Q8YA 4NCTC 1E9HA 1GAGA 2OFVA 2ZMCA 5AP1A 4AOIA 5FGKA 2B4SB 1W84A 4ZZMA 2RFNA 2C6IA 3II5A 4C61A 4KINA 4QTBA 4MQ1A 4Y72A 2ITOA 1UKIA 3EH9A 3T3VA 3PP0A 3T3UA 4O6LA 3UG1A 4DT8A 4F9YA 4XP2A 3FLNC 3HAMA 3KXZA 2ZDTA 3BKBA 4HVIA 3N9XA 3BGPA 3CC6A 5FRIA 4AF3A 2HENA 2LAVA 4O83A 2I40A 1ZOHA 4JL9A 3V8SA 4BIBA 1NVQA 1Q5KA 1VJYA 3Q32A 5EG3A 4WUNA 3VWAA 3HV7A 3WZDA 2EUFB 1JKSA 2R3QA 4QMOA 5K5XA 4FIJA 2XEZA 4L42A 2PVYA 4OAUC 2JLDA 5BUEA 4BBEA 2XBAA 4APPA 2XVDA 4AG8A 3MA6A 5C8KA 2JDSA 2XRUA 3HA8A 3PZHA 4FG7A 4GYGA 2A4LA 3NSZA 5EM8A 3RNIA 4D1ZA 5C4KA 3HMPA 4XG2A 1JWHA 3F5XA 1PMVA 3PFQA 4FL3A 5GINE 5HE0A 3E62A 1M2PA 4MD8E 4TWNA 2WTDA 3R2BA 4O0TA 5EI2A 3TTJA 2XK8A 3A7GA 5M4FA 5FDXA 4BDJA 2CGUA 2F7XE 2VRXA 4B9DA 4DHFA 3E87A 3L9MA 2EXCX 4F9WA 3VN9A 2ONLA 4E26A 4KD1A 4FV5A 5T6KA 1B38A 4QMLA 3U6IA 3UOJA 1H1RA 5EQYA 3V6SA 2Q0NA 4CFXA 4S30A 3C7QA 2IVSA 3G51A 3OOMA 4BYJA 2I7QA 3Q52A 4RJ7A 2QG7A 2R3FA 1H0VA 5GJFA 4DE4A 2V62A 4M67A 1XWSA 2E9PA 2Z7LA 2HW7A 3ACJA 3P79A 4RJ3A 1H28A 4TPTA 4K77A 2BPMA 2YABA 4R1YA 2FUMA 4TYEA 4I4EA 2C3KA 5L2TA 2ZOQA 2O63A 4F1TA 4U43A 5HTCA 4MNEB 3ROCA 2HXLA 2W7XA 2BROA 3DZOA 2C6LA 3AMBA 3FI8A 5I3OA 4EOLA 1WBSA 4AGDA 5FM3A 3KKVA 3CY2A 3Q9ZA 5BVFA 5EKNA 5ANKA 5ETFA 4UN0C 4FTOA 3GC0A 5LMBA 4BR3A 4CV9A 4DEAA 2J0IA 3PVGA 4FNWA 1KE9A 3ERKA 5BVWA 4BKZA 4RIXB 4AACA 4L44A 4UX9A 4IC7A 1PY5A 2OG8A 3U4WA 3ZBXA 2QR7A 4EQUA 2XH5A 2E9NA 2HCKA 4NIFB 4RBLA 4B8MA 4ZY5A 3ALOA 3GCSA 3C13A 1P14A 1Z5MA 4AOJA 3HMNA 5DVRA 4MXYA 3HX4A 5AV1A 4CTBA 5BUJA 5M07A 4ZP5A 2Y9QA 4IZAA 3VUKA 4EH3A 2PTKA 2OXXA 1LUFA 2BZJA 3NW6A 5DR2A 4I24A 1APME 3CTQA 4RIOA 2UZVA 3RPYA 3OOGA 3UZPA 1PW2A 4GL9A 4L9IA 4ENYA 4O7YA 3OWLA 2QODA 2Y4IC 2FSMX 4Q5EA 5M44A 3PSBA 2BRBA 3P86A 4E3CA 5BMMA 1M7QA 3R8MA 3K5VA 2RFSA 3HRCA 4GT3A 1PRYA 4JOAA 4WO5A 3QTUA 4D28A 4DH7A 5CYIA 1DAWA 4TYGA 3DQWA 3ORPA 2PL0A 3F5UA 2JC6A 4UWCA 2WPAA 1WBVA 1OUKA 3DT1A 1NW1A 3KF4A 2OO8X 3FZTA 3NUPA 3ZEWA 4EUTA 2A27A 3P0MA 4ZAUA 3U6HA 3ZLXA 3FZPA 3FJQE 4YZBA 2WTJA 4G6OA 4IM3A 5HNBA 2WFYA 2XIYA 4FKSA 3TZMA 4DA5A 4GSBA 4XG3A 2WMWA 3DV3A 4C33A 4DG0E 3O51A 5BQ0A 3MPTA 4FV7A 3R8VA 4JI9A 2YCRA 3Q9WA 4RWIA 5FM2A 5JT2A 3ID6C 3RI1A 2C0IA 2BKKA 4F6UA 1O6YA 2OGVA 3QTWA 4IM2A 2Z2WA 3EN5A 3VRYA 4FV4A 3MVJA 2C5XA 4YC8A 1VYZA 3C0GA 3GFEA 4R7HA 4ZTHA 4LUDA 3P5KA 4JDHA 4IAIA 3RAHA 3EHAA 3O23A 2R3JA 2WO6A 4IFCA 2OIBA 2OIDA 3ULZA 3OZ6A 3BYOA 1SNUA 3ZONA 3SVVA 5LWMA 1KV2A 5F4NA 3VW6A 3HMMA 4NFNA 4R5YA 3Q9XA 2WQOA 3MY5A 3R6XA 3Q5ZA 3BELA 2AC3A 4C3FA 4D5HA 2G15A 3PA3A 4G5PA 5CANA 4HW7A 4DFBA 1RQQA 3PTGA 4FIGA 4IE9A 3TKHA 2XJ1A 5LARA 4C4JA 4CGAA 3IW4A 4AW0A 4MCVA 3GFWA 4D2SA 2PVFA 3MFSA 3P4KA 2WMQA 5A14A 4ZLZA 3AQVA 3VAPA 3QTSA 3UNKA 5B0XA 3FYKX 4WNOA 4I6BA 3VVHA 4UZHA 1Z9XA 4G9CA 5AP6A 3WZKA 4BTMA 3Q3BA 4XJ0A 2WQNA 2ZM3A 4JBPA 4E4MA 4N57A 3ZYAA 3DOGA 3FWQA 3UP2A 3K2LA 4KKEA 1NVSA 2JFLA 2YHVA 3AT3A 4ASEA 4N70A 3C4FA 3AMAA 3ZDUA 4BB4A 5IEVA 2C6OA 5ANGA 4I6FA 4IDVA 5HVYA 2R0IA 3CKXA 3IW7A 4JLCA 3ZU7A 4IB1A 4CSVA 4PP7A 3GCPA 3FYJX 1SNXA 3UQFA 4OTQA 3RP9A 3DBDA 1U5QA 3QYWA 4I6HA 4YGAA 4JDIA 1KOBA 2JAMA 4N6YA 5ANIA 5M09A 2BZKB 4UY9A 4PDOA 4B0GA 3E8EA 5L4QA 3L8SA 4FSZA 3SKCA 5CASA 4QP2A 4DGLC 5L8JA 4JBVA 4KSPA 5J5TA 3SHEA 3FXXA 2BTRA 4RIYB 4DFZE 2FSLX 2YIQA 1FGKA 3FQSA 2ZMDA 3EQFA 3WILA 3V8TA 3FMJA 3PVUA 3V8WA 2I0YA 4KBCA 3FMHA 4TRLA 5HVJA 4C2WA 3OY1A 3UQGA 3FMNA 4DGNA 2IZSA 5J7HA 5JFVA 1RW8A 4YJTA 5E90A 4AFEA 2YZAA 1YXUA 4FTQA 2QHMA 3QX2A 4Q9SA 3IOPA 3EQHA 4MF0A 4BRXA 3LXPA 3S00A 3TM0A 1UNLA 2WQBA 3M42A 3SDJA 3A8XA 4LI5A 4IH8A 4FMQA 3P9JA 2W5AA 4MVFA 2YWVA 3LFNA 3ZO3A 1UA2A 4A9TA 2G2FA 5CU4A 2PVHA 4CFVA 5LJJA 4ASDA 2VTAA 4BCJA 1FINA 4EK4A 2Q0BA 2Z7SA 3LHJA 2DWBA 2W9FB 1ZRZA 3P78A 4FTCA 4PRJA 5CU2A 4CCUA 3CCNA 4M12A 5HD7A 3R83A 1PXJA 2ZDUA 3TV6A 3NIEA 4PMMA 4U3ZA 4QMPA 4L67A 4ZTRA 4BI0A 2H34A 3OEFX 4FA2A 2ONLC 3EL8A 5AP2A 4QTAA 4M3QA 2X4ZA 3SOAA 3VS0A 3LQ8A 2X2KA 3QFVA 1Q8ZA 2NPQA 1ZARA 3OC1A 4JX7A 2OJIA 3R9OA 4G3DA 3ZLYA 4F4PA 1WBOA 5A3XA 1YOJA 3SW4A 3MW1A 4H3QA 4AZEA 4W4XA 5ETAA 3DA6A 5I9XA 1JNKA 4RVKA 4GT5A 3W2OA 2QLUA 3AGMA 2VUWA 3QC4A 4FF8A 2C5NA 2VWBA 3RAWA 4YUQA 4YJQA 3BU3A 4EHEA 2G01A 4X2JA 4MBJA 4USEA 4KS7A 4O27B 4RJ6A 2DQ7X 2HELA 3ORIA 4NJ3A 3KRWA 2B1PA 3ZOSA 4CLIA 3LJ1A 4PQNA 4PPCA 3WF6A 3VRZA 2R3LA 1Q8TA 2PVMA 4OAVB 3PJ3A 1ZY5A 3EMGA 2QKRA 5AUUA 2WEIA 1URWA 4HYIA 4B6LA 2GNHA 2WGJA 3LCOA 4NW5A 2UZLA 1L8TA 2FSOX 1KE7A 1FMKA 3LCSA 3LQ3A 4XS2A 5J79A 2HY0A 4JG8A 4AP7A 3NUYA 3R73A 5EW3A 4LRJA 3VS1A 4QTCA 4I5PA 1KV1A 2OWBA 3KY2A 2PZRA 2Y4PA 4QPMA 3QKLA 4U6RA 2QR8A 3RCDA 5JGDA 4CLJA 4XG7A 4NEUA 4H3BA 3HP5A 3DXNA 5AP4A 4AA5A 4I5HA 2QOBA 1ZY4A 3GUBA 3H9OA 2JDVA 4IWOA 4QMNA 4JDJA 4PTEA 3NRMA 5ANEA 3GXLA 3W33A 4BGGA 3MDYA 3CD8A 2O0UA 4WSQA 5AWMA 1A06A 4YJOA 3S0OA 5ACKA 2RGPA 2X8EA 3VUMA 3GCVA 4RFYA 5DIAA 2X7OA 2QD9A 4UMTA 5IU2A 2JKMA 3EN4A 3BBTB 5GJGA 4RQKA 5M4CA 4M13A 2YDIA 4Z7HA 2X6EA 4RIWA 2BDFA 2FYSA 3RK9A 3NNUA 2WMAA 4NUSA 1QCFA 3E88A 4KIQA 3OBGA 4U0IA 2PVRA 2IO6A 3QQGA 3RAIA 2PMLX 5E8TA 5HGIA 4AA4A 2WMBA 5KCVA 4XX9A 5DYJA 5EW8A 4RWKA 4ZY4A 5BX0A 3O50A 4BWXA 2QONA 3OUKA 4P7EA 5EKOA 3SXSA 4AZWA 5IISA 4TKSA 2R3RA 4YLLA 3MPAA 2X4FA 1REKA 1T46A 2CKQA 3HZTA 3MB6A 3V5TA 4DFXE 3FHIA 4AXAA 4EH8A 3DJ7A 3MA3A 4KRCA 3T9TA 4PL3A 3QD0A 5AP0A 1R3CA 2Z60A 3DS6A 4EONA 3ZO1A 3IOKA 2YM4A 4X3FA 4D1XA 2P33A 2H8HA 3HDMA 4W4WA 3D94A 4EBWA 4GFOA 4FEQA 2C1BA 2W1IA 4E5BA 4EHGA 2VTQA 3Q60A 3MPMA 3W2SA 4CFFA 3D7ZA 2P2HA 5EFQA 3LXKA 1QPDA 4O22A 2O8YA 3MVLA 4AGCA 3TI1A 2XKFA 4DH1A 4QQTA 2VWZA 2VTRA 3S3IA 4TL0A 2XYNA 3L8PA 2UVYA 4OUCA 4ZXTA 4NM7A 4YJPA 3BLRA 3RJCA 5CAQA 3OT8A 3O7LD 5GIOE 4K9YA 4GW8A 3A62A 4LOQA 2BFYA 2PE1A 4AWIA 3R21A 4H1JA 1UWHA 4EH4A 3V51A 2E2BA 2UZOA 4KIKB 4OTHA 5FD2A 4ANMA 3ZC5A 3LFFA 5CSHA 1TVOA 4D58A 4QPAA 2ITTA 4JDKA 2HY81 3ZZWA 5DN3A 2PULA 5CSWA 5E8SA 4BDDA 4PTCA 5T68A 2FH9A 1T45A 1FOTA 3LW0A 4ACMA 4I92A 4D4VA 5EOBA 2WTVA 5CEMA 4N6ZA 3EZRA 4PUZA 3V01A 2W0JA 3PY3A 4AN2A 3UVRA 4E6DA 4BYIA 4RWLA 2WZJA 2YJRA 4WSYA 4MXAA 3LFCA 4WNMA 4FODA 4K18A 4QMTA 5EI6A 2PMNX 3KXGA 5JQ5A 4I22A 2WD1A 3F69A 3Q96A 3NYXA 2YIWA 4JAJA 4ANOA 5I9WA 1QPJA 1TQPA 2Z8CA 3RK5A 5A46A 4JRNA 3EWHA 3WE8A 3AT2A 1BYGA 2GNIA 1OB3A 2YIYA 4LV8A 4F0IA 3MBLA 3WF8A 2XNNA 4C37A 3PXZA 2OKRA 1OITA 4QYEA 2ITYA 4YJVA 3KU2A 2OI4X 3KRRA 3BV2A 3MVHA 5BYZA 4AZVA 4YZCA 2HXQA 2F2CB 1PXPA 1M2RA 2A19B 3EKKA 4FNZA 5HIDA 4UMUA 2A2AA 2CJMA 2WMTA 3F9NA 3NS9A 1U54A 4GG5A 1ZZLA 3E93A 5AR5A 4AW1A 4ZTMA 1XHAA 4C2VA 2I0VA 3H30A 2QOLA 4O2ZA 3AC2A 3HV6A 2ZAZA 4ITIA 4ZJJA 4DYMA 4QMYA 3ENMA 2YCSA 3BPRA 3ORTA 4R77A 4YC3A 1BX6A 3FXWA 4AAAA 4GFMA 1KSWA 4O84A 4J98A 5A4CA 4TTHB 2R3NA 2H96A 4U45A 5AUXA 1CDKA 5CWZA 4FK6A 4HJOA 2XEYA 5F95A 5HG8A 2JAVA 1YXTA 3M11A 4U81A 3G9LX 4C3PA 4XH6A 4C8BA 3C1XA 5HEZA 2BKZA 5DH3A 4IIRA 5H8GA 4IWQA 3EFLA 4FKLA 2JKKA 3RMFA 3EQPA 4QYYA 3TJDA 3KEXA 1U5RA 3ZSGA 3DB6A 4JR3A 1PMNA 2UW9A 1Y6BA 2W1CA 5CQWA 3OTUA 1J91A 3UOLA 1U46A 4JG6A 2XJ2A 3CGFA 4S33A 3MY0A 2CKEA 4IAZA 4G34A 4GEOA 1XR1A 3DJ5A 4D0XA 2OXYA 5JN2A 4AU8A 3ZC6A 4BY9E 3SG9A 3IK3A 2W4OA 4ONAA 4U3YA 3CQWA 5KMNA 4H39A 3HMIA 4QYHA 2VX3A 3OCSA 2ZM4A 2C6KA 2YM8A 4EWQA 3TUBA 4F1MA 5DLSA 1P4FA 3P7CA 1TKIA 3DKOA 4DT9A 2ZV7A 4WRGA 5D10A 2IW9A 5DEWA 2C47A 5HG7A 4R7IA 1QL6A 4JG7A 3GOPA 2XM9A 4I0TA 2VTTA 3TCPA 3PY1A 1XH6A 1OL6A 3VHKA 2PU8A 4F09A 3MJ2A 3FEGA 3VUDA 4K6ZA 5AV4A 2PPQA 5IQEA 3TZ7A 4TZRA 4OBQA 2R3KA 4DN5A 5HNIX 3W2PA 3DDPA 5HQ0A 4BBFA 2ITQA 2GHGA 4F9AA 2X9FA 1G3NA 3NUXA 4UBAA 3D2IA 4UWYA 3EKNA 3MS9A 2UVXA 2YERA 5AP5A 3RCJA 4PF4A 3ZUVA 3P7AA 3CQUA 4L7SA 3D7TB 2VN9A 2OF2A 4DTBA 5HO6A 4YLJA 3O7LB 4LFIA 5K3YA 3WE4A 2QO2A 4BDHA 3NNWA 4EKLA 2C6DA 5JQ8A 3L9NA 4BHNA 2ZV8A 5CZIA 4O7LA 2EU9A 4IACA 4EH2A 4GCJA 4NM5A 1P5EA 2WTKB 4E1ZA 4XBUA 3TUDA 4ZTSA 2W1GA 5KMOA 5KMKA 3BHYA 5HESA 4FKIA 5DWRA 4I5CA 4IADA 4FEWA 2ZM1A 4ZEGA 3FLYA 3T8OA 3LM0A 4RSSA 5KZIA 3EN6A 2GNGA 3D5WA 3OROA 4QMZA 4ZSAA 5HG5A 4QNYA 2C0TA 2WMXA 3OD6X 1H25A 4TW9A 5D7AA 1JLUE 1YI6A 4F7JA 3B2TA 5LXMA 5M55A 3RAKA 3FZRA 2UZDA 3MVMA 4ENXA 4FGBA 4NT4A 4DEBA 1W98A 4M69B 2CHLA 4FKVA 1OBDA 1MRVA 4D9UA 3L1SA 4O7TA 4XYFA 4C3RA 4JIKA 5IPJA 3JY9A 4LM5A 2J50A 4HYUA 4ZSEA 2XK3A 4ZLOA 1IEPA 3LFSA 4RC4A 1ZYCA 4LUEA 3RINA 4DBNA 3GBZA 3WARA 5CI6A 4IZYA 2R3IA 3FHRA 3ENHA 5B2LA 4MX9A 2XKEA 4IB5A 3TL8A 2O64A 3ZDIA 4YJSA 2CLXA 4A07A 1DI9A 3AXWA 3FLWA 3PG1A 5FBOA 4BI2A 2GQGA 2J0LA 2J0MB 2JIVA 4CYJA 4R7BA 3CIKA 1WAKA 3G9NA 4RX9A 4MTAA 5BVOA 3E8DA 3QALE 4WUAA 4KBKA 3JPVA 4O7WA 4CCBA 1O9UA 2YITA 4F63A 3ZFYA 1WVWA 4WG5A 2E9VA 4FT9A 4O1PA 1WBPA 2XNBA 3R1NA 3PJ1A 5BVEA 4X3FC 3OWPA 2QNJA 4C62A 4DEIA 2X6DA 3MFRA 5E8ZA 5LMAA 3VQUA 5LVOA 3A2CA 4FZ7A 4N0SA 4LL0A 4RJ5A 2CN5A 4X6QC 4HVDA 1UKHA 2BVAA 4EH9A 4FVPA 4UWBA 4X0MA 3SAYA 5CLPA 4BGHA 4RX7A 3WF7A 4BTJA 1XJDA 5JK3A 2EB2A 2V55A 2IVTA 4EBVA 3R22A 4E93A 2XUUA 2V7OA 2WEVA 1R39A 5KMLA 1GIJA 1XBBA 3E7OA 4LGDA 4BWKA 2VWXA 3ZSIA 5B7VA 3GC8A 5E1EA 2VWUA 4KRDA 4IX3A 3A8WA 3TV4A 3NUUA 5E92A 3N4VA 5AAEA 4O0UA 3QYZA 4RVLA 5AP3A 3PZEA 2VGPA 4USDA 3C4EA 3U54A 1QPCA 3HEGA 5DRDA 2Q83A 1AD5A 1J7IA 2ZV9A 5B2MA 2PVJA 3B8RA 4CKIA 3HNGA 5C8NA 3IS5A 4IBMA 4IAAA 2BRGA 3FMEA 4AX8A 3UQCA 1PXIA 1W83A 4NH1A 1RDQE 2Z7QA 2OBJA 4I5MA 5TOZA 3VBTA 3DNDA 3JYAA 4GRBA 5IH4A 3QZFA 4F08A 3KVWA 2IVUA 3SRVB 1G8SA 3RHXA 3VO3A 3PVBA 3QZHA 1VR2A 4E20A 5JFXA 1ZXEA 5HBHA 3FPQA 4IC8A 5IDNA 4GKHA 3F7WA 3HMOA 3G5DA 3OP5A 4W8DA 2GMXA 4RQVA 1UU8A 3AC1A 2BFXA 4M68A 5IEXA 1ZWSA 4D4YA 1SVGA 3DPKA 4F6SA 1IG1A 1Q8WA 4FTRA 3FZSA 3GOKA 3ATSA 3DXQA 3ACKA 4FI1A 4PNKA 5GZAA 4M15A 3NAYA 3E8CA 3DQXA 4K1BA 5DRBA 4GFGA 1BKXA 2OZAB 3A61A 1GJOA 3QWKA 2ZB1A 5C26A 3B8QA 4E6CA 1PF8A 1S9JA 4WOVA 4QMMA 4K2RA 1O6LA 2YAAA 4OBPA 4YZDA 3R9HA 3RHKA 2PWLA 3JVSA 3LOKA 4FSYA 3WI6A 4EOPA 1JOWB 2RG5A 2W5HA 3DKFA 4MBIA 4HCUA 3QRUA 5EDQA 3OVVA 3LIJA 4O38A 3CE3A 2YIRA 4PX6A 4O7SA 5KKRC 3OWKA 4KIPA 4UMRA 4QO9A 3A7JA 4Z55A 4YJUA 3OS3A 4E5WA 4EQCA 4CRSA 4I1ZA 2XP2A 3E64A 2AUHA 3LVPA 2I6LA 3BHUA 2XNEA 3UG2A 5JZJA 2RIOA 5CAPA 5HHWA 2UW4A 1OIRA 4YLKA 3SC1A 4O7VA 3A4OX 4YNOA 5DI1A 1UVRA 1YXXA 2J90A 4IW0A 5J95A 2QLQA 2WIHA 4TXCA 5CAOA 1PKDA 3A60A 2XB7A 4BICA 5J8IA 5HG9A 1OKYA 2BHHA 2P55A 3POOA 5GJDA 3C0IA 4D4SA 3BYSA 3QLFA 5DE2A 2ETRA 1R78A 3BYVA 2PVLA 2XNOA 3ZEPA 1GNGA 3ZXTA 4LL5A 2X9EA 3BHHA 3VS7A 3EQGA 4XOZA 4O2PA 1Q99A 3AC3A 2PYWA 3A99A 1PXOA 3FZOA 2W17A 5L2IA 3HRBA 1ZOGA 2HWPA 1S9IA 2I1MA 4EC9A 2PE2A 4PL5A 4IDTA 2VWIA 3UO4A 3VS3A 2QG5A 4ACDA 2W99B 3NAXA 4FL2A 4I0SA 2GHMA 2UW3A 4L3LA 2X8IA 1YDSE 4U9AA 3K3JA 3QRTA 5F20A 5HNGA 3UMWA 4CYIA 4Q2AA 2Y8OA 4QMUA 3WYXA 3PWYA 4C57A 4O0YA 5FXSA 5IQAA 2PUIA 3G33A 4H58A 5DOSA 3BQCA 3F6XA 4DF3A 2X2MA 2UUEA 4YP8A 3ZO4A 4FV2A 3FI3A 5CENA 3PDTA 3LQ5A 4IJ9A 3QUPA 3C9WA 4G6NA 4I6QA 1REJA 2XIKA 5IEYA 2GU8A 4FTNA 2PUNA 2GQRA 3TWJA 1W8CA 1OVEA 1YHSA 3ET7A 4Y83A 2QOFA 4BZNA 4FVQA 5E8YA 5IMXA 4IM0A 4BTKA 2WIPA 3BQRA 3O17A 4C7TA 3EOCA 3HECA 3OXZA 4G31A 3ZFXA 4Q9ZA 3IW8A 3IW5A 4S31A 3DB8A 2YCFA 5HX8A 2DUVA 2QQ7A 1GY3A 4OLIA 5KMJA 2YAKA 1STCE 3ORXA 3EFKA 3FL5A 2HOGA 5FEQA 5CNNA 1M14A 3F5PA 2JFMA 3VUGA 4O7ZA 1Q61A 2WOTA 2Y0AA 5CTPA 5CVGA 3DFAA 5JGBA 5M08A 1F5QA 4IX4A 3LXNA 4J53A 4L00A 5I9YA 1Y6AA 4ITHA 3TIZA 3UZTA 2GDOA 1XH9A 3MFTA 2W9ZB 2CSNA 3QGWA 4D2PA 1NT2A 4NL0A 1X8BA 3BE2A 4V0GB 2B9FA 3CSVA 2ZJWA 4TYHB 3DXPA 5AAFA 1AGWA 2R3HA 3QGYA 3H4JA 4EORA 4ALVA 5L6OA 2WQMA 3DKCA 1DAYA 2UVZA 4YZ9A 3DK6A 3LFDA 5I5ZA 3ZFMA 2F4JA 3H3CA 3F5GA 1JVPP 3QQJA 2W4KA 1P4OA 3QWJA 4LG4A 5H8BA 4ERWA 3OFMA 5EYKA 2NNWB 5J9YA 4TWOA 3GP0A 4QP7A 3E3BX 3ZTXA 4A9UA 4O21A 2OFUA 3EQIA 4HYSA 3TDVA 2WMVA 4XV2A 3UIUA 2OW3A 4G3EA 1PXNA 5AUTA 1OIYA 4YO6A 3FSFA 4DC2A 5K4IA 1GZNA 1M52A 3I79A 1PKGA 3EN9A 3QQUA 3NZ0A 3R30A 4MXXA 4DGOA 4ZZOA 2ZB0A 1CM8A 4GK3A 2F2UA 2VWWA 5AR4A 3KB7A 5IA5A 3UNZA 1KOAA 3PXQA 3MESA 4PTGA 4BN1A 4D9TA 1O6KA 4FK3A 2WB8A 3UJGA 5EQEA 3FV8A 2QO7A 2PUUA 3OCTA 4U8ZA 3EIDA 3ORMA 4OTPA 1ND4A 3GCQA 3HVCA 3AD5A 3QRIA 4FV0A 3ZLWA 3OW3A 5AFVA 3FZ1A 5KUPA 5KO1A 3D2KA 2VX1A 4QT1A 4C4GA 4RMZA 1M17A 3U51A 4I3ZA 5G1XA 2J0JA 2QOCA 5FG8A 4DLIA 5AEPA 2UZTA 3IGGA 5CEOA 4EEVA 1FVVA 4YMJA 3UO5A 4LV5A 3R71A 3VS4A 2O2UA 3DK7A 3UP7A 1J1CA 2O5KA 3I4BA 2RG6A 3QQHA 4CG8A 2JKOA 3COHA 3JY0A 2PK9A 3PIXA 4MHAA 5AV0A 3QLGA 4M0YA 4I21A 3E3PA 5M57A 2QOKA 1BUHA 4FZDB 1XH4A 2WMRA 3IECA 3I6UA 5I9VA 1IA8A 3TKIA 4KWPA 4UMQA 3KRJA 4LOOA 3F2RA 4PMSA 2Y6OA 2WNTA 2V5QA 3R63A 4A06A 2GS2A 5L2QA 1CKJA 3K5UA 3QTRA 3G90X 5CS6A 2JDTA 3ATTA 1GIHA 3AMYA 2KULA 5IH5A 2XK6A 3U6JA 3SGCA 4X6RA 3UYTA 3QXPA 2IVVA 5KZ0A 1ZLTA 4L45A 4YTHA 1XO2B 4E8AA 4HGLA 3POZA 4AQCA 5H9BA 3OUNB 2XYUA 5HO7A 4WT6A 3PJCA 4KS8A 5KNJA 2Y4IB 4PWNA 2EB3A 4J8NA 4YTCA 2G9XA 3CP9A 3PJ8A 3SG8A 3TZ8A 2R3OA 3IQ7A 5AIRA 5ANDA 3NYOA 1Q97A 3R0TA 4IXPA 3FC2A 4L01A 4FIIA 5HBEA 2XBJA 2O3PA 5IUGA 4F9CA 4FT7A 3BHVA 2WTIA 3MB7A 4WNKA 5CY3A 3U9CA 4HVHA 3LJ2A 4XLIA 5AUZA 3DKGA 5E7RA 1RJBA 1H0WA 1H07A 1LEWA 1OECA 5F94A 5EYMA 3TNPC 5KE0A 1Z57A 4GU6A 3W2CA 3GU6A 4MNEA 4MBLA 3ZH8A 4IAFA 5L6PA 1ZMVA 3NMUF 3I60A 4ZMFA 5BYYA 3LLAA 3GU4A 1BMKA 4FTJA 3CTHA 3OT3A 5EYDA 2C3LA 4EK6A 5HE3A 4DCEA 3DNEA 1UNGA 4NW6A 2CLQA 1UNHA 5K9IA 1KE5A 3NW7A 3DBQA 3PPZA 5HIBA 4HVGA 1PXMA 3OCBA 4EUUA 4BDBA 3PPJA 3OTVA 4KSQA 3I1AA 3ZXZA 4PDYA 4RIXA 2ITVA 3AC5A 3JS2A 1H00A 3HV5A 5KHWA 4OW8A 3ZM4A 2F7ZE 3KMUA 3V6RA 4NIFA 4BC6A 4QOXA 1OL1A 3W8QA 4QYGA 2UV2A 3GB2A 5G6VA 3UGCA 3NNXA 3UVQA 3N4TA 3BBWA 4CFWA 2CPKE 4RC3A 4FGRA 4NYEA 4FIFA 5IQBA 3QUEA 4WD5A 4B7TA 4I93A 3ZMMA 1V1KA 2BILB 4LOPA 3UC3A 4D4RA 4D5KA 2CN8A 3UMXA 5J1WA 5LCKA 4GUBA 2X0GA 4M0ZA 3PXYA 4FSTA 3ZBFA 3O8PA 3LZBA 5DT0A 5HCYA 3R7IA 3I0OA 3QQKA 4R3CA 3BCEA 1A48A 1XKKA 4EZ5A 4UV0A 3F3VA 4FTTA 4G9RA 4AT5A 5JRQA 4FV3A 1IAJA 4RX5A
chains in the Genus database with same CATH superfamily
2CNVA 3VJOA 3PVWA 3ORLA 5ICPA 4BCOA 4R1VA 2BZHB 4O4EA 3R7YA 3C5IA 2C0OA 2ETKA 3BE9A 3BV3A 3BRBA 3HUCA 4GK2A 4YPSA 4FV1A 5DNRA 3ZUTA 4CZYB 3KREA 3ZM9A 5EK7A 4JRVA 4W9XA 2A1AB 3UOKA 5DEYA 5L8KA 3RZFA 3QA0A 4LRKA 5CX9A 5GIPE 3QU0A 1XH8A 4FKOA 4BCNA 3TNHA 2AYPA 2RKUA 4HGEA 4WBBB 4RFZA 5CEQA 2P4IA 3F3WA 3KULB 4FSNA 4Y5HA 2ITPA 3PSDA 5AAGA 5IUHA 3E5AA 4L43A 4KA3A 1LEZA 2F49A 2SRCA 3KXXA 4XMOA 2IWIA 3R28A 1XQZA 2RSVA 2VO0A 3DDQA 4FSRA 3C0HA 4L52A 4WBOA 3ORNA 2VTJA 2W5BA 5HLPA 1OPKA 5EI8A 5IQIA 5HX6A 2UW6A 2J0KA 5C9CA 2DS1A 3Q4ZA 5CF6A 4UEUA 2QOQA 2VTIA 3EQCA 2IPXA 3G6HA 3NFGB 3ULIA 3VBWA 4F1OA 2XNPA 5D11A 5IDPA 4LGHA 5EDPA 4F6WA 4FEVA 5JGAA 3W0QA 1HOWA 4DGMA 5LWNA 4AT3A 5A4EA 2XIZA 3V5LA 5EHLA 1JAMA 2XM8A 4FTUA 3UDBA 4L53A 2JDRA 3W18A 2WQEA 3NVMB 3GVUA 3RTPA 3MY1A 3R9NA 2VNYA 3HV3A 4ACGA 4GU9A 3UPZA 3KQ7A 4Z3VA 3BX5A 3KRXA 4R3PA 4PP9A 2YWPA 3TUCA 2WXVA 2C6TA 4JS8A 3BHTA 4QP1A 3H9FA 5AX9A 3VBYA 4AE9A 5J9ZA 3OY3A 3DBCA 3C4XA 3Q2JA 2J5EA 3LE6A 1MRUA 5KMMA 3KXHA 4XV1A 5DFPA 5HU9A 3FQEA 1FBNA 3H9RA 4IVCA 4FT5A 5EHYA 1JSUA 4IZ7A 4EOQA 3EFWA 2C30A 2BR1A 4J99A 4ZS4A 1LP4A 2OSCA 4G2FA 4HCTA 3VS5A 3KL8A 5ETCA 3AD4A 3LAUA 4WG4A 3PY0A 3VS6A 3MH3A 4FIEA 4OTFA 5HLWA 2YFXA 5CNOA 1YKRA 3Q9YA 1XH5A 3PPKA 4C4EA 2R3PA 4NZWB 3RBWA 2C6MA 2GS6A 4UB7A 3ELJA 3KCKA 3ANRA 3OWJA 2ZV2A 4E6QA 4WHZA 5EDRA 3GU5A 3KN5A 4C34A 4MKCA 4IWDA 1OIQA 2VTPA 2XNMA 2YM7A 3LCDA 5A6OA 5JH6A 3W32A 3E8NA 3MN3A 4ANBA 2W1DA 4MK0A 3NUSA 5HOAA 5CEPA 3P08A 4ZMEA 3QKKA 4RIYA 3PE1A 1UU3A 4IMYA 3BLQA 5C8MA 5J1VA 3KK9A 5BNJA 1WMKA 2OU7A 3L8VA 3AC8A 4YU2A 2FA2A 4Y85A 1JSVA 4FNXA 3FLQA 1HCKA 2QU6A 5LMKA 4UMPA 3GNIB 5HE2A 3MIAA 3C4ZA 3CEKA 3MSSA 2YISA 4NJDA 4MWIA 4FL1A 3LFEA 4BDKA 4R5SA 5LOHA 4FSQA 2UW7A 4UYNA 3PLSA 5HKMA 1VZOA 3AOXA 3D15A 3KF7A 2VTNA 4DH3A 2CGVA 3W0NA 3CKWA 4S34A 3UIBA 2UZNA 2XNGA 3Q53A 4ZTNA 2OICA 2OLCA 4O96A 3U55A 4ZK5A 4L46A 1UWJA 4ANLA 4BDAA 4YURA 5LVLA 2W05A 3R9RA 2WOUA 5EH0A 4ERKA 4U40A 4BIDA 1OL7A 4TT7A 3QUDA 2QI8A 3S4QA 3OXTA 4L8MA 4HVSA 3FDNA 2PZYA 5E91A 1CKPA 5DPVA 3E7VA 2VTOA 4L3PA 3RVGA 1ZYDA 4FOBA 1NY3A 1WFCA 3RPVA 4FKPA 3VQHA 3V5PA 3NLBA 5A9UA 4Y5QA 5DT4A 5IKWA 3ZRMA 4FKWA 4CD0A 4QMXA 3UC4A 4G3CA 4R3RA 3FSKA 3PLAE 3CPBA 4HYHA 4U44A 3MH1A 4J8MA 3WF5A 5EQPA 1R0PA 3I81A 3PXFA 5IQHA 3HLLA 3EQDA 3TNQB 2IJMA 3CD3A 3UPXA 3BLHA 4DEHA 5BMSA 3DK3A 4FKJA 3UDSA 4L6QA 3LXLA 3RNYA 1JPAA 5AADA 4BDFA 2QU5A 4DTKA 3OEZA 3R00A 4DDIA 4YTIA 3I7BA 5CSPA 5AUVA 4QRCA 1W0XC 1J1BA 4BJJA 5TR6A 3R2YA 4ACCA 3BWFA 4CG9A 3BI6A 3NUNA 5LVNA 2FO0A 4EOKA 5BYLA 4EH5A 5IG1A 5M4IA 4A4OA 3ZRLA 3TN8A 4CEGA 4FTLA 4CFNA 3VF9A 3I5NA 3U87A 1MRYA 4IB0A 2J7TA 3DTCA 5IQDA 3QCXA 4YBKA 3R8ZA 2CNQA 3MFUA 3VIDA 4W4YA 4ARKA 3Q5IA 2OIQA 4YPDA 4G5JA 4YO4A 5D41A 4RA5A 5CAVA 1JBPE 4GUEA 4IHPA 2ESMA 1W2CA 2VX0A 2H9VA 3MH2A 5K0XA 5IA1A 4QMSA 3G2FA 4BDIA 1SMHA 4WIHA 4DITA 4EOOA 1BI8A 4FG9A 5H8EA 5E4HA 4U5JA 1FPUA 2X7GA 4HZSA 4CT2A 4S2ZA 4FE2A 2QCSA 3ZZEA 3KXNA 4H1MA 3QTXA 3SOCA 5HLNA 1YQJA 4FKRA 1BI7A 3Q04A 3D83A 1Q3WA 1OGUA 3PJ2A 3UIMA 4E4XA 1URCA 3NDMA 4BHZA 4Z7GA 2ZFYA 3MIYA 3DLSA 2EWAA 4TN6A 4D2TA 5J87A 1WBNA 3OF0A 5AA9A 1I44A 3JUHA 1OIUA 2HZ4A 4J71A 4PY1A 4XNEA 2BDWA 4Y95A 3V3VA 1ZYSA 4ZY6A 3KFAA 3NGAA 1PXLA 2R3GA 3QA8A 3QTIA 4WA9A 3MTLA 3KMMA 3VUHA 1Y8YA 3AG9A 4CT1A 2R7IA 3BIZA 3TTIA 4GS6A 2JBOA 3F2AA 3OBJA 4D1SA 1OPJA 2WU6A 4EK5A 2VNWA 5KX8A 2IEWA 1K3AA 3UYSA 2V22A 4GVAA 5AM7A 4R8QA 4TYJA 3TZ9A 4AA0A 4FKTA 3F3TA 3QTQA 4GT4A 4MWHA 4EOJA 3LCTA 4HNFA 4DFUA 3VF8A 2FGIA 4EZ7A 4MUQA 4EOMA 4E7WA 4K0YA 2JDOA 3IGOA 3OCGA 3R02A 2X2LA 1GIIA 5JZNA 5I9ZA 2CGWA 4HPUE 3EJ1A 3IW6A 3D5XA 4WKQA 4JJRA 4R78A 3L9PA 3UZRA 3HGKA 3QD3A 4DH5A 2VV9A 5A6NA 2YCQA 3GU7A 4HPTE 2CMWA 2OH0E 3TMOA 5EM5A 2PHKA 1PYEA 1J7LA 5TO8A 3QZGA 5GZ9A 4C4FA 3S1HA 4O86A 3Q4TA 5IMEA 2UW5A 2V7AA 3UBDA 4GJ3A 3UODA 4IX5A 5FTGA 1B6CB 3HP2A 3DY7A 4FUXA 4KIOA 3TACA 4MF1A 1H8FA 4OTGA 4ANQA 4PNIA 3IKAA 5HCZA 3FI2A 1ZYLA 3NIZA 5EHOA 1SYKA 4KIKA 3D9VA 4FV8A 5EW9A 4PMPA 4S32A 3C5UA 1AQ1A 2VD5A 3EZVA 5M51A 5FTOA 2JKQA 3GT8A 4L3JA 2WELA 3IDPA 4YTFA 2B52A 4AE6A 4QP4A 1OI9A 2VWYA 3Q2MA 5L6WL 4CQGA 2VTMA 2R3MA 5LVPA 4O81A 4ZTQA 5L2SA 2FVDA 3IG7A 4M66A 3RM7A 4NKSA 5JMSA 4Y46A 3KRLA 1P2AA 4MXCA 2IZTA 2W1FA 3PG3A 4F0GA 5EM7A 1PMUA 5HTBA 3UIXA 3F3UA 5CT0A 1Y8GA 3FL4A 4HGTA 2BAJA 5HD4A 3PXRA 3FAAA 3EQRA 4Q5HA 4G17A 2QOOA 4CMOA 2GSFA 5CEKA 2XCHA 4FVRA 3RWPA 4YR8A 3CBLA 3S2PA 2VO6A 4IB3A 2B55A 2C69A 4ZJIA 3NFFB 4USFA 1L3RE 1ZYJA 3NR9A 5AP7A 5A54A 1UU7A 3ODZX 2HK5A 1YDRE 3QRKA 4XOYA 5CXZA 4QTEA 1YXSA 4EC8A 4V04A 5KBRA 5FUTA 4JBQA 3HL7A 1RE8A 3EYGA 4OT6A 2DYLA 2J51A 2YM5A 3NPCA 4NTTA 4PMTA 4RC2A 4V01A 4JXFA 4DFNA 2XANA 3ORZA 1H1PA 4DG3E 4EOSA 5F9EA 3D4QA 3O0GA 2YIXA 5HTIA 1YOMA 3ZSHA 2GNJA 4K8AA 2BIKB 3IDCA 4FKUA 5LMKC 4QEBA 3BYUA 4XLVA 4YSJA 5JFSA 4DEEA 4X2NA 4YHFA 5D9HA 3NUAA 1PXKA 4RGJA 4BZOA 2YLEA 4C35A 4JT3A 3COKA 3OW4A 2B54A 3RGFA 1JQHA 2XK7A 3P1AA 4BWPA 2GFSA 4FT0A 4U97A 3R7UA 5AR7A 3RPOA 4YHTA 3W2QA 2XF0A 4ITJA 4BGQA 4ASZA 2R7BA 3NX8A 3ZCLA 5K5NA 4G1WA 1OUYA 2BRNA 4JQ8A 4W4VA 5DHJA 3O2MA 5JSMA 2YLFA 2IZRA 4GH2A 4NSTA 5FEEA 4BCPA 3W0OA 1E1VA 2FB8A 4FSMA 3I0QA 4MEDA 3F88A 4ORKA 3M2WA 2J4ZA 5CAUA 2AC5A 4FTAA 2GPHA 3QC9A 3R7EA 4A4XA 4F78A 3AGLA 3DLZA 3W10A 5CSVA 3FQHA 4QYFA 3D14A 1G8JA 1Q4LA 2IN6A 4F9BA 3FI4A 2IZUA 4XCUA 4HGSA 1ZOEA 1V0BA 1YWNA 4FOCA 2BMCA 3IO7A 4CZTA 3R7VA 5E8VA 4F7SA 4GG7A 2CKOA 3PE2A 4DINA 3CQEA 2Y7JA 3HUBA 3FKLA 4JBOA 3G0EA 2CGXA 1IA9A 2OJGA 3D0EA 5CALA 2CKPA 2R9SA 4YSMA 3V5WA 4DAWA 4A7CA 2BRHA 3GI3A 4IAKA 4NM0A 4V05A 4UXLA 3BEGA 1J3HA 3PWDA 4TYIA 4ASXA 1F0QA 4UXQA 4M8TA 3VUIA 4IANA 3SV0A 3ETAA 5AA8A 5H2UA 1WCCA 1CTPE 4RVTA 3D5VA 4ZZNA 4RIWB 4YHJA 1H24A 3KMWA 3QZIA 2YM6A 3BGZA 2VGOA 4YJRA 2R0UA 3DAKA 3P7BA 4PV0A 2F7EE 3WZJA 3TG1A 4E5AX 3LJ0A 5H3QA 1H08A 1IASA 3E63A 3D7TA 2UZEA 5HORA 4FEUA 2WKMA 2Z7RA 3B2WA 4OBOA 3JXWA 4ZSGA 3U4UA 2ERKA 2XARA 4AZSA 3RPRA 3MV5A 5JRSA 1NA7A 3I5ZA 2GHLA 5IQFA 2B9JA 2C6EA 3R1QA 5AR2A 2IW6A 2GS7A 4BIEA 4EK8A 3WYYA 3LFBA 4X3FB 1FGIA 3VBQA 2PMOX 4BDCA 2GTMA 2WTWA 1Y57A 3KXMA 5JEBA 4BCQA 4BKJA 3A7HA 4APCA 2IF8A 4EWHA 3DU8A 5ACBC 4RA4A 2VTHA 3PSCA 1PYXA 3PIYA 5IUIA 4P5QA 4D2VA 1JKTA 3EL7A 3QCQA 4YNEA 3ZS5A 5DGZA 3PFYA 2QURA 1W7HA 4EH6A 4DCAA 4Z9LA 1SZMA 2C1AA 4OTRA 1Q3DA 3Q6UA 4M69A 4PL4A 2A0CX 4NU1A 5CF4A 1EH4A 2RF9A 1JSTA 3AD6A 3H0YA 4TWCA 4YC6A 2PZIA 3PUFC 2C5OA 4AXDA 4FV9A 5CVFA 2VWVA 5DR6A 2XK4A 3KGAA 4BF2A 4TNDA 4J1RA 4U79A 3FXZA 4GIHA 4GJ2A 5AR3A 2BCJA 1GZ8A 5CU0A 5HVKA 3HKOA 3BYMA 1PMEA 1U59A 4M14A 4BCFA 4DHIB 4LYNA 1K2PA 2ZVAA 4KKHA 3C50A 5EOLA 3JR1A 4L68A 4AUAA 3VS2A 4C58A 4GIIA 3EFJA 3RM6A 1H1WA 2X7FA 5FLFA 4XG4A 4EJNA 3FE3A 2IG7A 2OH4A 3VHEA 2W1HA 3H10A 2NYAA 3THBA 2G1TA 4BBMA 4RRVA 1H27A 3D5UA 2LGCA 4RZVA 4F65A 4EHZA 5BPYA 5I0BA 3TDWA 1XBCA 5HCXA 4KABA 4DH8A 3VBXA 4KB8A 4KUJA 5IQGA 3BWJA 3MJ1A 4CZUA 4C38A 3GENA 3U8WA 1FQ1B 4DFLA 4XP3A 4O7RA 1U54B 4FR4A 1UU9A 1B39A 1F3MC 1VEBA 3COIA 3AC4A 4DLJA 5CZHA 5GHVA 3O8TA 3RALA 1Q8UA 1H26A 4FIHA 4C0TA 2HAKA 2AQXA 2X8DA 1WBWA 2ITNA 3GQIA 4XBRA 5C03A 3GU8A 5L8LA 3FPMA 4R6VA 2RFEA 4IVAA 4FEXA 4O82A 5HE1A 3F2NA 4AZFA 3LFAA 5KMIA 5L2WA 5M4UA 4I0RA 2F57A 3CJGA 3QHWA 4QMWA 5DA3A 1ZZ2A 1OL5A 1QMZA 4O0RA 2FSTX 2VAGA 4BL1A 5KKRB 2PVKA 5LCJA 3PYYA 2JGZA 4FICA 4CRLA 3UNJA 2PUPA 2J5FA 4PDPA 2G2HA 2W4JA 4X2FA 3DJ6A 3Q6WA 1HCLA 1ZAOA 4FC0A 4IQ6A 4XG6A 3ALNA 4BDGA 2C5VA 4PPAA 1H1QA 4EZ3A 2JITA 4BCHA 5IA0A 2EXEA 4N4SA 4D55A 5J7BA 4EHVA 2C3IB 4FTMA 4RG0A 4AT4A 3SQQA 2BAKA 2WTCA 3MH0A 4BI1A 4E4LA 3SRVA 4IEBA 1YRPA 4RWJA 4F99A 1FMOE 4CKJA 5I9UA 1YWRA 5A4LA 2QC6A 4FTKA 1JKKA 2YDKA 3H0ZA 3QD2B 4J95A 5KBQA 1YXVA 3A4PA 1OKVA 3DAJA 4ZOGA 2ITWA 4QP9A 3FLZA 4FG8A 3GCUA 3FUPA 3MI9A 4HNIA 1R0EA 5C01A 4D0WA 3VBVA 1XH7A 2BZIB 2QHNA 3R01A 1ZMUA 3SA0A 2BRMA 3G15A 3OXIA 1V0OA 3PA5A 4XG9A 3I6WA 3M1SA 2J6MA 2JIIA 5HICA 4X2KA 1LPUA 4MD7E 2VU3A 4B8LA 4CNHA 2OZAA 4RVMA 4LRMA 3DGKA 4AOTA 2R2PA 4ZSJA 5ITAA 5J5SA 2JEDA 2PE0A 4JX3A 1H4LA 4NTSA 4QNAA 3TXOA 4DFYA 5IA4A 3ITZA 4D2RA 3R7GA 2V0DA 4F64A 3NEWA 5HIEA 4GV1A 3W0RA 2XIRA 4IFGA 3QQLA 3F82A 3UO6A 5C4LA 2BALA 2KTYA 4M97A 3C4CA 3SX9A 3W0PA 5BVDA 3NCZA 4AGUA 3F7ZA 3QCSA 3HYHA 5AUWA 5HU3A 3PRFA 3W1FA 1DS5A 4DGGA 1UV5A 3GQLA 3ZUUA 1GZOA 3EB0A 2B53A 4C02A 4X3JA 3CGOA 2XJ0A 4HCVA 3WOWA 2GNFA 4BDEA 4D2WA 4I20A 5LQFA 3KC3A 5A4QA 3R9DA 4EJ7A 2RL5A 3C51A 3V04A 3KCFA 3TKUA 3CS9A 4F70A 4IX6A 3QRJA 5BVNA 5M53A 3RK7A 2VO7A 1SVEA 3KVXA 4IVBA 3P23A 3WZEA 4I23A 4QMQA 2YJSA 3CTJA 3C4WA 4A9RA 1OM1A 5JKGA 3BU6A 3HV4A 5D1JA 4H3PA 4F0FA 2F9GA 4FTIA 2GTNA 3PXKA 1M2QA 3KN6A 4ID7A 2HZ0A 2X39A 4IVDA 4JQEA 1BL7A 4MYGA 1A9UA 3UOHA 5K4JA 4AFJA 5J9LA 3V5JA 4RJ8A 4A9YA 4AGWA 2C3JA 4I6LA 2YDJA 3LLTA 4MNFA 4JVGA 4J97A 1YDTE 2C68A 2I0HA 4Y73A 3SXFA 5ANOA 4BZDA 4MH7A 4FSWA 2QOHA 3R04A 2UZWE 1Q62A 1YHWA 4P4CA 5TKDA 4U42A 2R4BA 5FEDA 5DR9A 4QQ5A 4MXZA 5FWKK 3BU5A 3DBEA 3FMDA 3IDBA 4U41A 4KAOA 4OT5A 4XG8A 4RLKA 1VYWA 2UZBA 3E92A 3FMKA 3LFQA 4QQCA 4YZNA 3RKBA 4C4IA 4O6EA 3RZBA 4EYMA 5AV2A 4QDEA 3ZLSA 3O8UA 3TV7A 1Y91A 4I4FA 3LKMA 4GVJA 4NKAA 1OBGA 4KBAA 4O91A 2VO3A 4I41A 2JBPA 5FXRA 4LQMA 4UYAA 3VW8A 4IWPA 2EVAA 4H36A 3UVPA 1H01A 5IQCA 5T3QA 2OJ9A 2BIYA 3K3IA 3UTOA 2H6DA 4FUYA 2QVSE 3HDNA 4DG2E 4X2GA 2NRYA 2WTKC 4NCTA 4DTAA 4JIAA 2ZYBA 4W9WA 2UW0A 4L7FA 4P5ZA 4UALA 2WAJA 3CXWA 2BDJA 4AW5A 3HAVA 1YI3A 4FBXA 1JKLA 2ERZE 3NWWA 4FZAB 2JD5A 2BTSA 3U9NA 1CMKE 2VTSA 3FBVA 1SVHA 4ACHA 5CF8A 2J2IB 4AN9A 3SXRA 4K11A 2X0PA 3N51A 3RPSA 2WHBA 4XV9A 2WMUA 4C4HA 4LMUA 4ZSLA 4CFMA 4RX8A 1BL6A 1LR4A 3N4UA 1W2FA 1K9AA 1PJKA 5IH6A 5AIKA 3R1YA 2WMSA 3ZO2A 1MP8A 3QBNA 3VNTA 4E4NA 3I7CA 2HYYA 3DCVA 3ZRKA 2P0CA 4RPVA 2B9HA 2PSQA 3L8XA 3QX4A 3ORKA 3CJFA 4V0GA 4J52A 3VULA 4TYHA 1KE6A 2UZUE 2XKDA 3LM5A 3QQFA 3QTZA 5D7VA 3WZUA 4EKKA 4EL9A 2HZIA 3K54A 4ANNA 4IAYA 5M56A 3R8PA 4CV8A 5AUYA 1J7UA 4JAIA 3O71A 3TNIA 4GKIA 2YM3A 4E73A 4YZMA 3FY2A 2OJFE 3O96A 3BGQA 2PY3A 4EK3A 3Q4UA 3QXOA 2JIUA 1YW2A 5HZNA 5AM6A 3ZHPC 3A7FA 4ZIMA 5CVHA 5CU3A 4CMUA 4O7NA 2VTLA 4CTCA 2OJJA 4FSUA 3LCKA 5AR8A 5K0KA 2YZLA 1NXKA 2BHEA 4RT7A 4YBJA 4HOKA 5FXQA 2QO9A 3DBFA 1QPEA 3KK8A 3R7OA 5JFWA 2HIWA 2HWOA 4FV6A 4XEYA 1OKWA 2XMYA 3W2RA 4OTIA 3G6GA 4W8EA 3TIYA 3MTFA 2R64A 5B2KA 3VUTA 5LVMA 2PVNA 5M06A 2OF4A 5EYCA 1TQMA 2E9OA 3W8LA 1V0PA 3W55A 4BCMA 4KKGA 3W0MA 4TY1A 2XRWA 4XHKB 5E1SA 5E8WA 2P2IA 3RWQA 3GC7A 4CVAA 5CI7A 5C1QB 1Q41A 1KWPA 1FVTA 1WVXA 2W1ZA 4TNBA 3TNWA 4AN3A 1IR3A 5D12A 3SD0A 4QP8A 4IZ5A 5HI2A 4Z16A 3KIOC 2XCKA 4AXCA 4II5A 2QOIA 3GEQA 4ZS0A 2GNLA 4QD6A 3R8LA 3G0FA 3TT0A 5IZFA 3QHRA 3OG7A 3OMVA 2ACXA 2CDZA 4J7BA 3CPCA 4WG3A 1OZ1A 4BVUA 4CXAA 1H1SA 1XBAA 2XA4A 4B4LA 2X1NA 5GZ8A 4RFMA 3L9LA 2CNUA 4JQ7A 4U7ZA 2B0QA 3QAME 4DBXA 5BUIA 5I4NA 2PMIA 5AJQA 2ITXA 4DHZA 2GFCA 1TQIA 3WBLA 4A4LA 5HBJA 5CXHA 4BCKA 3R1SA 1IRKA 2W96B 5FP5A 1R1WA 4FZ6A 1BLXA 4FKGA 4JR7A 4NWMA 4YJNA 3T9IA 1MQBA 4A9SA 2QKWB 4GK4A 3OHTA 4G16A 4IJPA 4EQMA 4MD9E 4OGRA 1WVYA 3MGYA 4WNPA 3LMIA 1ZMWA 5TE0A 3TJCA 3REPA 4TWPA 4QQJA 1KE8A 3LMHA 3EYHA 4FKQA 4C59A 3IONA 4J96A 4E6AA 3WIKA 4KNBA 3LMGA 4MAOA 4M84A 4O0XA 4O0WA 5DBXA 2NO3A 3NYVA 3WF9A 4BCIA 5L3AA 2XZSA 4UZDA 2YACA 4O1OA 2PZ5A 3QL8A 1CKIA 2UW8A 5ETIA 2O65A 1OL2A 4CKRA 5I3RA 2B7AA 1W82A 2W1EA 2PZPA 3MYGA 4NK9A 2B9IA 5C27A 1OPLA 3FLSA 2X81A 5DT3A 4FZFB 5GNKA 3PP1A 3VC4A 4C36A 4NFMA 5FTQA 3FMLA 3V5QA 3QCYA 4ANSA 1WZYA 2C4GA 4XUFA 3DFCB 3FMMA 4EOIA 4RLLA 1YHVA 1CSNA 1FVRA 4CQEA 1PHKA 4GYIA 4JNWA 4DEGA 4BCGA 5EM6A 5FDPA 1I09A 3SW7A 3CLYA 3FKNA 3R8UA 5BVKA 2OXDA 1WBTA 4LGGA 4X7QA 4AAYA 1DI8A 4QP6A 1ATPE 4O0SA 4F7LA 5IA3A 2BAQA 4X21A 3BZ3A 4WRSA 4ALUA 3MWUA 4MQ2A 1U4DA 2NRUA 1G5SA 5DG5A 4CMTA 2Z02A 3VJNA 3QD4A 2CCHA 3F3ZA 3DAEA 2HZNA 4B99A 2XIXA 3EQBA 3PIZA 2I0EA 4H05A 1YWVA 1SM2A 5E8UA 3WIGA 5CSXA 1XMMA 4NM3A 1Q24A 4AQKA 5IA2A 1YOLA 3IPHA 4XRLA 4ALWA 5IF1A 3P5JC 4EH7A 1MUOA 3LPBA 4CFUA 3Q4CA 2OK1A 4FYOA 2ITUA 2Y6MA 2OZOA 4P90A 4PPBA 2GQSA 5AMNA 2XS0A 3QKMA 5FBNC 4QTDA 2W06A 2WU7A 5TT7A 1E1XA 2YEXA 2REIA 3FY0A 4QPSA 5E8XA 3F66A 2RFDA 1OKZA 3F61A 4LMNA 4RJ4A 5CU6A 3DZQA 3AT4A 5FP6A 3COMA 4GMYA 2EXMA 5TF9A 3CR0A 2R5TA 3PUPA 4MXOA 5CQUA 3NVKI 5A4TA 4QP3A 1ERKA 3NNVA 3BEAA 2YA9A 3DTWA 3PRIA 5AX3A 3TEIA 3W16A 3HRFA 1YI4A 2BUJA 1YVJA 2CCIA 2ITZA 4AW2A 3FKOA 3PA4A 4OR5A 4OTDA 2NP8A 3A7IA 3JVRA 4XV3A 1MQ4A 1OMWA 3QF9A 4I94A 4BTFA 1DM2A 2HW6A 4FNYA 4Y8DA 5F1ZA 2IW8A 5E9EA 1GOLA 4XRJA 4DEDA 4G6LA 3CY3A 4HZRA 4BFMA 4U80A 4G3FA 4FJVA 2P3GX 3NYNA 3NCGA 3KA0A 3SLSA 4AS0A 5HO8A 2VZ6A 3KULA 4FYNA 5FQDC 2YN8A 1NVRA 1KUTA 5CT7A 3NW5A 4PDSA 4ZLYA 3ODYX 4FX3A 2G2IA 3ROYA 4P2KA 5AV3A 2J9MA 3FC1X 4ZTLA 2GCDA 4BKYA 5CF5A 4RZWA 5KHXA 4OTWA 4ZJVA 2E9UA 4M7IA 2C5YA 3UE4A 3HA6A 4O0VA 2XKCA 4EYJA 5DMZA 3GC9A 3GGFA 5ANJA 3S95A 1G8AA 1IAHA 3EN7A 1GZKA 2ETMA 4G3GA 4FT3A 4K33A 5CEIA 4AZTA 4F7NA 4XP0A 3ANQA 4EI4A 2XK9A 4QMVA 1M7NA 1Q8YA 4NCTC 1E9HA 1GAGA 2OFVA 2ZMCA 5AP1A 4AOIA 5FGKA 2B4SB 1W84A 4ZZMA 2RFNA 2C6IA 3II5A 4C61A 4KINA 4QTBA 4MQ1A 4Y72A 2ITOA 1UKIA 3EH9A 3T3VA 3PP0A 3T3UA 4O6LA 3UG1A 4DT8A 4F9YA 4XP2A 3FLNC 3HAMA 3KXZA 2ZDTA 3BKBA 4HVIA 3N9XA 3BGPA 3CC6A 5FRIA 4AF3A 2HENA 2LAVA 4O83A 2I40A 1ZOHA 4JL9A 3V8SA 4BIBA 1NVQA 1Q5KA 1VJYA 3Q32A 5EG3A 4WUNA 3VWAA 3HV7A 3WZDA 2EUFB 1JKSA 2R3QA 4QMOA 5K5XA 4FIJA 2XEZA 4L42A 2PVYA 4OAUC 2JLDA 5BUEA 4BBEA 4O4FA 2XBAA 4APPA 2XVDA 4AG8A 3MA6A 5C8KA 2JDSA 2XRUA 3HA8A 3PZHA 4FG7A 4GYGA 2A4LA 3NSZA 5EM8A 3RNIA 4D1ZA 5C4KA 3HMPA 4XG2A 1JWHA 3F5XA 1PMVA 3PFQA 4FL3A 5GINE 5HE0A 3E62A 1M2PA 4MD8E 4TWNA 2WTDA 3R2BA 4O0TA 5EI2A 3TTJA 2XK8A 3A7GA 5M4FA 5FDXA 4BDJA 2CGUA 2F7XE 2VRXA 4B9DA 4DHFA 3E87A 3L9MA 2EXCX 4F9WA 3VN9A 2ONLA