3P1AA

Structure of human membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase myt1 (pkmyt1)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
287
structure length
281
Chain Sequence
QLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human Membrane-associated Tyrosine- and Threonine-specific cdc2-inhibitory kinase MYT1 (PKMYT1)
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Membrane-associated tyrosine- and threonine-specific cdc2-in
total genus 85
structure length 281
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p1aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p1aA01
3TG1A 2O5KA 3GC9A 1OPLA 5BNJA 4EOPA 5BPYA 3O50A 4ZOGA 2WOTA 2Y6MA 4IH8A 4NEUA 5J7BA 2CGWA 1WFCA 2UZDA 3QKMA 3SDJA 5CEQA 2YIYA 4ZJJA 3EMGA 2YABA 4RFMA 5DH3A 4DGNA 2G2IA 4L43A 3R9NA 5JSMA 5BX0A 2XNBA 1GZ8A 4O83A 4JG6A 3MDYA 4S30A 3AXWA 3VQUA 3RHKA 1ZZ2A 3ALNA 3F5GA 4FIFA 2OJGA 2ZV9A 4XV9A 4W9XA 2R4BA 3UGCA 3REPA 4YBJA 4YJPA 5H8EA 3TN8A 2CKOA 5E8YA 2ZMCA 4BI1A 4KIOA 2BHEA 2FSMX 3TUBA 3N4UA 3O71A 3L8SA 3AC8A 4GFOA 4O82A 2JIUA 4N0SA 5D11A 5J87A 3QUDA 1KE8A 2XYUA 3KRLA 1Q8WA 2QG5A 4R77A 1UNLA 4E4LA 5LVNA 2VO7A 3IW4A 3GOKA 4EJ7A 4PX6A 1OL5A 2LGCA 2QU5A 3TZ8A 4L68A 2PHKA 3H3CA 4NJDA 1URCA 2EXEA 3FHRA 4CZYB 1KUTA 5CQUA 4PDYA 2X39A 3PP1A 2YDJA 1JQHA 4EKLA 4XHKB 5DLSA 3ZRMA 3UC4A 5DFPA 3L9NA 4R1YA 1L3RE 3TV6A 4ZS4A 3EN9A 3ZEWA 4YZNA 4ZMFA 1GZNA 5HU3A 5DWRA 3FMNA 2JLDA 5JFVA 2WQNA 3QYWA 1PXNA 3BU5A 4EH5A 3CC6A 3G51A 4MXCA 1GZKA 3FXWA 2X0GA 5CSVA 2W5BA 3ZO2A 3KF7A 3ZO1A 4OW8A 3TKUA 3II5A 4D1ZA 3R8ZA 4ONAA 4FA2A 3OF0A 3PJ2A 3DU8A 3SLSA 5BVOA 4DGOA 2QOFA 5IDPA 4P7EA 4RVLA 3VN9A 2RGPA 2RG6A 4JRNA 4H39A 3EQHA 3BV2A 3EFLA 4V05A 4K1BA 4GH2A 5DT3A 4UY9A 3MPAA 4JX7A 4P4CA 2VTTA 2YM7A 5F20A 5C8NA 4CMOA 3Q96A 4GUEA 1JKSA 2VO0A 4O0WA 2UUEA 5DE2A 1OMWA 5EDPA 2OJJA 4UMRA 4G31A 4FG8A 2QVSE 1CKIA 2F9GA 2YM6A 5HG9A 5C01A 4E26A 4CYIA 4M7IA 5KZIA 2WMQA 3TIZA 2J50A 2QO9A 3OW3A 5AX3A 1H1RA 2UZNA 2X6DA 3I0QA 4IJPA 3FY0A 3QU0A 4IAFA 3RMFA 3VRZA 5CEIA 3QF9A 5F9EA 3FMHA 2WQEA 4J8MA 4JVGA 4H1JA 1Q24A 1FVVA 3GUBA 3TM0A 1SYKA 5CI6A 1SVGA 4LL0A 2G2FA 4QP6A 1YI3A 3KCFA 2YZLA 4YZ9A 4XNEA 1RQQA 4NM0A 5DIAA 2PZPA 3UBDA 1FMKA 1FBNA 4GCJA 2JKMA 1OUYA 3FYJX 3Q5IA 3ZM4A 4WHZA 4EQUA 2BVAA 4XLVA 5ANDA 4YTCA 4USDA 2VO6A 4O96A 3PXZA 3MI9A 3GU8A 3S00A 2G01A 3FLWA 2OXDA 3ZLYA 3HMNA 4RFYA 4X3FC 5HO7A 3LFDA 3EN5A 4FEWA 3DBQA 3R7UA 3W32A 5I9ZA 5JGBA 1QCFA 2VNYA 2WU6A 4FT3A 4L3PA 3G15A 5TF9A 1XH9A 4JDKA 4ALUA 3VW8A 4AW1A 1G8AA 2ETRA 4IFCA 4C0TA 3A61A 1F5QA 3BU6A 4U41A 1V1KA 4AAAA 4ZSAA 3OTUA 5HESA 4O21A 5F1ZA 3ZFMA 2PVHA 1Y57A 2NO3A 2OF2A 4D58A 2ETMA 3CP9A 3Q53A 3RNYA 3AD5A 4S31A 4WO5A 4XRLA 3H9OA 1DI8A 2QLQA 5FM3A 2E9UA 1Y8GA 2QHMA 2VTLA 3FQEA 4FV7A 4QPSA 3OWPA 5BVEA 5CENA 1Z9XA 4CFMA 3R9RA 4RJ3A 3H0ZA 4ARKA 4ACCA 4GRBA 2YISA 4M97A 3TTIA 3PY3A 1UV5A 3ROYA 3CTQA 5HLWA 4DTBA 1YQJA 4TYHB 4YZBA 5CAPA 2IO6A 2I0HA 4J95A 4BRXA 4FTOA 2GHGA 5LVLA 4ANBA 1QPJA 1MRVA 4Y85A 5FDXA 4FBXA 2B4SB 4GYIA 4W4XA 4AOJA 2CGVA 2I1MA 4GK2A 5LMKA 3ENMA 5E1SA 2X2LA 3A4OX 3QTRA 3FL4A 1EH4A 5EYDA 3AD6A 4EH4A 5AAGA 4BDHA 2OXYA 2Z7QA 4E7WA 2ZM4A 5AR5A 1H28A 3ODYX 3K5UA 1YXSA 5C8MA 3RWPA 3R2YA 1H1PA 2HXQA 2P4IA 4BGHA 2J90A 2ZAZA 3PG1A 3QD0A 4FMQA 3S4QA 4DLIA 3GEQA 3R01A 4G3GA 3UNKA 1CDKA 5AA9A 3AC1A 2CNQA 3OTVA 3DBCA 1JKTA 2X1NA 3F5UA 3E92A 3OUKA 4R6VA 4GYGA 4H36A 3DBFA 3SG9A 1TVOA 2FSTX 3IW5A 4GFMA 3QFVA 4JIAA 3K54A 5DR6A 1UNGA 4O81A 1RE8A 4CEGA 5FTQA 3BYSA 4QP1A 3TJCA 4E5BA 4QMUA 3O7LD 4EWHA 5CU0A 4AG8A 1U46A 3HKOA 1RW8A 3OWLA 2ITTA 2IW8A 2OG8A 4WNMA 4B6LA 4ASZA 5HORA 3UMWA 3NAXA 4BB4A 1GIHA 4H05A 5T3QA 1BMKA 4CFVA 1X8BA 5I4NA 4QP4A 4ZLYA 1G5SA 5M4CA 3VBYA 2UZLA 1WBWA 4ITIA 2WO6A 4TY1A 4Q2AA 3ULZA 4QTEA 4F9YA 4DBNA 1OM1A 2GPHA 2R3MA 3QCQA 4KABA 1K2PA 2VWIA 2BROA 3C4WA 2O2UA 2VX1A 2BZKB 4ALWA 2PMIA 4Y5QA 5I9WA 5DBXA 4EONA 1XBBA 5FP5A 3W2OA 1APME 2QOOA 5D7AA 4WA9A 3W1FA 4IM2A 4F99A 3HAVA 3Q4TA 3MY0A 1Q8ZA 3VVHA 2ITVA 4C02A 4IB0A 2JDSA 2VWUA 5IZFA 2W05A 3RM6A 2F4JA 3AT3A 5D9HA 3KVWA 3EHAA 4AW5A 4O0RA 3VNTA 1R3CA 3JYAA 1GOLA 2YM8A 4AGUA 4RMZA 4QMLA 3CY2A 4YURA 5J9YA 1KE6A 3RJCA 5AM6A 3C4ZA 4YZMA 3ZONA 4O1OA 4ZSLA 3EZRA 1JWHA 2VTPA 3GT8A 1FINA 4AN3A 5FUTA 2OU7A 2RKUA 5HBHA 3MESA 4AZTA 4J1RA 4D9TA 3LCDA 3GP0A 2UVZA 3FMMA 1ZY5A 1YWNA 1OITA 3D5XA 3EZVA 4L9IA 3AT4A 3FZRA 4FSNA 4FUYA 3R1SA 2ACXA 2WQBA 4JAJA 4FEVA 4DFBA 4WRSA 1HCLA 2HZIA 4APCA 2YIXA 4CFNA 4OBOA 3NCZA 3GVUA 3LOKA 1RDQE 4HYSA 4FSMA 2GS2A 3SD0A 4CV8A 2X7GA 3AMYA 2XBJA 1H0WA 4NIFB 4N4SA 4G34A 1UVRA 5AUVA 3R0TA 5FQDC 4BBMA 1WBOA 3NUYA 2Z7RA 3KF4A 3DXNA 3L8XA 4I4EA 3QUPA 4KWPA 3UP2A 1BI8A 2GCDA 3BGPA 5KBRA 4J96A 3O8UA 3R7YA 1YOLA 2A27A 5LARA 3ACJA 3QL8A 2I40A 4KNBA 4IAZA 4BDBA 1K3AA 4YMJA 5IQFA 4ZXTA 4FV3A 4O0VA 3U55A 3PJ1A 3VUTA 3BHYA 5EFQA 4EZ7A 1QL6A 4YC3A 5TT7A 5IU2A 1XH8A 5M56A 4ANMA 4W4VA 5DGZA 1J1BA 1PY5A 2XYNA 4I23A 3W10A 2VN9A 2W7XA 1JSVA 4GKHA 2X2KA 4BZNA 3KXHA 4DFZE 3QQUA 1LUFA 3QGYA 2UW0A 4JQEA 4UWBA 3A60A 2QR7A 2WTWA 3FZPA 5D41A 3UIMA 3UNJA 3VJOA 5IQAA 4L45A 4OT6A 4GIHA 5DPVA 3TXOA 4EORA 1U54A 2JD5A 3FI2A 4XH6A 4YLLA 4XV3A 5LWMA 5JK3A 4XOZA 2UVXA 4U6RA 2QOLA 4Y72A 2FB8A 3E63A 3QZHA 1ZOEA 2YAKA 4L8MA 3ZC5A 4XOYA 3PRIA 3WF7A 3LQ8A 3R73A 4X6RA 3ZMMA 5AR2A 5KE0A 5K0KA 5CTPA 3BHHA 5EYMA 4K8AA 2ZV7A 1OECA 3LQ5A 3ERKA 4NFNA 3V8SA 4I5CA 2W1FA 3E5AA 3DDPA 4IAKA 3W18A 3WF8A 3IW7A 4EOOA 3NNXA 1H24A 2XJ0A 5J9LA 3RM7A 3UPZA 4I5MA 2ZDUA 3AOXA 4WNPA 5IQBA 4ORKA 4CZUA 1WCCA 1Q3WA 2QOIA 2F57A 2XEYA 4IWQA 4P90A 3TTJA 5HNIX 2IZSA 3KULB 1H27A 3L8PA 3PSDA 4MNEB 4X2NA 3F69A 1R39A 2HK5A 3QCSA 5AUWA 5CLPA 5CU4A 2XIZA 3RPRA 3JXWA 4I24A 4PTEA 5HBEA 3MH1A 4UX9A 3BLRA 2UW5A 4D2SA 2XH5A 3PWYA 3EFWA 3OOGA 3P1AA 3C5UA 4U44A 5HG8A 2PZYA 3FBVA 2WMUA 4HVHA 4XCUA 2EU9A 4XJ0A 4DEBA 4DG3E 4O7LA 4JT3A 3CQWA 3RK7A 2GNFA 5H8GA 3R1YA 1B38A 2C6OA 4HCTA 4TXCA 3UIUA 4QTDA 1PKGA 2OJIA 4IE9A 4RC3A 2YM3A 4UMTA 4FZ6A 5CZHA 4I5HA 1WZYA 2RFDA 5M53A 3UJGA 4ANOA 4GVJA 4J53A 2NNWB 3CKXA 4QMZA 3EQPA 1I09A 3OCSA 4ASEA 2I6LA 4BCIA 4QMQA 2RIOA 5F95A 5JRQA 2WEVA 3BX5A 1YVJA 4MWHA 5CASA 3QZFA 4W4YA 4CZTA 4Y46A 5CSXA 5FTGA 2G2HA 1KV1A 3DFCB 1FOTA 2W5HA 4MNFA 5CNOA 1W98A 3BLHA 4BGQA 4X7QA 3PYYA 2OKRA 2KULA 2IW9A 2PYWA 1YRPA 4ENYA 3W33A 2XZSA 5EHLA 3BWJA 4L3JA 3FI3A 3R1NA 4C61A 4AA0A 2C68A 3QC9A 4GW8A 2QOKA 5B2MA 4ACMA 2BRHA 3HUCA 3T9IA 4CQGA 4MWIA 3TUCA 1YDTE 4NU1A 4V0GB 5C26A 1JSTA 3PXYA 2Y4PA 1WBSA 2XIYA 3KRJA 4TNDA 5LJJA 3L1SA 2I7QA 3LFAA 4AFJA 5EKOA 3LJ0A 4C2WA 2JIIA 4IAAA 3ZUUA 1J3HA 1L8TA 4AWIA 5AP7A 4PP9A 4U8ZA 3FWQA 4YZDA 2Y9QA 2UW9A 4AN2A 2WB8A 3NIZA 3CD8A 3V5LA 2UZTA 3R21A 4WNOA 5IUIA 3CPBA 2B53A 1R0PA 2C3LA 3LJ2A 2DUVA 2WEIA 5FTOA 5TO8A 1PJKA 5AR3A 4HPUE 5E91A 4K0YA 3R7IA 4EOQA 3VAPA 1H1SA 1WAKA 3ZHPC 4BN1A 1PF8A 4NWMA 2XKEA 5JFXA 3MVHA 3D15A 4AS0A 2OFVA 3NVMB 4U43A 4TWCA 4FUXA 4E20A 4IC7A 3DKCA 5AX9A 2O3PA 3FEGA 3FSKA 3NLBA 3NGAA 2CLXA 3PXKA 2B52A 4KKGA 1NW1A 4F0GA 1H26A 3SXSA 4RLLA 4F09A 2PUUA 4K33A 4CNHA 5FEDA 1STCE 4DN5A 5IQDA 3CTHA 1UNHA 4EL9A 2ZV2A 2C3IB 4LMUA 1TQMA 5AJQA 3WOWA 5GZAA 3OXIA 1XH5A 2FSLX 2W5AA 4U40A 4GVAA 3HP5A 3LFSA 4S33A 1ZWSA 2H96A 2YM5A 2XIRA 4D2PA 3BHTA 3TUDA 4NKSA 4BIDA 2W1HA 4FV8A 3HRCA 4AQCA 3NMUF 3AMBA 3PLSA 4G6LA 4Q9SA 4QQ5A 4PNIA 5FBNC 2WTJA 4B8LA 4C37A 3Q4ZA 3JVSA 3LFFA 5HNGA 4ZY5A 2X4FA 3HDNA 4PL4A 3VUDA 3ZEPA 1UWJA 5AUTA 3EN6A 2ITNA 5I9UA 2CKPA 3E7OA 4ZIMA 3BQCA 3HL7A 3E93A 4KIQA 5A4TA 4EK4A 3HV6A 3LFNA 4YC8A 2R3GA 5L6WL 2HXLA 4E93A 3ZS5A 4PTGA 3CS9A 4J98A 4R8QA 3SW4A 3ORXA 1JKKA 2IZUA 3D94A 3DB6A 4KINA 1OPKA 3VHKA 5ANGA 2ZJWA 4JG8A 4PRJA 3TV4A 4ZJIA 5KMNA 2VTIA 1FPUA 3OY1A 4M84A 4UXQA 5CSHA 3C4EA 4NKAA 5CT0A 3OZ6A 5HZNA 1V0BA 2R3JA 5EM8A 3E8NA 3ORZA 3GU6A 4GU6A 3QQJA 5I3OA 2WHBA 3O8PA 5BUEA 1ZMVA 4BBEA 4FTQA 3GENA 4D4VA 4U7ZA 4YP8A 3VBQA 4E6DA 4EI4A 4HVGA 3C4CA 4TYJA 1M52A 1M7NA 2WGJA 2Y8OA 5HICA 4FKLA 4O22A 3P5KA 5KNJA 2IZTA 3DGKA 4RC4A 3OS3A 5DVRA 5C03A 4I6FA 2PU8A 4PPBA 3DZQA 2GS6A 3FAAA 2PUIA 4RIWA 3QHRA 4M15A 5IA5A 1DS5A 2NRYA 3C4XA 3PUPA 4FC0A 3FMDA 4HJOA 4JBOA 4O91A 4OTRA 1YXXA 1OIQA 2BHHA 3BKBA 3MH0A 3TI1A 3GOPA 2VTNA 1Z57A 1ZZLA 3D5WA 4XMOA 2BUJA 5D10A 5JH6A 2XNEA 3F3WA 2PVLA 4E6QA 5JMSA 2FVDA 2OIQA 2RG5A 5M09A 4EYJA 5D1JA 4MD7E 2C6EA 2E9OA 4FIJA 2CSNA 4TYEA 3MBLA 2HYYA 4P5QA 4J8NA 5K0XA 4OLIA 4AT3A 4CKRA 3TZMA 3SHEA 1NY3A 1CKPA 3ORIA 3PE2A 4TYHA 5AP3A 3VUHA 3UG2A 4GMYA 4W4WA 3RCDA 3JY9A 1TQIA 4D2TA 5JZJA 2WMVA 1Q97A 3VS0A 3CQUA 2P33A 3C7QA 4D28A 4RFZA 3NCGA 2FGIA 2RF9A 4B9DA 2ITWA 2UV2A 4BDAA 2VU3A 3I4BA 3KL8A 2EWAA 1XJDA 3MFSA 1JSUA 3BU3A 4UMUA 4XP3A 5AIKA 5T68A 4FZ7A 3SV0A 5AUYA 4C7TA 4DFNA 4CFWA 3W2PA 2XJ2A 4MQ2A 5CSWA 3VW6A 5IMEA 2X2MA 2OXXA 5CEPA 2GTMA 3LM0A 4I41A 3EB0A 3F88A 3NUUA 3TNWA 3RPVA 4BCNA 5GIPE 4EYMA 4ALVA 4TYGA 4JG7A 4HYIA 5K3YA 3TV7A 3ANRA 4AZVA 1YHSA 2Q0BA 4FNYA 4EH8A 3GFWA 3CEKA 4H58A 4LGGA 4RQVA 4X0MA 4EZ3A 2WPAA 4IX3A 4CSVA 2WQOA 2XRWA 3FMJA 3TZ7A 5KMIA 3H30A 4LMNA 2W0JA 1GIJA 4XRJA 2BAKA 2WIPA 3WIGA 2YDKA 3WBLA 4B7TA 4USEA 3EN4A 2PUNA 5E9EA 5E8XA 4BHNA 2GFSA 2OZAB 4FV4A 5BMSA 1Q8YA 1REKA 4RWLA 2J0LA 3I6WA 2PMLX 3COHA 3M1SA 1VYZA 1W0XC 2UW4A 3LXNA 3B2TA 3TCPA 1U4DA 1YW2A 3G2FA 4RA5A 5L8KA 5E4HA 4RIWB 3CTJA 4QMSA 3MH2A 4HVSA 3UQCA 3D14A 4YPSA 5C9CA 4AXAA 2R3OA 2PUPA 2EXCX 4U45A 3GGFA 5CVGA 5FXQA 3UOLA 4FE2A 4AX8A 3BBTB 5CU6A 4AUAA 1JKLA 1W84A 4QO9A 1P2AA 4EUTA 2C69A 3IW8A 3NX8A 3SW7A 5CF4A 3DY7A 3IK3A 3MA6A 4HPTE 2J0MB 3BIZA 4O7YA 3FUPA 5J95A 4CRLA 2PE1A 3FLSA 4ACGA 3ZSGA 3D83A 3R02A 3C51A 5AV4A 2GQRA 2RL5A 4BDIA 4O84A 3QRIA 2YAAA 3C1XA 4FVPA 4OTQA 3V5TA 4TW9A 4C3RA 2JFMA 2FSOX 4QMMA 3HA8A 4AOTA 3HA6A 4L00A 4M69B 3R7EA 2C0TA 2Y6OA 4P5ZA 4X2FA 5CXHA 4TPTA 2UW7A 2VTAA 4FZFB 4WKQA 4ZJVA 2OFUA 3QHWA 1GNGA 2OF4A 4YSMA 3S1HA 3WF5A 3FC2A 4OTIA 3QTIA 2YN8A 3KREA 4AACA 3IG7A 2YWPA 3FXZA 2VAGA 4TKSA 4BZDA 4PP7A 5KMKA 3P9JA 4OAUC 3FPMA 3TDWA 2XK3A 3EWHA 1W7HA 2CLQA 1CMKE 4K2RA 4UYNA 3DNEA 4R5SA 2O0UA 5JZNA 4NUSA 4UYAA 5FEQA 1QMZA 3TKIA 3V8WA 4BDDA 4NH1A 2H34A 1J7UA 3MFTA 2ITZA 4FV1A 2C6IA 3QALE 4I20A 2X9EA 4FODA 2WMXA 3NUSA 2GMXA 4I6BA 3HDMA 2IVTA 3CIKA 2BIKB 2F49A 2AYPA 4BVUA 3PZHA 1OI9A 3BZ3A 2WTVA 3CJGA 3MA3A 3NW5A 3NWWA 3ZFXA 4EH7A 2IW6A 4APPA 4D2RA 4TNBA 2C0IA 4MQ1A 4QQJA 5B2KA 5A4CA 3MJ2A 1ZY4A 2XKFA 2R0IA 2WTKC 3PWDA 4IHPA 4O0XA 2HW7A 3DK7A 3ZOSA 2YDIA 5ACBC 4HW7A 5LQFA 5GINE 1H08A 4D2WA 3TNHA 3RKBA 1OL1A 3ZU7A 2PULA 3UIBA 1R0EA 4UEUA 4JLCA 3RINA 3ZCLA 2C4GA 4PV0A 1XBCA 2C5OA 3P08A 2J0KA 4WUAA 4NSTA 4JRVA 3EL8A 5AUZA 3DBEA 2Z2WA 4HNFA 3NYVA 5AIRA 5A14A 3FI8A 4IAYA 3T3UA 3KN6A 1E1XA 4E8AA 4FEQA 2V5QA 3WZJA 3PA5A 3LJ1A 3MVMA 4FNXA 3LLAA 3QWJA 2ZB1A 5E90A 3MY5A 3I60A 5AADA 3MW1A 1IASA 2C6KA 5HTBA 2YM4A 4IC8A 3C9WA 3F2RA 5EHYA 4KBAA 5ETFA 2P2IA 2V7OA 3R00A 2J5FA 4ZMEA 3NW6A 4E5AX 3UZRA 4GT3A 3HRFA 5ANIA 4DCEA 2ZMDA 4GSBA 3KB7A 3H0YA 3RK9A 2PE0A 5K5NA 3IONA 3RTPA 2P55A 3NYOA 4KRDA 4I3ZA 2PVMA 3GU5A 3FMKA 4EJNA 4Q9ZA 5BVFA 5LVOA 2W1IA 3LFBA 4E5WA 4DH1A 5HG7A 4X3FA 2QU6A 2B9HA 3POZA 4EOIA 4FK3A 2F7EE 2VTQA 5E8VA 2PVKA 3FE3A 4FICA 1PMVA 2E9PA 4HZRA 4BWXA 1UU3A 2W1CA 3R6XA 3UG1A 2VTSA 5JFWA 4K9YA 5CXZA 4QYEA 2ITUA 2C3KA 3KXGA 4JOAA 3TJDA 3OWJA 3V5WA 1IAHA 4ZLZA 3MPTA 3WZUA 4ZY4A 2BAQA 4BDEA 3Q6WA 2Z8CA 3D2KA 3CSVA 5HVYA 4MNEA 3QUEA 3PVWA 4XG4A 3OEFX 2HOGA 2X7FA 3P0MA 3H4JA 4DH7A 4K11A 4MD8E 5AV0A 1KSWA 4B8MA 4ANLA 5EI6A 4IIRA 1GJOA 5EYKA 4RWIA 3C0IA 3FZSA 4MXAA 3ORPA 3IECA 2IWIA 4NK9A 4R7HA 5C1QB 3QTXA 3COMA 3OBJA 4FNZA 2BTSA 4AZFA 3EH9A 2QR8A 5L8JA 4RVKA 4DFUA 3ETAA 4IX4A 3RI1A 2FH9A 4IW0A 1DI9A 2QO7A 2VO3A 5J79A 2B55A 4FF8A 5M4FA 5EW9A 4A9UA 4C4EA 4CKJA 4HGTA 4LGHA 5JGDA 3GC7A 2DWBA 2VD5A 1PKDA 3Q2MA 4DHFA 4DT9A 5CY3A 4LRKA 3QCYA 1LP4A 4XYFA 3I5ZA 3W55A 4BL1A 4ERKA 2C1BA 2QG7A 3NIEA 4YJVA 4ENXA 3R71A 2XMYA 3U87A 3OT8A 4KIPA 2OJ9A 3U54A 4S32A 4DGGA 1GIIA 4ZY6A 3BV3A 1PXMA 3SQQA 3VF9A 2E9VA 3TT0A 1ZYJA 3NNWA 3R8PA 3R9DA 4CFUA 4FYOA 2Q83A 4NFMA 3OUNB 4LGDA 3OXZA 4DEAA 2GTNA 2JFLA 3P23A 4FSYA 3OXTA 4NZWB 4AGCA 4EHGA 3VS7A 1YWRA 5CAVA 3GU4A 5EQYA 4BI0A 4BTJA 4ZSGA 2OLCA 3V6RA 1Q8TA 4Z7HA 3EQRA 4QMVA 3BYUA 3PJ8A 2GHMA 3C4FA 4F7NA 4YO4A 1TQPA 1E1VA 5ACKA 4LYNA 5E8UA 4OBQA 1WVXA 4NL0A 4G3FA 1U54B 4NT4A 4LG4A 3PA3A 3PIYA 1YDRE 3HV5A 5E8ZA 4X2GA 3P86A 3UO5A 4UN0C 3F66A 3U51A 3OROA 2HZ4A 3IDCA 5AM7A 4B4LA 2R3NA 4FTIA 5IA3A 5JN2A 4IVAA 4E3CA 1ZYSA 4O2PA 1F0QA 4NM7A 4EQMA 5KUPA 3MVLA 3TNIA 4G5PA 4U79A 4FL3A 2VGPA 4OTDA 5K4JA 2XB7A 4QMWA 5HGIA 3DTWA 4LOQA 4M66A 4YUQA 2Z60A 4L6QA 5JKGA 3UO4A 4G6OA 4RJ4A 3Q9WA 2C5YA 3C5IA 2C6TA 2UZEA 5L6OA 5KMOA 3GC8A 2ZB0A 3IDPA 3NPCA 4BF2A 3OWKA 4AF3A 4LV8A 3U9CA 4RRVA 4QTCA 3EIDA 3I79A 1FQ1B 1ZLTA 3UOJA 3DKOA 1PHKA 3GQLA 4IWOA 5HD7A 3UODA 3ZUVA 2YCRA 5I9YA 5CAOA 3QA8A 3VO3A 5AA8A 3ZLWA 1DAYA 5ICPA 3L9MA 4ZTLA 4GT4A 4S2ZA 3R28A 4HGEA 3R8LA 3V6SA 4FKPA 4TWOA 3VRYA 3EKNA 3V5PA 2UW8A 2VTMA 1ZOHA 3VS3A 4A9YA 4I6HA 3F3TA 3ORNA 3VBWA 2F7XE 3LE6A 3DT1A 3PVGA 4K18A 2HELA 2OICA 5ANEA 3T8OA 4FV9A 4F9BA 5CEKA 4PMMA 2KTYA 1YHVA 4PMSA 5CU2A 5CYIA 4DTKA 4F6SA 3T9TA 2JDVA 4GU9A 3DLZA 1ZMWA 4Y5HA 4BI2A 2R3RA 4F7SA 5IUHA 2EB3A 2R3KA 4R1VA 5DN3A 2BDWA 4CGAA 3S0OA 2JDRA 4XG6A 2BR1A 2XVDA 2VTRA 3F3UA 4FSQA 4YJRA 3V8TA 4IM3A 3F7WA 1A48A 3K3JA 4JDJA 4YBKA 3ROCA 4FZAB 5KKRC 5FXRA 3CE3A 3F5PA 3R2BA 5EM6A 2Y4IB 3DXQA 2JEDA 1VYWA 2I0YA 3KU2A 3M42A 2W1DA 5H2UA 4L7SA 3A7JA 3KN5A 4AFEA 3QQFA 3TDVA 3ZDUA 3UVRA 4NJ3A 5HO8A 2QQ7A 4JQ8A 4A9RA 5A46A 1BYGA 3PPZA 4O7SA 2Q0NA 4BTFA 2QKRA 3E62A 4RT7A 3QTWA 4DGMA 4DG0E 2QONA 4F4PA 3N4VA 4MVFA 3KRXA 2JDTA 3LMGA 4C3PA 3EN7A 1NT2A 4CMTA 2WFYA 5CSPA 3TACA 2QOQA 4ANNA 2PVNA 5HE0A 5EH0A 3HMOA 3L8VA 2BKZA 4PL5A 4RIYA 1OKYA 2VWZA 5AR4A 4HNIA 1T46A 1Y91A 4RQKA 3VIDA 1CTPE 3R7VA 2R3LA 3QWKA 4BY9E 5FXSA 3WILA 2BKKA 3LM5A 5J1WA 5EW8A 3DQXA 3F61A 4FSUA 1OUKA 4I6QA 1IR3A 2ITYA 5IISA 3R9OA 4V0GA 2EVAA 3N9XA 4IFGA 3QGWA 1R1WA 5J8IA 5IEXA 4C2VA 1OKZA 1UU8A 2Y0AA 4GT5A 3DNDA 3P78A 4PPAA 2XIKA 3D7TB 2VTOA 3EFKA 3HYHA 2QCSA 4QOXA 5F94A 2CGXA 1IG1A 1F3MC 4XP0A 5IPJA 1OIUA 3QD3A 3G6GA 2OIBA 3NYXA 5DRDA 3LLTA 3RP9A 3MJ1A 1KV2A 3PXFA 3Q6UA 4FG7A 3HEGA 4YZCA 3Q3BA 3MIAA 4PQNA 4DFXE 3R7OA 3ELJA 2PVJA 3IW6A 3UQGA 2QNJA 1U5RA 4F6UA 2IN6A 4J52A 2OH4A 3GCVA 1NVQA 3COIA 3FZOA 4L67A 5HOAA 3OCGA 4RVTA 3OD6X 2W4JA 4PDSA 5HVKA 3FXXA 4EHVA 5JQ5A 2J9MA 3T3VA 3LHJA 3DS6A 5ETIA 2H9VA 3MGYA 1MQBA 3I6UA 4X3JA 2GS7A 4D4SA 4YO6A 2J4ZA 4FR4A 3FZTA 3ORMA 4F1MA 4WBBB 3Q32A 2QURA 3KC3A 5KKRB 3U6IA 4FL1A 2XM9A 4IB3A 4F63A 3QD2B 4D2VA 1P14A 2UW6A 2W1GA 2BDFA 4Y73A 3ZTXA 4A4OA 5IMXA 4HOKA 4O7WA 3S2PA 4YC6A 2VRXA 4C36A 4MH7A 4GJ3A 5HX8A 4Z55A 4BIEA 3VUIA 3CGFA 3E8DA 2W9FB 3KULA 5I9XA 4L7FA 2CDZA 5IG1A 1J1CA 4NW5A 4RIXB 4TWNA 4DINA 3C0HA 4RJ8A 5KBQA 1IAJA 2F2CB 3OFMA 4F65A 1XQZA 4RWKA 5DRBA 3D5VA 4IEBA 3ZM9A 2XNPA 1CKJA 3NUNA 4EH2A 2XM8A 4PUZA 4RVMA 2JC6A 3A7HA 3E8EA 3HP2A 1PMNA 2QD9A 2J0IA 3R8UA 4GS6A 4FTRA 1O6LA 1KE7A 1U59A 3RALA 3ODZX 4W9WA 3FHIA 4EOMA 4ZTMA 3A7FA 5G1XA 3AGLA 2ITPA 3RBWA 3QA0A 2B9JA 4CT1A 3MFUA 1HOWA 3FKLA 3PJCA 2I0VA 2OO8X 2YEXA 3W2QA 4XG9A 2YCFA 2IZRA 4DGLC 1KE5A 3BGZA 4I0RA 2WTCA 3KMMA 3W16A 2BZIB 3HX4A 2BZHB 3GI3A 4NM3A 2QLUA 1S9JA 4X6QC 4QYHA 1E9HA 1J91A 4I5PA 4MXZA 3OMVA 1UKHA 1ATPE 5CWZA 4ZTHA 2CNVA 3A2CA 4KS8A 4H3BA 4TL0A 4DT8A 4O0TA 2OK1A 4N57A 5B7VA 3DZOA 3MV5A 3ZLSA 4A7CA 4JAIA 3I1AA 3EYGA 5GNKA 1RJBA 3U8WA 4YU2A 2HWOA 1AGWA 1NA7A 1Q41A 5E92A 2G1TA 3R7GA 4G6NA 4OTPA 2VNWA 2BFXA 3WF6A 5DA3A 4DH5A 4O7ZA 1GY3A 2FA2A 4DCAA 1GAGA 2GQGA 4MXXA 4U80A 1WMKA 2V0DA 3O96A 3PXRA 4G16A 4UALA 5BYYA 4CVAA 2OH0E 4JIKA 2YIRA 2JBOA 4M68A 4QMTA 4FVRA 2DS1A 3MB6A 3O17A 4IANA 3WE4A 3UMXA 3QQHA 4E4XA 5M4IA 4ASXA 3BLQA 4QP2A 1G8SA 2ITQA 5IA1A 3VS6A 3I0OA 1OIRA 4H1MA 3MTLA 4BCJA 3NAYA 3CGOA 3RGFA 3G6HA 3BBWA 4F9CA 2J51A 1OL6A 1OPJA 3OOMA 4MXYA 2YWVA 2QOCA 2P3GX 2XNOA 3UYSA 2J2IB 2UZUE 3QZIA 5I0BA 3QLGA 3NDMA 3LAUA 4FG9A 4WG5A 1P4FA 4FIHA 4EBVA 1OZ1A 2B9FA 5LMKC 4O7TA 3W8LA 3FI4A 5LVMA 2PMOX 4QRCA 4ACHA 1M2QA 4ZP5A 4AOIA 1OBGA 2ITOA 2VWBA 3PP0A 5AUXA 3FLNC 3MPMA 5GZ8A 4UWCA 5F4NA 1QPDA 3FL5A 2HY0A 3AC4A 4TZRA 5HE3A 5BVKA 5JT2A 4WSQA 3H10A 3ZYAA 4O38A 3IQ7A 2RFEA 3O2MA 3OT3A 3QQKA 4FKRA 2QOBA 5CX9A 4FV6A 2PVYA 2V62A 4L53A 3L9LA 3M11A 4AZSA 5IA4A 5M57A 4AE6A 4YJTA 5IH4A 1H4LA 5CQWA 4YJOA 4GEOA 2G15A 4DFLA 2HZNA 4AA4A 4BCQA 5FBOA 5CT7A 5IQGA 3F6XA 3JPVA 5KCVA 4FEUA 4Q5EA 3QKLA 3FQHA 2WMWA 3HV7A 3MS9A 2BALA 3NRMA 4FKQA 5D12A 5GJGA 3ZC6A 2OJFE 4RLKA 5M06A 3HVCA 1KWPA 4RIOA 4QT1A 3BQRA 5CVHA 3ITZA 3PA4A 4GKIA 4BICA 4O7VA 4FV0A 2ONLC 4MBLA 4R3RA 5FLFA 3P4KA 3RZBA 5A6OA 4FEXA 4FKJA 3DK6A 3LZBA 3G33A 1H0VA 4G5JA 5LCJA 2UW3A 3POOA 3ATTA 4FIGA 4KIKA 2BTRA 3TIYA 2OSCA 3BELA 3O0GA 4M13A 4C38A 4RX5A 2YACA 5JQ8A 3HAMA 4A07A 4IJ9A 4P2KA 5C4LA 2QKWB 4AA5A 4I0TA 1B39A 2BDJA 4QYGA 3VQHA 4O27B 1UU7A 4RIXA 5AP4A 4F9WA 4FSRA 4WUNA 3KMWA 4MBJA 5KMLA 4BKJA 2W9ZB 3EL7A 4Y83A 4LRJA 4BCKA 3W2RA 2W06A 3K5VA 4QYFA 4KA3A 2CKQA 5HQ0A 2DYLA 4HVIA 4N6YA 1R78A 2VZ6A 1B6CB 1H1WA 1PXIA 4E6AA 3PRFA 5FEEA 4EOKA 1PW2A 4LM5A 3UVPA 3FZ1A 4MD9E 4QP8A 1MRYA 3PLAE 4I0SA 4E4MA 3BYMA 4IZYA 4JXFA 5BQ0A 3Q04A 3EOCA 3W2CA 3KQ7A 1PXJA 3G5DA 4IQ6A 5HCYA 4BWPA 2WOUA 1LEZA 4CG8A 5G6VA 1XBAA 5AP5A 5AP6A 3E7VA 4IZ7A 4RG0A 3QRUA 4FV5A 3IS5A 3UPXA 4FZDB 3F3VA 5IF1A 4FTTA 1PXKA 3SRVA 4FGBA 4ZSEA 4EEVA 5DNRA 3OBGA 1SVEA 2JBPA 2RFNA 5HEZA 3COKA 3ZDIA 4DYMA 2XNGA 3S95A 5L2TA 3WI6A 2WKMA 2PMNX 1PYEA 4RBLA 4CG9A 2XK7A 4RX7A 1OL7A 3RPYA 2J0JA 4MEDA 5C27A 1OL2A 1WBVA 1JBPE 2PVFA 1XR1A 2WTDA 3QQGA 3QYZA 3KVXA 4Y95A 1BLXA 3DOGA 3MN3A 1YKRA 4DTAA 4M8TA 2XK6A 2ZYBA 3BHVA 3LCTA 4D55A 4QPMA 4DC2A 4DEGA 3D4QA 2BRNA 2A1AB 3DAEA 4EH9A 1ZYCA 1PYXA 3PFQA 3W8QA 4EUUA 5AEPA 2EB2A 4FKWA 3B8RA 4D5HA 1KOBA 2I0EA 2R9SA 5DT0A 4E6CA 1Z5MA 4ZTRA 3UTOA 3ACKA 4YTHA 3PTGA 3SAYA 3PDTA 3P79A 1S9IA 3E87A 4HVDA 2HW6A 1AQ1A 4OT5A 2UZWE 1XH7A 2BRBA 2JAVA 5DR9A 4DE4A 3R04A 3EQFA 2BAJA 5HE2A 3GQIA 2IPXA 3ALOA 3FSFA 4KKEA 2ONLA 4FK6A 4R7IA 2CPKE 4D1SA 4U9AA 3PE1A 2O65A 3V5QA 3E3PA 2O63A 4RJ6A 3QTUA 4S34A 5AFVA 4FYNA 4H3QA 3G0FA 3UE4A 4F9AA 1YXUA 5JEBA 2SRCA 3QAME 4AZEA 2JIVA 4C35A 4RJ5A 3RHXA 4UB7A 4FV2A 1M14A 1P4OA 4EOJA 1JLUE 3ORKA 4FOBA 4XG8A 3RK5A 3KXNA 4MK0A 4IDVA 4C59A 2R3IA 4FKOA 4ZK5A 3B2WA 4FSTA 4FKTA 2XA4A 4XP2A 4CQEA 1NVSA 4KB8A 3U6HA 3DKGA 3ZZWA 5DYJA 3ID6C 2XS0A 2YLFA 5M55A 3ZBXA 5LXMA 3EQDA 2ERZE 4NIFA 3Q60A 4R3PA 3G90X 3PY1A 3R22A 3R63A 2VTJA 4YHJA 5TE0A 2YHVA 3R8VA 1XHAA 3Q9XA 5DOSA 3VS4A 3BI6A 5H8BA 1SMHA 1ZYDA 4Y8DA 5HCXA 2V22A 3RNIA 3ZRKA 2PY3A 4R78A 4JL9A 3WF9A 2BIYA 2JDOA 3RPOA 4R7BA 1MP8A 4IACA 4RZVA 4LQMA 1LEWA 4DH8A 4WSYA 4F0FA 2CGUA 1W8CA 3DTCA 5FM2A 4C62A 2P0CA 4J71A 3H9RA 3IGGA 3DK3A 4AE9A 5CAUA 5IH5A 3OG7A 4LUDA 2LAVA 2R7BA 4IXPA 4OTFA 4EOSA 4USFA 2W1EA 5EI2A 4BYIA 4CCBA 2IJMA 3NSZA 2ZM3A 2PL0A 3WYXA 2PE2A 2XF0A 3I7BA 3UC3A 4AP7A 4AT5A 4F1OA 4EK5A 4MF1A 1M2PA 3NUAA 1ZRZA 5KHWA 4G3DA 4PTCA 3VBTA 1Q5KA 3JVRA 3CBLA 4NCTA 4A4XA 5A9UA 5IA2A 4OTHA 4BWKA 4DEHA 4JBPA 4ZZMA 2HENA 4DG2E 3IOPA 4WG4A 2JKKA 4MCVA 5EK7A 4E73A 3A4PA 3R1QA 4FVQA 3A7IA 3LFCA 3QRJA 4JBVA 3FPQA 2A2AA 2C5XA 1VJYA 3JY0A 4QMYA 3UQFA 1MQ4A 2J7TA 3GC0A 2EUFB 3KCKA 2PWLA 4UZDA 4CTBA 5HD4A 2B1PA 5E1EA 1A06A 3RZFA 3LW0A 4G3EA 3DB8A 2VWXA 4IB5A 4MKCA 5A54A 5DEWA 3IOKA 2BFYA 2XEZA 1H8FA 4IWDA 4M3QA 4MYGA 5M07A 2ZDTA 1FGIA 4RX8A 3S3IA 2C47A 1ZYLA 1PMEA 4EH6A 3D5UA 5LOHA 4A9SA 4TWPA 3EQBA 4FKIA 3CQEA 4ZSJA 3AG9A 3BE2A 3MWUA 3O51A 4C4GA 1Q61A 1SM2A 4CLIA 3FLQA 1YXVA 5EI8A 3VBXA 5HNBA 3UVQA 3FY2A 3PG3A 4M12A 2Y4IC 3VWAA 5KO1A 4XX9A 4EBWA 2C6LA 3DXPA 4FT0A 4U0IA 4EC9A 3D7TA 4GJ2A 4HGSA 5AV2A 2IVSA 2X4ZA 5BYZA 2WELA 3F3ZA 4CTCA 4YJNA 2WMTA 5EKNA 4EK6A 4C34A 2AC3A 4FTMA 4U5JA 4K77A 1YI6A 4Z3VA 4IZ5A 3BGQA 3FKNA 4TN6A 3V01A 2X8DA 5DEYA 1XKKA 3DJ7A 2CNUA 2ERKA 4PNKA 3N4TA 4MF0A 4JQ7A 4IVCA 2B54A 4FKVA 2WTIA 4BTKA 3HUBA 3R9HA 1SNUA 4GG7A 3RVGA 1MRUA 3UZTA 2PPQA 3EQGA 1PXPA 3DJ5A 2YCSA 4XS2A 3RAWA 5M4UA 3I81A 4R3CA 4A4LA 3U9NA 5K5XA 2X9FA 3D7ZA 3LCKA 5HCZA 1YHWA 5L4QA 3Q52A 2CN8A 4E1ZA 3NUPA 5EDRA 2HY81 4G17A 3SG8A 4F70A 5AWMA 2CMWA 2C3JA 3BYVA 3PPKA 4D4YA 3UOKA 4OR5A 4DITA 3KEXA 3P7BA 3FMLA 5BVWA 5JGAA 3LCOA 3Q4UA 5KMJA 4NTTA 3GCQA 4YGAA 3KXZA 3F2NA 1IEPA 3BYOA 2IVUA 3CKWA 3QX2A 4FT5A 4ITHA 3WIKA 1LPUA 4EK3A 2W17A 5EOBA 3HNGA 4M69A 1KE9A 3P7AA 4UV0A 1BL7A 4AU8A 4F0IA 5BVNA 1OB3A 5DG5A 3ZUTA 4DLJA 5IQEA 2YITA 4Z7GA 2FUMA 4FTJA 4BCFA 1FVTA 4OUCA 5CI7A 4CRSA 2J5EA 4YLJA 1PRYA 3MH3A 3KKVA 4IM0A 5HLNA 3VHEA 2XJ1A 4WRGA 3SXFA 4KS7A 4W8DA 1J7IA 2VWWA 3PSBA 4OBPA 4U3ZA 3RAIA 2QO2A 4BGGA 2VGOA 4YJUA 5FRIA 2W99B 3QTZA 5AR8A 5B0XA 5L2WA 2ESMA 2H6DA 4RX9A 5EDQA 3QTSA 4MBIA 5A3XA 2QODA 5CF6A 5L8LA 2WMAA 5BUIA 4FI1A 4AW0A 4D5KA 4TRLA 1YXTA 4FT7A 4GV1A 4PPCA 4FTUA 5AP0A 2JGZA 4BC6A 3DAJA 4BCGA 4IVBA 1OKWA 4DEIA 1O9UA 4BCOA 3FDNA 4EK8A 5HTCA 3NZ0A 5A6NA 5IKWA 4UMQA 2R3PA 4CMUA 3DLSA 4KBKA 3E88A 4JNWA 3EYHA 2WU7A 3EKKA 5DHJA 2GNHA 4YNEA 3VUMA 1URWA 1UWHA 3ZXTA 2XRUA 2JKQA 2JAMA 4FKGA 3VUKA 4DBXA 3VS2A 4AW2A 4XG2A 4ITJA 1DM2A 5BUJA 1U5QA 5BVDA 4ZS0A 5CF5A 2CJMA 5AP1A 5B2LA 4O0UA 2O8YA 4HYUA 3MTFA 4MXOA 5CZIA 3LPBA 4YTFA 4IADA 1Q99A 3B8QA 3PY0A 4U42A 4HGLA 3GB2A 2R3QA 3K3IA 3SKCA 3QKKA 4U81A 4BKZA 1Y6BA 1OVEA 3DBDA 2X81A 3OP5A 3QBNA 4PWNA 1JPAA 4QTBA 4BBFA 3OC1A 4W8EA 3BWFA 4FTKA 1SNXA 2B7AA 2C6DA 5EW3A 1WVWA 4ZTNA 5HE1A 4WIHA 3NNUA 3PVBA 3JR1A 1XWSA 3UOHA 3FJQE 4YSJA 2XK4A 5C4KA 2QC6A 3R83A 4FKSA 4QMXA 4UBAA 5BMMA 3ENHA 2GQSA 3LXLA 5E8SA 5GZ9A 4YLKA 4LOOA 3BE9A 2YJSA 5CS6A 3VC4A 4G9CA 4LFIA 2GFCA 4EH3A 3LQ3A 3OW4A 3WYYA 4L42A 5BYLA 1CSNA 5AP2A 3ORTA 3H9FA 2BCJA 4CV9A 3TKHA 3CXWA 5K9IA 3G9LX 2FYSA 1W82A 2OZOA 4A9TA 1ZMUA 4QYYA 2R2PA 1H1QA 2GDOA 2XBAA 3F9NA 3OCTA 4GK3A 5LVPA 2V55A 4PDOA 4QNAA 4GG5A 4J99A 2WNTA 5AMNA 1XO2B 2Z7LA 5DR2A 2Z7SA 4XG7A 3NW7A 3SOCA 4WT6A 4C8BA 4IVDA 3ZO4A 3QC4A 4KRCA 4YR8A 5HU9A 2E9NA 3ZBFA 3QLFA 3SXRA 3DQWA 4C33A 4EHEA 5EOLA 4EC8A 2PK9A 2UZBA 1BX6A 3IKAA 4I93A 2R64A 4C4FA 4G1WA 2WAJA 2REIA 5TR6A 4Z9LA 4BDKA 3OVVA 5ANKA 5ETAA 3ZLXA 4FIIA 3QRKA 1ZARA 2BZJA 4BCPA 4RIYB 2XKDA 3DV3A 3OHTA 1Y6AA 5CVFA 3SOAA 4A06A 3ZFYA 5HBJA 2JITA 3LFEA 4F64A 5M08A 4ZLOA 1BL6A 4II5A 4JX3A 1V0OA 3Q2JA 4F7LA 2BRGA 2YIWA 3QTQA 4YJQA 4RC2A 5LMAA 4UWYA 5HKMA 4BZOA 1WBPA 4IAIA 3R8MA 3C13A 4YPDA 2C6MA 3CR0A 5IQCA 3AQVA 3P7CA 2J6MA 3UO6A 4L46A 4WNKA 2YFXA 5EM7A 1G3NA 2ZV8A 3CD3A 4BDGA 1IRKA 3D0EA 1J7LA 4FNWA 4D0WA 3KY2A 4M14A 1ZXEA 3GFEA 3I5NA 4H3PA 4U97A 4YHTA 5AAEA 2IVVA 4G9RA 3UNZA 3SGCA 3CJFA 4MTAA 1UA2A 3DA6A 2Y7JA 4ID7A 4QD6A 2OIDA 4I4FA 4ACDA 2VX0A 4ANSA 2XK9A 5KHXA 4DFYA 3VF8A 2GU8A 1JVPP 3Q5ZA 4GFGA 1LR4A 3LXKA 4UMPA 1WVYA 1ERKA 4DA5A 3LVPA 2PTKA 2HAKA 2WTKB 3AC2A 3QCXA 2OBJA 3QRTA 4BFMA 5HHWA 3ZO3A 4N6ZA 3KGAA 2YJRA 4O2ZA 4EKKA 5IUGA 3NUXA 1JNKA 1CM8A 2WZJA 3KK9A 5JFSA 5L6PA 3A99A 3V5JA 2BPMA 5I5ZA 4NM5A 4FIEA 4KD1A 3ZZEA 2W96B 4PMTA 3A7GA 4KUJA 1VEBA 5T6KA 5IQIA 3UDBA 2R0UA 2UVYA 3RWQA 2X8EA 4QP9A 4O1PA 2C0OA 1JAMA 4FKUA 4L44A 1GZOA 4QPAA 3OCBA 4YNOA 4YTIA 4CFFA 4BTMA 3AMAA 4X2KA 2YZAA 5FP6A 5J5TA 1M7QA 3WARA 5GIOE 3D2IA 3FC1X 1SVHA 4FL2A 3LXPA 3NEWA 5A4EA 4MX9A 1UU9A 2R3FA 3HECA 4OTGA 4M0ZA 1ND4A 3ANQA 2OW3A 3E3BX 5EYCA 1W83A 2DQ7X 4RPVA 1FMOE 3PPJA 4FT9A 4WOVA 4O7RA 2F2UA 1BI7A 5A4LA 2OGVA 5DT4A 4M0YA 4DH3A 2X7OA 3SRVB 4QMNA 2A4LA 4RGJA 5ETCA 3E64A 2B0QA 1OKVA 2HWPA 4QMPA 4QNYA 5K4IA 4XUFA 4UXLA 4UZHA 5KX8A 2UZOA 2WQMA 2YCQA 3PIZA 3ZSIA 1YDSE 4FTNA 4CT2A 2R7IA 2XP2A 3GCSA 4CD0A 1I44A 3MSSA 4QQTA 2XCKA 4BDCA 5ITAA 1TKIA 4WD5A 2PZ5A 3BHUA 3HV4A 4BCHA 5E8WA 3KFAA 1OIYA 4C4IA 5E7RA 2W1ZA 3DDQA 3LFQA 2RSVA 1M17A 1JOWB 3WZEA 2XK8A 4ASDA 2PVRA 3O7LB 3UZPA 4XLIA 2VWYA 4QTAA 2GHLA 5IEYA 3HZTA 4B99A 4FGRA 2CHLA 3JS2A 4EQCA 1SZMA 3LKMA 2HZ0A 4XV2A 5GJDA 3SC1A 3ZSHA 2NP8A 4IMYA 5H3QA 4EHZA 2AUHA 4C4HA 4PL3A 5CF8A 3FLYA 2X8IA 1UKIA 4KSPA 4D9UA 2V7AA 1FGKA 1HCKA 3CLYA 3F82A 4IDTA 4GK4A 4KIKB 2YLEA 3Q4CA 4B0GA 3EFJA 3JUHA 2O64A 3QZGA 5J7HA 1PXLA 3BEAA 1H01A 4CKIA 1XH6A 4L3LA 2CCIA 1OGUA 2WIHA 3KRRA 1Q62A 2UZVA 4MAOA 3CY3A 3CCNA 4V04A 5L2QA 3LIJA 1YI4A 4AN9A 4JR3A 4BDFA 4J7BA 1QPEA 5IH6A 4JR7A 2WXVA 5TKDA 5HTIA 3C0GA 1Y8YA 1ZAOA 3GCPA 4NW6A 4GIIA 5LCKA 2C5VA 4HYHA 3FYKX 4RJ7A 4PY1A 5J9ZA 5AV1A 1OBDA 5EHOA 1H00A 2OI4X 2BRMA 3VS1A 1O6KA 4E4NA 4PMPA 3MIYA 4BR3A 3HRBA 2XKCA 4ANQA 2BMCA 5FGKA 3KXMA 3O8TA 3TL8A 2XUUA 3IPHA 2R3HA 4F1TA 5HIEA 1YOMA 4DF3A 3QXPA 3KA0A 3LCSA 4IZAA 4CFXA 2C30A 3IDBA 3SVVA 5J1VA 4F7JA 3KMUA 3PIXA 4BKYA 5AUUA 5H9BA 4JI9A 5EM5A 3U4UA 4OAVB 2BILB 4ZZNA 3DPKA 3MVJA 4PDPA 3BRBA 3HLLA 4V01A 2B9IA 5CEMA 5C8KA 4CLJA 1Q8UA 5HIDA 5HI2A 5HX6A 4NYEA 3EQCA 3AT2A 1YWVA 4JDIA 4IX6A 3MFRA 4U3YA 3RPSA 5IA0A 4I22A 2QHNA 2P2HA 4RA4A 3HMIA 2C1AA 3F2AA 2QI8A 2G9XA 5DMZA 3SA0A 3PVUA 3PSCA 3UYTA 3GCUA 3LMIA 5GHVA 5FWKK 3FLZA 4TTHB 4N70A 2OZAA 4X3FB 3L9PA 3TNQB 3MB7A 2GSFA 4F08A 1WBNA 3MYGA 2VWVA 5ANJA 5JRSA 2EXMA 1BKXA 2WMBA 2VX3A 3PZEA 4YHFA 5I9VA 4QMOA 5FD2A 4AGWA 2FO0A 3GNIB 3NYNA 4CXAA 4HCVA 2C5NA 4YJSA 5AR7A 4XEYA 2HCKA 3EJ1A 4MHAA 3RAKA 5LWNA 3OY3A 2CKEA 2XCHA 4FTCA 1REJA 1VZOA 4LL5A 2ZM1A 3Q9ZA 4ZTSA 4O6LA 5A4QA 3AC3A 3VULA 3UIXA 1AD5A 2GNJA 3VBVA 1QPCA 2H8HA 4M67A 4ZAUA 3O23A 5HO6A 5M51A 3MY1A 1K9AA 3QQLA 3ZRLA 5CAQA 5ANOA 1H25A 4AZWA 3K2LA 4BCMA 3QX4A 4O6EA 2XNNA 4RZWA 4CYJA 3G0EA 4C58A 1YOJA 3VJNA 5FDPA 3ORLA 5AV3A 2NPQA 1T45A 4FSZA 3ULIA 2WMRA 1DAWA 4Q5HA 5M44A 4LOPA 4LI5A 4LUEA 4KKHA 4WBOA 3F7ZA 3M2WA 4NCTC 4RSSA 3ATSA 3FKOA 1Q4LA 3IGOA 2W4OA 4GL9A 4QQCA 4Z16A 3C50A 2CCHA 4I92A 4CCUA 3HGKA 5CALA 4K6ZA 2GNIA 1MUOA 3HV3A 3U4WA 3KK8A 3NNVA 4ERWA 4JDHA 1XH4A 3KRWA 3THBA 4KBCA 4LRMA 4EOLA 4X21A 2WMSA 3FMEA 3Q9YA 2JKOA 2YA9A 4KAOA 5KZ0A 1BUHA 3WZDA 4BDJA 1NVRA 5IQHA 3DCVA 2ZOQA 1WBTA 3V04A 4AGDA 4GUBA 2PZIA 5GJFA 5KMMA 2A19B 4BYJA 5LMBA 4X2JA 1PMUA 2ZVAA 4D1XA 3FV8A 4O7NA 4G3CA 2VUWA 2ITXA 4FX3A 5EG3A 5HVJA 3BEGA 3DFAA 3PXQA 3DAKA 4R5YA 5TOZA 4AT4A 4O0YA 1A9UA 4DAWA 4HZSA 3HMMA 4C57A 1KOAA 3A8XA 3QXOA 4JBQA 5CU3A 3A62A 3E8CA 4KSQA 5EQPA 3WZKA 4D0XA 4I1ZA 3RCJA 3DJ6A 5AAFA 2AC5A 3I7CA 3F5XA 4EZ5A 3BCEA 4I21A 4TT7A 2YERA 3PJ3A 3D9VA 4ZEGA 4L01A 5D7VA 3WE8A 4I94A 4O0SA 5EQEA 1M2RA 3R30A 4C3FA 4D4RA 4JS8A 1P5EA 3GU7A 4TYIA 3ET7A 4C4JA 4IWPA 2RFSA 3NS9A 3DKFA 4PF4A 3V51A 1VR2A 2E2BA 2F7ZE 3TNPC 2R5TA 3U6JA 4L52A 3RAHA 4XG3A 3AGMA 4NTSA 3NR9A 1ZOGA 2VTHA 4QP7A 4HCUA 2GNLA 2PZRA 3QD4A 4FTAA 3EQIA 2XNMA 3BPRA 4FTLA 2WD1A 5FG8A 3ZH8A 1Q3DA 4RWJA 2XIXA 3LMHA 3KXXA 5IDNA 1O6YA 3GBZA 2A0CX 3OEZA 5CNNA 3TWJA 5J5SA 1FVRA 3TEIA 2X6EA 3FQSA 3HMPA 4BIBA 2IG7A 1IA9A 5HIBA 1IA8A 2PSQA 4FOCA 2NRUA 5DI1A 4EWQA 3IO7A 1NXKA 3UP7A 4O86A 1V0PA 5CEOA 1PXOA 5L3AA 4F6WA 4ZTQA 3V3VA 3AD4A 5HLPA 4OGRA 4LV5A 4QP3A 2YIQA 4ZZOA 3N51A 4DEEA 3NVKI 5HG5A 2W4KA 5L2SA 5E8TA 4FSWA 4XV1A 4DEDA 4XBRA 3AC5A 3SX9A 1H07A 5IEVA 2HIWA 4IX5A 5I3RA 2VV9A 4BHZA 2CN5A 5CANA 3G9NA 2QOHA 2OWBA 2GNGA 3VS5A 4IB1A 4XBUA 3CPCA 3TZ9A 2Z02A 3A8WA 3VUGA 4OTWA 3ZXZA 4J97A 5L2IA 4JJRA 3GXLA 4WG3A 2ETKA 3W2SA 4G2FA 4IBMA
chains in the Genus database with same CATH superfamily
3TG1A 2O5KA 3GC9A 1OPLA 5BNJA 4EOPA 5BPYA 3O50A 4ZOGA 2WOTA 2Y6MA 4IH8A 4NEUA 3KIOC 5J7BA 2CGWA 1WFCA 2UZDA 3QKMA 3SDJA 5CEQA 2YIYA 4ZJJA 3UDTA 3EMGA 2YABA 4RFMA 5DH3A 4DGNA 2G2IA 4L43A 3R9NA 5JSMA 5BX0A 2XNBA 1GZ8A 4O83A 4JG6A 3MDYA 4S30A 3AXWA 3VQUA 3RHKA 1ZZ2A 3ALNA 3F5GA 4FIFA 2OJGA 2ZV9A 4XV9A 4W9XA 2R4BA 3UGCA 3REPA 4YBJA 4YJPA 5H8EA 3TN8A 2CKOA 5E8YA 2ZMCA 4BI1A 4KIOA 2BHEA 2FSMX 3TUBA 4DHJA 3W0MA 3N4UA 3O71A 3L8SA 3AC8A 4GFOA 4O82A 2JIUA 4N0SA 5D11A 5J87A 3QUDA 1KE8A 2XYUA 3KRLA 1Q8WA 2QG5A 4R77A 1UNLA 4E4LA 5LVNA 2VO7A 3IW4A 3GOKA 4EJ7A 4PX6A 1OL5A 2LGCA 2QU5A 3TZ8A 4L68A 2PHKA 3H3CA 4NJDA 1URCA 2EXEA 3FHRA 4CZYB 1KUTA 5CQUA 4PDYA 2X39A 3PP1A 2YDJA 1JQHA 4EKLA 4XHKB 5DLSA 3ZRMA 3UC4A 5DFPA 3L9NA 4R1YA 1L3RE 3TV6A 4ZS4A 3EN9A 3ZEWA 4YZNA 4ZMFA 1GZNA 5HU3A 5DWRA 3FMNA 2JLDA 5JFVA 2WQNA 3QYWA 1PXNA 3BU5A 4EH5A 3CC6A 3G51A 4MXCA 1GZKA 3FXWA 2X0GA 5CSVA 2W5BA 3ZO2A 3KF7A 3ZO1A 4OW8A 3TKUA 3II5A 4D1ZA 3R8ZA 4ONAA 4AXFA 4FA2A 3OF0A 3PJ2A 3DU8A 3SLSA 5BVOA 4DGOA 2A98A 2QOFA 4O4CA 4P7EA 5IDPA 4RVLA 3VN9A 2RGPA 2RG6A 4JRNA 4H39A 3EQHA 3BV2A 3EFLA 4V05A 4K1BA 4GH2A 5DT3A 4UY9A 3MPAA 4JX7A 4P4CA 2VTTA 2YM7A 5F20A 5C8NA 4CMOA 3Q96A 4GUEA 1JKSA 2VO0A 4O0WA 2UUEA 5DE2A 1OMWA 5EDPA 1ST4A 2OJJA 4UMRA 4G31A 4FG8A 3UDZA 2QVSE 1CKIA 2F9GA 2YM6A 5HG9A 5C01A 4E26A 4CYIA 4M7IA 5KZIA 2WMQA 3TIZA 2J50A 2QO9A 3OW3A 5AX3A 1H1RA 2UZNA 2X6DA 3I0QA 4IJPA 3FY0A 3QU0A 4IAFA 3RMFA 3VRZA 5CEIA 3QF9A 5F9EA 3FMHA 2WQEA 4J8MA 4JVGA 4H1JA 1Q24A 1FVVA 3GUBA 3TM0A 1SYKA 5CI6A 1SVGA 4LL0A 2G2FA 4QP6A 1YI3A 3KCFA 2YZLA 4YZ9A 4XNEA 1RQQA 4NM0A 5DIAA 2PZPA 3UBDA 1FMKA 1FBNA 4GCJA 2JKMA 1OUYA 3FYJX 3Q5IA 3ZM4A 4WHZA 4EQUA 2BVAA 4XLVA 5ANDA 4YTCA 4USDA 2VO6A 4O96A 3PXZA 3MI9A 3GU8A 3S00A 2G01A 3FLWA 2OXDA 3ZLYA 3HMNA 4RFYA 4X3FC 5HO7A 3LFDA 3EN5A 4FEWA 3DBQA 3R7UA 3W32A 5I9ZA 5JGBA 1QCFA 2VNYA 2WU6A 4FT3A 4L3PA 3G15A 5TF9A 1XH9A 4JDKA 4ALUA 3VW8A 4AW1A 1G8AA 2ETRA 4IFCA 4C0TA 3A61A 1F5QA 3BU6A 4U41A 1V1KA 4AAAA 4ZSAA 3OTUA 5HESA 4O21A 5F1ZA 3ZFMA 2PVHA 1Y57A 2NO3A 2OF2A 4D58A 2ETMA 3CP9A 3Q53A 3RNYA 3AD5A 4S31A 4WO5A 4XRLA 3H9OA 1DI8A 2QLQA 5FM3A 3NFFB 2E9UA 1Y8GA 2QHMA 2VTLA 3FQEA 4FV7A 4QPSA 3OWPA 5BVEA 5CENA 1Z9XA 4CFMA 3R9RA 4RJ3A 3H0ZA 4ARKA 4ACCA 4GRBA 2YISA 4M97A 3TTIA 3PY3A 1UV5A 3ROYA 3CTQA 5HLWA 4DTBA 1YQJA 4TYHB 4YZBA 5CAPA 2IO6A 2I0HA 4J95A 4BRXA 4FTOA 2GHGA 5LVLA 4ANBA 1QPJA 1MRVA 4Y85A 5FDXA 4FBXA 2B4SB 4GYIA 4W4XA 4AOJA 4AXEA 2CGVA 2I1MA 4GK2A 5LMKA 3ENMA 5E1SA 2X2LA 3A4OX 3QTRA 3FL4A 1EH4A 5EYDA 3AD6A 4EH4A 5AAGA 4BDHA 2OXYA 2Z7QA 4E7WA 2ZM4A 5AR5A 1H28A 3ODYX 3K5UA 1YXSA 5C8MA 3RWPA 3R2YA 1H1PA 2HXQA 2P4IA 4BGHA 2J90A 2ZAZA 3PG1A 3QD0A 4FMQA 3S4QA 4DLIA 3GEQA 3R01A 4G3GA 3UNKA 1CDKA 5AA9A 3AC1A 2CNQA 3OTVA 3DBCA 1JKTA 2X1NA 3F5UA 3E92A 3OUKA 4R6VA 4GYGA 4H36A 3DBFA 3SG9A 1TVOA 2FSTX 3IW5A 4GFMA 3QFVA 4JIAA 3K54A 5DR6A 1UNGA 4O81A 1RE8A 4CEGA 5FTQA 3BYSA 4QP1A 3TJCA 4E5BA 4QMUA 3O7LD 4EWHA 5CU0A 4AG8A 1U46A 3HKOA 1RW8A 3OWLA 2ITTA 2IW8A 2OG8A 4WNMA 4B6LA 4ASZA 5HORA 3UMWA 3NAXA 4BB4A 1GIHA 4H05A 5T3QA 1BMKA 4CFVA 1X8BA 5I4NA 4QP4A 4ZLYA 1G5SA 5M4CA 3VBYA 2UZLA 1WBWA 1VLRA 4ITIA 2WO6A 4TY1A 4Q2AA 3ULZA 4QTEA 4F9YA 4DBNA 1OM1A 2GPHA 2R3MA 3QCQA 4KABA 1K2PA 2VWIA 2BROA 3C4WA 2O2UA 2VX1A 2BZKB 4ALWA 2PMIA 4Y5QA 5I9WA 5DBXA 4EONA 1XBBA 5FP5A 3W2OA 1APME 2QOOA 5D7AA 4WA9A 3W1FA 4IM2A 4F99A 3HAVA 3Q4TA 3MY0A 1Q8ZA 3VVHA 2ITVA 4C02A 4IB0A 2JDSA 2VWUA 5IZFA 2W05A 3RM6A 2F4JA 3AT3A 5D9HA 4AQKA 3KVWA 3EHAA 4AW5A 4O0RA 3VNTA 1R3CA 3JYAA 1GOLA 2YM8A 4AGUA 4RMZA 4QMLA 3CY2A 4YURA 5J9YA 1KE6A 3RJCA 5AM6A 3C4ZA 4YZMA 3ZONA 4O1OA 4ZSLA 3EZRA 1JWHA 2VTPA 3GT8A 1FINA 4AN3A 5FUTA 2OU7A 2RKUA 5HBHA 3MESA 4AZTA 4J1RA 4D9TA 3LCDA 3GP0A 2UVZA 3FMMA 1ZY5A 1YWNA 1OITA 1TZDA 3D5XA 3EZVA 4L9IA 3AT4A 3BL9A 3FZRA 4FSNA 4FUYA 3R1SA 2ACXA 2WQBA 4JAJA 4FEVA 4DFBA 4WRSA 1HCLA 2HZIA 4APCA 2YIXA 4CFNA 4OBOA 3NCZA 3GVUA 3LOKA 1RDQE 4HYSA 4FSMA 2GS2A 3SD0A 4CV8A 2X7GA 3AMYA 2XBJA 1H0WA 4NIFB 4N4SA 4G34A 1UVRA 5AUVA 3R0TA 5FQDC 4BBMA 1WBOA 3NUYA 2Z7RA 3KF4A 3DXNA 3L8XA 4I4EA 3QUPA 4KWPA 3UP2A 1BI8A 2GCDA 3BGPA 5KBRA 4J96A 3O8UA 3R7YA 1YOLA 2A27A 5LARA 3ACJA 3QL8A 2I40A 4KNBA 4IAZA 4BDBA 1K3AA 4YMJA 5IQFA 4ZXTA 4FV3A 4O0VA 3U55A 3PJ1A 3VUTA 3BHYA 5EFQA 4EZ7A 1QL6A 4YC3A 5TT7A 5IU2A 1XH8A 5M56A 4ANMA 4W4VA 5DGZA 1J1BA 1PY5A 2XYNA 4I23A 3W10A 4LV7A 4MUQA 2VN9A 2W7XA 1JSVA 4GKHA 2X2KA 4BZNA 3KXHA 4DFZE 3QQUA 1LUFA 3QGYA 2UW0A 4JQEA 4UWBA 3A60A 2QR7A 2WTWA 3FZPA 5D41A 3UIMA 3UNJA 3VJOA 5IQAA 4L45A 4OT6A 4GIHA 5DPVA 3TXOA 4EORA 1U54A 2JD5A 3FI2A 4XH6A 4YLLA 4XV3A 5LWMA 5JK3A 4XOZA 2UVXA 4U6RA 2QOLA 4Y72A 2FB8A 3E63A 3QZHA 1ZOEA 2YAKA 4L8MA 3ZC5A 4XOYA 3PRIA 3WF7A 3LQ8A 3R73A 4X6RA 3ZMMA 5AR2A 5KE0A 5K0KA 5CTPA 3BHHA 5EYMA 4K8AA 2ZV7A 1OECA 3LQ5A 3ERKA 4NFNA 3V8SA 4I5CA 2W1FA 4QDEA 3E5AA 3DDPA 4IAKA 3W18A 3WF8A 3IW7A 4EOOA 3NNXA 1H24A 2XJ0A 5J9LA 3RM7A 3UPZA 4I5MA 2ZDUA 3AOXA 4WNPA 5IQBA 4ORKA 4CZUA 1WCCA 1Q3WA 2QOIA 2F57A 2XEYA 4IWQA 4P90A 3TTJA 5HNIX 2AEGA 2IZSA 3KULB 1H27A 3L8PA 3PSDA 4MNEB 4X2NA 3F69A 1R39A 1XMMA 2HK5A 3QCSA 5AUWA 5CLPA 5CU4A 2XIZA 3RPRA 3JXWA 4I24A 4PTEA 5HBEA 3MH1A 4UX9A 3BLRA 2UW5A 4D2SA 2XH5A 3PWYA 3EFWA 3OOGA 3P1AA 3C5UA 4U44A 5HG8A 2PZYA 3FBVA 2WMUA 4HVHA 4XCUA 2EU9A 4XJ0A 4DEBA 4DG3E 4O7LA 4JT3A 3CQWA 3RK7A 2GNFA 5H8GA 3R1YA 1B38A 2C6OA 4HCTA 4TXCA 3UIUA 4QTDA 1PKGA 2OJIA 4IE9A 4RC3A 2YM3A 4UMTA 4FZ6A 5CZHA 4I5HA 1WZYA 2RFDA 5M53A 3UJGA 4ANOA 4GVJA 4J53A 2NNWB 3CKXA 4QMZA 3EQPA 1I09A 3OCSA 4ASEA 2I6LA 4BCIA 4QMQA 2RIOA 5F95A 5JRQA 2WEVA 3BX5A 1YVJA 4MWHA 5CASA 3QZFA 4W4YA 4CZTA 4Y46A 5CSXA 5FTGA 2G2HA 1KV1A 3DFCB 1FOTA 2W5HA 4MNFA 5CNOA 1W98A 3BLHA 4BGQA 4X7QA 3PYYA 2OKRA 2KULA 2IW9A 2PYWA 1YRPA 4ENYA 3W33A 2XZSA 5EHLA 3BWJA 4L3JA 3FI3A 3R1NA 4C61A 4AA0A 2C68A 3QC9A 4GW8A 2QOKA 5B2MA 4ACMA 2BRHA 3HUCA 3T9IA 4CQGA 4MWIA 3TUCA 1YDTE 4NU1A 4V0GB 5C26A 1JSTA 3PXYA 2Y4PA 1WBSA 2XIYA 3KRJA 4TNDA 5LJJA 3L1SA 2I7QA 3LFAA 4AFJA 5EKOA 3LJ0A 4C2WA 2JIIA 4IAAA 3ZUUA 1J3HA 1L8TA 4AWIA 5AP7A 4PP9A 4U8ZA 3FWQA 4YZDA 2Y9QA 2UW9A 4AN2A 2WB8A 3NIZA 3CD8A 3V5LA 2UZTA 3R21A 4WNOA 5IUIA 3CPBA 2B53A 1R0PA 2C3LA 3LJ2A 2DUVA 2WEIA 5FTOA 5TO8A 1PJKA 5AR3A 4HPUE 5E91A 4K0YA 3R7IA 4EOQA 3VAPA 1H1SA 1WAKA 3ZHPC 4BN1A 1PF8A 4NWMA 2XKEA 5JFXA 3MVHA 3D15A 4AS0A 4FJVA 2OFVA 3NVMB 4U43A 4TWCA 4FUXA 4E20A 4IC7A 3DKCA 5AX9A 2O3PA 3FEGA 3FSKA 3NLBA 3NGAA 2CLXA 3PXKA 2B52A 4KKGA 1NW1A 4F0GA 1H26A 3SXSA 4RLLA 4F09A 2PUUA 4K33A 4CNHA 5FEDA 1STCE 4DN5A 5IQDA 3CTHA 1UNHA 4EL9A 2ZV2A 2C3IB 4LMUA 1TQMA 5AJQA 3WOWA 5GZAA 3OXIA 1XH5A 2FSLX 2W5AA 4U40A 4GVAA 3HP5A 3LFSA 4S33A 1ZWSA 2H96A 2YM5A 2XIRA 4D2PA 3BHTA 3TUDA 4NKSA 4BIDA 2W1HA 4FV8A 3HRCA 4AQCA 3NMUF 3AMBA 3PLSA 4G6LA 4Q9SA 4QQ5A 4PNIA 5FBNC 2WTJA 4B8LA 4C37A 3Q4ZA 3JVSA 3LFFA 5HNGA 4ZY5A 2X4FA 3HDNA 4PL4A 3VUDA 3ZEPA 1UWJA 5AUTA 3EN6A 2ITNA 2XARA 5I9UA 2CKPA 3E7OA 4ZIMA 3BQCA 3HL7A 3E93A 4KIQA 5A4TA 4EK4A 3HV6A 3LFNA 4YC8A 2R3GA 5L6WL 2HXLA 4E93A 3ZS5A 4PTGA 3CS9A 4J98A 4R8QA 3SW4A 3ORXA 1JKKA 2IZUA 3D94A 3DB6A 4KINA 1OPKA 3VHKA 5ANGA 2ZJWA 4JG8A 1OGYA 4PRJA 3TV4A 4ZJIA 5KMNA 2VTIA 1FPUA 3OY1A 4M84A 4UXQA 5CSHA 3C4EA 4NKAA 5CT0A 3OZ6A 5HZNA 4LDTA 1V0BA 2R3JA 5EM8A 3E8NA 3ORZA 3GU6A 4GU6A 3QQJA 5I3OA 4DHIB 2WHBA 3O8PA 5BUEA 1ZMVA 4BBEA 4FTQA 3GENA 4D4VA 4U7ZA 4YP8A 3VBQA 4E6DA 4EI4A 4HVGA 3C4CA 4TYJA 1M52A 1M7NA 2WGJA 2Y8OA 5HICA 4FKLA 4O22A 3P5KA 5KNJA 2IZTA 3DGKA 4RC4A 3OS3A 5DVRA 5C03A 4I6FA 2PU8A 4PPBA 3DZQA 2GS6A 3FAAA 2PUIA 4RIWA 4F78A 3QHRA 4M15A 5IA5A 1DS5A 2NRYA 3C4XA 3PUPA 4FC0A 3FMDA 4HJOA 4JBOA 4O91A 4OTRA 1YXXA 1OIQA 2BHHA 3BKBA 3MH0A 3TI1A 3GOPA 2VTNA 1Z57A 1ZZLA 3D5WA 4XMOA 2BUJA 5D10A 5JH6A 2XNEA 3F3WA 2PVLA 4E6QA 5JMSA 2FVDA 2OIQA 2RG5A 5M09A 4EYJA 5D1JA 4MD7E 2C6EA 2E9OA 4FIJA 2CSNA 4TYEA 3MBLA 2HYYA 4P5QA 4J8NA 5K0XA 4OLIA 4AT3A 4CKRA 3TZMA 3SHEA 1NY3A 1CKPA 3ORIA 3PE2A 4TYHA 5AP3A 3VUHA 3UG2A 4GMYA 4W4WA 3RCDA 3JY9A 1TQIA 4D2TA 5JZJA 2WMVA 1Q97A 3VS0A 3CQUA 2P33A 3C7QA 4D28A 3W0OA 4RFZA 3NCGA 2FGIA 2RF9A 4B9DA 2ITWA 2UV2A 4BDAA 2VU3A 3I4BA 3KL8A 2EWAA 1XJDA 3MFSA 1JSUA 3BU3A 4UMUA 4XP3A 5AIKA 5T68A 4FZ7A 3SV0A 5AUYA 4C7TA 4DFNA 4O4BB 4CFWA 3W2PA 2XJ2A 4MQ2A 5CSWA 3VW6A 5IMEA 2X2MA 2OXXA 5CEPA 2GTMA 3LM0A 4I41A 3EB0A 3F88A 3NUUA 3TNWA 3RPVA 4BCNA 5GIPE 4EYMA 4ALVA 4TYGA 4JG7A 4HYIA 5K3YA 3TV7A 3ANRA 4AZVA 1YHSA 2Q0BA 4FNYA 4EH8A 3GFWA 3CEKA 4H58A 4LGGA 4RQVA 1W2CA 4X0MA 4EZ3A 2WPAA 4IX3A 4CSVA 2WQOA 2XRWA 3FMJA 3TZ7A 5KMIA 3H30A 4LMNA 2W0JA 1GIJA 4XRJA 2BAKA 2WIPA 3WIGA 2YDKA 3WBLA 4B7TA 4USEA 3EN4A 2PUNA 5E9EA 5E8XA 4BHNA 2XALA 2GFSA 2OZAB 4FV4A 5BMSA 1Q8YA 1REKA 4RWLA 2J0LA 3I6WA 2PMLX 3COHA 3M1SA 1VYZA 1W0XC 2UW4A 3LXNA 3B2TA 3TCPA 1U4DA 1YW2A 3G2FA 4RA5A 5L8KA 5E4HA 4RIWB 3CTJA 4QMSA 3MH2A 4HVSA 3UQCA 3D14A 4YPSA 5C9CA 4AXAA 2R3OA 2PUPA 2EXCX 4U45A 3GGFA 5CVGA 5FXQA 3UOLA 4FE2A 4AX8A 3BBTB 5CU6A 4AUAA 1JKLA 1W84A 4QO9A 1P2AA 4EUTA 2C69A 3IW8A 3NX8A 3SW7A 5CF4A 3DY7A 3IK3A 3MA6A 4HPTE 2J0MB 3BIZA 4O7YA 3FUPA 5J95A 4CRLA 2PE1A 3FLSA 4ACGA 3ZSGA 3D83A 3R02A 3C51A 5AV4A 2GQRA 2RL5A 4BDIA 4O84A 3QRIA 2YAAA 3C1XA 4FVPA 4OTQA 3VONA 3V5TA 4TW9A 4C3RA 2JFMA 2FSOX 4QMMA 3HA8A 4AOTA 3HA6A 4L00A 4M69B 3R7EA 2C0TA 2Y6OA 4P5ZA 4X2FA 5CXHA 4TPTA 2UW7A 2VTAA 4FZFB 4WKQA 4ZJVA 2OFUA 3QHWA 1GNGA 2OF4A 4YSMA 3S1HA 3WF5A 3FC2A 4OTIA 3QTIA 2YN8A 3KREA 4AACA 3IG7A 2YWPA 3FXZA 2VAGA 4TKSA 4BZDA 4PP7A 5KMKA 3P9JA 4OAUC 3FPMA 3TDWA 2XK3A 3EWHA 1W7HA 4O4FA 4BJJB 2CLQA 1CMKE 4K2RA 4UYNA 3DNEA 4R5SA 2O0UA 5JZNA 4NUSA 4UYAA 5FEQA 1QMZA 3TKIA 3V8WA 4BDDA 4NH1A 2H34A 1J7UA 3MFTA 2ITZA 4FV1A 2C6IA 3QALE 4I20A 2X9EA 4FODA 2WMXA 3NUSA 2GMXA 4I6BA 3HDMA 2IVTA 3CIKA 2BIKB 2F49A 2AYPA 4BVUA 3PZHA 1OI9A 3BZ3A 2WTVA 3CJGA 3MA3A 3NW5A 3NWWA 3ZFXA 4EH7A 2IW6A 4APPA 4D2RA 4TNBA 2C0IA 4MQ1A 4QQJA 5B2KA 5A4CA 3MJ2A 1ZY4A 2XKFA 2R0IA 2WTKC 3PWDA 4IHPA 4O0XA 2HW7A 3DK7A 3ZOSA 2YDIA 5ACBC 4HW7A 5LQFA 5GINE 1H08A 4D2WA 3TNHA 3RKBA 1OL1A 3ZU7A 2PULA 3UIBA 1R0EA 4UEUA 4JLCA 3RINA 3ZCLA 2C4GA 4PV0A 1XBCA 2C5OA 3P08A 2J0KA 4WUAA 4NSTA 4JRVA 1W2FA 3EL8A 5AUZA 3DBEA 2Z2WA 4HNFA 3NYVA 5AIRA 5A14A 3FI8A 3TMOA 4IAYA 3T3UA 3KN6A 1E1XA 4E8AA 4FEQA 2V5QA 3WZJA 3PA5A 3LJ1A 3MVMA 4FNXA 3LLAA 3QWJA 2ZB1A 5E90A 4QEBA 3MY5A 3I60A 5AADA 3MW1A 1IASA 2C6KA 5HTBA 2YM4A 4IC8A 3C9WA 3F2RA 5EHYA 4KBAA 5ETFA 2P2IA 2V7OA 3R00A 2J5FA 4ZMEA 3NW6A 4E5AX 3UZRA 4GT3A 3HRFA 5ANIA 4DCEA 2ZMDA 4GSBA 3KB7A 3H0YA 3RK9A 2PE0A 5K5NA 3IONA 3RTPA 2P55A 3NYOA 4KRDA 4I3ZA 2PVMA 3GU5A 3FMKA 4EJNA 4Q9ZA 5BVFA 5LVOA 2W1IA 3LFBA 4E5WA 4DH1A 5HG7A 4X3FA 3BL7A 2QU6A 2B9HA 3POZA 4EOIA 4FK3A 2F7EE 2VTQA 5E8VA 2PVKA 3FE3A 4FICA 1PMVA 2E9PA 4HZRA 4BWXA 1UU3A 2W1CA 3R6XA 3UG1A 2VTSA 5JFWA 4K9YA 5CXZA 4QYEA 2ITUA 2C3KA 3KXGA 4JOAA 3TJDA 3OWJA 3V5WA 1IAHA 4ZLZA 3MPTA 3WZUA 4ZY4A 2BAQA 4BDEA 3Q6WA 2Z8CA 3D2KA 3CSVA 5HVYA 4MNEA 3QUEA 3PVWA 4XG4A 3OEFX 2HOGA 2X7FA 3P0MA 3H4JA 4DH7A 4K11A 4MD8E 5AV0A 1KSWA 3AKKA 4B8MA 4ANLA 5EI6A 4IIRA 1GJOA 5EYKA 4RWIA 3C0IA 3FZSA 4MXAA 3ORPA 3IECA 2IWIA 4NK9A 4R7HA 5C1QB 3QTXA 3COMA 3OBJA 4FNZA 2BTSA 4AZFA 3EH9A 2QR8A 5L8JA 4RVKA 4DFUA 3ETAA 4IX4A 3RI1A 2FH9A 4IW0A 1DI9A 2QO7A 2VO3A 5J79A 2B55A 4FF8A 5M4FA 5EW9A 4A9UA 4C4EA 4CKJA 4HGTA 4LGHA 5JGDA 3GC7A 2DWBA 2VD5A 1PKDA 3Q2MA 4DHFA 4DT9A 5CY3A 3UDSA 4LRKA 3QCYA 1LP4A 4XYFA 3I5ZA 3W55A 4BL1A 4ERKA 2C1BA 2QG7A 3NIEA 4YJVA 4ENXA 3R71A 2XMYA 3U87A 3OT8A 4KIPA 2OJ9A 3U54A 4S32A 4DGGA 1GIIA 4ZY6A 3BV3A 1PXMA 3SQQA 3VF9A 2E9VA 3TT0A 1ZYJA 3NNWA 3R8PA 3R9DA 4CFUA 4FYOA 2Q83A 4NFMA 3OUNB 4LGDA 3OXZA 4DEAA 3AKLA 2GTNA 2JFLA 3P23A 4FSYA 3OXTA 4NZWB 4AGCA 4EHGA 3VS7A 1YWRA 5CAVA 3GU4A 5EQYA 4BI0A 4BTJA 4ZSGA 2OLCA 3V6RA 1Q8TA 4Z7HA 3EQRA 4QMVA 3BYUA 3PJ8A 2GHMA 3C4FA 4F7NA 4YO4A 1TQPA 1E1VA 5ACKA 4LYNA 5E8UA 4OBQA 1WVXA 4NL0A 4G3FA 1U54B 4NT4A 4LG4A 3PA3A 3PIYA 1YDRE 3HV5A 5E8ZA 4X2GA 3P86A 3UO5A 4UN0C 3F66A 3U51A 3OROA 2HZ4A 3IDCA 5AM7A 4B4LA 2R3NA 4FTIA 5IA3A 5JN2A 4IVAA 4E3CA 1ZYSA 4O2PA 1F0QA 4NM7A 4EQMA 5KUPA 3MVLA 3TNIA 4G5PA 4U79A 4FL3A 2VGPA 4OTDA 5K4JA 2XB7A 4QMWA 5HGIA 3DTWA 4LOQA 4M66A 4YUQA 2Z60A 4L6QA 5JKGA 3UO4A 4G6OA 4RJ4A 3Q9WA 2C5YA 3C5IA 2C6TA 2UZEA 5L6OA 5KMOA 3GC8A 2ZB0A 3IDPA 3NPCA 4BF2A 3OWKA 4AF3A 4LV8A 3U9CA 4RRVA 4QTCA 3EIDA 3I79A 1FQ1B 1ZLTA 3UOJA 3DKOA 1PHKA 3GQLA 4IWOA 5HD7A 3UODA 3ZUVA 2YCRA 5I9YA 5CAOA 3QA8A 3VO3A 5AA8A 3ZLWA 1DAYA 5ICPA 3L9MA 4ZTLA 4GT4A 4S2ZA 3R28A 4HGEA 3R8LA 3V6SA 4FKPA 4TWOA 3VRYA 3EKNA 3V5PA 2UW8A 2VTMA 1ZOHA 3VS3A 4A9YA 4I6HA 3F3TA 3ORNA 3VBWA 2F7XE 3LE6A 3DT1A 3PVGA 4K18A 2HELA 2OICA 5ANEA 3T8OA 4FV9A 4F9BA 5CEKA 4PMMA 2KTYA 1YHVA 4PMSA 5CU2A 5CYIA 4DTKA 4F6SA 3W0SA 3T9TA 2JDVA 4GU9A 3DLZA 1ZMWA 4Y5HA 4BI2A 2R3RA 4F7SA 5IUHA 2EB3A 2R3KA 4R1VA 5DN3A 2BDWA 4CGAA 2X0QA 3S0OA 2JDRA 4XG6A 2BR1A 2XVDA 2VTRA 3F3UA 4FSQA 4YJRA 3V8TA 4IM3A 3F7WA 1A48A 3K3JA 4JDJA 4YBKA 3ROCA 4FZAB 5KKRC 5FXRA 3CE3A 3F5PA 3R2BA 5EM6A 2Y4IB 3DXQA 2JEDA 1VYWA 2I0YA 3KU2A 3M42A 2W1DA 5H2UA 4L7SA 3A7JA 3KN5A 4AFEA 3QQFA 3TDVA 3ZDUA 3UVRA 4NJ3A 5HO8A 2QQ7A 4JQ8A 4A9RA 5A46A 1BYGA 3PPZA 4O7SA 2Q0NA 4BTFA 2QKRA 3E62A 4RT7A 3QTWA 4DGMA 4DG0E 2QONA 4F4PA 3N4VA 4MVFA 3KRXA 2JDTA 3LMGA 4C3PA 3EN7A 1NT2A 4CMTA 2WFYA 5CSPA 3TACA 2QOQA 4ANNA 2PVNA 5HE0A 5EH0A 3HMOA 3L8VA 4AXDA 2BKZA 4PL5A 4RIYA 1OKYA 2VWZA 5AR4A 4HNIA 1T46A 1Y91A 4RQKA 3VIDA 1CTPE 3R7VA 2R3LA 3QWKA 4BY9E 5FXSA 3WILA 2BKKA 3LM5A 5J1WA 5EW8A 3DQXA 3F61A 4FSUA 1OUKA 4I6QA 1IR3A 2ITYA 5IISA 3R9OA 4V0GA 2EVAA 3N9XA 4IFGA 3QGWA 1R1WA 5J8IA 5IEXA 4C2VA 1OKZA 1UU8A 2Y0AA 4GT5A 3DNDA 3P78A 4PPAA 2XIKA 3D7TB 2VTOA 3EFKA 3HYHA 2QCSA 4QOXA 5F94A 2CGXA 1IG1A 1F3MC 4XP0A 5IPJA 1OIUA 3QD3A