3DBDA

Crystal structure of an activated (thr->asp) polo-like kinase 1 (plk1) catalytic domain in complex with compound 094
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
287
structure length
261
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Polo-like kinase 1
publication title Design and synthesis of 2-amino-pyrazolopyridines as Polo-like kinase 1 inhibitors.
pubmed doi rcsb
source organism Danio rerio
total genus 73
structure length 261
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dbdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dbdA01
5K5NA 3QTSA 3RK9A 3NPCA 2WTDA 5LVPA 3DDPA 4RPVA 4Y8DA 1PMVA 1Y57A 5HIEA 4IVCA 3PA3A 4F9BA 1FVTA 3VS2A 4MXAA 4F64A 4FKOA 2LGCA 5AV2A 1O6KA 4I41A 3R9HA 2YWVA 3U8WA 4DH5A 3FL4A 2GS6A 5AR2A 4RA5A 3ZRMA 3LIJA 5I9YA 4E6QA 5KNJA 2BIKB 4HYIA 2XEYA 1FVVA 3EQCA 3ZC6A 1XO2B 3NMUF 3SG9A 4FL3A 1XWSA 4WSQA 2I40A 4F7JA 2V7AA 4GUBA 3CCNA 4DYMA 5IA0A 4LG4A 5CY3A 5AJQA 4IZAA 5EYCA 3ZRLA 2WOTA 4QQJA 3TI1A 5EM5A 2WMTA 4M12A 2XKCA 5JRQA 5HBEA 2P55A 4QMZA 2VTSA 1H0VA 2XIKA 2QONA 4XP0A 4BICA 3WI6A 5EK7A 1Y8YA 4DG0E 4KKHA 4MWIA 2CGVA 3UODA 1KE8A 2CLXA 2QD9A 3BHYA 1PXIA 2R3IA 3DTWA 2ZVAA 4I6FA 2RFNA 1H1WA 3VBQA 1ZOEA 2WIPA 1GIIA 3C50A 3GCQA 3QC9A 4MD8E 1P14A 2R7IA 4U3YA 2JDTA 4AGWA 5BVNA 2XVDA 3ZEPA 4C3FA 1ZYJA 4NJ3A 5AADA 3OT3A 4K8AA 4KS7A 4PP9A 5DIAA 2F4JA 3RI1A 1YI3A 4NM7A 3GCPA 3IPHA 1OKVA 1Q8ZA 2P4IA 3ENHA 3SRVB 3H3CA 4EOMA 2HCKA 4FUYA 3RWQA 2YIRA 3G15A 4XUFA 1OIQA 3ZHPC 5CT7A 2B9IA 2WMAA 2ZMCA 3FMNA 3BHVA 4FTTA 3U4WA 4EWQA 3VUDA 2VTOA 1R3CA 4OR5A 4EOJA 2X2MA 5DNRA 1XR1A 3KULB 5E1SA 5HTBA 1P4FA 3VUIA 3EJ1A 4Z16A 2Z02A 5JK3A 4WHZA 3EN6A 3SX9A 3QTWA 3BWJA 5DR9A 2I1MA 4FTQA 1B39A 2GFCA 3QCYA 5DEWA 4M69B 3SOAA 4DFXE 5EM8A 3NLBA 5DE2A 3QA0A 1SM2A 2KTYA 2ZJWA 4G3CA 4LOQA 5A4LA 3ZRKA 3PG3A 5CAQA 2WELA 3BZ3A 3R1QA 3Q2MA 3LFCA 5CX9A 4ANBA 5JGDA 3BU6A 3KCFA 4FKRA 1CDKA 3NCGA 3O8TA 4RJ8A 2W17A 2W1IA 2REIA 3I79A 3W2RA 3EYHA 3Q96A 4A4XA 2Y0AA 3DAKA 3BI6A 1GZNA 5EDPA 4CLIA 2E9OA 4C37A 4DEBA 2BUJA 2XNPA 4EEVA 3L9PA 3AQVA 5I9WA 1XH5A 3BELA 2B4SB 3QTUA 1YOJA 2J4ZA 5JQ8A 4Y5QA 2YM4A 3QYZA 4F9CA 3UIBA 5M55A 3VBXA 5C26A 4O0WA 3PG1A 4E7WA 4BCQA 3GXLA 4DA5A 2GCDA 3OY3A 3UVPA 3H0ZA 3KRJA 2B9HA 2FGIA 2W0JA 4FYNA 4BBMA 4E1ZA 4FKSA 4HNFA 3PPKA 4AZSA 4QTBA 2XUUA 3NRMA 4QYHA 4MK0A 2O2UA 4HYSA 2XK6A 3WE8A 5AUXA 4EH6A 4HGEA 2C6KA 3HEGA 4D9UA 3RGFA 4QMYA 5C1QB 3LMHA 4ZTSA 1FINA 1REKA 1OKYA 3F7ZA 4USDA 4AT4A 4CKRA 1NA7A 2WKMA 3UQGA 3BE2A 5CU0A 4YO4A 4EKLA 2GHGA 2YAAA 4Y72A 5JKGA 3C1XA 3ZMMA 5IUGA 2VU3A 1BI8A 4NWMA 5LVOA 2OLCA 4OTFA 2QLQA 4L44A 5IPJA 5KE0A 4ANMA 4F7SA 3P78A 5HCXA 1FMKA 5DVRA 2QOCA 5EM7A 4FV8A 2R3PA 4HGLA 4LRJA 3KRRA 3WYYA 2ITTA 2VWXA 2YAKA 4L53A 3VQHA 5HNBA 5D1JA 1YXVA 5IA3A 2WMRA 4R5SA 2JKQA 3FJQE 2OJFE 2XM8A 3HV3A 3K3JA 4DFNA 3JYAA 3MESA 1ZMVA 2XIYA 4BCFA 2ZMDA 4A07A 4FIHA 1U5QA 5FP5A 4WBBB 4FVPA 3CTHA 1E1VA 2IZSA 4RZWA 2RKUA 4FKVA 5BVWA 2ZV9A 3FMKA 2Q83A 1JQHA 3QRIA 2X7OA 3PRFA 4O2PA 3CPCA 3PDTA 1TQMA 4AZVA 4C4FA 3QXOA 4DGNA 2FA2A 3S0OA 5GZ8A 4AZTA 2VAGA 4NKSA 5CNOA 4ZSAA 4I4FA 3CLYA 4FTCA 3ATTA 1M2PA 1UU9A 2GDOA 3TJCA 2VTAA 3G0EA 1RW8A 3BV3A 3NNXA 1CKIA 4WNPA 4FG8A 5FDPA 2P2IA 4G6NA 2W1FA 5IQHA 4IANA 4FSZA 3FQEA 3PZEA 5AUVA 4XV3A 4QTEA 2AYPA 3DNEA 3RHKA 5IH4A 4RJ3A 4X6QC 5HNGA 3WF5A 3VS6A 4D2VA 4EH5A 4F9YA 3F82A 2FH9A 3ORNA 3LCTA 4O6LA 3G6GA 3WBLA 2ZOQA 1YXSA 3AC1A 2GS2A 3D83A 4MHAA 4X3FC 3MVJA 3NDMA 2ZYBA 4BHNA 3UOHA 1BUHA 1WCCA 4R6VA 3TXOA 2UW6A 5IMEA 3HAVA 3K2LA 3IKAA 4MXZA 5EI8A 2J0LA 2HENA 4MVFA 2ZAZA 4HCTA 2ZM1A 5HGIA 4PWNA 3TUDA 2RG5A 4EQUA 2OJIA 2P3GX 3QTZA 4AWIA 4U43A 4DH7A 1OBDA 4QYGA 3Q4UA 2NPQA 2YDJA 1U5RA 1J91A 1E1XA 4PPAA 2Q0BA 4IVBA 4ACMA 3UMWA 5BUJA 4N70A 4WG3A 4O7YA 2EXCX 2VO7A 4DBNA 3II5A 3PE1A 1Q8WA 4XV9A 5EI6A 4XP3A 2JAMA 2YERA 1XKKA 1A48A 4H05A 5M06A 4U41A 4TYGA 1JOWB 2QURA 5F94A 2XB7A 3GB2A 4UXLA 4QQTA 5A14A 2I0YA 3PWDA 2UVXA 4MCVA 5LJJA 4AFJA 4DHFA 3HLLA 4MF1A 3PA5A 4FV7A 3RCJA 4XG3A 2SRCA 2CJMA 3MI9A 1Q3DA 4FZ7A 4QMMA 1YVJA 3VAPA 3V5PA 2F7ZE 5J9LA 4O7LA 4FBXA 2JITA 3TNHA 3UVQA 5GZAA 1URWA 4IDTA 4AA4A 1Y6AA 2WHBA 1XH8A 1WBPA 3SW7A 2ZDUA 3SV0A 2PMLX 4RC3A 4QMPA 2UZWE 4OTPA 3R83A 4DITA 5M57A 3TN8A 2GQRA 2PVJA 2QOQA 4AACA 4FKPA 4MD9E 2E9UA 2GNLA 3LFBA 4RJ4A 4W8DA 4WRGA 3UC3A 4USFA 4PMTA 3NNWA 4BDHA 2O5KA 3MA6A 4DLJA 2PE1A 5CSWA 5JFXA 4OBQA 5L2SA 2Z2WA 3R30A 4G1WA 4ALVA 4EH8A 4GK2A 5AA9A 4L3PA 5L6OA 2QG5A 3ORKA 2C3JA 2PSQA 5HG7A 3ZDUA 3LPBA 3F69A 4GJ3A 1G3NA 3SDJA 2BAKA 4YPSA 3TM0A 4GSBA 3FLYA 4DBXA 2B9FA 5EOLA 3DLZA 2PVFA 3I81A 2PZIA 4C0TA 5AR7A 4QD6A 5IUIA 3S1HA 4XNEA 4QP6A 5FEDA 1GY3A 3EQRA 3F9NA 2YISA 1H08A 3QTIA 4NW6A 3CE3A 2ZM4A 2HZ4A 1R1WA 1OKZA 4XOYA 1ZARA 5AX3A 3DXNA 4BFMA 5GHVA 1H25A 2R2PA 3IECA 2XIXA 3R73A 3ZBFA 4ANNA 4RGJA 2HWPA 1F5QA 3C4CA 3ORMA 4D4VA 2G9XA 4F7LA 2OIDA 3COKA 3KL8A 5K4JA 3PXRA 3WF6A 1PW2A 2CN8A 4AQCA 4QP2A 3DJ6A 2ZB0A 1H8FA 4TWPA 1KUTA 2ITUA 3AC8A 4ZTHA 1XH6A 3TTIA 3R1YA 1YHWA 4KKGA 4CMTA 2OI4X 4QOXA 4EL9A 5KBQA 4CV8A 3OY1A 2VTTA 2XNNA 2C3IB 3KU2A 4QTCA 5ANIA 3TKHA 5EM6A 4WIHA 4YMJA 2RFSA 2PU8A 4GVAA 4OTGA 4DN5A 5J95A 4IX5A 3NIEA 4OTWA 4K1BA 4EK8A 2O0UA 4RWJA 2KULA 3V04A 2Z7LA 3G6HA 3JVSA 4BKYA 3O23A 5GZ9A 3CQUA 5DG5A 4FNYA 3S4QA 3U55A 1OI9A 3LLTA 3UMXA 3BHUA 2VWWA 2BRBA 4JQ8A 4AUAA 1RDQE 4HZSA 2A0CX 4AU8A 1V0OA 4ZTQA 2ACXA 4Z3VA 1T45A 1Q62A 4FTMA 4FV2A 5AA8A 5HLNA 3AXWA 2J2IB 4HOKA 5LOHA 3WZJA 2VO0A 5CF6A 3IW7A 3GCSA 3R02A 4CZUA 4FGBA 2J90A 3AC3A 2Y6OA 3F6XA 4LM5A 1JVPP 1AQ1A 3R8ZA 3UJGA 4LL0A 4E6DA 3OROA 4QYEA 2YZLA 4C3PA 4JR3A 3VVHA 2W99B 3SA0A 4IJ9A 4MX9A 4QT1A 4CFUA 2W9FB 4U3ZA 5IA5A 4ANSA 3LFAA 2J0IA 2YWPA 3VN9A 4NKAA 3R0TA 3KXXA 3V3VA 3DQWA 3Q53A 3A7FA 4J97A 5DT3A 5KZIA 2X0GA 1QL6A 2GNFA 2XCKA 4C38A 4Y73A 5KMMA 3Q5IA 4RX8A 2DYLA 1DI9A 5EYMA 4YC6A 3R7VA 4FZ6A 4A9SA 2YM8A 4L42A 4YBJA 3EB0A 4JX3A 4A06A 4X2KA 2QOFA 4Q2AA 2C1AA 4EH2A 2FSMX 5HVYA 4ZJIA 3DXPA 4C02A 1JSTA 4DLIA 4DH3A 4PUZA 5BYYA 3PY0A 2YIXA 5FUTA 3KA0A 1OL5A 1QPCA 2G2HA 5AUWA 2UZTA 3DPKA 3G9LX 5FTOA 4HJOA 2C30A 4CEGA 3NUAA 3GU4A 4BI1A 1Q8TA 3DNDA 1OIUA 4FSUA 3TL8A 2X6EA 2IO6A 4YJQA 3TDWA 4QMUA 2GMXA 4EZ7A 4H3QA 4EC9A 1W82A 5E90A 4E26A 3ELJA 5AP3A 2CKQA 1Y6BA 2QOOA 2RL5A 1ZYDA 1UKIA 5AP5A 3KN5A 4EUUA 4RQVA 5T3QA 3GFEA 3LMGA 3RTPA 2LAVA 2XZSA 1SNUA 2X8DA 4NIFA 2BDJA 3O7LB 4O1PA 3U51A 3UO6A 2R5TA 5A54A 2FSTX 5DRBA 4XOZA 3A60A 4IM0A 3D15A 5A4QA 5JGBA 3MPTA 4PTGA 3U87A 4ZY6A 4RC2A 1NW1A 1WAKA 2Z7QA 3KK9A 2WD1A 3CQEA 3F3WA 4K77A 4OTQA 1OL1A 1QPJA 3W2CA 5EQEA 5AV3A 3JPVA 2XP2A 3ORZA 3R9DA 4CFNA 4R5YA 3R7OA 4YNOA 5KHXA 3ODZX 5HE0A 4V0GB 5ETIA 5HZNA 2OF4A 5A9UA 3VQUA 3ZZWA 4BCIA 4ZZNA 2PZRA 2J51A 2O65A 3S95A 5JSMA 4FKWA 4CD0A 5BYLA 2BROA 5DR6A 3VUHA 4YURA 2YEXA 3RK7A 3D4QA 3DFCB 5D41A 3WF8A 4CKJA 3GU6A 4S34A 3PSCA 4ZSGA 5FG8A 3V51A 2YM7A 3C4EA 2XK4A 2ZM3A 3O71A 2WMBA 4FV4A 4QMTA 5CTPA 5CZHA 4EI4A 4ZS0A 4IZ7A 3DK6A 3VBWA 4J99A 2PULA 4UY9A 3W33A 5BYZA 4FEQA 2GNHA 4M7IA 3SQQA 2VO6A 4B0GA 4BCNA 4RG0A 4GVJA 2ETKA 4TYEA 5IMXA 4C2VA 2XYUA 2VX3A 4P5QA 4D1XA 5E8XA 2P0CA 2BDFA 4ITHA 3AMBA 3GC0A 4BWXA 1XQZA 2W1HA 4IX3A 4KS8A 2X9FA 2YJSA 5CEPA 5CAPA 3LCKA 2NP8A 5KZ0A 3HKOA 4LOOA 3E8NA 3EHAA 1B6CB 2VTPA 3QQUA 4R7BA 4I5PA 4F08A 3DZQA 4RA4A 4ZJJA 1WBWA 4AW5A 3KKVA 5J79A 2XJ1A 4YJTA 5CF8A 3ZO1A 4C3RA 1YDTE 3ZC5A 2IW9A 1RQQA 4ANLA 4KAOA 4KBCA 4R3CA 3QRTA 5CZIA 5CEIA 4C57A 3OOMA 3MFTA 5LVLA 3OTUA 1Z57A 5LXMA 4JL9A 2ETMA 5D12A 2CGXA 3PLSA 4MNFA 4YBKA 3D9VA 4LGGA 3R7YA 4EOOA 2W1CA 3RP9A 2IVSA 4AN3A 4ZMFA 3ZDIA 2JDSA 3RAKA 3FL5A 1DAYA 3BLRA 4LUEA 3GP0A 4HCUA 4GT4A 1DM2A 2WZJA 5E8WA 5K4IA 2WU7A 3KFAA 3HUCA 5IKWA 2QODA 3I6UA 3P1AA 3QQLA 3F3TA 3KGAA 4IHPA 2YITA 1OMWA 3DA6A 3OCSA 2PTKA 3OWKA 1M7QA 5D11A 2ZV7A 4IJPA 4BIDA 2ITVA 2O63A 4DFBA 4YZCA 4CRLA 2ITYA 3KQ7A 2CPKE 2H9VA 3DK3A 4MF0A 3DAEA 3CQWA 4QYYA 4CMUA 3PP1A 3C5IA 3O17A 3BU5A 3ZLXA 2WU6A 3OW4A 5I3RA 4JQEA 3QQHA 3BRBA 4PTEA 1GZ8A 2IWIA 3CPBA 2VV9A 4RVKA 2X2KA 5IG1A 3TEIA 1A06A 4I94A 3H10A 4USEA 2FUMA 3FY0A 3EMGA 3MVMA 4UMRA 1YW2A 3QBNA 3LQ3A 4IAAA 4BIEA 3Q6WA 3W10A 3DBCA 1EH4A 4CYIA 4ENXA 4FF8A 1OPLA 3VUKA 2WTCA 2OXYA 2BMCA 2WMXA 2WQEA 3HA8A 3SHEA 1E9HA 4EOPA 2OIQA 4ZOGA 3ITZA 2BZJA 2CKOA 3MV5A 4YTIA 4FGRA 4ENYA 3JR1A 3I0QA 4C4EA 3FI2A 3I4BA 3IOKA 4CFMA 4FOBA 1SMHA 2GHMA 3O51A 3QKKA 5ANJA 1G8SA 4IWDA 4JAIA 1HCLA 4FTJA 1ZZLA 3E7VA 4E4NA 4O22A 4MXOA 4QPAA 3RZFA 3QQKA 3CY2A 5BMSA 2C4GA 3LHJA 3ZSHA 1LR4A 4FSNA 2ERKA 3TNIA 2QC6A 2OU7A 3JUHA 4AAAA 4AZWA 4RRVA 3KN6A 4ZTNA 5IA4A 2WAJA 1PMEA 2PZYA 4FTIA 1OL2A 3KCKA 2F7EE 3LFQA 3LXPA 3NW7A 4L01A 5FBNC 4KIOA 3UGCA 2OJGA 3FZ1A 4B9DA 5KO1A 5T6KA 4B8LA 4Q9ZA 1J3HA 2PVYA 3Q9ZA 4MEDA 1X8BA 2BPMA 2PUIA 5L6WL 2GNGA 5I9VA 4F09A 3EZVA 4RSSA 1UA2A 1YWRA 2A2AA 2QU6A 3FHRA 3NUYA 1GOLA 4TYJA 4U5JA 4GFOA 3EQPA 3WF7A 3FZRA 4H1MA 3TZ8A 3POZA 2Z7SA 3GT8A 2UV2A 3FLZA 4BI0A 2OWBA 4BCHA 4K0YA 4MAOA 4EOSA 3FMMA 4O7NA 2YM3A 3HMMA 2VNYA 3W16A 5L8KA 4UBAA 5J7BA 4M0ZA 3QCQA 1F3MC 3WF9A 3W2PA 3L9NA 3DK7A 4QYFA 4GIIA 1T46A 3FBVA 4PDPA 2F9GA 2Y4IC 4Z9LA 4MXXA 4E73A 5CALA 5KMLA 4D5HA 4GYGA 2HZNA 5HOAA 5CENA 5HX6A 4PDYA 2BALA 2WTKB 2BKZA 4U0IA 2IVUA 4JT3A 2GPHA 4KIQA 3B2WA 5HIDA 5HBHA 4QPMA 5KMIA 5M08A 4ZLYA 3ZXTA 3GFWA 3NVKI 3E92A 3DZOA 1U4DA 2A27A 5HBJA 2WFYA 4XMOA 3C0IA 3OCBA 5EW9A 3BYUA 4FTOA 3NUXA 1GIJA 2F57A 1LEZA 2GS7A 4PPCA 4KA3A 5BQ0A 3Q4TA 1CSNA 4H3PA 5FXSA 1WVWA 3ZU7A 2XCHA 2JEDA 2G1TA 4FMQA 5HG8A 4YNEA 5CVFA 5HD4A 4J95A 5CEMA 4V05A 4NM0A 5FM2A 5I4NA 3IONA 5EQYA 3MBLA 5L2WA 3EQFA 3F5UA 3FV8A 4OTDA 2JIUA 5CASA 3TKIA 5DEYA 5D9HA 2YA9A 2W5HA 4BF2A 4EQMA 2R3MA 3BIZA 1SZMA 3OT8A 4BDFA 2B0QA 2OXDA 2DS1A 1FOTA 3TV6A 3FKNA 4HVSA 3L8SA 5AAEA 3ORPA 5I5ZA 1OUYA 3LCDA 4S33A 2QOIA 1WBSA 2X9EA 5JFSA 1H07A 2HZIA 5HLPA 2J7TA 4GKIA 4ALWA 4FL2A 3E8CA 3FDNA 3CS9A 3JY0A 1R78A 4F0GA 4OGRA 3F3UA 3Q60A 3MY0A 4H1JA 1UNHA 4PPBA 3V6RA 2WTWA 1UU8A 2JGZA 2W4OA 5CXZA 5J7HA 4RIWB 4AOTA 2PL0A 4RT7A 2BAJA 1BI7A 4X2GA 1PJKA 3DY7A 1KSWA 4V04A 4EBWA 1FBNA 1PKDA 4G2FA 3WZEA 4NUSA 4AOIA 4DGMA 5J9YA 3SGCA 3ET7A 3EQDA 3LQ8A 4LMNA 3RAHA 5I3OA 3RNYA 5KKRC 4TWOA 1MQ4A 1V0BA 3PXYA 4UYNA 2QQ7A 4RX9A 5HI2A 3SOCA 4DGOA 3IQ7A 5JH6A 5K5XA 3RCDA 2VWVA 3LJ1A 3QYWA 5G1XA 3RKBA 2QI8A 2BHHA 2BFXA 2Y7JA 2XBAA 4PV0A 1YDRE 4C36A 1ZOGA 4IE9A 1WFCA 4QO9A 3LFSA 5DN3A 4GH2A 4JXFA 3S2PA 4PP7A 5AEPA 3HZTA 1AD5A 3K5UA 4UYAA 2JKMA 3QAME 2WNTA 4YGAA 3NCZA 4C4HA 1IEPA 3DTCA 2YM6A 3PVBA 4FV3A 4ASZA 3K54A 3FI3A 3UP2A 4ZTRA 1J7UA 4JIKA 3OZ6A 4QMXA 5L2TA 1I44A 5K0XA 3UPZA 4K2RA 4GG5A 4X3FA 1JNKA 2F7XE 4DC2A 4FIEA 5BVEA 4C7TA 5CSXA 4KNBA 4C33A 3SXSA 3FMLA 1KV2A 2XF0A 4DEDA 3VBVA 2YZAA 4EHZA 4C4JA 4O83A 1GIHA 2VWYA 2WTIA 4FKUA 5T68A 4YTCA 5TKDA 4G17A 5AFVA 2CCHA 3Q9XA 3F2RA 2Z60A 3EFKA 4B8MA 4JVGA 4HVGA 4J1RA 2X81A 3F2AA 3DB6A 4OW8A 4ZXTA 5CYIA 3RJCA 2R3NA 3FZSA 4JR7A 2VX1A 4FKTA 2W5AA 4TYHA 3DBDA 4GK3A 3D7ZA 4IXPA 2WTJA 1DI8A 4Q9SA 4RVMA 3O2MA 3ULIA 2A19B 1JKKA 2C0OA 4FVQA 3ZXZA 4BBEA 4F99A 3O8UA 4UZHA 5TF9A 3A4OX 5CU4A 4L52A 3R63A 2C6IA 2H96A 3UOLA 2QLUA 4KBKA 3CBLA 3E3BX 3NYNA 4PF4A 4WG5A 5HTIA 3ORIA 1LPUA 4UMPA 2UZVA 3BKBA 3SC1A 3TCPA 3UTOA 5HTCA 4M8TA 3HMOA 2RGPA 5EDRA 4JNWA 3SRVA 4CQGA 3LXNA 4UWCA 4JG8A 1W8CA 3D7TB 3E88A 4G3GA 4BGGA 2JDRA 4D1SA 5JEBA 5KMJA 2V22A 3ACKA 5IU2A 1ZYSA 2HWOA 2XEZA 3GBZA 3QWJA 3KK8A 4IM3A 2W05A 4LGDA 3KXHA 4FTLA 4WSYA 4CRSA 4IB0A 4ASXA 3L1SA 4TY1A 4O6EA 4BCGA 4R3PA 3PVUA 1QPEA 3COIA 3KULA 3N4VA 2PZ5A 1YWNA 3VJOA 4FTUA 3LFNA 4ZMEA 3Q4CA 4C34A 4JOAA 5B2MA 1IR3A 3P08A 1OBGA 3OHTA 4JLCA 4RC4A 5H3QA 4B7TA 4ACGA 2YCQA 2W5BA 4V01A 1L8TA 2EB3A 1BYGA 4M69A 4E4MA 3R01A 4E5AX 3NEWA 4I0TA 1NVQA 2C47A 3FI4A 1L3RE 2XKEA 4RFZA 5GJGA 3C7QA 1BMKA 4H3BA 2YIQA 3PIXA 4IM2A 2J5FA 2BTRA 3PWYA 4I1ZA 5D7AA 3TNWA 5E9EA 1FGKA 4BCKA 2IJMA 1J7IA 3P0MA 1MUOA 5CQUA 2IZRA 4PQNA 4F1MA 2VUWA 3R22A 4GL9A 4RLLA 5AR3A 5JGAA 4R3RA 4ASDA 2VTLA 3ALNA 3G0FA 3A7JA 3NUNA 2A4LA 2ITPA 3DDQA 2C3LA 3BX5A 2YLFA 3OC1A 1QMZA 3P23A 1TVOA 4JRVA 3QALE 4JBQA 4OLIA 5C03A 5AUTA 2UW4A 3TDVA 2OFVA 3AG9A 1YHVA 4AF3A 4Y46A 4CCBA 4ZZOA 4HW7A 2R0UA 3UDBA 4AZFA 3ZLWA 5HCZA 2C6MA 5IQCA 3HYHA 4O27B 1BLXA 3PPZA 1M7NA 3LOKA 3WIGA 3AMYA 3GC7A 4H39A 4NM5A 3R7GA 2OZAA 5CEKA 3MTFA 4XX9A 3QQGA 2R4BA 4WOVA 1YWVA 5KCVA 5AIKA 3V5QA 4CCUA 5BVDA 3SKCA 5GJDA 4G9RA 5JFVA 4E6CA 4QP7A 4ZZMA 2XNGA 2BRNA 1Q41A 3KRLA 4LRKA 4C61A 3BYVA 3VRZA 2PE2A 4KIKA 4N0SA 5ETAA 2ITQA 3FLQA 2W7XA 4L3JA 4F4PA 1XBBA 4HVDA 3A7IA 3QGYA 5C4KA 4O0SA 4WA9A 2XNOA 3RM7A 1JKTA 1PMUA 4H36A 4EYJA 4WO5A 2IG7A 4YPDA 4FK6A 3IGOA 4FX3A 3UBDA 2DQ7X 4FEXA 2Z8CA 5J5TA 1JAMA 3HMIA 3NYOA 4M15A 3UIMA 4AG8A 3MSSA 3D5WA 2HOGA 2YACA 4I21A 4FT7A 4BTMA 4O7VA 5FQDC 3MIYA 3D94A 3HDMA 1UU3A 4QP8A 4EK3A 2E9PA 3DGKA 2R64A 4MQ1A 2YIYA 4O0RA 1PF8A 4QMSA 4G31A 3MGYA 3FQHA 3BV2A 4I4EA 3ROYA 5HU9A 2BZIB 4FKIA 3UO5A 2UZBA 2YLEA 3AD5A 3HV5A 4O96A 3WZDA 4Y5HA 5J1VA 5CLPA 3T9IA 2YCSA 1ZXEA 4HYHA 3N4UA 4W4XA 4O0XA 4EK4A 1J1CA 5IF1A 4MH7A 2ITOA 5L8JA 5ANOA 4M13A 5KUPA 2IW6A 2YJRA 4YJNA 2C5OA 4FIFA 3ZS5A 4EH9A 3OBJA 5GIPE 3MVLA 4U97A 3TZ7A 2VN9A 5D7VA 4YZ9A 3CSVA 3MB7A 4DEHA 3KXNA 3QQFA 3S00A 4YLJA 4YR8A 3HNGA 4RWLA 3GQIA 3CD3A 4ZEGA 4ACCA 3FLNC 2NRUA 4JG6A 3HV6A 3MH1A 4YU2A 1WVYA 2QCSA 2XNMA 4PY1A 3MVHA 4EHEA 2X8IA 3EIDA 3NR9A 4BCMA 3PVGA 3M1SA 3NAYA 4AGCA 2B53A 3AT4A 1DAWA 4ZSLA 5C8MA 5AM6A 3KMUA 2PVRA 3LZBA 4AW2A 5L3AA 3NSZA 4CFXA 2CNUA 5C4LA 4CZYB 4JI9A 3TV4A 3EN9A 2QOKA 4IWQA 4S31A 3UZPA 4D2SA 4D0XA 2R7BA 2YCRA 3D2KA 4EUTA 2HELA 1H27A 4G3FA 2HXQA 1WZYA 5C8NA 3DJ7A 4I6HA 4RZVA 4A4OA 4QTAA 4YJVA 4FTKA 1M2QA 5A4TA 3VS4A 1H01A 3A7HA 3CXWA 4J71A 2G2IA 2ZV2A 3VJNA 5LVNA 4I5CA 3V5TA 2YIWA 4E20A 4F65A 3NWWA 2XKDA 4BVUA 4BYIA 4RVLA 1YXTA 2HIWA 2RG6A 3PYYA 5HE1A 3GENA 1PXPA 2OSCA 4E4XA 4ANQA 3CC6A 5M4IA 4WNMA 4G5JA 1OL7A 2WTVA 4ZAUA 4MKCA 4S2ZA 3V6SA 3TIZA 5CU2A 2UW5A 3GU5A 2ZB1A 3IGGA 4AFEA 4BTFA 4CTBA 4RJ7A 3QUDA 3F2NA 5AUUA 2B55A 2JDVA 4ITJA 3N9XA 4QMVA 4W8EA 5BUIA 2QG7A 5M09A 1HOWA 5KMOA 5JRSA 4II5A 5EW3A 2IVVA 3HL7A 2OJJA 1YDSE 4GU9A 4X2FA 5FD2A 3JS2A 5HIBA 1GAGA 2QHNA 2R3HA 3MIAA 4GRBA 4F1TA 3QX2A 1FMOE 2J0KA 2VWUA 3ZEWA 4BWKA 3LFDA 3BHTA 1UNLA 3R1NA 2BFYA 1JKLA 3R9OA 3UYSA 4ALUA 4PX6A 3EN5A 3OVVA 4FL1A 1Q8YA 4JQ7A 3V5JA 3NYVA 3UPXA 3ZO4A 3R1SA 3LW0A 1URCA 5HO8A 3CGFA 3R21A 5EYKA 2JKKA 4XJ0A 2QOLA 2V55A 2VTNA 5FP6A 5M4CA 5I9XA 3R2YA 1AGWA 2J0JA 3DKCA 3PSDA 4YLLA 3R7EA 4Y85A 5BVFA 5BX0A 4YZDA 3RAWA 4C62A 4UV0A 3F7WA 4QMOA 2EVAA 5EKOA 2XA4A 4I6QA 4M14A 4U45A 5IQFA 2XKFA 3DQXA 4O1OA 4BGHA 3H4JA 2VGOA 4UMQA 4J96A 2HYYA 4MQ2A 3RHXA 1XHAA 1Z5MA 3SW4A 1WBTA 3EKNA 5EDQA 4NIFB 2E9NA 4YZNA 3UIUA 5IUHA 2XJ2A 1PRYA 1PKGA 2RFEA 4IFCA 3PE2A 3R7IA 3WIKA 4IVDA 4N57A 4F70A 3F66A 4TT7A 4XG4A 3RPOA 4CG8A 2ONLC 3BE9A 3HV7A 4O82A 4FI1A 3ZUVA 2R9SA 3OWPA 3QC4A 3GCVA 5H9BA 2VNWA 1PY5A 3AT2A 4NU1A 4NSTA 4EYMA 5EQPA 5CU6A 5B0XA 3ZOSA 5CSVA 2JFMA 5HG9A 4XBRA 4J53A 4R7HA 4IB5A 2R3QA 3NUSA 2YFXA 4ITIA 5FRIA 4FTAA 3MS9A 5FXQA 4AOJA 4WKQA 3QU0A 4GU6A 5LCJA 5AP7A 3LLAA 3L9LA 4NYEA 1UV5A 4XG6A 4PL5A 2PUPA 2XRWA 4PTCA 3Q9WA 1GNGA 4M67A 2GSFA 2QKWB 3COHA 4C4GA 4AW1A 5JT2A 2QO7A 4TNDA 4FV9A 3IDCA 3LJ2A 1ZOHA 5F95A 4F6WA 2PYWA 4Q5EA 1KE5A 4R1YA 3UG1A 5KMNA 3CJFA 3QZGA 3BLHA 4R78A 2J9MA 2OG8A 5K0KA 4IX6A 4WRSA 5DR2A 2VRXA 3NW5A 5E8VA 3IDBA 4WNKA 3R6XA 4KKEA 5HVKA 4I6BA 3Q5ZA 4OUCA 1UNGA 4K33A 3DBEA 3DKFA 5IISA 3OF0A 4MNEB 2WMVA 2I7QA 1ZY4A 3FMHA 3BQCA 4FA2A 1M14A 3O7LD 3RNIA 1Y91A 4I22A 5F1ZA 5M07A 4BGQA 4J98A 5K9IA 4NK9A 2XMYA 5G6VA 3VS1A 5AUZA 3T9TA 4IX4A 4GK4A 3G9NA 2B7AA 3CTJA 4KSPA 5EHLA 5TR6A 4BZOA 4XV2A 2CMWA 4BCOA 1PXMA 3OP5A 2OJ9A 2I0EA 2BZHB 2PE0A 4KWPA 1Q99A 3W8LA 3QRJA 5J5SA 3QGWA 3D5XA 2JIIA 2W06A 3FAAA 3G2FA 3POOA 4QPSA 5EHYA 2VTMA 1O6LA 1TKIA 4O0YA 5IQIA 1OECA 1LEWA 4HVHA 5AR5A 3N4TA 4Y95A 1IRKA 2CKEA 4TL0A 2XJ0A 3TNPC 4RFMA 5LMKC 4U80A 3BYMA 3EFWA 1REJA 4AXAA 4CYJA 2EWAA 3V5WA 2BRGA 4O91A 4DT8A 4QP4A 4ZY5A 1OL6A 3AT3A 4FEUA 3GOPA 4F6SA 5LVMA 4XS2A 3EWHA 2GTNA 3EZRA 3KC3A 3KRWA 4FEVA 2J50A 3GU8A 3FSFA 3HMPA 4K9YA 4K11A 4KB8A 3JXWA 5M56A 3MH2A 3OXIA 1M17A 4Z7GA 4W4YA 4C8BA 4ZJVA 2PUUA 3IW5A 3DAJA 4RIXA 3BCEA 3BYOA 2JIVA 4KBAA 3LXLA 4WUAA 4FE2A 3NZ0A 4APCA 4K6ZA 4E5WA 4RFYA 4GW8A 3C13A 4CG9A 4XG9A 4BDKA 2C6DA 3LFFA 4IQ6A 4IW0A 4U6RA 3UC4A 4B99A 3GC8A 1FGIA 1RE8A 4ORKA 2PMIA 3IOPA 2XS0A 5CF5A 2F2CB 1WBVA 4FYOA 3GOKA 3FMJA 1JLUE 4KD1A 4RIYA 4YJUA 4YTFA 4L6QA 4GS6A 4D4RA 1JWHA 1ATPE 4Z7HA 3CY3A 3P79A 4FC0A 4C35A 2BCJA 4DINA 2ITZA 3VULA 3FPQA 1VYZA 2P2HA 2WMQA 1U46A 3FZTA 2VWIA 5H8GA 4EORA 3MDYA 3HA6A 3SXFA 2AUHA 1LUFA 2RSVA 4RMZA 4CFWA 4O7RA 1UWJA 4EBVA 2QO9A 2WQNA 5DGZA 3FWQA 4EJNA 1W83A 5IDNA 1H28A 4EZ5A 4ZLOA 2XK8A 3ULZA 3PJCA 4QTDA 4DEIA 5AMNA 4V0GA 5GNKA 3MH3A 1M52A 4DFLA 3FLSA 3OWJA 5IEVA 1W0XC 2EB2A 3VHEA 3C9WA 5HE3A 4GYIA 5CT0A 3LJ0A 4D4SA 2NO3A 2R3JA 4OAUC 2H8HA 4M97A 5EI2A 2XM9A 2G15A 4FT9A 5H8BA 4F9WA 4QMQA 4CFVA 1G5SA 4A9YA 3LMIA 1PXLA 2BZKB 1RJBA 3C0HA 3OS3A 2NNWB 1YHSA 2IN6A 4DH1A 3EN4A 4TZRA 5FBOA 3WILA 5ANDA 3V01A 2X1NA 3D14A 4EK5A 5IA1A 5HHWA 3QWKA 3FQSA 4QQCA 5DT4A 4S32A 4D0WA 4XBUA 4WNOA 3VUTA 4FOCA 2BRHA 1OKWA 4NFMA 3CKWA 3O96A 2EXMA 4UEUA 2PY3A 4LMUA 4AE6A 5EOBA 4O0UA 4BZDA 4Q5HA 4LGHA 3RPSA 4EOLA 1H1SA 3MFRA 4IC8A 2A1AB 3BGQA 1MRUA 5JN2A 1FVRA 4FODA 4XP2A 5B2LA 3MY5A 5LQFA 2HW6A 4NCTA 5AUYA 3IO7A 1OM1A 1QPDA 1VZOA 3H0YA 2CGUA 2I0HA 3LVPA 1GZKA 5HICA 2UW3A 1U54B 1UU7A 4I24A 3HAMA 2GFSA 5DRDA 3LQ5A 4D4YA 3R9NA 4YHJA 4AA0A 3G5DA 5JFWA 3GQLA 1CKPA 3PJ8A 4EWHA 2QO2A 2XBJA 1SNXA 3ODYX 4UXQA 3KF7A 3FY2A 3QHWA 2XYNA 4GV1A 2CLQA 2WOUA 2BILB 3QTQA 2J0MB 3R7UA 4G5PA 4EOIA 3K3IA 3LM5A 5BVOA 3HMNA 4IACA 2XK3A 3IS5A 1ZZ2A 5JQ5A 1P2AA 3CKXA 2V62A 1Q8UA 3U54A 3Q04A 2C69A 3F61A 5DPVA 4DEAA 2XK9A 4FVRA 4G6OA 3L8PA 4KINA 4YJRA 1XBCA 2DWBA 1HCKA 5JZJA 2PHKA 4N6YA 5E8YA 3BBTB 4ERWA 3CJGA 3ZM4A 4IBMA 4U8ZA 3TNQB 4AZEA 4EJ7A 1JPAA 3DKGA 1NXKA 2UZEA 4KIPA 3VIDA 4M68A 4ERKA 3PZHA 3ANQA 4U44A 3OOGA 1UVRA 3Q4ZA 1G8AA 4YJPA 3CR0A 2YHVA 2PK9A 5J1WA 3RINA 3CD8A 4XRLA 1V0PA 3VS0A 2OO8X 2ITWA 5HO6A 3EYGA 3LCSA 3SVVA 2W1ZA 2JBOA 5HE2A 2AC3A 4A9UA 2VZ6A 4KABA 4U42A 5BVKA 4LL5A 2VTQA 4BN1A 2OH4A 1YKRA 4F0FA 1UKHA 3FMEA 4YSMA 4HNIA 3QQJA 4MTAA 4TWCA 3E3PA 5E7RA 4FT0A 1OGUA 3A4PA 2V7OA 3W1FA 4DF3A 4DH8A 1W84A 3ZFYA 1U59A 4RQKA 4BDDA 3SLSA 4CFFA 4BDIA 3F3VA 3O50A 4NM3A 4D2TA 4FK3A 2XIRA 4I92A 3P4KA 4WT6A 4BY9E 3AC4A 2XRUA 3WARA 3ALOA 5B7VA 5F20A 3ZO2A 4YZMA 4CVAA 3ZONA 4IAZA 4GUEA 2C5XA 5E91A 4JBOA 4GCJA 3F3ZA 3P7BA 4MBJA 4NFNA 1PMNA 2C3KA 3R8LA 2UVYA 3BEAA 3C5UA 2ESMA 5GIOE 1ZMUA 4IVAA 4DTBA 2OIBA 1P4OA 5A6NA 3PFQA 4RX7A 3VC4A 2C68A 1KE9A 1K9AA 5CAOA 5FXRA 4O7ZA 3BBWA 5HVJA 4AGUA 4HPUE 2F2UA 2GU8A 3DT1A 3TTJA 4QMNA 1J1BA 2WMSA 4BYJA 5LMAA 4JDJA 2WQMA 3NNVA 5L8LA 5IEYA 1OPKA 1ZAOA 4NL0A 1OIRA 3E64A 3MFUA 3VHKA 4AN9A 4O21A 2CN5A 2UUEA 5IQAA 1NVSA 4X3FB 3FEGA 4MD7E 4FICA 2BHEA 2BAQA 4M0YA 4B6LA 3PXKA 4ZIMA 3ZTXA 3MPMA 4HCVA 2JC6A 4ZY4A 4FIJA 2VTIA 3GEQA 3OWLA 2WPAA 4LYNA 4I3ZA 3FC2A 4CGAA 1JSVA 1YOLA 2VWBA 1SVEA 3B2TA 3OEZA 3Q6UA 4ANOA 1M2RA 4QMLA 2BTSA 4TRLA 1ZYLA 5F4NA 4NCTC 3DB8A 3ZUUA 4IAIA 3TV7A 4A9TA 4LOPA 5M51A 3KRXA 3IW4A 2X7GA 3R71A 4TYHB 1JKSA 5K3YA 2FYSA 3P9JA 1KOAA 1K2PA 3D5UA 5CI7A 4EONA 3MW1A 4GT5A 4ZLZA 4QP3A 4XG7A 2WMWA 5TO8A 1IASA 2PWLA 2IPXA 2JFLA 3SG8A 3HX4A 3VBYA 4MXYA 4BDGA 5HX8A 5ANEA 4PMSA 3E93A 4TWNA 5L2QA 3HRCA 5HLWA 3ENMA 3ORLA 2R3LA 3SD0A 2UW0A 4UB7A 3IK3A 3PJ2A 5AR4A 3D0EA 4BI2A 3I1AA 3I5NA 3CGOA 5DLSA 3PTGA 3R2BA 2OF2A 2JKOA 1SYKA 3L8XA 4EOQA 3ATSA 3BEGA 3H9OA 3MN3A 1YQJA 2P33A 4HGSA 3COMA 4E4LA 2O3PA 2WQOA 3QUPA 3A99A 4XYFA 3RM6A 4FSQA 2UZLA 1KWPA 3A2CA 4J52A 4RJ5A 4BWPA 2GNJA 2R3GA 3IG7A 1PXNA 3PY1A 3QTXA 3LAUA 3PJ3A 1R0EA 4IZYA 4U7ZA 2Y8OA 4QQ5A 4XHKB 3PXQA 4P7EA 3BQRA 5HU3A 4F6UA 4FSRA 2WIHA 2ZDTA 4FT3A 5HG5A 4F1OA 5C8KA 4L68A 4ZSEA 3RPVA 1H26A 4D2RA 1CKJA 4IH8A 4D9TA 1UWHA 2ZV8A 3W55A 3AD4A 3VRYA 2F49A 4L8MA 3DV3A 3HRBA 2HW7A 2QU5A 5A4CA 3QCXA 4X6RA 5AIRA 3F5XA 5LCKA 3THBA 1WBOA 1ZWSA 4D55A 2VO3A 3QD3A 4HYUA 1SVGA 5CSPA 4F0IA 2Q0NA 4RIWA 3H9RA 5ANKA 2XNBA 1K3AA 3G51A 4EH4A 1PHKA 3UNKA 4OTHA 2HZ0A 4GIHA 3WZKA 3PIYA 4R77A 4P5ZA 2JD5A 1GZOA 5AV4A 1J7LA 5J87A 2QR7A 4BZNA 3ZYAA 5EW8A 3PRIA 2V0DA 1W7HA 3ETAA 2WB8A 4X21A 3QZFA 3EQGA 3OFMA 2QKRA 2I6LA 3MYGA 4P2KA 3C0GA 5ITAA 3ZLSA 3AGMA 1S9IA 2NRYA 3QTRA 4O81A 1Q97A 5EHOA 4ZSJA 3Q52A 3V5LA 1OB3A 4GT3A 3BGZA 2ITNA 3NIZA 4XG2A 2EUFB 3NAXA 3ZUTA 4FV6A 3QF9A 4DTAA 4FIIA 1O9UA 5AM7A 2OZAB 4O38A 2ITXA 5DBXA 2Y6MA 3PY3A 4J7BA 2C6TA 3TZ9A 5HQ0A 4FKLA 5I9UA 3LKMA 4GG7A 3R8UA 4I0RA 4RX5A 4HGTA 3VS7A 4O0TA 4NT4A 1KV1A 4KIKB 2FSLX 5CI6A 5CNNA 3EQHA 3ORXA 4BKJA 3KXGA 5IA2A 4DCEA 3EFLA 5ETCA 5CEQA 5IH6A 3DKOA 3E63A 2WTKC 3U6JA 3O8PA 5B2KA 3KXMA 1OVEA 3TZMA 3VWAA 4DFUA 2WQBA 4BB4A 4ID7A 1I09A 3P5KA 5FM3A 3QRKA 3AC5A 5E8UA 2UZUE 4MBLA 4E5BA 3T3UA 2UVZA 5E4HA 4G6LA 3FXZA 4AA5A 4DGLC 5KX8A 4AW0A 4YSJA 4LQMA 3BLQA 1APME 3D2IA 2H6DA 3U6IA 3QD2B 3B8RA 4FV1A 2BR1A 3FYKX 4JBVA 3GU7A 3CTQA 3HECA 3FLWA 3TWJA 4EOKA 1XH4A 1ZRZA 3UOJA 2B9JA 2EXEA 3FKLA 2B52A 3FXWA 3R04A 3I5ZA 5JMSA 4FKGA 4XH6A 3TT0A 4CQEA 3TG1A 3A7GA 4L46A 4NH1A 4NW5A 3MFSA 4AGDA 2GQGA 2WEVA 4UX9A 2I0VA 5FDXA 2UZOA 4RLKA 3GI3A 4DAWA 3D7TA 2XIZA 3RK5A 2HK5A 2PVHA 1R0PA 3CEKA 4QNAA 4XRJA 3RZBA 5AP0A 3FC1X 2J5EA 3E5AA 3QX4A 5C27A 5KMKA 2VX0A 3HP5A 1MRVA 5CXHA 2CHLA 4FNZA 4YJOA 5LARA 4CLJA 3LXKA 3PXZA 4BTJA 4IB1A 4JBPA 4CSVA 2JBPA 2BIYA 4HPTE 4EK6A 2FB8A 3UNZA 3Q3BA 3QKLA 5HO7A 3VUMA 1ZMWA 3EKKA 4D1ZA 5F9EA 4CT2A 5HD7A 2X6DA 4A7CA 3C51A 1MP8A 3N51A 4KRCA 3OUKA 4PDOA 4IADA 2QNJA 3EQBA 5CSHA 3VF8A 2J6MA 3KF4A 4TXCA 3KREA 3Q2JA 4DTKA 4GFGA 3KEXA 3EQIA 3VS3A 2ONLA 4G9CA 1R39A 3P7AA 1VR2A 1XH7A 4JAJA 2BVAA 2DUVA 2YABA 3PVWA 4B4LA 1MQBA 1YXXA 2CNQA 3HUBA 4GEOA 4IFGA 2CCIA 4JX7A 4JG7A 4XCUA 2G2FA 4RWKA 5DA3A 1IA9A 4GFMA 1PYEA 4IEBA 3R8VA 2PVNA 3C4WA 2HAKA 3DU8A 5CS6A 4YHTA 3ZBXA 5TT7A 2FO0A 2Y4PA 4BBFA 2UW8A 1CM8A 1P5EA 3H9FA 4AE9A 4CTCA 2X2LA 2VD5A 4FZDB 3ERKA 3DOGA 4P4CA 2GHLA 4M66A 3EH9A 4OBPA 1BL6A 3UP7A 3QUEA 5DMZA 4E6AA 1FQ1B 2RFDA 3M2WA 1ERKA 5BMMA 4L7SA 3GCUA 3HVCA 3MWUA 4D28A 4L7FA 5AP4A 3PP0A 5H2UA 2UZDA 4PDSA 4F63A 2R3OA 1STCE 4YUQA 3DJ5A 3E62A 4O7WA 3K5VA 4BDJA 3GUBA 4YZBA 3QZIA 4FUXA 4ACHA 4XLIA 2IZUA 1BL7A 4H58A 4LFIA 3KB7A 2CDZA 4FSTA 1JBPE 2E2BA 4IDVA 2YM5A 1IAHA 4TKSA 5E8TA 3PXFA 5AP2A 2OGVA 3PIZA 4DEEA 5M53A 4L67A 5LMBA 2R0IA 3E8DA 3A8XA 4O7SA 1CMKE 4AP7A 2C1BA 3QFVA 2OZOA 3QRUA 5HCYA 4TYIA 4W4WA 5CVGA 3V8TA 5EG3A 3ZFMA 4NJDA 3DS6A 1A9UA 3FKOA 5M44A 4PNKA 1MRYA 3EOCA 3LM0A 4FSWA 5IQBA 3AGLA 5IQDA 3TUCA 5IQEA 5FWKK 3MY1A 3VW8A 3PJ1A 4LUDA 2PUNA 3EN7A 4EZ3A 3QKMA 4OBOA 1Y8GA 5LMKA 3ZCLA 5A46A 3VUGA 1OZ1A 5M4FA 1YI4A 2PVKA 3FPMA 4FTRA 4YC3A 4DFYA 2UW9A 2X8EA 3KMWA 2C0TA 4EH3A 3NW6A 3R8PA 2VGPA 2XNEA 3IW6A 3AD6A 5GJFA 4BTKA 3O0GA 4FSYA 5DOSA 2PVMA 3UVRA 2JLDA 2JAVA 3ZFXA 4CZTA 1B38A 4JIAA 5HNIX 2BKKA 2VWZA 2CSNA 4U9AA 4EH7A 2Z7RA 2VTHA 2CNVA 3VO3A 3A8WA 3QD0A 3D5VA 3JY9A 3TIYA 3CIKA 4ONAA 3JVRA 1FPUA 4FSMA 2O8YA 1Q5KA 4HVIA 4IAKA 5AWMA 4RVTA 4AX8A 3LFEA 4NZWB 4JJRA 4BDBA 4APPA 1VYWA 4WUNA 4L45A 3UOKA 3FYJX 4I5HA 3QL8A 4YO6A 3I6WA 3RBWA 4AT5A 1VJYA 4PRJA 3KXZA 2B54A 3HP2A 5EYDA 1WMKA 4R8QA 2C0IA 4QRCA 1IAJA 5ACKA 2UW7A 5E8ZA 4ZTLA 4O84A 5E8SA 3QLFA 3ANRA 3IW8A 5EH0A 4IMYA 3NNUA 1XJDA 3EL7A 4QNYA 4E8AA 5CF4A 2ETRA 5GINE 2W96B 2OK1A 4OTRA 4BDEA 3CP9A 2WXVA 5FEEA 3PLAE 4ASEA 5JZNA 4IZ5A 4FEWA 4DG2E 4KSQA 4WD5A 4LI5A 4FT5A 4QP1A 4YP8A 1NVRA 3QLGA 3NUPA 5AP6A 5FTGA 4DCAA 2QVSE 1Z9XA 4FTNA 3V8WA 5CU3A 2W1GA 4W9WA 2UZNA 4R7IA 1QCFA 4U81A 1YRPA 3BU3A 4MBIA 3LCOA 3GVUA 3NVMB 3SXRA 2C5YA 4BC6A 4U79A 4EC8A 4LV5A 4G3DA 4GMYA 2WMUA 3I7BA 3OMVA 4RIXB 5L4QA 3UZTA 3FSKA 5TE0A 4I0SA 5FLFA 4FKJA 4RJ6A 3FZOA 4MYGA 3UQFA 1S9JA 4FIGA 5I0BA 2X39A 2Y4IB 3A62A 3DFAA 3NS9A 5DFPA 3T3VA 3I60A 5TOZA 3HRFA 5CVHA 4CKIA 1W98A 2C5NA 1YOMA 3R8MA 5BUEA 3DXQA 4WBOA 3QCSA 2OICA 3KMMA 4RIYB 4G3EA 3G90X 5DH3A 3TUBA 1BKXA 5EFQA 5E92A 2E9VA 1BX6A 4ZK5A 4R1VA 5DHJA 2RIOA 1TQPA 4N4SA 4I93A 5J8IA 3UYTA 4I23A 4D58A 2OXXA 3U9CA 1H0WA 3AMAA 4UMUA 4IWPA 3WE4A 3A61A 1CTPE 4S30A 4TN6A 5CEOA 4UZDA 5IQGA 4DE4A 4CNHA 1H1PA 1OPJA 2XK7A 5L2IA 2QHMA 1NT2A 2H34A 4UMTA 4BIBA 4X7QA 3FI8A 2CGWA 4PNIA 3UIXA 1KE6A 1KE7A 4NTSA 4IC7A 4N6ZA 1PYXA 3ZH8A 1IA8A 4A9RA 1KOBA 1O6YA 3OCTA 3QD4A 3ID6C 3ZLYA 3MTLA 1OITA 3UG2A 3MB6A 3T8OA 1H00A 3BHHA 3HDNA 4NTTA 4IIRA 2OBJA 2EU9A 2G01A 4D5KA 5KBRA 5AP1A 4C58A 4EKKA 5D10A 4ACDA 2C6LA 4XG8A 3UE4A 3MA3A 4BHZA 4PMPA 3ZM9A 3BPRA 3MPAA 3Q32A 4X3JA 2PMNX 4OT6A 4JDKA 2VTJA 2HY81 3M42A 1XH9A 3MJ2A 4RIOA 2QOHA 5IZFA 4FR4A 2QR8A 3WYXA 3PA4A 1H4LA 4A4LA 2W1DA 5A6OA 2PMOX 2C6OA 3EFJA 4K18A 3VW6A 4X2JA 4PMMA 3DCVA 3QZHA 3B8QA 3OBGA 2WO6A 4BR3A 4C2WA 5CAUA 2OKRA 1ZY5A 4FNXA 3FE3A 2YN8A 4U40A 4C4IA 2BRMA 3OW3A 2JDOA 4MNEA 2HXLA 4P90A 4OT5A 4FZAB 3PPJA 3VF9A 3U6HA 5AAFA 4G34A 3F5GA 2X4FA 1V1KA 4L43A 4LRMA 4D2WA 3E7OA 3BYSA 3U9NA 4LV8A 4IB3A 5FTQA 1YXUA 3FUPA 5C01A 4GJ2A 5KKRB 4EHVA 4AN2A 3Q9YA 4E3CA 5DWRA 5A3XA 3I0OA 4FKQA 3FMDA 4YTHA 5ETFA 1GJOA 1PXKA 5LWNA 4UWYA 3V8SA 5IH5A 3C4ZA 4DEGA 4E93A 3P7CA 5FGKA 4D2PA 4IWOA 1Q24A 5DI1A 5LWMA 2VTRA 4F9AA 2W9ZB 3DLSA 1PXOA 4FG7A 2R3FA 4JRNA 2IVTA 3GC9A 4FNWA 4TPTA 4BDCA 5IEXA 5M4UA 3UQCA 3EL8A 4BDAA 5CANA 5AX9A 4KRDA 1SVHA 2GTMA 4UN0C 4W4VA 3KVWA 4CMOA 2R3RA 4NEUA 3C4XA 3NGAA 2PZPA 4MWHA 3RMFA 5CWZA 4YC8A 4XV1A 3KVXA 2YCFA 2GNIA 3OXTA 4PL4A 5HKMA 4TW9A 2OH0E 5C9CA 3OCGA 1OUKA 3R00A 5ACBC 3OTVA 4TNBA 4XLVA 2O64A 4I20A 2C6EA 2R3KA 4BKZA 2GQSA 5AR8A 4BL1A 3PSBA 3QA8A 5CQWA 3HGKA 1Q4LA 4I5MA 4J8MA 3SAYA 3GNIB 4G16A 4DGGA 1ZLTA 4W9XA 4Z55A 3IDPA 2FSOX 3G33A 3NX8A 5BNJA 2C5VA 3E8EA 1TQIA 2ERZE 1PXJA 3W18A 2V5QA 2OFUA 2PVLA 3VBTA 4UWBA 5EKNA 3ZO3A 2W4JA 3L9MA 4IAFA 3MJ1A 5DYJA 5HORA 3W32A 4WG4A 3FXXA 3L8VA 3TACA 3R9RA 5L6PA 4IAYA 4O0VA 5BPYA 5AV0A 5HESA 4TTHB 3RWPA 3F88A 3UZRA 4HZRA 1NY3A 4MXCA 3KY2A 5CAVA 2HY0A 4FV5A 4L00A 3ZZEA 3MH0A 2YDKA 3C4FA 4ZP5A 4CV9A 4DFZE 5H8EA 4O7TA 4ZS4A 3WOWA 2FVDA 3S3IA 5IDPA 3W2SA 4FG9A 5E1EA 1H24A 4JS8A 3W2OA 4J8NA 4C59A 1YI6A 4RBLA 3FZPA 4JDIA 3ZSGA 4AT3A 2X7FA 3R28A 2BDWA 2YDIA 4CT1A 4OAVB 1F0QA 2X4ZA 3OEFX 3AC2A 1VEBA 4X0MA 3RAIA 3TJDA 4AS0A 4BCJA 5AAGA 4YJSA 3VNTA 3E87A 1XBAA 4JDHA 4X2NA 2IZTA 4F7NA 3DBQA 4XEYA 1IG1A 2AC5A 5J9ZA 2PPQA 3RALA 4DT9A 4L9IA 4ARKA 2WEIA 5KHWA 1LP4A 2IW8A 3ROCA 2Y9QA 3W8QA 3QXPA 3RVGA 1JSUA 5I9ZA 2W1EA 2XH5A 3DBFA 3OG7A 4OTIA 4QMWA 5A4EA 4PL3A 2RF9A 3BWFA 1H1RA 3ACJA 1OIYA 3VS5A 1Q3WA 1WBNA 3BGPA 4M3QA 4DG3E 2W4KA 5ICPA 2WGJA 3OUNB 3M11A 3TKUA 4O2ZA 3UO4A 4YLKA 3ZSIA 1ZYCA 1WVXA 1Q61A 3GGFA 3RPRA 3OXZA 3F5PA 4FZFB 4L3LA 2OW3A 3HV4A 5ANGA 3U4UA 4CXAA 1DS5A 4BRXA 4Y83A 5HEZA 3RPYA 4EHGA 3PUPA 4BCPA 4YHFA 3UNJA 3NUUA 3I7CA 3WZUA 4ZTMA 2QOBA 3OD6X 3AOXA 1U54A 3QHRA 4QP9A 4UALA 5DT0A 3ORTA 4FV0A 5FEQA 2B1PA 3H30A 1H1QA 3NYXA 3P86A 4M84A 3W2QA 2CKPA 4GKHA 3LE6A 3REPA 4KUJA 4O86A 4RWIA 1ND4A 3FHIA 5AV1A 4EQCA
chains in the Genus database with same CATH superfamily
5K5NA 3QTSA 3RK9A 3NPCA 2WTDA 5LVPA 3DDPA 4RPVA 4Y8DA 1PMVA 1Y57A 5HIEA 2IEWA 4IVCA 3PA3A 4F9BA 1FVTA 3VS2A 4MXAA 4F64A 4FKOA 2LGCA 5AV2A 1O6KA 4I41A 3R9HA 2YWVA 3U8WA 4DH5A 3FL4A 2GS6A 5AR2A 4RA5A 3ZRMA 3AKLA 3LIJA 5I9YA 4E6QA 5KNJA 2BIKB 4HYIA 2XEYA 1FVVA 3EQCA 3ZC6A 1XO2B 3NMUF 3SG9A 4FL3A 1XWSA 4WSQA 2I40A 4F7JA 2V7AA 4GUBA 3CCNA 4DYMA 5IA0A 4LG4A 5CY3A 5AJQA 4IZAA 5EYCA 3ZRLA 2WOTA 4QQJA 3TI1A 5EM5A 2WMTA 4M12A 2XKCA 5JRQA 4DHIB 5HBEA 2P55A 4QMZA 2VTSA 1H0VA 2XIKA 2QONA 4XP0A 4BICA 3WI6A 5EK7A 1Y8YA 4DG0E 4KKHA 4MWIA 2CGVA 3UODA 1KE8A 2CLXA 2QD9A 3BHYA 1PXIA 2R3IA 3DTWA 2ZVAA 4I6FA 2RFNA 1H1WA 3VBQA 1ZOEA 2WIPA 1GIIA 3C50A 3GCQA 3QC9A 4MD8E 1P14A 2R7IA 4U3YA 2JDTA 4AGWA 5BVNA 2XVDA 3ZEPA 4C3FA 1ZYJA 4NJ3A 5AADA 3OT3A 4K8AA 4KS7A 4PP9A 5DIAA 2F4JA 3RI1A 1YI3A 4NM7A 3GCPA 3IPHA 1OKVA 1Q8ZA 2P4IA 3ENHA 4O4DA 3SRVB 3H3CA 4EOMA 2HCKA 4FUYA 3RWQA 2YIRA 3G15A 4XUFA 1OIQA 3ZHPC 5CT7A 2B9IA 2WMAA 2ZMCA 3FMNA 3BHVA 4FTTA 3U4WA 4EWQA 3VUDA 2VTOA 1R3CA 4OR5A 4EOJA 2X2MA 5DNRA 1XR1A 3KULB 5E1SA 5HTBA 1P4FA 3VUIA 3EJ1A 4Z16A 4USFA 2Z02A 5JK3A 4WHZA 3EN6A 3SX9A 3QTWA 3BWJA 5DR9A 2I1MA 4FTQA 1B39A 2GFCA 3QCYA 5DEWA 4M69B 3SOAA 4DFXE 5EM8A 3NLBA 5DE2A 3QA0A 1SM2A 2KTYA 2ZJWA 4G3CA 4LOQA 5A4LA 3ZRKA 3PG3A 5CAQA 2WELA 3BZ3A 3R1QA 3Q2MA 3LFCA 5CX9A 4ANBA 5JGDA 3BU6A 3KCFA 4FKRA 4DDIA 1CDKA 3NCGA 3O8TA 4RJ8A 2W17A 2W1IA 2REIA 3I79A 3W2RA 5BV3A 3EYHA 3Q96A 4A4XA 2Y0AA 3DAKA 3BI6A 1GZNA 5EDPA 4CLIA 2E9OA 4C37A 4DEBA 2BUJA 2XNPA 4EEVA 3L9PA 3AQVA 5I9WA 1XH5A 3BELA 2B4SB 3QTUA 1YOJA 2J4ZA 5JQ8A 4Y5QA 2YM4A 3QYZA 4F9CA 3UIBA 5M55A 3VBXA 5C26A 4O0WA 3PG1A 4E7WA 4BCQA 3GXLA 4DA5A 2GCDA 3OY3A 3UVPA 3H0ZA 3KRJA 2B9HA 2FGIA 2W0JA 4FYNA 4BBMA 4E1ZA 4FKSA 4HNFA 3PPKA 4AZSA 4QTBA 2XUUA 3NRMA 4QYHA 4MK0A 2O2UA 4HYSA 2XK6A 3WE8A 5AUXA 4EH6A 4HGEA 2C6KA 3HEGA 4D9UA 3RGFA 4QMYA 5C1QB 3LMHA 4ZTSA 1FINA 1REKA 1OKYA 3F7ZA 4USDA 4AT4A 4CKRA 1NA7A 2WKMA 3UQGA 3BE2A 5CU0A 4YO4A 4EKLA 2GHGA 2YAAA 4Y72A 5JKGA 3C1XA 3ZMMA 5IUGA 2VU3A 1BI8A 4NWMA 5LVOA 2OLCA 4OTFA 2QLQA 4L44A 5IPJA 5KE0A 4ANMA 4F7SA 3P78A 5HCXA 1FMKA 5DVRA 2QOCA 5EM7A 4FV8A 2R3PA 4HGLA 4LRJA 3KRRA 3WYYA 2ITTA 2VWXA 2YAKA 4L53A 3VQHA 5HNBA 5D1JA 1YXVA 5IA3A 2WMRA 4R5SA 2JKQA 3FJQE 2OJFE 2XM8A 3HV3A 3K3JA 4DFNA 3JYAA 3MESA 1ZMVA 2XIYA 4BCFA 2ZMDA 4A07A 4FIHA 1U5QA 5FP5A 4WBBB 4FVPA 3CTHA 1E1VA 2IZSA 4RZWA 2RKUA 4FKVA 5BVWA 2ZV9A 3FMKA 2Q83A 1JQHA 3QRIA 2X7OA 3PRFA 4O2PA 3CPCA 3PDTA 1TQMA 4AZVA 4C4FA 3QXOA 4DGNA 3BLAA 2FA2A 3S0OA 5GZ8A 4AZTA 2VAGA 4NKSA 5CNOA 4ZSAA 4I4FA 3CLYA 4FTCA 3ATTA 1M2PA 1UU9A 2GDOA 3TJCA 2VTAA 3G0EA 1RW8A 3BV3A 3NNXA 1CKIA 4WNPA 4FG8A 5FDPA 2P2IA 4G6NA 2W1FA 5IQHA 4IANA 4FSZA 3FQEA 3PZEA 5AUVA 4XV3A 4QTEA 2AYPA 3DNEA 3RHKA 5IH4A 4AXDA 4RJ3A 4X6QC 5HNGA 3WF5A 3VS6A 4D2VA 4EH5A 4F9YA 3F82A 2FH9A 3ORNA 3LCTA 4O6LA 3G6GA 3WBLA 2ZOQA 1YXSA 3AC1A 2GS2A 3D83A 4MHAA 4X3FC 3MVJA 3NDMA 2ZYBA 4BHNA 3UOHA 1BUHA 1WCCA 4R6VA 3TXOA 2UW6A 5IMEA 3HAVA 3K2LA 3IKAA 4MXZA 5EI8A 2J0LA 2HENA 4MVFA 2ZAZA 4HCTA 2ZM1A 5HGIA 4PWNA 3TUDA 2RG5A 4EQUA 2OJIA 2P3GX 3QTZA 4AWIA 4U43A 4DH7A 1OBDA 4QYGA 3Q4UA 2NPQA 2YDJA 1U5RA 1J91A 1E1XA 4PPAA 2Q0BA 4IVBA 4ACMA 3UMWA 5BUJA 4N70A 4WG3A 4O7YA 2EXCX 2VO7A 4DBNA 3II5A 3PE1A 1Q8WA 4XV9A 5EI6A 4XP3A 2JAMA 2YERA 1XKKA 1A48A 4H05A 5M06A 4U41A 4TYGA 1JOWB 2QURA 5F94A 2XB7A 3GB2A 4UXLA 4QQTA 3PFYA 5A14A 2I0YA 3PWDA 2UVXA 4MCVA 5LJJA 4AFJA 4DHFA 3HLLA 4MF1A 3PA5A 4FV7A 3RCJA 4XG3A 2SRCA 2CJMA 3MI9A 1Q3DA 4FZ7A 4QMMA 1YVJA 3VAPA 3V5PA 2F7ZE 5J9LA 4O7LA 4FBXA 2JITA 3TNHA 3UVQA 5GZAA 1URWA 4IDTA 4AA4A 1Y6AA 2WHBA 1XH8A 1WBPA 3SW7A 2ZDUA 3SV0A 2PMLX 4RC3A 4QMPA 2UZWE 4OTPA 3R83A 4DITA 5M57A 3TN8A 2XAOA 2GQRA 2PVJA 2QOQA 4AACA 4FKPA 4MD9E 2E9UA 2GNLA 3LFBA 4RJ4A 1TZDA 4W8DA 4WRGA 3UC3A 4PMTA 3NNWA 4BDHA 2O5KA 3MA6A 4DLJA 2PE1A 5CSWA 5JFXA 4OBQA 5L2SA 2Z2WA 3R30A 4G1WA 4ALVA 4EH8A 4GK2A 5AA9A 4L3PA 5L6OA 2QG5A 3ORKA 2C3JA 2PSQA 5HG7A 2AQXA 3ZDUA 3LPBA 3F69A 4GJ3A 1G3NA 3SDJA 2BAKA 4YPSA 3TM0A 4GSBA 3FLYA 4DBXA 2B9FA 5EOLA 3DLZA 2PVFA 3I81A 2PZIA 4C0TA 5AR7A 4QD6A 5IUIA 3S1HA 3NFFB 4XNEA 4QP6A 4DDGA 5FEDA 1GY3A 3EQRA 3F9NA 2YISA 1H08A 3QTIA 4NW6A 3CE3A 2ZM4A 2HZ4A 1R1WA 1OKZA 4XOYA 1ZARA 5AX3A 3DXNA 4BFMA 5GHVA 1H25A 2R2PA 3IECA 2XIXA 3R73A 3ZBFA 4ANNA 4RGJA 2HWPA 1F5QA 3C4CA 3ORMA 4D4VA 2G9XA 4F7LA 2OIDA 3COKA 3KL8A 5K4JA 1W2CA 3PXRA 3WF6A 1PW2A 2CN8A 4AQCA 4QP2A 3DJ6A 2ZB0A 1H8FA 4TWPA 1KUTA 2ITUA 3AC8A 4ZTHA 1XH6A 3TTIA 3R1YA 1YHWA 4KKGA 4CMTA 2OI4X 4QOXA 4EL9A 5KBQA 4CV8A 3OY1A 2VTTA 2XNNA 2C3IB 3KU2A 4QTCA 5ANIA 3TKHA 5EM6A 4WIHA 4YMJA 2RFSA 2PU8A 4GVAA 4OTGA 4DN5A 5J95A 4IX5A 3NIEA 4OTWA 4K1BA 4EK8A 2O0UA 4RWJA 2KULA 3V04A 2Z7LA 3G6HA 3JVSA 4BKYA 3O23A 5GZ9A 3CQUA 5DG5A 4FNYA 3S4QA 3U55A 1OI9A 3LLTA 3UMXA 3BHUA 4O4CA 2VWWA 2BRBA 4JQ8A 4AUAA 1RDQE 4HZSA 2A0CX 4AU8A 1V0OA 4ZTQA 2ACXA 4Z3VA 1T45A 1Q62A 4FTMA 4FV2A 5AA8A 5HLNA 3AXWA 2J2IB 4HOKA 5LOHA 3WZJA 2VO0A 5CF6A 3IW7A 3GCSA 3R02A 4CZUA 4FGBA 2J90A 3AC3A 2Y6OA 3F6XA 4LM5A 1JVPP 1AQ1A 3R8ZA 3UJGA 4LL0A 4E6DA 3OROA 4QYEA 2YZLA 4C3PA 4JR3A 3VVHA 2W99B 3SA0A 4IJ9A 4MX9A 4QT1A 4CFUA 2W9FB 4U3ZA 5IA5A 4ANSA 4BJJB 3LFAA 2J0IA 2YWPA 3VN9A 4NKAA 3R0TA 3KXXA 3V3VA 3DQWA 3Q53A 3A7FA 4J97A 5DT3A 5KZIA 2X0GA 1QL6A 2GNFA 2XCKA 4C38A 4Y73A 5KMMA 3Q5IA 4RX8A 2DYLA 1DI9A 5EYMA 4YC6A 3R7VA 4FZ6A 4A9SA 2YM8A 4L42A 4YBJA 2XARA 3EB0A 4JX3A 4A06A 4X2KA 2QOFA 4Q2AA 2C1AA 4EH2A 2FSMX 5HVYA 4ZJIA 3DXPA 4C02A 3AKJA 1JSTA 4DLIA 4DH3A 4PUZA 5BYYA 3PY0A 2YIXA 5FUTA 3KA0A 1OL5A 3UDZA 1QPCA 2G2HA 5AUWA 2UZTA 3DPKA 3G9LX 5FTOA 4HJOA 2C30A 4CEGA 3NUAA 3GU4A 4BI1A 1Q8TA 3DNDA 1OIUA 4FSUA 3TL8A 4LV7A 2X6EA 2IO6A 4YJQA 3TDWA 4QMUA 2GMXA 4EZ7A 4H3QA 4EC9A 1W82A 5E90A 4E26A 3ELJA 5AP3A 2CKQA 1Y6BA 2QOOA 2RL5A 1ZYDA 1UKIA 5AP5A 3KN5A 4EUUA 2NYAA 4RQVA 5T3QA 3GFEA 3LMGA 3RTPA 2LAVA 2XZSA 1SNUA 2X8DA 4NIFA 2BDJA 3O7LB 4O1PA 3U51A 3UO6A 2R5TA 5A54A 2FSTX 5DRBA 4XOZA 3A60A 4IM0A 3D15A 5A4QA 5JGBA 3MPTA 4PTGA 3U87A 4ZY6A 4RC2A 1NW1A 1WAKA 2Z7QA 3KK9A 2WD1A 3CQEA 3F3WA 4K77A 4OTQA 1OL1A 1QPJA 3W2CA 5EQEA 5AV3A 3JPVA 2XP2A 3ORZA 3R9DA 4CFNA 4R5YA 3R7OA 4YNOA 5KHXA 3ODZX 5HE0A 4V0GB 5ETIA 5HZNA 2OF4A 5A9UA 3VQUA 3ZZWA 4BCIA 4ZZNA 2PZRA 2J51A 2O65A 3S95A 5JSMA 4FKWA 4CD0A 5BYLA 2BROA 5DR6A 3VUHA 4YURA 2YEXA 3RK7A 3D4QA 3DFCB 5D41A 3WF8A 4CKJA 3GU6A 4S34A 3PSCA 4ZSGA 5FG8A 3V51A 2YM7A 3C4EA 2XK4A 2ZM3A 3O71A 2WMBA 4FV4A 4QMTA 5CTPA 5CZHA 4EI4A 4ZS0A 4IZ7A 3DK6A 3VBWA 4J99A 2PULA 4UY9A 3W33A 5BYZA 4FEQA 2GNHA 4M7IA 3SQQA 2VO6A 4B0GA 4BCNA 4RG0A 4GVJA 2ETKA 4TYEA 5IMXA 4C2VA 2XYUA 2VX3A 4P5QA 4D1XA 5E8XA 2P0CA 2BDFA 4O4FA 4ITHA 3AMBA 3GC0A 4BWXA 1XQZA 2W1HA 4IX3A 4KS8A 2X9FA 2YJSA 5CEPA 5CAPA 3LCKA 2NP8A 5KZ0A 3HKOA 4LOOA 3E8NA 3EHAA 1B6CB 2VTPA 3QQUA 4R7BA 4I5PA 4F08A 3DZQA 4RA4A 4ZJJA 1WBWA 4AW5A 3KKVA 5J79A 2XJ1A 4YJTA 5CF8A 3ZO1A 4C3RA 1YDTE 3ZC5A 2IW9A 1RQQA 4ANLA 4KAOA 4KBCA 4R3CA 3QRTA 5CZIA 3PUFC 5CEIA 4C57A 3OOMA 3MFTA 5LVLA 3OTUA 1Z57A 5LXMA 4JL9A 2ETMA 5D12A 2CGXA 3PLSA 4MNFA 4YBKA 3D9VA 4LGGA 3R7YA 4EOOA 2W1CA 3RP9A 2IVSA 4AN3A 4ZMFA 3ZDIA 2JDSA 3RAKA 3FL5A 1DAYA 3BLRA 4LUEA 3GP0A 4HCUA 4GT4A 1DM2A 2WZJA 5E8WA 5K4IA 2WU7A 3KFAA 3HUCA 5IKWA 2QODA 3I6UA 3P1AA 3QQLA 3F3TA 3KGAA 4IHPA 2YITA 1OMWA 3DA6A 3OCSA 2PTKA 3OWKA 1M7QA 5D11A 2ZV7A 4IJPA 4BIDA 2ITVA 2O63A 4DFBA 4YZCA 4CRLA 2ITYA 3KQ7A 2CPKE 2H9VA 3DK3A 4MF0A 3DAEA 3CQWA 4QYYA 4CMUA 3PP1A 3C5IA 3O17A 3BU5A 3ZLXA 2WU6A 3OW4A 5I3RA 4JQEA 3QQHA 3BRBA 4PTEA 1GZ8A 2IWIA 3CPBA 2VV9A 4RVKA 2X2KA 5IG1A 3TEIA 1TFFA 1A06A 4I94A 3H10A 4USEA 2FUMA 3FY0A 3EMGA 3MVMA 4UMRA 1YW2A 3QBNA 3LQ3A 4IAAA 4BIEA 3Q6WA 3W10A 3DBCA 1EH4A 4CYIA 4ENXA 4FF8A 1OPLA 3VUKA 2WTCA 2OXYA 2BMCA 2WMXA 2WQEA 3HA8A 3SHEA 1E9HA 4EOPA 2OIQA 4ZOGA 3ITZA 2BZJA 2CKOA 3MV5A 4YTIA 4F78A 4FGRA 4ENYA 3JR1A 3I0QA 4C4EA 3FI2A 3I4BA 3IOKA 4CFMA 4FOBA 1SMHA 2GHMA 3O51A 3QKKA 5ANJA 1G8SA 4IWDA 4JAIA 1HCLA 4FTJA 1ZZLA 3E7VA 4E4NA 4O22A 4MXOA 4QPAA 3RZFA 3QQKA 3CY2A 5BMSA 2C4GA 3LHJA 3ZSHA 1LR4A 4FRFA 2ERKA 4FSNA 3TNIA 2QC6A 2OU7A 3JUHA 4AAAA 4AZWA 4RRVA 3KN6A 4ZTNA 5IA4A 2WAJA 1PMEA 2PZYA 4FTIA 1OL2A 3KCKA 2F7EE 3LFQA 3LXPA 3NW7A 4L01A 5FBNC 4KIOA 3UGCA 2OJGA 3FZ1A 4B9DA 5KO1A 5T6KA 4B8LA 4Q9ZA 1J3HA 2PVYA 3Q9ZA 4MEDA 1X8BA 2BPMA 2PUIA 5L6WL 2GNGA 5I9VA 4F09A 3EZVA 4RSSA 1UA2A 1YWRA 2A2AA 2QU6A 3FHRA 3NUYA 1GOLA 4TYJA 4U5JA 4GFOA 3EQPA 3WF7A 3FZRA 4H1MA 3TZ8A 3POZA 2Z7SA 3GT8A 2UV2A 3FLZA 4BI0A 2OWBA 4BCHA 4K0YA 4MAOA 4EOSA 3FMMA 4O7NA 2YM3A 3HMMA 2VNYA 3W16A 5L8KA 4UBAA 4O4EA 4M0ZA 5J7BA 3QCQA 1F3MC 3WF9A 3W2PA 3L9NA 3DK7A 4QYFA 4GIIA 1T46A 3FBVA 4PDPA 2F9GA 2Y4IC 4Z9LA 4MXXA 4E73A 5CALA 5KMLA 4D5HA 4GYGA 2HZNA 5HOAA 5CENA 5HX6A 4PDYA 2BALA 2WTKB 2BKZA 1OGYA 4U0IA 2IVUA 4JT3A 2GPHA 4AXFA 4KIQA 3B2WA 5HIDA 5HBHA 4QPMA 5KMIA 5M08A 4ZLYA 3ZXTA 3GFWA 3NVKI 3E92A 3DZOA 1U4DA 2A27A 5HBJA 2WFYA 4XMOA 3C0IA 3OCBA 5EW9A 3BYUA 4FTOA 3NUXA 1GIJA 2F57A 1LEZA 2GS7A 4PPCA 4KA3A 5BQ0A 3Q4TA 1CSNA 4H3PA 5FXSA 4MUQA 1WVWA 3ZU7A 2XCHA 2JEDA 2G1TA 4FMQA 5HG8A 4YNEA 5CVFA 5HD4A 4J95A 5CEMA 4V05A 4NM0A 5FM2A 5I4NA 3IONA 5EQYA 3W0QA 3MBLA 3NFGB 5L2WA 3EQFA 3F5UA 3FV8A 4OTDA 2JIUA 5CASA 3W0MA 3TKIA 5DEYA 5D9HA 2YA9A 2W5HA 4BF2A 4EQMA 2R3MA 3BIZA 1SZMA 3OT8A 4BDFA 2B0QA 2OXDA 2DS1A 1FOTA 3TV6A 3FKNA 4HVSA 3L8SA 5AAEA 3ORPA 5I5ZA 1OUYA 3LCDA 4S33A 2QOIA 1WBSA 2X9EA 5JFSA 1H07A 2HZIA 5HLPA 2J7TA 4GKIA 4ALWA 4FL2A 3E8CA 3FDNA 3CS9A 3JY0A 1R78A 4F0GA 4OGRA 3F3UA 3Q60A 3MY0A 4H1JA 3KIOC 1UNHA 4PPBA 3V6RA 2WTWA 1UU8A 2JGZA 2W4OA 5CXZA 5J7HA 4RIWB 4AOTA 2PL0A 4RT7A 1ST4A 2BAJA 1BI7A 4X2GA 1PJKA 3DY7A 1KSWA 4V04A 4EBWA 1FBNA 1PKDA 4G2FA 3WZEA 4NUSA 4AOIA 4DGMA 5J9YA 3SGCA 3ET7A 3EQDA 3LQ8A 4LMNA 3RAHA 5I3OA 3RNYA 5KKRC 4TWOA 1MQ4A 1V0BA 3PXYA 4UYNA 2QQ7A 4RX9A 5HI2A 3SOCA 4DGOA 3IQ7A 5JH6A 5K5XA 3RCDA 2VWVA 3LJ1A 3QYWA 5G1XA 3RKBA 2QI8A 2BHHA 2BFXA 2Y7JA 2XBAA 4PV0A 1YDRE 4C36A 1ZOGA 4IE9A 1WFCA 4QO9A 3LFSA 5DN3A 4GH2A 4JXFA 3S2PA 4PP7A 5AEPA 3HZTA 1AD5A 3K5UA 4UYAA 2JKMA 3QAME 2WNTA 4YGAA 3NCZA 4C4HA 1IEPA 3DTCA 2YM6A 3PVBA 4FV3A 4ASZA 3K54A 3FI3A 3UP2A 4ZTRA 1J7UA 4JIKA 3OZ6A 4QMXA 5L2TA 1I44A 5K0XA 3UPZA 4K2RA 4GG5A 4X3FA 1JNKA 2F7XE 4DC2A 4FIEA 5BVEA 4C7TA 5CSXA 4KNBA 4C33A 3SXSA 3FMLA 1KV2A 2XF0A 4DEDA 3VBVA 2YZAA 4EHZA 4C4JA 4O83A 1GIHA 2VWYA 2WTIA 4FKUA 5T68A 4YTCA 5TKDA 4G17A 5AFVA 2CCHA 3Q9XA 3F2RA 2Z60A 3EFKA 4B8MA 4JVGA 4HVGA 4J1RA 2X81A 3F2AA 3DB6A 4OW8A 4ZXTA 5CYIA 3RJCA 1G8KA 2R3NA 3FZSA 4JR7A 2VX1A 4FKTA 2W5AA 4TYHA 3DBDA 4GK3A 3D7ZA 4IXPA 2WTJA 1DI8A 4Q9SA 4RVMA 3O2MA 3ULIA 2A19B 1JKKA 2C0OA 4FVQA 3ZXZA 4BBEA 4F99A 3O8UA 4UZHA 5TF9A 3A4OX 5CU4A 4L52A 3R63A 2C6IA 2H96A 3UOLA 2QLUA 4KBKA 3CBLA 3E3BX 3NYNA 4PF4A 4WG5A 5HTIA 3ORIA 1LPUA 4UMPA 2UZVA 3BKBA 3SC1A 3TCPA 3UTOA 5HTCA 3UDSA 4M8TA 3HMOA 2RGPA 5EDRA 4JNWA 3SRVA 4CQGA 3LXNA 4UWCA 4JG8A 1W8CA 3D7TB 3E88A 4G3GA 4BGGA 2JDRA 4D1SA 5JEBA 3BL7A 5KMJA 2V22A 3ACKA 5IU2A 1ZYSA 2HWOA 2X0PA 2XEZA 3GBZA 3KK8A 3QWJA 4IM3A 2W05A 4LGDA 3KXHA 4FTLA 4WSYA 4CRSA 4IB0A 4ASXA 3L1SA 4TY1A 4O6EA 4BCGA 4R3PA 3PVUA 1QPEA 3COIA 5J1VA 3KULA 3N4VA 2PZ5A 1YWNA 3VJOA 4FTUA 3LFNA 4ZMEA 3Q4CA 4C34A 4JOAA 5B2MA 1IR3A 3P08A 1OBGA 3OHTA 4JLCA 4RC4A 5H3QA 4B7TA 4ACGA 2YCQA 2W5BA 4V01A 1L8TA 2EB3A 1BYGA 4M69A 4E4MA 3R01A 4E5AX 3NEWA 4I0TA 1NVQA 2C47A 3FI4A 1L3RE 2XKEA 4RFZA 5GJGA 3C7QA 1BMKA 4H3BA 2YIQA 3PIXA 4IM2A 2J5FA 2BTRA 3PWYA 4I1ZA 5D7AA 3TNWA 5E9EA 1FGKA 4BCKA 2IJMA 1J7IA 4AXEA 3P0MA 1MUOA 5CQUA 2IZRA 4PQNA 4F1MA 2VUWA 3R22A 4GL9A 4RLLA 5AR3A 5JGAA 4R3RA 4ASDA 2VTLA 3ALNA 3G0FA 3A7JA 3NUNA 2A4LA 2ITPA 3DDQA 2C3LA 3BX5A 2YLFA 3OC1A 1QMZA 3P23A 1TVOA 4JRVA 3QALE 4JBQA 4OLIA 5C03A 5AUTA 2UW4A 3BL9A 2OFVA 3TDVA 3AG9A 1YHVA 4AF3A 4Y46A 4CCBA 4ZZOA 4HW7A 2R0UA 3UDBA 4AZFA 3ZLWA 5HCZA 2C6MA 5IQCA 2ZFYA 3HYHA 4O27B 1BLXA 3PPZA 1M7NA 3LOKA 3WIGA 3AMYA 3GC7A 4H39A 4NM5A 3R7GA 2OZAA 5CEKA 3MTFA 4XX9A 3QQGA 2R4BA 4WOVA 1YWVA 5KCVA 5AIKA 3V5QA 1W2FA 4CCUA 5BVDA 3SKCA 5GJDA 4G9RA 5JFVA 4E6CA 4QP7A 4ZZMA 2XNGA 2BRNA 1Q41A 3KRLA 4LRKA 4C61A 3BYVA 3VRZA 2PE2A 4KIKA 4N0SA 5ETAA 2ITQA 3FLQA 2W7XA 4L3JA 4F4PA 1XBBA 4HVDA 3A7IA 3QGYA 5C4KA 4O0SA 4WA9A 2XNOA 3RM7A 1JKTA 1PMUA 4H36A 4EYJA 4WO5A 2IG7A 4YPDA 4FK6A 3IGOA 4FX3A 3UBDA 2DQ7X 4FEXA 2Z8CA 5J5TA 1JAMA 3HMIA 3NYOA 4M15A 3UIMA 4AG8A 3MSSA 3D5WA 2HOGA 2YACA 4I21A 4FT7A 4BTMA 4O7VA 5FQDC 3MIYA 3D94A 3HDMA 1UU3A 4QP8A 4EK3A 2E9PA 3DGKA 2R64A 4MQ1A 2YIYA 4O0RA 1PF8A 4QMSA 4G31A 3MGYA 3FQHA 3BV2A 4I4EA 3ROYA 5HU9A 2BZIB 4FKIA 3UO5A 1W2DA 2UZBA 2YLEA 3AD5A 3HV5A 4O96A 4Y5HA 3WZDA 5CLPA 3T9IA 2YCSA 1ZXEA 4HYHA 3N4UA 4W4XA 4O0XA 4EK4A 1J1CA 5IF1A 4MH7A 2ITOA 5L8JA 5ANOA 3ML1A 4M13A 5KUPA 2IW6A 2YJRA 4YJNA 2C5OA 4FIFA 3ZS5A 4EH9A 3OBJA 5GIPE 3MVLA 4U97A 3TZ7A 2VN9A 5D7VA 4YZ9A 3CSVA 3MB7A 4DEHA 3KXNA 3QQFA 3S00A 4YLJA 4YR8A 3HNGA 4RWLA 3GQIA 3CD3A 4ZEGA 4ACCA 3FLNC 2NRUA 4JG6A 3HV6A 3MH1A 4YU2A 1WVYA 2QCSA 2XNMA 4PY1A 3MVHA 4EHEA 2X8IA 3EIDA 3NR9A 4BCMA 3PVGA 3M1SA 3NAYA 4AGCA 2B53A 3AT4A 1DAWA 4ZSLA 5C8MA 5AM6A 3KMUA 2PVRA 3LZBA 4AW2A 5L3AA 3NSZA 4CFXA 2CNUA 5C4LA 4CZYB 4JI9A 3TV4A 3EN9A 2QOKA 4IWQA 4S31A 3UZPA 4D2SA 4D0XA 3P5JC 2R7BA 2YCRA 3D2KA 4EUTA 2HELA 1H27A 4G3FA 2HXQA 1WZYA 5C8NA 3DJ7A 4I6HA 4RZVA 4A4OA 4QTAA 4YJVA 4FTKA 1M2QA 5A4TA 3VS4A 1H01A 3A7HA 3CXWA 4J71A 2G2IA 2ZV2A 3VJNA 5LVNA 4I5CA 3V5TA 2YIWA 4E20A 4F65A 3NWWA 2XKDA 4BVUA 4BYIA 4RVLA 1YXTA 2HIWA 2RG6A 3PYYA 5HE1A 3GENA 1PXPA 2OSCA 4E4XA 4ANQA 3CC6A 5M4IA 4WNMA 4G5JA 1XMLA 1OL7A 2WTVA 4ZAUA 4MKCA 4S2ZA 3V6SA 3TIZA 5CU2A 2UW5A 3GU5A 2ZB1A 3IGGA 4AFEA 4BTFA 4CTBA 4RJ7A 3QUDA 3F2NA 5AUUA 2B55A 2JDVA 4ITJA 3N9XA 4QMVA 4W8EA 5BUIA 2QG7A 5M09A 1HOWA