3P1AA

Structure of human membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase myt1 (pkmyt1)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
287
structure length
281
Chain Sequence
QLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human Membrane-associated Tyrosine- and Threonine-specific cdc2-inhibitory kinase MYT1 (PKMYT1)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Membrane-associated tyrosine- and threonine-specific cdc2-in
total genus 85
structure length 281
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p1aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p1aA01
5J79A 4FNWA 3FC2A 5CTPA 4CLIA 2PVLA 3OC1A 5HGIA 5LVNA 2Y6MA 4FKGA 4YZNA 5CEKA 2IZSA 3ODZX 3LJ0A 4ANBA 2X7FA 5CAQA 4V01A 3TIYA 5HLWA 3QLGA 4DITA 3R2YA 1U5RA 2IZRA 3H9OA 3O8UA 4RJ4A 1VJYA 2YM4A 4I3ZA 2GQSA 3AG9A 5FLFA 2JEDA 2ZOQA 3BQRA 2BAKA 4EOOA 5J1WA 5HG5A 1WCCA 2BVAA 3QC9A 4PPAA 4GK3A 4A9SA 3C0HA 4ERWA 3VBXA 4Z55A 1J1CA 5AWMA 2Y9QA 4K11A 1JKLA 1UNHA 3K2LA 3QXPA 3WZDA 3VWAA 2RGPA 1JPAA 3BEAA 5LCJA 1XBBA 2PWLA 2VO7A 2WU7A 5K3YA 5D11A 3KXZA 2PVHA 1JAMA 3OBGA 3ORZA 3NAXA 3GOPA 3C4FA 1LP4A 2F2CB 4KNBA 4XHKB 3H30A 1YWNA 2DUVA 4BGGA 5A14A 1Q8ZA 3EQRA 4BDHA 4CZUA 2XK8A 4FL3A 2VTSA 3E62A 3SXRA 4DEDA 4EZ3A 5TT7A 5CEPA 3NEWA 5LOHA 1GZOA 4MXOA 3RAHA 1VR2A 3BV2A 5KNJA 1M2PA 4FUYA 5IQGA 4F9YA 4BF2A 5HNBA 3QCYA 1J3HA 4JJRA 3IKAA 4HYHA 1R3CA 2CSNA 4RIYA 5AV3A 4C3PA 3BHYA 5DRBA 3HV6A 3R1QA 5CAUA 4KUJA 4TWPA 2C6DA 5AV0A 1KSWA 2ITXA 3GVUA 2XK7A 2IPXA 5GZAA 4F9WA 3K54A 3R04A 3DKOA 4YHTA 3UG2A 5JN2A 2BDWA 4UWYA 3QAME 3UC3A 4LYNA 5HG8A 3ZHPC 2WQBA 4NL0A 5AP1A 3V8SA 4I20A 3WYXA 3SW7A 4ZTMA 3BYUA 3DBCA 3LMGA 4U9AA 4F7SA 3C4CA 1J7LA 3G0FA 5CQWA 4LGDA 1OIUA 4EWHA 3P86A 4ZLZA 4RFYA 3QRIA 2YLFA 3ZBXA 2B1PA 4EJNA 2I7QA 3MS9A 1M2QA 5B7VA 4DTBA 5KHXA 2ETKA 3KRJA 2X4FA 4F0IA 4HYIA 5H9BA 3FSFA 4CFVA 1S9JA 3ENHA 2QOFA 5AUTA 2ZV7A 4BCOA 4J97A 5ITAA 1KV1A 3R22A 4M66A 4HVSA 5M56A 3CJFA 2CGVA 3OW3A 4AFEA 1FMKA 3SGCA 1BMKA 2W5BA 2VWVA 3CTQA 1I09A 3C4XA 4AZEA 4EWQA 4PNKA 3G5DA 4YP8A 4MAOA 5K0XA 4R3RA 3Q9WA 1KOBA 2J0LA 3ZZEA 3GFEA 2BRNA 3PG1A 3P7CA 4QPAA 3ZXTA 2QD9A 3VF9A 3IDBA 2ERZE 4L3PA 2DWBA 2OIBA 3EJ1A 4JDIA 2XM9A 3A7HA 2PE1A 3JUHA 3K5UA 4ALVA 4D2RA 3NZ0A 3LFDA 4I0TA 2YCSA 3IOKA 3I0OA 4FTOA 3ZYAA 4YC3A 4C59A 4DHFA 4D5KA 4LFIA 4EQUA 1V0OA 1YXTA 1A48A 1GIJA 4F1MA 2WIHA 5I9ZA 3W2PA 4LUDA 3TZ9A 4E1ZA 2OKRA 2ACXA 4F08A 3ORMA 1VYWA 5IA4A 2EXMA 4KWPA 1QPEA 3R1YA 1YI6A 4ZSLA 4B6LA 3CY2A 2C30A 3MA3A 2W1ZA 4BCJA 5J87A 4AOTA 3ZTXA 4EOMA 3FUPA 2OZOA 4APPA 3V6SA 3ZLSA 2XVDA 2W5AA 4QMXA 5DBXA 3DY7A 4FYNA 5AR5A 5AUWA 3D14A 4KS7A 5AMNA 2C6EA 3UOHA 3OBJA 4EHGA 3EYHA 2FUMA 4X3FB 1NVSA 3ULZA 3HRBA 5KCVA 3DKFA 4W8EA 3LAUA 2J0IA 4ID7A 5EOLA 2BDFA 5KMNA 4D4VA 5CAVA 5M4CA 4CRSA 1OPLA 3G6GA 1WBOA 3EQHA 3CQUA 4FNZA 3E87A 4OTFA 3FEGA 5HG9A 3FKLA 5C4KA 2G1TA 5DR9A 3MV5A 3IW4A 4AAAA 4BCQA 3OCBA 4MD7E 5T6KA 2EB2A 3ANRA 3BQCA 3NUPA 3RM7A 3I60A 3G9NA 3R7OA 1GIIA 3BGQA 4M67A 5IUHA 4PDYA 4FNYA 3Q96A 4GT5A 4MXYA 3UTOA 1V0BA 4NFNA 3R83A 2UW5A 4OBPA 1SYKA 4AUAA 4YBKA 5EK7A 5K9IA 3LQ5A 4K1BA 2B7AA 3ETAA 4QMWA 3BHTA 3ULIA 3VBVA 4JDJA 3P4KA 1IG1A 3U6JA 4M12A 3K3JA 4ERKA 2UZBA 3BKBA 2UW9A 3A7GA 5J8IA 1Q41A 4R5YA 2Z60A 4JIAA 4I6FA 2R4BA 2QC6A 1NW1A 4XG7A 5I9XA 1Z9XA 3CP9A 2JDRA 4K18A 4X6QC 4ZS4A 5FWKK 1RE8A 2WGJA 3REPA 3CPCA 1B6CB 4WG3A 2XIKA 4EL9A 4EOIA 3D7TB 3PJ8A 4ZTRA 2YM7A 5EM5A 4Z7GA 4GFMA 5AUUA 3VBWA 4YNEA 3TXOA 3DLSA 2JGZA 3QRKA 3COIA 4OLIA 5D41A 3HMPA 3TTIA 4DGLC 3WILA 3VS5A 4AQCA 3TN8A 3UG1A 1LEZA 3QLFA 2I0EA 1H26A 3JY9A 4MVFA 4IXPA 4F99A 3LM0A 3RI1A 3UNJA 2WTCA 5C8KA 2I0VA 4MYGA 1YOMA 2YWVA 3QQUA 4EK5A 1R1WA 3A62A 4EYMA 5FEEA 3V51A 5FTQA 3DFCB 4WNMA 3UO4A 1GAGA 4IX3A 3UO6A 3VAPA 4HZRA 4TKSA 1CKPA 1JQHA 2JBPA 5CS6A 5DI1A 3AC8A 1EH4A 5IKWA 3D2IA 2YM6A 3MPAA 5C8MA 4OBOA 1JKKA 4EHEA 2Z2WA 3E64A 3UC4A 3R71A 1UU3A 3EFLA 2IVSA 3E3BX 1SNXA 3EFKA 2DQ7X 1U54A 4YHFA 2UVXA 3CTJA 4IVBA 4S30A 3V3VA 5JT2A 1GJOA 5DR6A 2JFMA 2UZEA 4U5JA 4J7BA 3C5IA 2J50A 4LGHA 1OMWA 3DXPA 2WD1A 4QMYA 4O82A 4XV9A 3KF7A 4GFOA 4OT6A 5K5NA 3BLQA 4O21A 4I4FA 4L43A 5JGBA 4I6BA 3BI6A 4O22A 4RX7A 3V8WA 4YLKA 5FQDC 4QTEA 1R78A 2GFCA 5E1EA 4O83A 4I93A 3RWQA 4AW5A 2XNPA 2AC5A 3NUSA 3BYMA 3Q2MA 5HE2A 1ZMVA 4HGLA 4IMYA 1W84A 1Q5KA 3FLSA 3Q60A 4GIHA 5F94A 4TYIA 3R7YA 2JKKA 4QP1A 4X3JA 4YTCA 4PDPA 4UEUA 4Y46A 3DTWA 1ZYLA 1JWHA 4D0WA 2IJMA 4EH5A 2OF4A 1XJDA 3GI3A 3ZCLA 1Q99A 4XG2A 5LVOA 3H0ZA 2XEYA 4HCVA 4W4VA 5EYMA 3KXXA 3QD4A 4IWOA 2WMQA 3OFMA 3QA8A 5IH6A 2CKEA 4XYFA 2QU5A 5CEOA 2OZAA 3TIZA 5H2UA 1TQMA 3EQBA 4C7TA 4WBOA 2HENA 1CM8A 4MQ1A 3FBVA 3U55A 2WQOA 4J98A 4FT0A 4XNEA 4K9YA 1MQBA 3HV3A 4DCEA 3R7UA 5L6OA 5HE1A 3HUCA 3DU8A 5EYKA 3MFRA 3RAKA 4TN6A 5LWMA 3GB2A 3NVKI 2A19B 3SX9A 3QWKA 2CLQA 3F2AA 2R3GA 2C5XA 4U7ZA 3ZEWA 4HYSA 5CSHA 4BIEA 2V22A 3LFBA 3R1SA 4FSTA 3VS7A 1LEWA 3F5GA 4BCNA 5A6OA 4BYIA 4BVUA 1IR3A 4O91A 2PVRA 5A4LA 4FNXA 5CALA 4MH7A 5E8VA 3FYJX 4YUQA 1ATPE 4NM3A 3UZRA 3OS3A 3HV4A 3O0GA 5I9UA 3SD0A 4ACHA 3PVBA 3QKMA 1OZ1A 1FGKA 4JBQA 4EBVA 3F5XA 3AT3A 4D4SA 2R3MA 3U51A 3VQUA 1H27A 5AP7A 2FH9A 4U43A 1QL6A 2B55A 4I5PA 4MBLA 5DA3A 3WZKA 3ERKA 1U54B 3BGZA 2ETMA 3BU3A 4IZYA 4S34A 5L2IA 2GQRA 4DF3A 3QX4A 4RA5A 2V5QA 3DPKA 5D7VA 4ANOA 3CD3A 4RIXB 2JDOA 4X3FC 2VWWA 3O50A 5CSXA 3DLZA 1K9AA 3D5XA 5A4CA 4RJ5A 4J95A 4LOQA 4OW8A 5D7AA 3POZA 4LGGA 4QMUA 5HX6A 1NY3A 3R8ZA 4O0WA 4OTHA 5IA3A 4X2GA 4RX9A 3GCPA 2ONLC 5LMAA 2I6LA 4IAKA 3SVVA 1OL6A 2W4OA 2UW4A 1V1KA 3LFAA 1TKIA 2X0GA 1PJKA 3L8SA 2C47A 3LE6A 2FVDA 2GNLA 3A7FA 2PZRA 5TKDA 4CTBA 1NVRA 2Z7QA 4IW0A 3IOPA 4O86A 3MVJA 1JSVA 3GEQA 3HP5A 1GNGA 1H0WA 4KBKA 4U6RA 4P5ZA 2CHLA 3HP2A 5A4QA 3TUDA 3CPBA 4DEEA 2YCRA 4G9CA 3DK6A 1J1BA 3TV4A 1P14A 1YWVA 5EHOA 4DH5A 1R0PA 2VRXA 4IM0A 4RMZA 2QG7A 4BI0A 3NRMA 4NW5A 1OGUA 3ORLA 4YJOA 5KE0A 4BCHA 5A4EA 2C3IB 5A4TA 3A99A 2PULA 3M1SA 5E8YA 1E9HA 3ET7A 2VWZA 4J8NA 4KSPA 1FVTA 2CGWA 3UE4A 4DEBA 5FUTA 2F57A 3Q6WA 2CCHA 3DXNA 3ZS5A 4HGSA 4UMQA 2CNUA 3Q4CA 4KRDA 1CSNA 2GNHA 3W1FA 4RBLA 3ZSHA 3QZGA 3IPHA 4C8BA 1NA7A 4BDJA 4R77A 4WNOA 4FTAA 4Z16A 3UIMA 2H34A 3PXYA 4KIKB 4N6ZA 2IWIA 4C02A 3O17A 1DI8A 4KA3A 2GSFA 3P7BA 3CR0A 4EEVA 2C6LA 4RIWB 4AS0A 3EWHA 1MRYA 4O7LA 3RNYA 3PJ2A 1HCLA 5AP3A 3GU7A 4FT3A 5K4IA 5HTCA 4QRCA 1KE8A 4AF3A 4O7NA 3GBZA 5CU3A 4FZ7A 4Z3VA 3F61A 1KE9A 4FTUA 4EH8A 4GT4A 3BU5A 2J0MB 2CN8A 2X2MA 1UKHA 4QYEA 4ZTQA 1WBWA 4CEGA 4FICA 5HICA 4GT3A 2ZB0A 1YQJA 3R2BA 2XNNA 4JS8A 4QP3A 4IWPA 5IMXA 3FMMA 1FQ1B 3UQCA 2F49A 2ITVA 3Q5ZA 5TF9A 2BROA 2YFXA 3VUGA 5M53A 4O7VA 2VTLA 1U5QA 4CVAA 3KC3A 3AC1A 3W33A 2JIVA 2V55A 5CVFA 3I81A 2DYLA 2J7TA 4WKQA 5EQEA 5LXMA 3UQGA 3HGKA 3OXTA 1VEBA 4PDSA 3VS6A 4B0GA 1A06A 4D0XA 4U81A 5LWNA 4DGGA 5L2SA 4OT5A 3FDNA 4DH7A 4XUFA 4DCAA 1XR1A 3PZEA 4PPBA 2QOQA 3FZRA 4FK3A 3GCUA 3HRFA 3PRIA 1O6LA 2X6DA 3W2OA 2OLCA 2QKRA 1ZRZA 2IW9A 1OL5A 2P2HA 3MFSA 2BHEA 1ZMUA 4W4YA 1XKKA 4O0XA 4PRJA 4UWBA 2JC6A 4NU1A 3TJDA 2PHKA 2P33A 3NAYA 4RVKA 4PUZA 5HU3A 5KX8A 1JSUA 4GS6A 2QOHA 2XYUA 1XHAA 4LV8A 4QYHA 3E5AA 2XMYA 5BVEA 2A2AA 2Y7JA 4NJDA 5FDPA 1PXLA 2XEZA 4PX6A 4ZTHA 3NNWA 5BVDA 5CEMA 1ZAOA 5EKNA 4CG8A 4U41A 2WTWA 4RZWA 3OWLA 2IZUA 3O96A 3F7WA 4ZJJA 4S31A 3I7CA 4ACCA 4MF0A 4RWLA 3QKLA 3UNKA 3F9NA 5EDQA 5BPYA 3P1AA 3FZOA 4ANQA 4RX8A 4G3EA 5HO7A 3NS9A 1PXIA 3QCSA 4M97A 2ITWA 4U45A 5KKRC 1E1VA 1GY3A 2GPHA 2EB3A 4TZRA 1ZYJA 3TM0A 2H96A 4GMYA 4CV9A 4QMPA 3BHHA 5CEQA 4QTAA 2B9IA 4BDKA 2ZV8A 5CF8A 1FVRA 2VU3A 5C01A 3QQKA 3PE1A 1Q8UA 2OJGA 3ANQA 3G90X 4RIOA 4F6WA 4UMPA 2Q83A 2VGPA 4EC9A 1KUTA 5DH3A 3D5UA 2HZ0A 4X2NA 1ZY5A 3T9IA 5HLNA 5F4NA 5JK3A 5DWRA 2R3PA 3QZIA 1KE6A 4NH1A 2F2UA 4BI2A 4YURA 5M57A 4ZSJA 3TUCA 2XK4A 2VWBA 5I9YA 5AEPA 5KHWA 4DE4A 3L9MA 3S4QA 2JDSA 3HEGA 3SW4A 5E4HA 2PMNX 3C4WA 4XG4A 5AADA 3UVRA 3AD5A 4FR4A 3KB7A 5AR3A 4Q9SA 4FKIA 3TL8A 2XNBA 3NIZA 5EQPA 4M0ZA 2JKOA 3R7GA 2B52A 4DLIA 4KINA 4U0IA 3FI3A 4LG4A 3OHTA 3OCSA 2X1NA 4MNFA 4EORA 5DVRA 2PMIA 3FMKA 2JIUA 3LOKA 4AE6A 4QD6A 5J7HA 2UZOA 2Y8OA 4FZAB 1BKXA 1YRPA 2GHLA 3VN9A 2GNFA 3NVMB 2O64A 4AG8A 5F9EA 3ACJA 3QD0A 5J5TA 4F7JA 4IADA 5JZJA 4BI1A 2UW8A 3RWPA 5L8JA 4XG9A 3QCQA 5K4JA 5M4IA 4DEIA 2FB8A 4TNBA 3LJ1A 3QTSA 5CU6A 2HAKA 5JZNA 2J2IB 2IZTA 2WEIA 5I0BA 2VNYA 3DQWA 5JH6A 5L8LA 2ITUA 4FZDB 4FKSA 2R9SA 3Q2JA 5CNNA 2WTDA 2X8DA 2I40A 2R7BA 1WVXA 1YOLA 3GC9A 3MDYA 4PWNA 2OG8A 4YNOA 3VRYA 4EHVA 4O7YA 1B39A 3SOAA 4F65A 2CGXA 3U6IA 1OL1A 4EH7A 3RPYA 1YDSE 2HOGA 3HZTA 3MYGA 3H10A 1MRVA 2E9VA 3E63A 2WB8A 4GU9A 4IFGA 4ZTNA 4FSYA 3THBA 5CU0A 5HLPA 1H08A 1WZYA 3LIJA 4GUEA 2OU7A 2Z7SA 1XQZA 4BZNA 3IDPA 4GYGA 1OUYA 1XH5A 3ALOA 3C7QA 4QT1A 5AR4A 4UALA 3AC2A 4QQJA 4RQKA 3UO5A 5BVKA 3SG9A 4F63A 4D9UA 4YBJA 5GJGA 3MJ1A 3Q9XA 5IH4A 1QPDA 5A6NA 2ZAZA 4BDEA 2J6MA 1APME 3FHIA 5C4LA 1Y8YA 1M17A 2NO3A 4FOBA 1PXNA 3FY0A 3F69A 3KRXA 3NCGA 3VS0A 2BRGA 3EN5A 4CKIA 3QRTA 2LGCA 3DDPA 5HHWA 3KULA 4FSRA 2YIQA 4Y85A 1Q3WA 2XJ1A 4G3CA 4OGRA 1ND4A 2YITA 4R8QA 3LMIA 4EK6A 3R6XA 3E3PA 3IG7A 2ZM1A 4Y5HA 3FLZA 4AACA 1OBDA 4I92A 2QOBA 4RLKA 4X0MA 2ZDUA 4XG8A 3NCZA 4MHAA 3MY1A 3QYZA 2WMVA 4FT9A 3DB6A 1LPUA 4ZZOA 4Z9LA 3OCTA 2WTKC 5IQDA 1H01A 5IQAA 2W06A 4GVAA 3GENA 4CMTA 4NKAA 3GQLA 5BYZA 3LQ8A 3O23A 2XF0A 3O8PA 3Q4ZA 3C4EA 2PU8A 3TWJA 3GOKA 4CYIA 4DFZE 3ZC5A 1OI9A 2GHGA 5BYYA 3ROCA 3HL7A 4BDDA 2FA2A 3V5QA 1J91A 2HZIA 5M4UA 4WUNA 5T3QA 2QQ7A 3HLLA 4J99A 3H3CA 4XV1A 1YWRA 2Z7LA 4BC6A 3BWFA 3RAIA 4NFMA 3CE3A 4AZVA 1FMOE 3TT0A 1WBTA 3D9VA 2C1AA 1W0XC 3FY2A 4L6QA 3F3UA 2FO0A 4AP7A 3EZVA 3QTIA 4YHJA 5IH5A 1FBNA 2C6OA 5ETCA 3SG8A 4O81A 3N4UA 5JFXA 3I5ZA 4UXLA 4EOSA 3CIKA 2HCKA 5L2QA 4K2RA 2VTTA 3BYVA 4I5MA 1JBPE 1P5EA 1Q4LA 3P08A 2ESMA 3PXRA 2JD5A 4X21A 4EUTA 1TVOA 4F4PA 2WELA 3HAVA 2XBAA 1ZXEA 2WMUA 3FXZA 4LMNA 2XNMA 1ZZLA 4C4JA 3PE2A 4E6CA 3CLYA 5HD4A 3IGGA 4QMLA 5A46A 4WD5A 2VX1A 3KMMA 3KXMA 5FTGA 1IA9A 1XBCA 2IVUA 2XIYA 4FKUA 1PXJA 3MVHA 3Q53A 4QO9A 4PMPA 4C2WA 1H1RA 2IW6A 2EXEA 2ITZA 2YCFA 3IO7A 2HZ4A 3F3WA 1A9UA 3VUTA 5KMOA 4QP7A 3UOLA 5FXSA 5AAGA 4FSUA 4PP9A 3V5TA 3VHEA 5BYLA 2JLDA 2CKQA 3EH9A 4N70A 3QZHA 3UYTA 4AXAA 5IMEA 4PMTA 2PTKA 5DLSA 4YGAA 3LFSA 5E8WA 3VUKA 4E6AA 1KOAA 3KK9A 1O9UA 2DS1A 1PMVA 3CJGA 5A9UA 3LXNA 4XBUA 4CCBA 4HGEA 2G9XA 3CY3A 4AT4A 2Y4IC 4EC8A 3GXLA 4JQEA 3RKBA 2BUJA 3P79A 2YDKA 1H4LA 3DTCA 3QRJA 5AV4A 4XP0A 4CZYB 2W1GA 3V5PA 4BL1A 5CYIA 2J51A 3DQXA 4FTIA 4JQ7A 4IFCA 4E26A 1PRYA 3E8CA 2YIWA 2HELA 3QYWA 1PY5A 4BTKA 4E4XA 3UOJA 5FBNC 4WNKA 2QVSE 1P4FA 1X8BA 1PXOA 3BZ3A 4JIKA 2WIPA 4BFMA 3VW8A 4FVQA 5G6VA 4AGUA 4LM5A 5JQ8A 4CKRA 3HUBA 2YLEA 4ZSEA 1BL6A 2PMOX 4EZ7A 2REIA 5CT0A 3P78A 5AV2A 3CEKA 3NR9A 4GJ2A 4DFXE 3EOCA 4Y83A 3ZFYA 4A07A 2R3OA 5HVKA 4FV6A 3C9WA 4FTQA 4FIGA 4OBQA 5J9YA 1Q97A 4GW8A 4MQ2A 1PHKA 4EH9A 3TV6A 4IX4A 4L53A 4CMUA 3FPMA 4NIFA 2XBJA 1H1WA 3QTWA 3UIBA 4G6LA 3TNQB 3I7BA 3W55A 3LLAA 5IQCA 3EQPA 4O7SA 4X7QA 4FK6A 4I6HA 2XNGA 3FMJA 3R9NA 2R3NA 3QFVA 2QO2A 2FYSA 2X9EA 4FGBA 4FTKA 3ORIA 4WA9A 1F5QA 3P7AA 4G5JA 3WF9A 4EKLA 3ORKA 3V5LA 4I1ZA 1GIHA 4XH6A 4D2PA 3EL7A 2JBOA 4USEA 4ANSA 2OW3A 2R3HA 5JMSA 2QCSA 4ZTLA 4CFWA 4Q5HA 4YC8A 1ZY4A 2GFSA 4TPTA 3IONA 3KL8A 3PY0A 4FSZA 1NXKA 2E9NA 1OM1A 3MTFA 4IZAA 4NSTA 1OB3A 1QPJA 4G17A 4O6EA 4RC2A 5CZIA 1NVQA 2RSVA 2YZAA 3E92A 3V6RA 1DM2A 5HBJA 3S95A 4UWCA 3CXWA 3LXKA 4DH8A 1U46A 5FG8A 4FG7A 4EK3A 3UIUA 2Y0AA 2F4JA 3AOXA 3KN6A 4CT2A 3IW6A 4Z7HA 3BHVA 4FI1A 3LCOA 3S00A 1U4DA 2J0JA 3PP0A 4AOJA 2PSQA 4X2KA 4GSBA 4NTTA 2XYNA 3OY1A 1G5SA 3ZO2A 5BUIA 2BKKA 4AZSA 2QURA 1UV5A 2XIRA 4C4FA 3F3VA 5CF6A 3RJCA 3DFAA 2FSMX 3MN3A 3A61A 4XLVA 2Q0NA 2VAGA 3HMOA 3LZBA 4IX5A 3SOCA 3OTVA 3B8RA 1OIRA 4DEGA 2UZWE 2JITA 2XRWA 4BB4A 4R78A 2WOTA 3DA6A 4FV0A 2BTRA 3IS5A 4FKWA 4EH3A 5L2TA 3F2RA 3CD8A 3DS6A 4IJPA 3ZFMA 3QX2A 2B0QA 3AQVA 4KRCA 3RCDA 1F0QA 4QMZA 5IEVA 1QMZA 4BCKA 4NKSA 5FTOA 3MH0A 3PLSA 1YXSA 3PP1A 4BCGA 5IDPA 3A2CA 4USDA 5HQ0A 5AAEA 5BUEA 4FV8A 4OTQA 3AGMA 3ZEPA 3WYYA 4AE9A 2ITOA 5CLPA 1YOJA 2WMSA 3MBLA 4BWPA 4H05A 5EI6A 3FMHA 4IAZA 2XRUA 3OEFX 3HECA 2CPKE 1ERKA 3T3UA 4RWJA 5EW8A 2W96B 4A9RA 2G15A 3A4PA 4M69A 4ORKA 4CTCA 4KS8A 4IAYA 3R73A 4FSMA 4MXAA 3FPQA 3QTUA 4R3PA 3BBTB 3AC5A 3JS2A 2CDZA 4K6ZA 2W1CA 4RWIA 5DN3A 5HESA 5LVLA 4KKEA 2NRUA 4YJQA 2VTJA 3I0QA 3Q04A 3F3TA 3V5WA 5L8KA 3P0MA 5D10A 3IQ7A 2BRBA 4LOPA 5IA2A 2EXCX 5FRIA 4F9AA 2BKZA 3OTUA 2QI8A 4E7WA 4LRJA 5ETFA 3QA0A 4A7CA 4EQCA 3NYNA 5EI8A 3QTXA 3LHJA 1YHSA 3U4WA 1OPJA 4V04A 5AM7A 4F0GA 4HVIA 4Y5QA 3COHA 4OR5A 4BICA 2W5HA 2OK1A 3BPRA 3DKCA 2OI4X 4YO4A 3OT8A 3VS3A 1CMKE 5AX3A 3Q9ZA 5DFPA 2Y4IB 3RHXA 3UJGA 2IN6A 4J71A 2PVKA 3VS1A 2GDOA 3KN5A 3UDBA 4WSYA 5KMJA 1IA8A 4EYJA 5I5ZA 5DMZA 5KZ0A 3D2KA 2OBJA 4FKOA 4DINA 4WHZA 4OTWA 4FGRA 3CGOA 3PPJA 4XRJA 3QGYA 3H0YA 2BZJA 1GZNA 4UN0C 4WT6A 5ANKA 3G9LX 3I79A 2QR7A 2YIYA 3MPTA 2X39A 4DFBA 4ALWA 3SRVB 3O71A 4XV2A 2JIIA 2CJMA 4RJ8A 4FEWA 3ZLXA 4FG9A 3ZXZA 2PYWA 1RW8A 4NZWB 5DGZA 1CTPE 4PL5A 4TW9A 5LARA 2X8EA 3T8OA 5BVNA 4DGMA 4QMNA 4X2FA 1YDRE 2C5OA 4E73A 4FSQA 2R2PA 3FZSA 2XIXA 4HJOA 4UZHA 4WOVA 3RK7A 3KGAA 2PE2A 3KXHA 2ZB1A 4G3GA 4QP2A 3UODA 2C3KA 4IB1A 4R3CA 2V0DA 2C3LA 1PKDA 3GC0A 4FC0A 2VUWA 1UVRA 3IGOA 3OMVA 4M15A 4XOZA 3G51A 3WF6A 4CQGA 4F7LA 4BDCA 4R7IA 3LFNA 5AJQA 4F1OA 3IK3A 1RDQE 2O5KA 1KV2A 2C1BA 3DK7A 4RZVA 3WIKA 4QPMA 4IDTA 4FT5A 4TYHA 4QYFA 4MCVA 4RX5A 3L1SA 5BVOA 3GQIA 3JYAA 1NT2A 3RZBA 1J7IA 3JY0A 4NT4A 3I6UA 4ENYA 4RVLA 3NYOA 4QTCA 2AUHA 3FKOA 3T3VA 2W9FB 4XG3A 4TWCA 2HXQA 3EN4A 1F3MC 1R39A 4HGTA 3G33A 5J9ZA 4TXCA 2RFSA 2WEVA 4QTDA 4BGHA 4S32A 4MNEA 3PVGA 5AIRA 3PXFA 4BCFA 4DT8A 2RKUA 2JDVA 4U97A 1Z57A 4EZ5A 3W2CA 5EG3A 4CZTA 1FOTA 1YW2A 2X7OA 4PL4A 4YJUA 4BDAA 3G15A 5GJDA 4CFUA 4O7TA 2J90A 2VTMA 1XWSA 2BIKB 4FIIA 3D7ZA 3H4JA 5ACKA 3TKHA 1IAJA 4O0YA 3GP0A 3VULA 2VWYA 5CANA 5IQFA 2J4ZA 5DEYA 3UMXA 5CXHA 4I5CA 2BALA 4A4OA 4W4XA 5CY3A 3RVGA 5CU2A 3MA6A 1ZLTA 3SHEA 2PPQA 4EI4A 2GU8A 4FV2A 3PTGA 4IHPA 4RVTA 2OXXA 4F09A 3VHKA 2QLUA 4ZLOA 4FSNA 4C34A 3EN9A 3PLAE 1BLXA 3ZO3A 2PL0A 3KVXA 4H1JA 4XP2A 4I4EA 5IQIA 5IA5A 4C4GA 4TWOA 5GJFA 4BR3A 4EOKA 2XA4A 4P2KA 3F5UA 4XG6A 3WZJA 4D1ZA 2C69A 3RMFA 3PA5A 4BN1A 1M7NA 5HOAA 3U9CA 2QKWB 3A7IA 4YR8A 5IQEA 3LFCA 2YEXA 4E4MA 5E8SA 4AX8A 4JOAA 4TNDA 5HTBA 3PUPA 4L8MA 5C03A 2BRHA 3TNIA 4D55A 3NMUF 2QO7A 4KSQA 1WBVA 2AC3A 2RIOA 4L44A 4L67A 3C51A 1Q62A 2GNJA 2UZNA 4ENXA 4YZCA 2UW7A 4D2WA 4EK4A 4UMTA 4UX9A 2VTIA 5JRQA 2CGUA 2R0UA 3UOKA 3GC7A 5JGDA 3N4VA 2UV2A 3UP7A 5DOSA 4E5WA 2AYPA 3OG7A 4Q5EA 4BBFA 4CKJA 2JAVA 2XM8A 4D4YA 2B9FA 4O7ZA 3NNXA 3R9OA 4JVGA 4O2ZA 3OWKA 3POOA 4IX6A 3LCKA 3RGFA 4DEAA 2E2BA 2YIRA 4C57A 2NNWB 4IEBA 2PMLX 4CV8A 3QQHA 2ITPA 2C0OA 2OJFE 5E7RA 4BY9E 2H9VA 3QUDA 4L7SA 2Z02A 4AFJA 2ZDTA 3NSZA 4IIRA 5EM6A 4CCUA 4L7FA 5CENA 3IDCA 3PPKA 2W9ZB 4QP6A 4KAOA 3FWQA 4ACGA 4Q9ZA 4TRLA 5I9WA 4IB3A 4JX3A 4MNEB 4ZLYA 1UNGA 3QF9A 4D58A 2WFYA 2R3IA 3AT4A 3C0GA 4JNWA 3NGAA 1JNKA 2VWXA 5F1ZA 3R8UA 3BIZA 4KBCA 2ITYA 5HIBA 3VUDA 4FV9A 2QOCA 2YZLA 4TT7A 1Y6BA 3EQGA 3PVUA 5AUXA 4QMSA 2PZIA 2HW6A 4YZDA 4H1MA 5FEQA 3MH3A 2B9JA 5M55A 1SZMA 2FSTX 3DNDA 2C6TA 1RQQA 2W1HA 2F9GA 2JFLA 3F5PA 3TNPC 4B9DA 4TYGA 3NLBA 3PWYA 1OECA 3R63A 2E9UA 4USFA 3A7JA 4ITHA 3MVLA 3FZTA 3DZQA 3OY3A 4IVAA 5M51A 4BBEA 2RF9A 3MFTA 5CVHA 3VS2A 4BKJA 5JGAA 3C13A 3NYVA 4ZP5A 4E5BA 2XCHA 1ZYCA 3HDNA 2C6IA 5EM7A 5GNKA 1UWHA 2HK5A 4C4EA 4GKIA 2ZV9A 1WBSA 3V01A 4ZAUA 2ITNA 3KKVA 4I21A 4XRLA 4FOCA 5AR7A 3LQ3A 2RG6A 2XJ2A 2QOLA 3DAJA 5KZIA 5H8EA 3MB7A 2P0CA 3QQJA 5CU4A 5CXZA 2XP2A 4YZBA 1Y8GA 2PUUA 4UXQA 3PY1A 4AU8A 2XCKA 5ICPA 2WMXA 1STCE 2EU9A 4PY1A 3L9LA 3DB8A 4O2PA 2WO6A 3QALE 4FKPA 3PJ3A 2GMXA 3O7LD 1B38A 4BCPA 3F3ZA 2CNQA 2OGVA 4Y72A 1YVJA 3HMNA 3PXQA 5AAFA 2YHVA 4IVDA 4L68A 5H3QA 2UZDA 4ALUA 2CCIA 5DNRA 4DFUA 4U42A 3SKCA 3QXOA 3E8NA 4AOIA 3F66A 4IANA 2C6KA 2W17A 3CGFA 2W1DA 1PYXA 4EUUA 3OCGA 3QKKA 4FTMA 4QYYA 5BMSA 1LR4A 4J8MA 3K5VA 4ZIMA 3GCQA 4R1VA 1SVGA 5E8UA 4DBXA 2UW3A 4JBPA 5HI2A 3NW6A 4O0RA 5AFVA 4MXZA 2VTPA 5AA8A 2QOKA 3TKIA 3FSKA 3DOGA 5D9HA 3QD2B 2YABA 3GGFA 3ZO4A 5L2WA 3FLQA 4M68A 4U79A 4K0YA 4B7TA 3MH2A 4AN2A 5DYJA 3TCPA 2YAAA 3NNVA 5CZHA 2OF2A 5AA9A 4CG9A 4RJ3A 2W1FA 1OIQA 5HIEA 4ZTSA 2X8IA 4MD9E 4UB7A 4H39A 2Y4PA 2B54A 3ORPA 3KRRA 4LV5A 2C4GA 5EKOA 3R7EA 3LMHA 5HO8A 4BDGA 3PY3A 1JOWB 2OSCA 4ACDA 4CRLA 3FAAA 3ACKA 2YM8A 2CMWA 4IDVA 3MIYA 2ZVAA 1JKSA 4CFXA 3OW4A 3VC4A 4PV0A 3V04A 3FZPA 4AGCA 4LOOA 3OT3A 3OWJA 5EW9A 4W8DA 3NW7A 1OBGA 3ATTA 4WUAA 4DLJA 5DEWA 3NUUA 4PNIA 1ZARA 3W18A 5CQUA 5IQHA 3IW5A 2B9HA 4QQTA 4ACMA 4GRBA 3TI1A 2VN9A 4DC2A 2GQGA 4DFYA 2PZYA 4A9YA 3LM5A 2R7IA 3N51A 3GUBA 4YTHA 1H00A 3R1NA 3AGLA 3QQGA 3BRBA 4G6NA 4NCTA 3HKOA 4BCMA 2Z7RA 4NM0A 3MB6A 4RC4A 3KEXA 4W9WA 1OKZA 3QQLA 3QZFA 3LPBA 4CLJA 5I3RA 1H28A 5CEIA 3OEZA 3GU6A 3ZUVA 3FI4A 5DRDA 4RIYB 1H25A 2J5EA 3AC3A 3O8TA 3Q32A 4YJRA 5IZFA 4HVHA 4UMUA 1H1QA 3ROYA 2ZYBA 4A4XA 1O6KA 4BTMA 2EVAA 4FUXA 3ORTA 3OOMA 3FL5A 4HOKA 3JVSA 4UV0A 4X2JA 3VQHA 5DHJA 4V05A 4YJPA 1PW2A 3G2FA 3QL8A 4MK0A 5JFSA 2UZLA 1Z5MA 3D5WA 3GCSA 4P7EA 5LCKA 3A4OX 4A06A 3QCXA 2OFVA 4OTRA 4GUBA 4LMUA 2WTKB 4ZJIA 1M7QA 4G31A 3PZHA 2G01A 1WMKA 3VF8A 4PPCA 4BHZA 4ZY4A 5HTIA 1VZOA 3TKUA 3DZOA 2ZJWA 3TZ7A 4XV3A 1O6YA 3OUKA 5FEDA 4M13A 3E8DA 4RQVA 4L9IA 3CBLA 5BMMA 4B8MA 4ZZMA 4PQNA 5HD7A 2QHNA 4EONA 4IACA 3AMYA 3CTHA 2YN8A 2FSOX 4TWNA 4I5HA 4WRSA 5CSWA 5ETAA 3QHWA 5HE0A 2BZHB 2PVMA 2ETRA 2OJJA 5AM6A 5EDPA 4N57A 3BEGA 3WZEA 4TYJA 4O1PA 5BUJA 4NIFB 3L9NA 4DEHA 1Q24A 4RPVA 3LCSA 3EB0A 3KQ7A 4B4LA 2YISA 3BLRA 3A8WA 4FA2A 4ITJA 3FQHA 3PSBA 5FBOA 3ELJA 3KK8A 3DCVA 3WIGA 3EZRA 3DGKA 3OP5A 3VBYA 1UNLA 4O0SA 3W16A 2XKFA 1H1SA 3B2WA 2RL5A 3PRFA 5CNOA 4DBNA 2BFYA 3U9NA 5B2MA 4B99A 2ZM3A 2HWOA 4PMSA 2BRMA 2XK3A 1QPCA 2XKCA 3CSVA 3R00A 5M09A 4GIIA 1P4OA 3JXWA 2CKOA 3E7OA 3L9PA 4QP9A 3IW8A 3W8LA 4XX9A 4FEQA 4KIQA 2XS0A 2QO9A 2B4SB 1SMHA 3IW7A 4HVGA 2UZTA 4YJTA 4NW6A 2VV9A 3MPMA 4KIPA 4JR3A 4J1RA 5FM2A 5TOZA 4FKTA 2YDIA 3OUNB 1ZOGA 3AD6A 5CF5A 4I24A 3L8XA 3OXIA 4C4IA 2P2IA 5HKMA 5C1QB 3ZRLA 3M11A 4O84A 4XBRA 4K77A 3KXGA 2VD5A 2W4JA 4WG5A 4YTIA 3WZUA 2R3FA 4A4LA 3AT2A 4O7RA 5BVWA 5LMBA 2PUIA 5KMLA 2XNEA 1PXPA 5HNIX 2R0IA 3BYOA 4FKRA 4JLCA 4RJ6A 3D5VA 4FIJA 5M08A 4PF4A 2WQMA 1CDKA 2NP8A 3A60A 4AA4A 2O65A 2X2KA 5DE2A 3P5KA 5IA1A 1T46A 4FKLA 4FTJA 4DFLA 4ANMA 4ZSAA 5DPVA 4YTFA 3PYYA 4JG8A 5EQYA 1YHVA 4FEXA 5J1VA 1UKIA 3HYHA 3Q4UA 4TYHB 5EI2A 2GCDA 5IUIA 3KA0A 3KMUA 2WXVA 2XB7A 3HMIA 4TTHB 2HIWA 4G1WA 3ZUUA 4D28A 5AP2A 3SXSA 4FBXA 5G1XA 3E93A 5HCZA 4ZK5A 4EH6A 4I0RA 3FLWA 4HCTA 1BX6A 4HPUE 4JL9A 4APCA 4O0VA 1RJBA 3FI2A 3B2TA 4CGAA 1REKA 5FP6A 4YJNA 3HRCA 4W4WA 1GOLA 2O2UA 5KMKA 4GU6A 2GS2A 2X4ZA 4FIHA 4RWKA 1G8SA 3KMWA 4E5AX 3MJ2A 1Q61A 3FLNC 4EJ7A 3A8XA 3CC6A 3EMGA 4G16A 3MW1A 3R8MA 3QHRA 2XKEA 4QMTA 4ASZA 2PVYA 4R7BA 3BCEA 3Q9YA 5GZ8A 3QUEA 3II5A 4XEYA 3QUPA 1FPUA 3O2MA 4IZ7A 3MVMA 5H8BA 4E3CA 2BFXA 2YJRA 4WIHA 2C6MA 2R3JA 3PIYA 4GG5A 2BIYA 4O0TA 4QMMA 4YO6A 3BBWA 4FTLA 5C9CA 4AZWA 4V0GA 4O7WA 1K2PA 1Y91A 4NEUA 3U8WA 1OIYA 3PSDA 4FG8A 2VGOA 1PYEA 2F7EE 4PTEA 5HCYA 4C58A 3DBEA 1Q8WA 1WFCA 3R8PA 3S1HA 2VTHA 3PG3A 4G5PA 4LQMA 4JT3A 1PXMA 3T9TA 4D1SA 5HG7A 3WOWA 5GINE 2ZM4A 1YHWA 2NRYA 2XKDA 3CCNA 3MY0A 4DYMA 4MTAA 4YC6A 4BTFA 4CMOA 3NUNA 5HNGA 2IO6A 4C2VA 4JBOA 4UMRA 4IE9A 3EQIA 2OH4A 1U59A 3VS4A 4D2SA 3SAYA 2B53A 3EKKA 3R0TA 5J9LA 5F95A 3RNIA 2X2LA 5FGKA 1OKYA 1YDTE 1ZYDA 2C3JA 4D1XA 4D2TA 1SNUA 1ZZ2A 1UWJA 5FD2A 4FTCA 3E7VA 3RPOA 2VTQA 2WOUA 2VO0A 3ZRMA 4QMVA 3LJ2A 5J7BA 2WTIA 5M07A 3FQEA 1Q8YA 4QTBA 3V5JA 3ZZWA 4AW1A 4O27B 4MF1A 4DN5A 4E4LA 3VVHA 5JFVA 5E8ZA 2PY3A 4MBIA 4BGQA 3G0EA 3RALA 3DKGA 5ANJA 4DT9A 5IEXA 4E4NA 4GH2A 4OTGA 4JG7A 3FE3A 4GEOA 3RBWA 3DNEA 1UU9A 3DBDA 1LUFA 3LCTA 2PE0A 4LI5A 2WPAA 3R7IA 4F9CA 1KWPA 4N4SA 2J0KA 2BTSA 3K3IA 3EQFA 4CNHA 4U3YA 3UMWA 3SC1A 3U4UA 3GCVA 4FEUA 4AGDA 3KRWA 4JRVA 3LFEA 4QP4A 4BWKA 4IAAA 4U44A 4C62A 4CT1A 2Q0BA 4GL9A 1P2AA 3MH1A 1DS5A 4JDHA 4EOJA 4AZFA 3GNIB 4LL5A 3BX5A 4DTKA 2ZMDA 2WMTA 1DAWA 3C1XA 3GC8A 3C4ZA 1DI9A 3KXNA 2BR1A 2VNWA 4FTRA 4IM3A 3U6HA 2BMCA 2WMWA 4G6OA 1UU7A 2HW7A 2VZ6A 1OUKA 3DAEA 3F2NA 4NUSA 3VNTA 3ZUTA 1Y6AA 2QNJA 1MP8A 2YM5A 2HWPA 2R3QA 4C3RA 1E1XA 3ATSA 5ETIA 4C61A 3ZM9A 4FKJA 4D4RA 3RCJA 2OO8X 2PVJA 3VJNA 4EK8A 2WHBA 4I41A 2CN5A 5EM8A 5HVJA 3JPVA 4MBJA 1UA2A 2QG5A 4NTSA 3DJ5A 4F70A 1UU8A 1H24A 1CKJA 2BZIB 2WTVA 3VUIA 4TYEA 1Y57A 2WQNA 3P23A 5JSMA 3M42A 5HBEA 3VBQA 4EQMA 4BKYA 1JLUE 1HCKA 2Y6OA 2OIQA 3EFJA 3R01A 4RVMA 1R0EA 3DT1A 5HO6A 5HE3A 4G34A 3I1AA 2P4IA 4FTTA 3KFAA 2UVYA 5HIDA 2PVNA 4I22A 3OZ6A 3C0IA 5CVGA 4CQEA 4WRGA 1Q8TA 2YACA 4U80A 3CKWA 5EFQA 4LL0A 5ANGA 4DFNA 3QU0A 5FM3A 5KMMA 3ODYX 3L8PA 3NW5A 4C0TA 2UVZA 3ZDUA 2CKPA 4FEVA 3AD4A 3NYXA 1KE7A 1L3RE 3V8TA 5AUVA 5CSPA 2YA9A 2OXYA 3BE2A 4AW2A 2O8YA 3QC4A 4FV7A 4PTCA 5D12A 3S3IA 3WARA 2E9OA 4JDKA 3FMNA 1JVPP 4G3FA 3VUHA 1YXUA 1W8CA 3LXPA 4L3LA 5AX9A 2UUEA 4RLLA 4GV1A 2GTNA 4JRNA 2C68A 4YJSA 4GK2A 4EBWA 4ONAA 5F20A 2YCQA 3HAMA 2A4LA 4QNAA 2O0UA 3PVWA 1OL2A 3PXZA 3PSCA 1PF8A 4ZEGA 3UZPA 1QCFA 4C37A 3M2WA 4KBAA 4X6RA 4BTJA 4BDBA 2R3LA 1YXXA 4L46A 2HZNA 1G8AA 2F7ZE 2XJ0A 4L01A 3E8EA 5AUYA 4IB0A 3NX8A 5CI6A 4G9RA 4GKHA 1XO2B 2F7XE 3FV8A 5GZ9A 4HNIA 3DK3A 2QLQA 4FIFA 4NWMA 4O6LA 5EOBA 3WI6A 3UBDA 2YERA 2J9MA 4AA0A 4L3JA 4QQCA 5JFWA 5I9VA 5KUPA 3DXQA 3RPRA 2XNOA 1S9IA 3PPZA 3O51A 4JR7A 4FVPA 4WNPA 3VIDA 4C3FA 3DBFA 4CFNA 4BRXA 3QTZA 3WBLA 2I0HA 3W10A 2JAMA 4HW7A 2BZKB 1OL7A 4OTDA 4H3PA 3GU8A 3GU5A 1PMNA 5TR6A 1XH7A 4BZOA 3HX4A 2BILB 3H9RA 1K3AA 2BCJA 3EYGA 3LFFA 4BDFA 3DAKA 4ASDA 3QTRA 5IDNA 2HY81 4IB5A 4IJ9A 5LVMA 4BYJA 2C0IA 3R28A 4OTIA 3ZSGA 2GS6A 3UVPA 4FV4A 4BWXA 1KE5A 3QWJA 5M4FA 4EH2A 3RM6A 4ZMEA 4AT5A 3RPSA 4GFGA 4XMOA 2FSLX 3Q3BA 3F82A 3TTJA 4QP8A 4GK4A 3UVQA 2OXDA 3LCDA 4IQ6A 4NM5A 1MUOA 2O63A 4R7HA 3MTLA 3RZFA 5HZNA 3DV3A 4XCUA 2WKMA 3UGCA 2OJIA 3SXFA 2PUNA 2A0CX 4UYAA 1OPKA 2XUUA 3ENMA 4FE2A 2RG5A 3ZMMA 3P9JA 1H07A 3R9RA 1BUHA 4FV1A 4II5A 3UIXA 3VO3A 4KKGA 3AMBA 4UY9A 3UNZA 4O1OA 3N4TA 3GT8A 2PK9A 3VW6A 5GIOE 1HOWA 3FMEA 3EN7A 3FJQE 4L45A 5AUZA 4ZY5A 4G3DA 5A54A 4P5QA 4ZZNA 1Q3DA 4KKHA 4YPDA 2OIDA 4RG0A 2G2HA 3CKXA 4YZMA 2WMRA 2RFDA 4DG0E 5IA0A 4NYEA 2OH0E 2QOIA 4CFMA 3CQEA 3QGWA 4R5SA 5M44A 1H8FA 3FL4A 4ITIA 2PZ5A 5CF4A 2EUFB 3PXKA 4M7IA 5HU9A 3D7TA 2UZUE 5FP5A 5FXRA 2WAJA 5CWZA 1V0PA 5IQBA 3ZC6A 1SVEA 3G6HA 3KCFA 2OJ9A 4MD8E 4QYGA 3KU2A 4PTGA 5FXQA 5AP5A 4TY1A 4IBMA 2XK9A 2FGIA 4FL2A 2YIXA 3ITZA 4GJ3A 4AN9A 3TDWA 3BV3A 3FHRA 4PP7A 4YJVA 2LAVA 3NUAA 4C38A 4L42A 2BAJA 3JR1A 4S33A 3UYSA 2VO3A 5HCXA 4E6DA 4HZSA 4PDOA 4RA4A 4HVDA 1M2RA 3C5UA 2ZV2A 4FZFB 5IUGA 4G2FA 5ANOA 5LMKA 3RPVA 4RIXA 4DG2E 2YM3A 4JI9A 3SRVA 4FX3A 5HEZA 5EH0A 4YZ9A 2C0TA 3PJ1A 5L3AA 4GVJA 3W32A 1CKIA 3ALNA 5JEBA 2I0YA 3W8QA 4DG3E 5BVFA 4EOQA 3VJOA 4C35A 5E90A 3NUXA 4DA5A 5DT0A 5CASA 3BE9A 3COMA 1ZYSA 5JRSA 3Q4TA 5IPJA 3KREA 3FYKX 4MEDA 4LRMA 5CI7A 3SV0A 1XH8A 2GNGA 3GU4A 3HDMA 4YLJA 3U54A 4I6QA 4K33A 3HV5A 4QOXA 4ZXTA 4EHZA 4FODA 4I23A 3NNUA 1JKTA 5DT4A 4S2ZA 4M69B 4XLIA 3UZTA 5DG5A 4KIKA 2C5VA 1TQPA 3ZOSA 2H8HA 3E88A 4D2VA 2JDTA 2P3GX 3MI9A 4H3QA 3DJ6A 4K8AA 4O0UA 5EYDA 4KD1A 3TEIA 4YSMA 4KABA 2QHMA 4BDIA 3W2QA 3WE4A 4IZ5A 5IISA 1M14A 1J7UA 1URWA 1GZKA 2HYYA 3D0EA 3NWWA 3ZLYA 2VX3A 5AIKA 4PMMA 1L8TA 3ZLWA 2QOOA 4RIWA 4JX7A 4RSSA 2WNTA 5EHYA 2IW8A 3TNWA 2GTMA 1ZMWA 5BQ0A 4FIEA 4N0SA 5H8GA 4HPTE 5E9EA 4IVCA 1OKWA 4I94A 2R3RA 1W98A 3R21A 4P4CA 4DGOA 4EH4A 5IG1A 4XJ0A 1IEPA 2R64A 2YDJA 3S2PA 3Q52A 4UYNA 4FYOA 5B0XA 2OFUA 4BKZA 4BHNA 4DAWA 3DDQA 3C50A 3F7ZA 4M14A 5KO1A 4F7NA 2W1EA 2UZVA 3MIAA 4CSVA 4KB8A 2WQEA 3D94A 3F88A 5ANEA 2P55A 4DH1A 3KCKA 4L52A 5K5XA 1YI3A 5BX0A 1BL7A 3Q6UA 4QMOA 3LW0A 4HCUA 4F64A 4F9BA 3VUMA 2R5TA 2G2FA 3LLTA 4J53A 1WBPA 3CQWA 3RAWA 4YPSA 4AGWA 2YJSA 4BZDA 3S0OA 4OUCA 2QONA 1FVVA 4FV5A 4CFFA 4JAJA 5AV1A 5J5SA 2VX0A 4RRVA 3WE8A 2GNIA 4MKCA 4O38A 3FQSA 3R30A 5LQFA 2OWBA 1G3NA 3FI8A 3TDVA 4WG4A 2A1AB 4ZOGA 5DIAA 3DBQA 2H6DA 3Q5IA 2JKMA 4F0FA 4DTAA 3FC1X 3TUBA 2XIZA 4EOPA 3R9HA 4UBAA 4E93A 5HX8A 4QQ5A 5E91A 3PWDA 3BLHA 1DAYA 4ASEA 2ONLA 4FMQA 1XH4A 3SA0A 2W05A 1AQ1A 3OROA 3ZDIA 3VRZA 2VTNA 2VWIA 5ANDA 3QTQA 3EKNA 4FSWA 3FKNA 4RGJA 2W0JA 5B2KA 4LRKA 4O96A 4IWQA 3FLYA 4GYIA 5AR2A 5LVPA 2BPMA 3TZMA 3PIZA 4R1YA 1W83A 2PZPA 1JSTA 4HNFA 1AD5A 3EQCA 3I5NA 2IG7A 4FL1A 2WZJA 5CSVA 4JG6A 4NJ3A 3D83A 3W2RA 3ZONA 5IEYA 4A9TA 3OF0A 5CX9A 3L8VA 3ORNA 2BAQA 2I1MA 2RFNA 2VO6A 2X9FA 4FV3A 4KIOA 3ZFXA 1MQ4A 2QODA 5ACBC 4L00A 1ZWSA 2G2IA 2W7XA 4OTPA 5M06A 4MXXA 4Y8DA 4CYJA 4PL3A 1WVWA 1XH9A 5HVYA 2OICA 2Z8CA 3I6WA 1OITA 5L6PA 2IVTA 5C8NA 3RINA 4UZDA 2UW6A 2VTAA 3B8QA 3MFUA 3NDMA 4U3ZA 4AZTA 4BIDA 2W4KA 4B8LA 5AP4A 5E92A 5I4NA 4TL0A 2HY0A 4N6YA 4J52A 3OOGA 3FMLA 1GZ8A 1IASA 3KY2A 4U40A 5LMKC 3TNHA 4WO5A 4IC8A 3PDTA 3OVVA 4D5HA 3PFQA 4F1TA 2X6EA 3R8VA 4YU2A 3COKA 1SM2A 1XH6A 3KRLA 4E8AA 4FKQA 3MWUA 5K0KA 5E8TA 1YXVA 3UQFA 3TJCA 3PA3A 2WTJA 3ZRKA 5IU2A 3TV7A 5HORA 4IAFA 2QU6A 4LUEA 2C5YA 4MX9A 3ZM4A 3OXZA 3WF5A 3BU6A 3FZ1A 3HA8A 5J95A 1BI8A 3TZ8A 2WMBA 3MESA 5C26A 3PJCA 4RT7A 3BWJA 2OZAB 4IC7A 2NPQA 2CNVA 5KBQA 1MRUA 1WBNA 2V7OA 3TACA 2JKQA 3SQQA 1M52A 3BYSA 5EYCA 3MGYA 1OVEA 2X81A 3KF4A 4H36A 5KKRB 4BBMA 4IAIA 4Q2AA 4FKVA 4EKKA 2A27A 3MY5A 4MXCA 2KULA 2YAKA 1W7HA 4W9XA 2WMAA 1REJA 3QD3A 5EDRA 4C4HA 2PUPA 3RK9A 5AP6A 4XS2A 3ZSIA 4ANNA 3ID6C 1PMUA 3RK5A 4AWIA 2GS7A 4CD0A 4QNYA 4GG7A 1I44A 4M84A 4WSQA 3UPXA 5CAOA 3UPZA 3EHAA 2IVVA 1WAKA 4FVRA 2HXLA 4AT3A 2ITQA 3NPCA 5GHVA 2XK6A 3F6XA 1PMEA 3QRUA 4BCIA 1YI4A 2PVFA 3PIXA 5AR8A 2SRCA 5C27A 2ITTA 1WVYA 4YLLA 4DH3A 1ZOEA 5JQ5A 5ANIA 3ZO1A 1FGIA 3AXWA 4MWIA 4YSJA 4ZY6A 1IAHA 1SVHA 3TG1A 4FZ6A 4IWDA 5GIPE 1YKRA 3OWPA 4OAUC 3FMDA 4FTNA 4JQ8A 5D1JA 2O3PA 2EWAA 4V0GB 3LVPA 4Y73A 3FXWA 2C5NA 4M3QA 3EL8A 3EN6A 3RHKA 1BYGA 2BHHA 5HBHA 4E20A 2XH5A 3LFQA 3ORXA 1W82A 2V62A 3N9XA 4ARKA 2RFEA 5IF1A 2VTRA 4H58A 3EFWA 4I0SA 5FDXA 1ZOHA 3AMAA 4RFZA 1VYZA 3HVCA 5BNJA 4XOYA 4ZJVA 1H0VA 2E9PA 5DT3A 2R3KA 3R7VA 4A9UA 4IM2A 5TO8A 1XBAA 4AA5A 2WU6A 4ASXA 4R6VA 1TQIA 4RFMA 4JXFA 2ERKA 5I3OA 5LJJA 5EHLA 3D15A 1H1PA 4AN3A 4WBBB 4EOLA 5KMIA 4P90A 4FT7A 3O7LB 3QBNA 3RP9A 4C33A 5TE0A 4MWHA 2KTYA 3BELA 2X7GA 3SDJA 1PKGA 1PXKA 4AW0A 4RC3A 3CS9A 3MSSA 3R9DA 3DJ7A 3RTPA 4GCJA 4QMQA 5CT7A 2CLXA 5T68A 3H9FA 3GFWA 3FXXA 3HA6A 1T45A 3HMMA 2YWPA 5L4QA 3LKMA 4F6SA 2BDJA 4XP3A 5JKGA 4OAVB 3HNGA 4M0YA 4M8TA 4C36A 3BHUA 1URCA 1BI7A 2J5FA 2W99B 2V7AA 2ZMCA 3AC4A 3KULB 3OD6X 4JAIA 4JBVA 3ZH8A 4CXAA 3U87A 3ZU7A 4FF8A 3R02A 4NM7A 3JVRA 2XZSA 4Y95A 5DR2A 1AGWA 4J96A 4QPSA 5E1SA 3WF8A 3WF7A 4F6UA 3EQDA 5EW3A 5A3XA 3BGPA 3R8LA 4ZMFA 3I4BA 1FINA 3KVWA 3NUYA 4NK9A 3VBTA 2QR8A 5CAPA 3IECA 3PA4A 5E8XA 2GHMA 3ZBFA 4DGNA 4D9TA 2W1IA 4HYUA 4U8ZA 5AP0A 4ZSGA 4ZS0A 3SLSA 4IH8A 4BIBA 5KBRA 3QQFA 1OKVA 3UP2A 4X3FA 4ANLA 4YMJA 2UW0A 2VTOA 5L6WL 3LXLA 3W2SA 4E6QA 3NIEA 5B2LA 3D4QA 3EIDA 3HV7A 4RJ7A 4H3BA 2VWUA 1IRKA 4NCTC
chains in the Genus database with same CATH superfamily
5J79A 4FNWA 3FC2A 5CTPA 4CLIA 2PVLA 3OC1A 5HGIA 5LVNA 2Y6MA 4FKGA 4YZNA 5CEKA 2IZSA 4AQKA 3ODZX 3LJ0A 4ANBA 2X7FA 5CAQA 4V01A 3TIYA 5HLWA 3QLGA 4DITA 3R2YA 1U5RA 2IZRA 3H9OA 3O8UA 4RJ4A 1VJYA 2YM4A 4I3ZA 2GQSA 3NFFB 3AG9A 5FLFA 2JEDA 2ZOQA 3BQRA 2BAKA 4EOOA 5J1WA 5HG5A 1WCCA 2BVAA 3QC9A 4PPAA 4GK3A 4A9SA 3C0HA 4ERWA 1W2FA 3VBXA 4Z55A 1J1CA 5AWMA 2Y9QA 4K11A 1JKLA 1UNHA 3K2LA 3QXPA 3WZDA 3VWAA 2RGPA 1JPAA 3BEAA 5LCJA 1XBBA 2PWLA 2VO7A 2WU7A 5K3YA 5D11A 3KXZA 2PVHA 1JAMA 3OBGA 3ORZA 3NAXA 3GOPA 3C4FA 1LP4A 2F2CB 4KNBA 4XHKB 3H30A 1YWNA 2DUVA 4BGGA 5A14A 1Q8ZA 3EQRA 4BDHA 4CZUA 2XK8A 4FL3A 2VTSA 3E62A 3SXRA 4DEDA 4EZ3A 5TT7A 5CEPA 3NEWA 5LOHA 1GZOA 4MXOA 3RAHA 1VR2A 3BV2A 5KNJA 4AXCA 1M2PA 4FUYA 5IQGA 4F9YA 4BF2A 5HNBA 3QCYA 1J3HA 4JJRA 3IKAA 4HYHA 1R3CA 2CSNA 4RIYA 5AV3A 4C3PA 3BHYA 5DRBA 3HV6A 3R1QA 5CAUA 4KUJA 4TWPA 2C6DA 5AV0A 1KSWA 2ITXA 3GVUA 2XK7A 2IPXA 5GZAA 4F9WA 3K54A 3R04A 3DKOA 4YHTA 3UG2A 5JN2A 2BDWA 4UWYA 3QAME 3UC3A 4LYNA 5HG8A 3ZHPC 1TZDA 2WQBA 5AP1A 3V8SA 4NL0A 4I20A 3WYXA 3SW7A 4ZTMA 3BYUA 3DBCA 3LMGA 4U9AA 4F7SA 4QEBA 3C4CA 1J7LA 3G0FA 5CQWA 4LGDA 1OIUA 4EWHA 3P86A 4ZLZA 4RFYA 3QRIA 2YLFA 3ZBXA 2B1PA 4EJNA 2I7QA 3MS9A 1M2QA 5B7VA 4DTBA 5KHXA 2ETKA 3KRJA 2X4FA 4F0IA 4HYIA 5H9BA 3FSFA 4CFVA 1S9JA 3ENHA 2QOFA 5AUTA 2ZV7A 4BCOA 4J97A 5ITAA 1KV1A 3R22A 2IF8A 4M66A 4HVSA 5M56A 3CJFA 2CGVA 3OW3A 4AFEA 1FMKA 3SGCA 1BMKA 2W5BA 2VWVA 3CTQA 1I09A 3C4XA 4AZEA 4EWQA 4PNKA 3G5DA 4YP8A 4MAOA 5K0XA 4R3RA 3Q9WA 1KOBA 2J0LA 3ZZEA 3GFEA 2BRNA 3PG1A 3P7CA 4QPAA 3ZXTA 2QD9A 3VF9A 3IDBA 2ERZE 4L3PA 2DWBA 2OIBA 3EJ1A 4JDIA 2XM9A 3A7HA 2PE1A 3JUHA 3K5UA 4ALVA 4D2RA 3NZ0A 3LFDA 4I0TA 2YCSA 3IOKA 3I0OA 4FTOA 3ZYAA 4YC3A 4C59A 4DHFA 4D5KA 4LFIA 4EQUA 1V0OA 1YXTA 1A48A 1GIJA 4F1MA 2WIHA 5I9ZA 3W2PA 4LUDA 3TZ9A 4E1ZA 2OKRA 2ACXA 4F08A 3ORMA 1VYWA 5IA4A 2EXMA 4KWPA 1QPEA 3R1YA 1YI6A 4ZSLA 4B6LA 3CY2A 2C30A 3MA3A 2W1ZA 4BCJA 5J87A 4AOTA 3ZTXA 4EOMA 3FUPA 2OZOA 4APPA 3V6SA 3ZLSA 2XVDA 2W5AA 4QMXA 5DBXA 3DY7A 4FYNA 5AR5A 5AUWA 3D14A 4KS7A 5AMNA 4FJVA 2C6EA 3UOHA 3OBJA 4EHGA 3EYHA 2FUMA 4X3FB 1NVSA 3ULZA 3HRBA 5KCVA 3DKFA 4W8EA 3LAUA 2J0IA 4ID7A 5EOLA 2BDFA 5KMNA 4D4VA 5CAVA 5M4CA 4CRSA 1OPLA 3G6GA 1WBOA 3EQHA 3CQUA 4FNZA 3E87A 4OTFA 3FEGA 5HG9A 3FKLA 5C4KA 2G1TA 5DR9A 3MV5A 3IW4A 4AAAA 4BCQA 3OCBA 4MD7E 5T6KA 2EB2A 3ANRA 3BQCA 3NUPA 3RM7A 3I60A 3G9NA 3R7OA 1GIIA 3BGQA 4M67A 5IUHA 4PDYA 4FNYA 3Q96A 4GT5A 4MXYA 3UTOA 1V0BA 4NFNA 3R83A 2UW5A 4OBPA 1SYKA 4AUAA 4YBKA 5EK7A 5K9IA 3LQ5A 4K1BA 2B7AA 3ETAA 4QMWA 3BHTA 3ULIA 3VBVA 4JDJA 3P4KA 1IG1A 3U6JA 4M12A 3K3JA 4ERKA 2UZBA 3BKBA 2UW9A 3A7GA 5J8IA 2XAOA 1Q41A 4R5YA 2Z60A 4JIAA 4I6FA 2R4BA 2QC6A 1NW1A 2ZFYA 4XG7A 5I9XA 1Z9XA 3CP9A 2JDRA 4K18A 4X6QC 4ZS4A 5FWKK 1RE8A 2WGJA 3REPA 3CPCA 1B6CB 4WG3A 2XIKA 4EL9A 4EOIA 3D7TB 3PJ8A 4ZTRA 2YM7A 5EM5A 4Z7GA 4GFMA 5AUUA 3VBWA 4YNEA 3TXOA 3DLSA 2JGZA 3QRKA 3COIA 4OLIA 5D41A 3HMPA 3TTIA 4DGLC 3WILA 3VS5A 4AQCA 3TN8A 3UG1A 1LEZA 3QLFA 2I0EA 1H26A 3JY9A 4MVFA 1TFFA 4IXPA 4F99A 3LM0A 3RI1A 3UNJA 2WTCA 5C8KA 2I0VA 4MYGA 1YOMA 2YWVA 3QQUA 4EK5A 4I6LA 1R1WA 3A62A 4EYMA 5FEEA 3V51A 5FTQA 3DFCB 4WNMA 3UO4A 1GAGA 4IX3A 3UO6A 3VAPA 4HZRA 4TKSA 1CKPA 1JQHA 2JBPA 5CS6A 5DI1A 3AC8A 1EH4A 5IKWA 3D2IA 2YM6A 3MPAA 5C8MA 4OBOA 1JKKA 4EHEA 2Z2WA 3E64A 3UC4A 3R71A 1UU3A 3EFLA 2IVSA 3E3BX 1SNXA 3EFKA 2DQ7X 1U54A 4YHFA 2UVXA 3CTJA 4IVBA 4S30A 3V3VA 5JT2A 1GJOA 5DR6A 2JFMA 2UZEA 4U5JA 4J7BA 3C5IA 2J50A 4LGHA 1OMWA 3DXPA 2WD1A 4QMYA 4O82A 4XV9A 3KF7A 4GFOA 4OT6A 5K5NA 3BLQA 4O21A 4I4FA 4L43A 5JGBA 4I6BA 3BI6A 4O22A 4RX7A 3V8WA 4YLKA 5FQDC 4QTEA 1R78A 2GFCA 5E1EA 4O83A 4I93A 3RWQA 4AW5A 2XNPA 2AC5A 3NUSA 3BYMA 3Q2MA 5HE2A 1ZMVA 4HGLA 4IMYA 1W84A 1Q5KA 3FLSA 3Q60A 4GIHA 5F94A 4TYIA 3R7YA 2JKKA 4QP1A 4X3JA 4YTCA 4PDPA 4UEUA 4Y46A 3DTWA 1ZYLA 1JWHA 4D0WA 2IJMA 4EH5A 2OF4A 1XJDA 3GI3A 3ZCLA 1Q99A 4XG2A 5LVOA 3H0ZA 2XEYA 4HCVA 4W4VA 5EYMA 3KXXA 3QD4A 4IWOA 2WMQA 3OFMA 3QA8A 5IH6A 2CKEA 4XYFA 2QU5A 5CEOA 2OZAA 3TIZA 5H2UA 1TQMA 3EQBA 4C7TA 4WBOA 2HENA 1CM8A 4MQ1A 3FBVA 3U55A 2WQOA 4J98A 4FT0A 4XNEA 4K9YA 1MQBA 3HV3A 4DCEA 3R7UA 5L6OA 5HE1A 3HUCA 3DU8A 5EYKA 3MFRA 3RAKA 2XANA 4TN6A 5LWMA 3GB2A 3NVKI 2A19B 3SX9A 3QWKA 3ML1A 2CLQA 3F2AA 2R3GA 2C5XA 4U7ZA 3ZEWA 4HYSA 5CSHA 4BIEA 2V22A 3LFBA 3R1SA 4FSTA 3VS7A 1LEWA 3F5GA 4BCNA 5A6OA 4BYIA 4BVUA 1IR3A 4O91A 2PVRA 5A4LA 4FNXA 5CALA 4JMQA 4MH7A 5E8VA 3FYJX 4YUQA 1ATPE 4NM3A 3UZRA 3OS3A 3HV4A 3O0GA 5I9UA 3SD0A 4ACHA 3PVBA 3QKMA 1OZ1A 1FGKA 4JBQA 4EBVA 3F5XA 3AT3A 4D4SA 2R3MA 3U51A 3VQUA 1XMMA 1H27A 5AP7A 2FH9A 4U43A 1QL6A 2B55A 4I5PA 4MBLA 5DA3A 3WZKA 3ERKA 1U54B 3BGZA 2ETMA 3BU3A 4IZYA 4S34A 5L2IA 2GQRA 3W0NA 4DF3A 3QX4A 4RA5A 2V5QA 3DPKA 5D7VA 4ANOA 3CD3A 4RIXB 2JDOA 4X3FC 2VWWA 3O50A 5CSXA 3DLZA 1K9AA 3D5XA 5A4CA 4RJ5A 4J95A 4LOQA 3UDTA 4OW8A 5D7AA 3POZA 4LGGA 4QMUA 5HX6A 1NY3A 3R8ZA 4O0WA 4OTHA 5IA3A 4X2GA 4RX9A 3GCPA 2ONLC 5LMAA 1OGYA 2I6LA 4IAKA 3SVVA 1OL6A 2W4OA 2UW4A 1V1KA 3LFAA 1TKIA 2X0GA 1PJKA 3L8SA 2C47A 3LE6A 2FVDA 2GNLA 3A7FA 2PZRA 5TKDA 4CTBA 1NVRA 2Z7QA 4IW0A 3IOPA 4O86A 3MVJA 1JSVA 3GEQA 3W0PA 3HP5A 1GNGA 1H0WA 4KBKA 4U6RA 4P5ZA 2CHLA 3HP2A 5A4QA 3TUDA 3CPBA 4DEEA 2YCRA 4G9CA 3DK6A 1J1BA 3TV4A 1P14A 1YWVA 5EHOA 4DH5A 1R0PA 2VRXA 4IM0A 4RMZA 2QG7A 4BI0A 3NRMA 4NW5A 1OGUA 3ORLA 4YJOA 5KE0A 4BCHA 5A4EA 2C3IB 5A4TA 3A99A 2PULA 3M1SA 5E8YA 1E9HA 3ET7A 2VWZA 4J8NA 4KSPA 1FVTA 2CGWA 3UE4A 4DEBA 5FUTA 2F57A 3Q6WA 2CCHA 3DXNA 3ZS5A 4HGSA 4UMQA 2CNUA 3Q4CA 4KRDA 1CSNA 2GNHA 3W1FA 4RBLA 3ZSHA 3QZGA 3IPHA 4C8BA 1NA7A 4BDJA 4R77A 4WNOA 4FTAA 4Z16A 3UIMA 2H34A 3PXYA 4KIKB 4N6ZA 2IWIA 4C02A 3O17A 1DI8A 4KA3A 2GSFA 3P7BA 3CR0A 4BJJA 4EEVA 2C6LA 4RIWB 4AS0A 3EWHA 1MRYA 4O7LA 3RNYA 3PJ2A 1HCLA 5AP3A 3GU7A 4FT3A 5K4IA 5HTCA 4QRCA 1KE8A 4AF3A 4O7NA 3GBZA 5CU3A 2AEGA 4FZ7A 4Z3VA 3F61A 1KE9A 4FTUA 4EH8A 4GT4A 3BU5A 2J0MB 2CN8A 2X2MA 1UKHA 4QYEA 4ZTQA 1WBWA 4CEGA 4FICA 5HICA 4GT3A 2ZB0A 1YQJA 3R2BA 2XNNA 4JS8A 4QP3A 4IWPA 5IMXA 3FMMA 1FQ1B 3UQCA 2F49A 2ITVA 3Q5ZA 5TF9A 2BROA 2YFXA 3VUGA 5M53A 4O7VA 2VTLA 1U5QA 4CVAA 3KC3A 3AC1A 2XARA 3W33A 2JIVA 2V55A 5CVFA 3I81A 2DYLA 2J7TA 4WKQA 5EQEA 5LXMA 3UQGA 3HGKA 3OXTA 1VEBA 4PDSA 3VS6A 4B0GA 1A06A 4D0XA 4U81A 5LWNA 3W0MA 4DGGA 5L2SA 4OT5A 3FDNA 4DH7A 4XUFA 4DCAA 1XR1A 3PZEA 4PPBA 2QOQA 3FZRA 4FK3A 3GCUA 3HRFA 3PRIA 1O6LA 2X6DA 3W2OA 2OLCA 2QKRA 1ZRZA 2IW9A 1OL5A 2P2HA 3MFSA 2BHEA 1ZMUA 4W4YA 1XKKA 4O0XA 4PRJA 4UWBA 2JC6A 4NU1A 3TJDA 2PHKA 2P33A 3NAYA 4RVKA 4PUZA 5HU3A 5KX8A 1JSUA 4GS6A 2QOHA 2XYUA 1XHAA 4LV8A 4QYHA 3E5AA 2XMYA 5BVEA 2A2AA 2Y7JA 4NJDA 5FDPA 1PXLA 2XEZA 4PX6A 4ZTHA 3NNWA 5BVDA 5CEMA 1ZAOA 5EKNA 4CG8A 4U41A 2WTWA 4RZWA 3OWLA 2IZUA 3O96A 3F7WA 4ZJJA 4S31A 3I7CA 4ACCA 4MF0A 4RWLA 3QKLA 3UNKA 3F9NA 5EDQA 5BPYA 3P1AA 3FZOA 4ANQA 4RX8A 4G3EA 5HO7A 3NS9A 1PXIA 3QCSA 4M97A 2ITWA 4U45A 5KKRC 1E1VA 1GY3A 2GPHA 2EB3A 4TZRA 1ZYJA 3TM0A 2H96A 4GMYA 4CV9A 2NYAA 4QMPA 3BHHA 5CEQA 4QTAA 2B9IA 4BDKA 2ZV8A 5CF8A 1FVRA 2VU3A 5C01A 3QQKA 3PE1A 1Q8UA 2OJGA 3ANQA 3G90X 4RIOA 4F6WA 4UMPA 2Q83A 2VGPA 4EC9A 1KUTA 5DH3A 3D5UA 2HZ0A 4X2NA 1ZY5A 3T9IA 5HLNA 5F4NA 4QDEA 5JK3A 5DWRA 2R3PA 3QZIA 1KE6A 4NH1A 2F2UA 4BI2A 4YURA 5M57A 4ZSJA 3TUCA 2XK4A 2VWBA 5I9YA 5AEPA 5KHWA 4DE4A 3L9MA 3S4QA 2JDSA 3HEGA 3SW4A 5E4HA 2PMNX 3C4WA 4XG4A 5AADA 3UVRA 3AD5A 4FR4A 3KB7A 5AR3A 4Q9SA 4FKIA 3TL8A 2XNBA 3NIZA 5EQPA 4M0ZA 2JKOA 3R7GA 2B52A 4DLIA 4KINA 4U0IA 3FI3A 4O4DA 4LG4A 3OHTA 3OCSA 2X1NA 4MNFA 4EORA 5DVRA 2PMIA 3FMKA 3W0OA 2JIUA 3LOKA 4AE6A 4QD6A 5J7HA 2UZOA 2Y8OA 4FZAB 1BKXA 1YRPA 2GHLA 3VN9A 2GNFA 3NVMB 2O64A 4AG8A 5F9EA 3ACJA 3QD0A 5J5TA 4F7JA 4IADA 5JZJA 4BI1A 2UW8A 3RWPA 5L8JA 4XG9A 3QCQA 5K4JA 5M4IA 4DEIA 2FB8A 4TNBA 3LJ1A 3QTSA 5CU6A 2HAKA 5JZNA 2J2IB 2IZTA 2WEIA 5I0BA 2VNYA 3DQWA 5JH6A 5L8LA 2ITUA 4FZDB 4FKSA 2R9SA 3Q2JA 5CNNA 2WTDA 2X8DA 2I40A 2R7BA 1WVXA 1YOLA 3GC9A 3MDYA 4PWNA 2OG8A 4YNOA 3VRYA 4EHVA 4O7YA 1B39A 3SOAA 4F65A 2CGXA 3U6IA 1OL1A 4EH7A 3RPYA 1YDSE 2HOGA 3HZTA 3MYGA 3H10A 1MRVA 2E9VA 3E63A 2WB8A 4GU9A 4IFGA 4ZTNA 4FSYA 3THBA 5CU0A 5HLPA 1H08A 1WZYA 3LIJA 4GUEA 2OU7A 2Z7SA 1XQZA 4BZNA 3IDPA 4GYGA 1OUYA 1XH5A 3ALOA 3C7QA 4QT1A 5AR4A 4UALA 3AC2A 4QQJA 4RQKA 3UO5A 5BVKA 3SG9A 4F63A 4D9UA 4YBJA 5GJGA 3MJ1A 3Q9XA 5IH4A 1QPDA 5A6NA 2ZAZA 4BDEA 2J6MA 1APME 3FHIA 5C4LA 1Y8YA 1M17A 2NO3A 4FOBA 1PXNA 3FY0A 3F69A 3KRXA 3NCGA 3VS0A 2BRGA 3EN5A 4CKIA 3QRTA 2LGCA 3DDPA 5HHWA 3KULA 4FSRA 2YIQA 4Y85A 1Q3WA 2XJ1A 4G3CA 4OGRA 1ND4A 2YITA 4R8QA 3LMIA 4AAYA 4EK6A 4AXDA 3R6XA 3E3PA 3IG7A 2ZM1A 4Y5HA 3FLZA 4AACA 1OBDA 4I92A 2QOBA 4RLKA 4X0MA 2ZDUA 4XG8A 3NCZA 4MHAA 3MY1A 3QYZA 2WMVA 4FT9A 3DB6A 1LPUA 4ZZOA 4Z9LA 3OCTA 2WTKC 2X0OA 5IQDA 1H01A 5IQAA 2W06A 4GVAA 3GENA 4CMTA 4NKAA 3GQLA 5BYZA 3LQ8A 3O23A 2XF0A 3O8PA 3Q4ZA 3C4EA 2PU8A 3TWJA 3GOKA 4CYIA 4DFZE 3ZC5A 1OI9A 2GHGA 5BYYA 3ROCA 3HL7A 4BDDA 2FA2A 3V5QA 1J91A 2HZIA 5M4UA 4WUNA 5T3QA 2QQ7A 3HLLA 4J99A 3H3CA 4XV1A 1YWRA 2Z7LA 4BC6A 3BWFA 3RAIA 4NFMA 3CE3A 4AZVA 1FMOE 3TT0A 1WBTA 3D9VA 2C1AA 1W0XC 3FY2A 4L6QA 3F3UA 2FO0A 4AP7A 3EZVA 3QTIA 4YHJA 5IH5A 1FBNA 2C6OA 5ETCA 3SG8A 4O81A 3N4UA 5JFXA 3I5ZA 4UXLA 4EOSA 3CIKA 2HCKA 5L2QA 4K2RA 2VTTA 3BYVA 4I5MA 3VONA 1JBPE 1P5EA 1Q4LA 3P08A 2ESMA 3PXRA 2JD5A 4X21A 4EUTA 1TVOA 4F4PA 2WELA 3HAVA 2XBAA 1ZXEA 2WMUA 3FXZA 4DHIB 4LMNA 2XNMA 1ZZLA 4C4JA 3PE2A 4E6CA 3CLYA 5HD4A 3IGGA 4QMLA 5A46A 4WD5A 2VX1A 3KMMA 3KXMA 5FTGA 1IA9A 1XBCA 2IVUA 2XIYA 4FKUA 1PXJA 3MVHA 3Q53A 4QO9A 4PMPA 4C2WA 1H1RA 2IW6A 2XAMA 2EXEA 2ITZA 2YCFA 3IO7A 2HZ4A 3F3WA 1A9UA 3VUTA 5KMOA 4QP7A 3UOLA 5FXSA 5AAGA 4FSUA 4PP9A 3V5TA 3VHEA 5BYLA 2JLDA 2CKQA 3EH9A 4N70A 3QZHA 3UYTA 4AXAA 5IMEA 4PMTA 2PTKA 5DLSA 4YGAA 3LFSA 5E8WA 3VUKA 4E6AA 1KOAA 3KK9A 1O9UA 2DS1A 1PMVA 3CJGA 5A9UA 3LXNA 4XBUA 4CCBA 4HGEA 2G9XA 3CY3A 4AT4A 2Y4IC 4EC8A 3GXLA 4JQEA 3RKBA 2BUJA 3P79A 2YDKA 1H4LA 3DTCA 3QRJA 5AV4A 4XP0A 4CZYB 2W1GA 3V5PA 4BL1A 5CYIA 2J51A 3DQXA 4FTIA 4JQ7A 4IFCA 4E26A 1PRYA 3E8CA 2YIWA 2HELA 3QYWA 1PY5A 4BTKA 4E4XA 3UOJA 5FBNC 4WNKA 2QVSE 1P4FA 1X8BA 1PXOA 3BZ3A 4JIKA 2WIPA 4BFMA 3VW8A 4FVQA 5G6VA 4AGUA 4LM5A 5JQ8A 4CKRA 3HUBA 2YLEA 4ZSEA 1BL6A 2PMOX 4EZ7A 2REIA 5CT0A 3P78A 5AV2A 3CEKA 3NR9A 4GJ2A 4DFXE 3EOCA 4Y83A 3ZFYA 4A07A 2R3OA 5HVKA 4FV6A 3C9WA 4FTQA 4FIGA 4OBQA 5J9YA 1Q97A 4GW8A 4MQ2A 4O4BB 1PHKA 4EH9A 3TV6A 4IX4A 4L53A 4CMUA 3FPMA 4NIFA 2XBJA 1H1WA 3QTWA 3UIBA 4G6LA 3TNQB 3I7BA 3W55A 3LLAA 5IQCA 3EQPA 4O7SA 4X7QA 4FK6A 4I6HA 2XNGA 3FMJA 3R9NA 2R3NA 3QFVA 2QO2A 2FYSA 2X9EA 4FGBA 4FTKA 3ORIA 4WA9A 1F5QA 3P7AA 4G5JA 3WF9A 4EKLA 5BV3A 3ORKA 3V5LA 4I1ZA 1GIHA 4XH6A 4D2PA 3EL7A 2JBOA 4USEA 4ANSA 2OW3A 2R3HA 5JMSA 2QCSA 4ZTLA 4CFWA 4Q5HA 4YC8A 1ZY4A 2GFSA 4TPTA 3IONA 3KL8A 3PY0A 4FSZA 1NXKA 2E9NA 1OM1A 3MTFA 4IZAA 4NSTA 1OB3A 1QPJA 4G17A 4O6EA 4RC2A 5CZIA 1NVQA 2RSVA 2YZAA 3E92A 3V6RA 1DM2A 5HBJA 3S95A 4UWCA 3CXWA 3LXKA 4DH8A 1U46A 5FG8A 4FG7A 4EK3A 3UIUA 2Y0AA 2F4JA 3TMOA 3AOXA 3KN6A 4CT2A 3IW6A 4Z7HA 3BHVA 4FI1A 3LCOA 3S00A 1U4DA 2J0JA 3PP0A 4AOJA 2PSQA 4X2KA 4GSBA 4NTTA 2XYNA 3OY1A 1G5SA 3ZO2A 5BUIA 2BKKA 4AZSA 2QURA 1UV5A 2XIRA 4C4FA 3F3VA 5CF6A 3RJCA 3DFAA 2FSMX 3MN3A 3A61A 4XLVA 2Q0NA 2VAGA 3HMOA 3LZBA 4IX5A 3SOCA 3OTVA 3B8RA 1OIRA 4DEGA 2UZWE 2JITA 2XRWA 4BB4A 4R78A 2WOTA 3DA6A 4FV0A 2BTRA 3IS5A 4FKWA 4EH3A 5L2TA 3F2RA 3CD8A 3DS6A 4IJPA 3ZFMA 3QX2A 2B0QA 3AQVA 4KRCA 3RCDA 1F0QA 4QMZA 5IEVA 1QMZA 4BCKA 4NKSA 5FTOA 3MH0A 3PLSA 1YXSA 3PP1A 4BCGA 5IDPA 3A2CA 4USDA 5HQ0A 5AAEA 5BUEA 4FV8A 4OTQA 3AGMA 3ZEPA 3WYYA 4AE9A 2ITOA 5CLPA 1YOJA 2WMSA 3MBLA 4BWPA 4H05A 5EI6A 3FMHA 4IAZA 2XRUA 3OEFX 3HECA 2CPKE 1ERKA 3T3UA 4RWJA 5EW8A 2W96B 4A9RA 2G15A 3A4PA 4M69A 4ORKA 4CTCA 4KS8A 4IAYA 3R73A 4FSMA 4MXAA 3FPQA 3QTUA 4R3PA 3BBTB 3AC5A 3JS2A 2CDZA 4K6ZA 2W1CA 4RWIA 5DN3A 5HESA 5LVLA 4KKEA 2NRUA 4YJQA 2VTJA 3I0QA 3Q04A 3F3TA 3V5WA 5L8KA 3P0MA 5D10A 1G8JA 3IQ7A 2BRBA 4LOPA 5IA2A 2EXCX 5FRIA 4F9AA 2BKZA 3OTUA 2QI8A 4E7WA 4LRJA 5ETFA 3QA0A 4A7CA 4EQCA 3NYNA 5EI8A 3QTXA 3LHJA 1YHSA 3U4WA 1OPJA 4V04A 5AM7A 4F0GA 4HVIA 4Y5QA 3COHA 4OR5A 4BICA 2W5HA 2OK1A 3BPRA 3DKCA 2OI4X 4YO4A 3OT8A 3VS3A 1CMKE 5AX3A 3Q9ZA 5DFPA 2Y4IB 3RHXA 3UJGA 2IN6A 4J71A 2PVKA 3VS1A 2GDOA 3KN5A 3UDBA 4WSYA 5KMJA 1IA8A 4MUQA 4EYJA 5I5ZA 5DMZA 5KZ0A 3D2KA 2OBJA 4FKOA 4DINA 4WHZA 4OTWA 4FGRA 3CGOA 3PPJA 4XRJA 3QGYA 3H0YA 2BZJA 1GZNA 4UN0C 4WT6A 5ANKA 3G9LX 3I79A 2QR7A 2YIYA 3MPTA 2X39A 4DFBA 4ALWA 3SRVB 3O71A 4XV2A 2JIIA 2CJMA 4RJ8A 4FEWA 3ZLXA 4FG9A 3ZXZA 2PYWA 1RW8A 4NZWB 5DGZA 1CTPE 4PL5A 4TW9A 5LARA 2X8EA 3T8OA 5BVNA 4DGMA 4QMNA 4X2FA 1YDRE 2C5OA 4E73A 4FSQA 2R2PA 3FZSA 2XIXA 4HJOA 4UZHA 4WOVA 3RK7A 3KGAA 2PE2A 3KXHA 2ZB1A 4G3GA 4QP2A 3UODA 2C3KA 4IB1A 4R3CA 2V0DA 2C3LA 1PKDA 3GC0A 4FC0A 4F78A 2VUWA 1UVRA 3IGOA 3OMVA 4M15A 4XOZA 3G51A 3WF6A 4CQGA 4F7LA 4BDCA 4R7IA 3LFNA 5AJQA 4F1OA 3IK3A 4O4CA 1RDQE 2O5KA 1KV2A 2C1BA 3DK7A 4RZVA 3WIKA 4QPMA 4IDTA 4FT5A 4TYHA 4QYFA 4MCVA 4RX5A 3L1SA 5BVOA 3GQIA 3JYAA 1NT2A 3RZBA 1J7IA 3JY0A 4NT4A 3I6UA 4ENYA 4RVLA 3NYOA 4QTCA 2AUHA 3FKOA 3T3VA 2W9FB 4XG3A 4TWCA 2HXQA 3EN4A 1F3MC 1R39A 4HGTA 3G33A 5J9ZA 4TXCA 2RFSA 2WEVA 4QTDA 4BGHA 4S32A 4MNEA 3PVGA 5AIRA 3PXFA 4BCFA 4DT8A 2RKUA 2JDVA 4U97A 1Z57A 4EZ5A 3W2CA 5EG3A 4CZTA 1FOTA 1YW2A 2X7OA 4PL4A 4YJUA 4BDAA 3G15A 5GJDA 4CFUA 4O7TA 2J90A 2VTMA 1XWSA 2BIKB 4FIIA 3D7ZA 3H4JA 5ACKA 3TKHA 1IAJA 4O0YA 3GP0A 3VULA 2VWYA 5CANA 5IQFA 2J4ZA 5DEYA 3UMXA 1XMLA 5CXHA 4I5CA 2BALA 4A4OA 4W4XA 5CY3A 3RVGA 5CU2A 3MA6A 1ZLTA 3SHEA 2PPQA 4EI4A 2GU8A 4FV2A 3PTGA 4IHPA 4RVTA 2OXXA 4F09A 3VHKA 2QLUA 4ZLOA 4FSNA 4C34A 3EN9A 3PLAE 1BLXA 3ZO3A 2PL0A 3KVXA 4H1JA 4XP2A 4I4EA 5IQIA