3P1AA

Structure of human membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase myt1 (pkmyt1)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
287
structure length
281
Chain Sequence
QLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Membrane-associated tyrosine- and threonine-specific cdc2-in
publication title Structure of human Membrane-associated Tyrosine- and Threonine-specific cdc2-inhibitory kinase MYT1 (PKMYT1)
rcsb
source organism Homo sapiens
total genus 85
structure length 281
sequence length 287
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3p1aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3p1aA01
1FVTA 4DFNA 3A8XA 5CSPA 1PXNA 2VX1A 4D9UA 3R8PA 4RQVA 4RX8A 2OIBA 4XH6A 5B0XA 5M4IA 3EKKA 4BKYA 3LFDA 5CQUA 4DF3A 2J2IB 3QQFA 4KBCA 4EKKA 4Z3VA 3ZHPC 3TZ8A 4ZZMA 4EBVA 3MFTA 3ZOSA 3LCSA 3O17A 5A54A 4D1ZA 1H8FA 1IASA 1JOWB 2WB8A 3JY0A 4RVLA 4ZJIA 3B8RA 3RI1A 3ZFMA 4O7VA 4BR3A 4JQ7A 2GS2A 4RG0A 3QKLA 2C6IA 1IA8A 5EHLA 1YXXA 5EK7A 4K0YA 4C3RA 3FMKA 4JVGA 2C1AA 4O0SA 5FD2A 3ZRLA 4PL4A 3T8OA 4F1TA 4QNYA 4U9AA 2R3QA 5BYLA 4K11A 2DS1A 2VZ6A 3NRMA 3TCPA 3Q9ZA 2PY3A 2QI8A 4NW6A 5JEBA 4R78A 4MNEB 4O2ZA 4D9TA 3OZ6A 4FV8A 4YBJA 5JQ5A 4ENYA 4H3QA 4XNEA 4O0RA 3ZC6A 5FBNC 4DEEA 4CTBA 1ZMVA 2CCHA 3NPCA 4IH8A 2W05A 4BF2A 1VR2A 1E1XA 3W1FA 4ID7A 2IW9A 2ZM3A 1WVYA 4O96A 2EXEA 3UYTA 1QL6A 4P5ZA 5CAVA 5I0BA 3R01A 5ANEA 4ZTMA 1V1KA 3W55A 2RFSA 4RVTA 4YR8A 4TRLA 1VZOA 3FHRA 4LFIA 1ZYSA 4U8ZA 3LAUA 5EG3A 2FO0A 2CKEA 2PVYA 3QCSA 4DH5A 4FGRA 4IB3A 3WYYA 3I1AA 3REPA 3QUPA 3BYUA 3R83A 3ZTXA 4BN1A 5CAUA 4FSQA 4FZ7A 4G3CA 2E9UA 3ACKA 3ACJA 4FTIA 4M97A 3PWDA 2BUJA 2WMSA 3SOAA 4BDEA 2I40A 3HLLA 4EOPA 2C69A 2ITZA 2F7EE 4F1OA 3TUCA 4EYJA 3ZO2A 1YRPA 1UKHA 4L67A 4RIYA 4BIEA 2C5VA 2VO3A 3C4CA 4N0SA 5DOSA 3FL5A 4F6WA 2Q83A 2VGPA 2WU7A 2VN9A 4AZFA 4O0WA 4RWLA 4MX9A 3KFAA 3SKCA 4JR3A 3JVRA 5I5ZA 4CFUA 3KMUA 3JR1A 3A2CA 3KRRA 4QPSA 4KRDA 4AUAA 4BZDA 2B0QA 4C61A 1PYXA 4G6LA 3PJ8A 1Y6BA 3BYSA 3KXGA 4XUFA 1H24A 2A1AB 2UZTA 2XEYA 4KD1A 3LOKA 3CKWA 2WAJA 3BU6A 3QYZA 3DB6A 4FV6A 2BROA 4XS2A 5JQ8A 2BZJA 3ORLA 4CFFA 5EQYA 3HECA 2W1HA 5HVYA 1UU7A 3FC1X 2HW6A 3BIZA 4UB7A 3VS2A 3QC9A 2UW9A 3U4WA 3V5PA 3TZMA 5HCZA 4YJTA 4D0XA 4MQ1A 2XKCA 2XM8A 3GU8A 2WO6A 5HG8A 5K9IA 3HV7A 2O5KA 5LXMA 1IR3A 4BDFA 3RPOA 3EFLA 2J51A 2ONLA 4HVIA 2WMXA 4E8AA 1NVQA 3DOGA 1JWHA 3ITZA 4DH1A 3DXPA 3K54A 3QA8A 2QG5A 3DNDA 1YDRE 5ETCA 2YIWA 4QYFA 3QZFA 2GMXA 2RGPA 2JIUA 1CKPA 1B38A 4CG8A 4O7ZA 4FTTA 4WNPA 4EHVA 1CTPE 5KMOA 5I9XA 3COHA 4AZVA 1YI6A 2JIIA 3L9LA 2BTSA 3L8VA 3OXIA 4G3DA 1H25A 3OY3A 4JBVA 5EOBA 3PIYA 5L2QA 3BQCA 3PXQA 3HMIA 4TYJA 4XOYA 2JBOA 1OIQA 5EFQA 3CP9A 4FZFB 3U8WA 3UJGA 3IW7A 2GHGA 2XBAA 3NS9A 2YFXA 3FLNC 2UVYA 4X6RA 2VO7A 5IQGA 4AXAA 1FVRA 5EI6A 4L6QA 3M1SA 4C4HA 4WSYA 1REJA 2X8IA 4XRJA 4I0TA 4ZSLA 4E4NA 2WMBA 1KWPA 3HMNA 1NY3A 4M3QA 5CU2A 5HNGA 4APCA 5HLNA 2PUUA 4JT3A 1ZY5A 1JVPP 5BVEA 3K5UA 4KSPA 4RJ3A 3KRWA 2FYSA 2CNVA 3F5XA 5EYKA 5LJJA 1DI8A 2HY81 3PA3A 2JAMA 4H1MA 4NUSA 2C3LA 3VBTA 3R8VA 3F3UA 3HRFA 3I4BA 3W2QA 4RC2A 3S1HA 1RDQE 1GZ8A 3LFQA 4GCJA 4H39A 4J8NA 4O6LA 5IA5A 5IG1A 5KHWA 2QG7A 3P9JA 2B54A 2UVXA 3QCXA 4ZZOA 4YP8A 1GNGA 2HZ4A 4PPCA 3EL8A 3HGKA 3K3JA 4OBPA 3FI3A 2GTNA 4ONAA 2F7ZE 4BIBA 2PULA 2Z7RA 3HA8A 3MH2A 4H05A 5FGKA 3TUDA 3UPZA 3T9IA 4A9SA 2I0YA 4I20A 5BVKA 2XKDA 3VRZA 4MD9E 4GRBA 2OW3A 2JFMA 3ERKA 4R7HA 1ND4A 4F99A 3H0YA 4PP9A 2QU6A 3VRYA 4RX7A 4QYEA 5DR2A 4QMQA 2XK4A 5FEDA 3ENMA 3H10A 5AAGA 5IQHA 4RJ8A 5KMMA 2H6DA 2WMTA 2GNJA 2BIYA 1PXPA 3PJ3A 4RX9A 3GU6A 5ETFA 4CKRA 4ZOGA 2JKQA 2YACA 2Z7SA 5CXHA 1G5SA 3R30A 3A4OX 4YJQA 3RAKA 3MH1A 4C8BA 4OTFA 4YSMA 2ITXA 2PUNA 2UZOA 3VAPA 2R7IA 5F9EA 2PHKA 2JDTA 2R3IA 4APPA 1ZYLA 4EYMA 3C13A 3C4XA 4FIEA 5BYYA 4GFGA 2QR8A 4Q9SA 2V7OA 4O7RA 4Q9ZA 3HL7A 3DKGA 4MQ2A 3GOPA 4O0XA 4I0SA 2UZNA 4YTFA 5GZ8A 5FP5A 4O83A 2H96A 2HZIA 3NUPA 5BYZA 4EQUA 3BPRA 2QNJA 3BV2A 2UW5A 3MPMA 4FNYA 3RK7A 4E7WA 1YWNA 2J5FA 5A4EA 4DCAA 3PA4A 5E1SA 2KULA 4CFNA 1FMKA 1FINA 3IQ7A 4D5KA 4AW1A 2VWVA 4TWOA 5ANJA 3NYNA 3R7GA 3F61A 4RLLA 4RIXA 3FKOA 4HYUA 3A8WA 4TZRA 4ZMFA 3LFBA 1KE5A 4CLIA 2XF0A 3KVWA 4QQ5A 2UW0A 3NEWA 4IAFA 4L3PA 4YBKA 4G6NA 3F6XA 3OWPA 5HG9A 5BNJA 2OXDA 4BBMA 4WRGA 4LGDA 3UDBA 5CALA 3DBDA 2HZNA 2QHNA 4HOKA 2QOHA 4MCVA 1ZYDA 2GFSA 4G1WA 4RA5A 3LCOA 4WHZA 5AV0A 1KOAA 3A99A 1JPAA 3OF0A 5AAEA 4I6HA 4ZJVA 4IVDA 4AQCA 4YZMA 3EOCA 5HE3A 3PUPA 4EJ7A 1ZYJA 4YZDA 3AC2A 3F69A 5HLPA 2C6OA 2GCDA 3RBWA 4AAAA 2SRCA 2W9ZB 4D4SA 2W1DA 4LMNA 3TUBA 2OJGA 3LCTA 3PVWA 5F4NA 3LFNA 3L9MA 1Q5KA 3FHIA 5HE1A 4F7LA 3GT8A 3F66A 3FMDA 3UP2A 1YDSE 4QMXA 3C0GA 3RNIA 3O8TA 2QLQA 4QTCA 4BDIA 5HOAA 3R73A 2ZV7A 1FPUA 4TTHB 4NH1A 1YXUA 3F2NA 4AZTA 4FEUA 3I60A 3SD0A 3Q96A 2P4IA 2EXMA 4QQTA 4ZAUA 3Q9XA 3P7AA 3II5A 3ZC5A 1ZWSA 4JG7A 4ZK5A 2QKWB 2WMWA 2YM4A 4I6QA 2OK1A 3GOKA 3GVUA 2WXVA 3V5LA 3B8QA 5GIOE 1OIYA 5HCXA 4YC6A 3UZRA 3C7QA 3EQBA 4FV7A 3NNWA 5ANDA 3HYHA 2J5EA 2YISA 5J8IA 3RZBA 4EZ7A 4PNIA 4M7IA 4ZTQA 3R8UA 2VV9A 3RMFA 4C4FA 3KXHA 1QMZA 1G3NA 3DJ5A 3W16A 5FRIA 3ZRMA 4M67A 2OIQA 4EH3A 3IW6A 3MN3A 3RWQA 3FSFA 4BZNA 4RZWA 3CKXA 5HO8A 4EHGA 1OUKA 5LMKA 3V5WA 4CYIA 2ITOA 2QHMA 4D2PA 2R3KA 3PVBA 3V8TA 4DYMA 3EHAA 4IVBA 4Y85A 1E1VA 1YXSA 2ONLC 3RZFA 4B9DA 4BGGA 4F7SA 4WOVA 5ITAA 4EQCA 3EYHA 3LZBA 3TDVA 3JY9A 4PL3A 5BVNA 1UWJA 5CVHA 5F20A 3C51A 3QXPA 4XBRA 2CNUA 4QTDA 2BDFA 1JNKA 3BEGA 4FYNA 3WIKA 4E20A 4CMUA 5JT2A 3AMYA 4ZXTA 3MS9A 2R2PA 2BVAA 3WYXA 4FSUA 4DEGA 3ENHA 3U6IA 2AUHA 4D28A 5HO6A 5FP6A 1UKIA 4FODA 4ZS4A 3AMAA 3LFFA 1YOJA 1PXLA 3RTPA 4QP1A 4QMNA 5DEWA 1OKVA 3F5PA 4IIRA 2WIPA 5DGZA 4QO9A 2VTQA 2B4SB 3G0EA 3CTHA 3VUDA 2BZKB 4HVGA 4Y5QA 1O6YA 4FL3A 1OBGA 5EQPA 2BR1A 4FIIA 5CXZA 3RK9A 4X2JA 3ZYAA 4DT9A 1MUOA 1W7HA 2B9JA 2QD9A 3OFMA 3ELJA 2F9GA 5AJQA 1IAJA 3DKFA 5AP1A 2CJMA 1OL1A 5AV3A 1R0EA 4QMVA 4C58A 4PTEA 3SGCA 3CXWA 3G6GA 1MRYA 2VTAA 1VEBA 3QHRA 1Y57A 2JEDA 4EORA 4DEHA 5B7VA 4YGAA 4C4EA 5BUEA 4ARKA 1OIUA 3NW5A 2C6KA 3NZ0A 3POOA 4ZSJA 5C03A 5CTPA 3DNEA 3PJ2A 5TOZA 4AG8A 1XBBA 2RSVA 2W4OA 5ANKA 5JZJA 4I21A 5E8VA 3RCDA 2VTHA 3EZVA 2BHHA 4K6ZA 4GVAA 2WQNA 3DB8A 1A06A 3ULIA 4UMQA 2GNLA 4M69A 3T3VA 4EK6A 4FKGA 4MVFA 1LPUA 4LQMA 4X2GA 3FMJA 3SRVB 5CEKA 4W9WA 5EDQA 5CQWA 4RJ4A 4RGJA 3WF9A 4RJ7A 4PDYA 3RHXA 4NZWB 4AOIA 1YI4A 4S33A 4P2KA 1RJBA 3KF4A 3PE2A 4WBOA 1G8AA 4DE4A 4AGDA 4UYAA 4EH5A 1WAKA 1YXTA 3OCGA 1FGKA 3EN7A 3I81A 2E2BA 1VJYA 3DBFA 4H3BA 3MBLA 2DQ7X 3P4KA 4QMLA 2YWVA 4JAIA 3Q4UA 2EB2A 3VBWA 2HY0A 3EIDA 4E5AX 4LUEA 4MD7E 2IJMA 4FNWA 2UZVA 4FZDB 2CNQA 3QZHA 5CAOA 2YM5A 5ANIA 3ZLWA 2PVNA 5I9VA 2BRMA 4DFXE 4YJOA 5CEPA 2YDKA 1FVVA 3GCSA 3HDMA 5HTCA 3N51A 2GNGA 2G1TA 4AGUA 5IA3A 1W82A 3H4JA 5CLPA 3FQEA 4YZBA 2YDIA 3KN5A 4C35A 4R77A 4TT7A 2FSLX 4Y73A 1OPKA 2VX0A 3SV0A 3MV5A 4NU1A 4F0IA 1JAMA 3AC3A 2XIRA 3HUCA 3QTUA 4QRCA 3LFEA 3AQVA 4O7SA 2UW3A 3E87A 4IBMA 3ZO3A 5ETIA 2WPAA 4DG2E 4FKWA 2QO7A 3A7IA 5FWKK 2PVMA 3ORZA 4RX5A 5I3RA 5DPVA 3R7VA 2NO3A 5CNOA 2VWUA 4IWDA 3BCEA 2WTKC 1PY5A 2ITNA 2FH9A 4PRJA 4FA2A 4YTCA 4LOOA 4M84A 3KL8A 3TEIA 3DS6A 3ZCLA 3ZS5A 2H9VA 3SW7A 3DU8A 3TV7A 2XJ1A 2B52A 4IC8A 5TT7A 4BKZA 1Q97A 4D1XA 3BLQA 3UG2A 3DZQA 3BHTA 1WVWA 3LFSA 3FLQA 4QP8A 4XMOA 3HAVA 1BI8A 2GQRA 4O22A 5CF8A 4YURA 1IRKA 5DIAA 2BMCA 3FQSA 3PY1A 3SOCA 3FLWA 3WZEA 4QMZA 1H01A 1OI9A 4EOSA 5JRSA 2OWBA 2ZOQA 3NNVA 3AXWA 4GU9A 1H27A 4DTKA 3KCKA 2CPKE 4UWCA 3QAME 5KO1A 3GC9A 4AE6A 3QRTA 4Z7HA 2PMIA 3BHHA 1Y91A 3GQIA 3P78A 2C4GA 4HYSA 5C9CA 4JX7A 5CI7A 5T6KA 4DBNA 5IEYA 3UMXA 4S2ZA 3VJNA 5K0KA 4AT3A 3U55A 2G2IA 4BDJA 4E6CA 3FKLA 3R7YA 1NVRA 4AU8A 3BWFA 3EFWA 1OL5A 3OT3A 4JRVA 3LFAA 5FXRA 2Y8OA 3GXLA 3L1SA 1F5QA 4RQKA 4FIGA 5I3OA 3CJGA 1OKWA 4S34A 4OW8A 4DTBA 1OIRA 3AD6A 1ATPE 3O96A 5HLWA 4LM5A 4YC8A 3MIAA 4NL0A 3QFVA 4M12A 2P33A 4NFMA 4IFCA 1IEPA 4PV0A 3ZSHA 4EC8A 5C8MA 1P4OA 2A27A 2HXQA 4CGAA 1XR1A 2C5YA 4R7IA 3PY0A 4TXCA 1B39A 1XHAA 4O21A 5L4QA 3HRCA 1KSWA 3QALE 4G2FA 2IVTA 2XEZA 5AWMA 3WF6A 5AIRA 4PP7A 4IVCA 3CGOA 3TKIA 4K1BA 1LR4A 2ITWA 3I79A 3F3WA 5LOHA 1M2RA 4IB1A 1W84A 3CIKA 2OXYA 3PJCA 5KMNA 3OUNB 3BBWA 3W33A 1GIJA 4ALWA 5CAQA 3GC0A 5LMKC 4OAVB 1OPLA 4J95A 5KNJA 5F94A 4AP7A 1GZOA 3AMBA 5HIDA 4X3FB 4Q2AA 4R1VA 3I5ZA 4F1MA 4BBEA 5J7HA 2QOLA 3KEXA 2QOBA 5LMAA 4C0TA 5M4UA 1UU8A 2RFDA 1H00A 4OTDA 5D11A 3UBDA 4C57A 5CI6A 4D5HA 4BTMA 5I9WA 5JRQA 1KE6A 3MGYA 4G34A 3F3VA 3A61A 3OD6X 4R5YA 1VYWA 4MHAA 2WMQA 3CPCA 4F09A 5J1VA 5AV1A 3FWQA 2CCIA 5KUPA 2IN6A 2RFEA 3A4PA 4BFMA 5IZFA 2XH5A 2IW6A 3FJQE 3R8LA 3DA6A 5CU0A 4GKHA 3FMLA 1H28A 5K4JA 2J7TA 3N4VA 3IW4A 3Q60A 5HESA 1ZLTA 5EDRA 4NIFA 2BILB 2X2KA 3MTLA 3Q2JA 3FI4A 4GK3A 5ANOA 1R1WA 1SVHA 3C4ZA 4JNWA 1PMEA 2BIKB 4TW9A 4O7NA 5JZNA 3G2FA 2C0TA 3PIZA 3QRUA 3TKUA 5L8LA 4R3RA 4C37A 2JKMA 5IDPA 5J95A 3RNYA 3ZUTA 3BZ3A 4WSQA 2ERZE 5GNKA 3A62A 1M7QA 2HZ0A 5ACKA 5AUTA 4RIOA 3U54A 2ZB0A 3C4WA 2W1IA 1W0XC 3GB2A 1PF8A 3NCGA 3P23A 2R5TA 4BY9E 4LGHA 3HV5A 4EOIA 4H36A 3TWJA 3DK7A 4X21A 4O38A 1KE7A 1WCCA 1UWHA 3UIBA 3C50A 3E8DA 4E6AA 3C0HA 4EHZA 5EHOA 4AX8A 2HAKA 3BI6A 3EQGA 2XNNA 2CKQA 5L2SA 3PLAE 3ZUUA 3QTSA 3CS9A 3IDBA 3VUGA 3VVHA 5KHXA 3IW8A 3Q9YA 2ITQA 3DGKA 5KBQA 2PL0A 1YWRA 5AR8A 5M06A 1F0QA 2ZMDA 3U87A 3G0FA 3NWWA 3PXKA 4I22A 3UGCA 3NNUA 4NKSA 5HEZA 5AADA 3UQFA 3VUTA 4UMPA 2YLEA 5IEXA 3UZTA 2J9MA 3DQWA 5AP7A 2R3RA 4IACA 1Q3DA 2Y4IB 3ANQA 3MVLA 4JR7A 3KVXA 5HBJA 1KV1A 4AZEA 3PSCA 4C2VA 4FKIA 5D7AA 4D58A 4FKTA 5CSVA 4EH8A 5GJGA 3D5WA 4A9TA 3R1QA 1WFCA 3MTFA 1TVOA 3IECA 3PSBA 4FG8A 4FSZA 3BU3A 4EONA 5A4LA 5EQEA 2YM8A 3GCQA 1OVEA 2ZV8A 4HJOA 1O6KA 5CEIA 4A06A 4CFXA 4J1RA 3KKVA 3NYXA 1MRUA 4I4EA 4P4CA 5M09A 4I93A 3MFUA 3RAWA 2X2MA 1XO2B 4L9IA 2YIYA 4GUBA 3V01A 4DEBA 2CSNA 5IA1A 4D55A 2XB7A 5T68A 1M14A 2C5XA 2CGXA 1S9JA 4YJSA 2RG6A 3G51A 3LJ2A 5EKNA 5AUVA 3TACA 4YUQA 2WOUA 4DFYA 2I0VA 2W4KA 3LVPA 3N9XA 2UUEA 1XH7A 4FKRA 1BL7A 4ZSAA 1JKKA 1U59A 3F9NA 2E9VA 4GH2A 3PJ1A 2VUWA 2UVZA 4O86A 5KMKA 1WBVA 2UZUE 5BUJA 4F9CA 2P0CA 3WIGA 4GFOA 5I9ZA 5K4IA 5KMIA 5AIKA 3ORMA 3V5JA 5BQ0A 3OP5A 3AT4A 4D1SA 4BB4A 3CCNA 2Y9QA 1H1WA 1PKGA 1YVJA 3WI6A 3GFEA 4PX6A 3R9RA 3VF9A 3NW6A 5AUXA 3KRJA 3R22A 4X2NA 2W5HA 3SX9A 4BYJA 5IUGA 2C47A 2GSFA 4FSRA 3OCTA 3UIXA 4B7TA 4C02A 4DEAA 1HOWA 3Q32A 2GU8A 2XYUA 2X0GA 5M55A 2GNHA 2GNIA 2JFLA 5F1ZA 4ZJJA 2UZEA 4F65A 4FL1A 5EKOA 5C4KA 4ANOA 2WIHA 3FXXA 1OBDA 5HCYA 2V22A 5B2LA 4HGLA 3BYVA 5HTBA 4WUNA 4FTAA 3QWJA 2RKUA 4BZOA 1XKKA 2I6LA 4YJRA 4OTWA 4O84A 4II5A 2PU8A 4NM3A 3G9NA 3TTIA 3V51A 3NVKI 5DH3A 1LEWA 5CT7A 2YZAA 4I3ZA 4CEGA 2OF4A 3E7OA 5CZIA 4QP4A 3PP1A 4WD5A 5IQIA 3DDPA 4XHKB 3AG9A 2UW8A 2J6MA 3CR0A 4XLVA 4E6QA 4QD6A 3PZEA 4IADA 4TYIA 4IM2A 4X6QC 4OLIA 4ANBA 4ASDA 5GZAA 4NWMA 1OGUA 4TWNA 2WMVA 1M7NA 3PFQA 4R3PA 1UVRA 4MKCA 4RIWB 5JK3A 2X4FA 4D2TA 3G90X 3RVGA 5M4CA 1XJDA 4JDKA 3Q3BA 2UW7A 4A7CA 4BVUA 2F2UA 2EXCX 3NUSA 3R9NA 5CF6A 2YERA 4YPSA 2VTOA 5BMMA 1X8BA 2YDJA 2R3GA 3IW5A 4OR5A 4E73A 2E9OA 4JS8A 3JPVA 3ORPA 3D5UA 3DT1A 4OAUC 3HKOA 3QTQA 3RM6A 4L53A 1ZOEA 3HV3A 2OZAB 4OT6A 4J52A 4JDIA 5AX3A 3UZPA 4B99A 5L8KA 4QYYA 2PUPA 2ETKA 4FUXA 1YDTE 4O7TA 5M57A 4J71A 2QVSE 4G3FA 5M56A 4LI5A 3FZSA 5J9YA 3EL7A 4S31A 3QUEA 4PDOA 4YLKA 2V0DA 4XP2A 5CASA 4AS0A 4BDGA 3ZLSA 4E93A 2JKKA 4D4RA 1T46A 2J0LA 4FV5A 5DFPA 4CMOA 1U5QA 3NGAA 5JSMA 4NM5A 5J79A 3TT0A 3IONA 3VBXA 3FZPA 4KA3A 1OM1A 5CF5A 4PNKA 2R3OA 3NCZA 2CN5A 2WQOA 3ORTA 5IEVA 3EZRA 4CYJA 4UN0C 4U3YA 3TNWA 3OEZA 1OECA 2IVVA 2O64A 3EN4A 3PSDA 3BV3A 4N70A 4WNKA 4E26A 5A4TA 2CKOA 3MDYA 5C27A 3N4TA 5JGAA 3AC4A 3MESA 3OTVA 4FT0A 2XNMA 4G5PA 2Y0AA 2YA9A 2RL5A 4D2WA 1OL2A 2O8YA 2Z7LA 4JDHA 4ZTSA 3DK3A 1WMKA 2JBPA 3VQUA 4WG5A 4BWKA 3HDNA 2W1EA 5DVRA 4DBXA 2G2HA 3QD4A 5CU3A 4IX6A 4JLCA 3HNGA 4LUDA 4U40A 3WILA 4BCOA 2ZVAA 3CTQA 3PRFA 3IPHA 2GQGA 3R1NA 4B4LA 1Q99A 4KB8A 5E1EA 2GHMA 4W4XA 2XJ2A 4TWCA 3I5NA 4JIKA 1PXKA 3QQUA 5DHJA 4UMUA 1O9UA 3UO5A 4F63A 5IA2A 3EQFA 2JKOA 2XJ0A 3AC5A 3OCSA 4M0YA 3SA0A 4C7TA 3CD3A 5LVOA 4AFJA 4GV1A 3S4QA 2VTIA 3R71A 5C01A 3SG9A 4ANLA 2YWPA 4LMUA 5AMNA 5FEQA 5HBHA 3BEAA 4GJ3A 4CMTA 4PMPA 4V01A 3TNQB 5KE0A 1W83A 2QOKA 3TNPC 4BI2A 4ERWA 1DAYA 5AP2A 4BTKA 3QLGA 4FK6A 3F2AA 2VWYA 5BPYA 2R3MA 2NNWB 3ID6C 4AW5A 5DT4A 3PPKA 3R63A 4RJ5A 4Y95A 2HENA 4O2PA 4FSMA 2X1NA 1IA9A 3KXXA 4EK3A 2OF2A 1DI9A 3L8PA 4GIHA 2R7BA 2O65A 4KKHA 4L42A 2VD5A 4XV3A 3QTXA 1LP4A 1SZMA 4PL5A 4ZTRA 4FSTA 4C4JA 4O7LA 3GENA 1K2PA 4IWOA 4Y83A 4NSTA 3FY0A 3OUKA 4IHPA 1DAWA 2J0JA 3EQDA 3R9HA 1HCLA 4GS6A 3U4UA 4IWPA 2CDZA 2JAVA 4V0GA 4PF4A 4EOLA 4GT5A 4O0YA 4IM0A 3TTJA 2RFNA 3BHVA 1Z5MA 3I0OA 4PMMA 3D7TB 1GJOA 3TV6A 3PVGA 4QP9A 2OO8X 1QPDA 3KXMA 5CNNA 5IU2A 3TL8A 4LGGA 4NK9A 4FUYA 3GFWA 4RA4A 3T9TA 4F0FA 3GC7A 4FIFA 4IANA 5J1WA 2BZHB 4PMTA 1PW2A 1J1BA 4WG4A 3ORNA 4BBFA 2PPQA 5AR4A 2GDOA 4P7EA 5AP0A 5C4LA 1YWVA 3COIA 3MJ1A 4IZAA 4TYGA 4BYIA 1TQMA 3LQ3A 3LQ5A 3MA6A 3NAXA 2W96B 2ITYA 4AE9A 4KRCA 5DEYA 4L7SA 4MEDA 4CD0A 3WE4A 4W9XA 4RWJA 4YU2A 4NKAA 2WZJA 5C8KA 3A7JA 2JD5A 4FZAB 4UWYA 4X3FA 3R7OA 3AGMA 3D5VA 4EK8A 2PTKA 3L8SA 1OKZA 3VWAA 5HZNA 2QKRA 2BKKA 1LUFA 4CTCA 5L2WA 3HP5A 5CZHA 4J96A 2NRYA 4U44A 2E9NA 2CGVA 4O0UA 5K0XA 5DT3A 2OJJA 4ACDA 1F3MC 1KE8A 2ZDTA 3MWUA 4F64A 2PMLX 3DZOA 3L8XA 4DGOA 1JKTA 3DLSA 4YZCA 4G6OA 1H26A 4KAOA 2IO6A 2ZV9A 4G3EA 3A7HA 4IEBA 2UZWE 3S0OA 4O7WA 3FAAA 4CVAA 3ALNA 4I4FA 4N6ZA 5HKMA 4GK4A 2BFYA 3FSKA 5H8BA 4QMOA 1GIHA 2QQ7A 3C5UA 5AAFA 3CY2A 4Y5HA 5HICA 4FV3A 5HORA 2GS6A 3U6JA 2YZLA 3DDQA 1K3AA 3CQEA 3OVVA 4IZ7A 2Y7JA 4KKGA 5C8NA 5D1JA 5JMSA 3DTWA 4KNBA 3WF8A 3LFCA 1KE9A 2XNBA 5E8ZA 4XG9A 4FMQA 1STCE 4G5JA 2ERKA 4FNZA 3LM0A 3NR9A 4H3PA 4FR4A 4RLKA 1PJKA 3RPVA 5E8XA 4AFEA 1SVEA 3QWKA 3FL4A 1ZY4A 2YJRA 2O0UA 3ZM9A 2QC6A 3HA6A 2B9FA 4BDDA 2JDOA 2X9FA 5LWMA 2BAKA 4J98A 4EJNA 4K8AA 3F3TA 2W1GA 3UVQA 4CKJA 2B9HA 4WRSA 3KA0A 3PWYA 5EW8A 4HVSA 5J87A 3C5IA 1U54A 3GP0A 3B2TA 4FTMA 3UP7A 2REIA 4CRSA 3DXNA 5L8JA 4NT4A 4M66A 3QQGA 4CFMA 4EOOA 2J4ZA 4GG5A 4G17A 4PY1A 4W4YA 2YN8A 3G9LX 4FTOA 3ZFXA 1M2PA 2Z2WA 2V5QA 3SDJA 5FTGA 4NEUA 4DCEA 4XV2A 3DPKA 3VS6A 4AA4A 3PZHA 2ZDUA 4GT3A 4UXQA 3LMGA 4L8MA 4XG3A 4F9YA 1O6LA 3VF8A 3E62A 4FVQA 3DK6A 2Z7QA 3DJ7A 1PXIA 2BRNA 3H30A 3O2MA 3HMPA 3DAEA 3LJ1A 3MFSA 1OB3A 4QNAA 4FGBA 3BGQA 3C1XA 2EUFB 2XK8A 2E9PA 1XH6A 4P90A 1AQ1A 2XIKA 5JKGA 3OROA 3FLSA 4S32A 4OTRA 5CU4A 5D12A 4ZSEA 3L9NA 4MWHA 4ZIMA 5BUIA 3TDWA 2X7GA 3JVSA 2C3KA 1Q8TA 2YCQA 3LXKA 3P08A 3H9OA 4O27B 5AUYA 4USDA 4DGMA 3PLSA 5EI8A 1MQBA 3D15A 3D9VA 3CPBA 4I1ZA 4JBQA 4MNEA 3UTOA 5K5XA 4JI9A 3NUXA 4GIIA 4IB0A 2ITUA 4WA9A 2WELA 4ZTHA 4WKQA 3VULA 2OFUA 2PVHA 4CQEA 3P7BA 3FUPA 1V0OA 4KSQA 4GT4A 5CYIA 3UC4A 4E1ZA 2WTDA 4QTBA 5H2UA 2YIQA 3F82A 4FOCA 4FTNA 4OTIA 4UMTA 2KTYA 3QXOA 2YEXA 1R0PA 3R6XA 2HYYA 3SLSA 3V3VA 4JG6A 3W18A 3QTWA 2B1PA 5HHWA 4EI4A 4RJ6A 2O63A 2WQBA 4C33A 2V7AA 3BRBA 3VUKA 4OGRA 2OU7A 3EMGA 3R02A 4PDPA 2HWOA 3W2CA 4U7ZA 1KOBA 2QO2A 1OL6A 2XM9A 3MY1A 3IGGA 4RIYB 1YHSA 4A9RA 5BVFA 3WE8A 3MFRA 3NDMA 2X8EA 4DLJA 2F7XE 3Q4ZA 2RF9A 2W4JA 5IQEA 3FYJX 4ZY5A 1TKIA 1WBWA 2UZDA 4A4XA 3DXQA 2PZRA 4U41A 4YLJA 4I23A 2BDJA 4BCPA 4CCBA 5E8YA 4C3PA 4QP3A 1P14A 4EKLA 3UO4A 4HVHA 4U5JA 4MBIA 2ZYBA 3DAKA 3E8NA 4IX5A 4Z16A 4BCHA 3MPAA 2ZM4A 4QP2A 4L3LA 3W2SA 1PMNA 2C6EA 4BCFA 3RALA 3LCDA 2WQMA 4QT1A 3W2RA 4IAYA 5HTIA 2CKPA 4I24A 2XCKA 4FKOA 2XNEA 4ANQA 5J5SA 4Y72A 3EN9A 3FMMA 5AUUA 3FMNA 2GHLA 3JUHA 4TYHB 4G3GA 4TY1A 3R7EA 4U81A 4OUCA 4XG4A 4AA5A 3TM0A 1Q8ZA 5TE0A 4QYGA 4LOPA 2I7QA 4XG2A 3ZDIA 4Z9LA 4QMYA 5CEMA 4HCTA 3VO3A 4IJPA 4DTAA 3RAIA 4FV4A 4FSYA 4G9CA 4MXZA 2WTJA 4FKSA 3PA5A 1H1PA 2VGOA 4X2KA 3G6HA 4FV0A 4K77A 2HIWA 1YI3A 3QQHA 5AEPA 3FMEA 4B8LA 1REKA 4G9RA 4U3ZA 2OJ9A 3ZMMA 4CV8A 1Q8YA 1WBSA 3BWJA 4L01A 3ZLYA 3CGFA 5FTQA 4ACGA 3OWJA 3FYKX 3H3CA 5HNIX 4BWPA 1NW1A 3UIMA 3ZU7A 4FTQA 1Q41A 4JOAA 3DJ6A 4IM3A 4U45A 3QQKA 4EK5A 4YHTA 4BICA 5IH5A 4CXAA 3VUHA 3NX8A 1SM2A 1ZRZA 3E64A 3NYOA 4PTCA 2C30A 4RFZA 4RSSA 5CEQA 3NVMB 3UQGA 3HX4A 5D41A 2OH0E 4X3FC 4FK3A 3RHKA 1H08A 2AYPA 2F2CB 4A07A 4XCUA 5AUZA 4MXXA 1I44A 1ZARA 4IW0A 2G01A 5DLSA 1QPCA 4FTRA 3VW6A 5A3XA 1BUHA 2OSCA 3ORXA 2UW4A 4AOTA 2C3JA 4KIPA 2F4JA 3EB0A 4E4XA 5GHVA 2QU5A 4BGHA 4C59A 5FM3A 3ZDUA 2QOQA 1ZZ2A 4AN2A 3F7WA 4AZWA 2F57A 3EJ1A 5L2TA 3KU2A 5AM6A 3UE4A 1IG1A 4FT3A 4U42A 3R8MA 4CQGA 3KK8A 3PG3A 4CV9A 3O7LD 2YJSA 5CSXA 4BDAA 4DITA 3UQCA 4BIDA 3D4QA 3LLAA 2C5NA 4GK2A 2Z60A 2Q0NA 5IQFA 5DG5A 4F08A 2YM3A 5JFVA 3NUUA 2X6DA 5C1QB 4D2VA 3CEKA 3QUDA 2DYLA 3QZIA 4JL9A 3OC1A 4M15A 4YO6A 3F3ZA 5AR5A 4LV5A 4FTUA 4ANMA 4ENXA 5BX0A 5IMEA 4IXPA 2B9IA 3AC8A 4ITHA 5E7RA 1OPJA 3NLBA 5L2IA 2QR7A 5L6PA 5CU6A 4UY9A 1HCKA 2C6MA 3DFCB 3JS2A 2IW8A 4O1PA 5FQDC 3ZBFA 2R3NA 5CWZA 2WMRA 4KS8A 3B2WA 3O50A 5FLFA 4D4VA 1B6CB 5GINE 2V62A 5LCJA 1GZKA 1ZOGA 1XBAA 4ASEA 5JFSA 5E4HA 3VIDA 4FL2A 3TN8A 1MP8A 3LHJA 3DV3A 4HPUE 4ACCA 2VNWA 5HIBA 2HCKA 3HRBA 4GVJA 4LRKA 2XCHA 4AW0A 4FT9A 3VW8A 2X81A 3FPQA 2IZUA 3TG1A 1Y6AA 5BVOA 5GIPE 3OG7A 4MXCA 1NA7A 5T3QA 3C4FA 4ZS0A 5FBOA 1ZYCA 2V55A 2FGIA 1L3RE 3UIUA 3LM5A 3R0TA 1XH9A 4WNOA 2W99B 2BKZA 1Y8GA 4BCMA 4C3FA 3WZKA 4FKLA 3VN9A 4PWNA 5IKWA 4ZMEA 4GJ2A 1Q4LA 1W98A 4O91A 4FTKA 3O71A 3MW1A 2GTMA 2WGJA 5DWRA 1ZMWA 2YIXA 3MY0A 3FZ1A 3NIEA 5KX8A 5FDPA 3O23A 4FC0A 2WTKB 3O8PA 3PPZA 4L00A 2ZJWA 2IVUA 3I6WA 3ANRA 3GUBA 4NCTA 3FZRA 2I1MA 5AA8A 4I94A 1NVSA 2WQEA 4YHFA 3W2OA 5HG5A 5KBRA 2R4BA 5KKRB 4A4OA 4DFUA 3VUIA 4J97A 2R3JA 1XH4A 4L45A 5E8UA 3ZONA 4FEWA 3KCFA 4EZ5A 2GFCA 3E8EA 3I6UA 4BC6A 4ZLOA 3GU4A 5HI2A 3DY7A 2PVKA 4ORKA 4FE2A 4U79A 3THBA 4FSWA 4GYGA 2ZV2A 4XV1A 3MA3A 2ETRA 3P79A 4EQMA 4N4SA 3UNJA 3H9FA 3EN6A 4FX3A 3HMMA 3E63A 4OTPA 5LARA 4D2RA 3OOGA 3KK9A 3KMMA 3UPXA 2C1BA 2YITA 3VHEA 2FVDA 3VS1A 4CSVA 4C62A 4ASXA 3MH0A 4FV9A 5FG8A 3CJFA 2G2FA 3PRIA 4RFYA 2PVRA 3CBLA 4DH3A 4QYHA 1H1QA 2PUIA 4ANSA 2XRUA 5HU9A 4U6RA 2J0MB 1P4FA 3D83A 2VWBA 1WZYA 3R1YA 2X39A 2EB3A 4DAWA 4EH9A 5HQ0A 4I6FA 4LYNA 4ZZNA 2WHBA 2CLXA 2OH4A 1QPJA 3PY3A 4OT5A 3UC3A 4USEA 5C26A 1Q61A 1WBNA 3EN5A 3F7ZA 4BDKA 4BI0A 5IDNA 4FEQA 2WNTA 4RVKA 3AT2A 4WT6A 4NW5A 2XKFA 4J8MA 3CD8A 3RKBA 2Z8CA 2A19B 3ZEPA 2WMUA 4TKSA 2ZMCA 3RK5A 4CKIA 5CF4A 3DKOA 1YOMA 4RPVA 5H3QA 2XMYA 3VJOA 1WBTA 4M0ZA 4O0TA 4GKIA 3O51A 3QTIA 3MSSA 1PXJA 2PMNX 2QOFA 4OBQA 4V04A 3MVHA 5LVMA 2C6TA 5FDXA 5LWNA 2OICA 3FXZA 2JGZA 3EFJA 5EM6A 4MWIA 2YHVA 4XBUA 3GU7A 2UV2A 2XA4A 2W1ZA 2Y4PA 3OWKA 4FBXA 5JN2A 2A0CX 4QMSA 3FV8A 2R3FA 4R6VA 4EOJA 3D2IA 3WZDA 3IOPA 4I41A 2O3PA 4I5PA 2Y6MA 2WTIA 2W9FB 3OHTA 4U43A 2ITVA 3A7FA 2PVJA 4OTGA 4F0GA 3PE1A 5E91A 4BCNA 3VS7A 4F7NA 3Q5ZA 4JQ8A 4IJ9A 2QO9A 2R3HA 5DNRA 2BTRA 4QMMA 3HZTA 4IDVA 3V8WA 4AT5A 2Z02A 3VBQA 4GFMA 3BYOA 5CAPA 5IPJA 3OBGA 2P2IA 4O81A 3P5KA 3T3UA 3AT3A 1MQ4A 2WD1A 3OXZA 3KC3A 4JQEA 4R8QA 4FVPA 4ANNA 4CFVA 3FQHA 3RCJA 4EH4A 3FDNA 2XBJA 1NT2A 4X2FA 3SVVA 3LQ8A 1KUTA 4RWIA 1G8SA 3E8CA 2BAJA 2XUUA 3LLTA 4KABA 1EH4A 4UX9A 3FBVA 4DHFA 3H0ZA 2HWPA 3GQLA 3RP9A 3OCBA 3QTRA 4YZNA 3VBVA 4TYEA 5LQFA 1L8TA 3MY5A 3RGFA 3LMHA 2WTWA 2UZBA 2YM6A 3IGOA 5IQCA 3V8SA 3KRLA 3MIYA 5AR2A 3RPRA 4C34A 2W1CA 4WUAA 2NRUA 4W4WA 2DUVA 2FSTX 3ZZEA 4ASZA 4HW7A 5AP5A 4NTSA 4FIJA 3W8LA 5TKDA 5GJDA 5AR3A 5K3YA 3UNKA 3E92A 3FXWA 3UMWA 1NXKA 4YJUA 3RM7A 5A9UA 1TQPA 2XYNA 4IZ5A 4F9WA 2HW7A 4I5HA 3DKCA 4J53A 4YC3A 2VAGA 3OWLA 2X9EA 4HGEA 2LAVA 4BCIA 4U97A 4Y8DA 2ZAZA 3Q53A 3E93A 4MXAA 4I5MA 2P3GX 3E88A 4ITIA 3BQRA 4HCUA 1YHVA 3QZGA 4DFBA 5CS6A 3PXFA 1GAGA 3RWPA 4HGTA 2JDVA 4IFGA 5AA9A 4K33A 1GZNA 5L6OA 4NYEA 2I0HA 2P2HA 4YSJA 3UODA 2W7XA 2BALA 4M69B 3CE3A 4E5WA 4WO5A 3KB7A 4KS7A 5J7BA 3KRXA 4AW2A 3LXLA 4PPAA 5CSHA 3GNIB 3VUMA 4QMWA 4KINA 4DLIA 3SRVA 1URCA 2VO0A 2PK9A 3BE2A 5E92A 3HV4A 4ZTLA 4F4PA 3TIYA 3BU5A 4RVMA 4F6UA 2C68A 3DCVA 1J7UA 4UBAA 4ZLYA 2R0IA 4BHZA 2WU6A 4TYHA 3ZBXA 1UA2A 4DFZE 3EQCA 4EC9A 4FOBA 2WMAA 3TNIA 3BELA 3KQ7A 3Q9WA 3QGWA 3TZ9A 4C36A 4YNOA 3NAYA 4Z55A 5LVPA 5E9EA 5DI1A 4AWIA 5AUWA 3DFAA 1P2AA 1UNHA 5HVKA 4FVRA 2J0KA 4NM0A 5L6WL 1V0PA 5CEOA 1FMOE 1H07A 3UVPA 2VTTA 4IVAA 3SXSA 1UV5A 4BCKA 3CC6A 3DBQA 3Q5IA 4FG9A 3R9DA 3PXRA 4QTEA 3A7GA 4O1OA 5J9LA 2VTMA 4KIQA 4PTGA 4YJVA 4ITJA 4ZY4A 3Q6UA 4XLIA 4I92A 3ATTA 1CDKA 4NFNA 2YM7A 4DGGA 5HVJA 3O0GA 4XG6A 4ZSGA 4IAIA 5IF1A 2YLFA 5ANGA 4ZP5A 2C5OA 1Y8YA 3H9RA 3WF5A 5LVLA 1H1RA 4C2WA 4RBLA 1OKYA 4NCTC 3IOKA 3I0QA 2VX3A 3RINA 1ERKA 2QOCA 3NUYA 2IZTA 2B7AA 3BHUA 3F5UA 3HV6A 3MVMA 4M8TA 3QL8A 4O0VA 3UVRA 4YMJA 5DR9A 3IKAA 2WEVA 3TJDA 4DT8A 2AC3A 2AC5A 4HZSA 3U9CA 2HK5A 4XP3A 3ROYA 3QTZA 4K9YA 3TXOA 2PE0A 4GYIA 2PE1A 5BVWA 3HEGA 3ALOA 3P0MA 1TQIA 4JIAA 1CKJA 3WZJA 3OEFX 4LL0A 3P1AA 2VTPA 4GG7A 5HBEA 4ZY6A 4W8DA 3D14A 3FY2A 5ETAA 3D0EA 4D4YA 3R7UA 4MF1A 3Q4TA 3V5QA 2CLQA 4JG8A 5JFXA 3GI3A 3HVCA 3MB7A 4ERKA 1OL7A 4PQNA 4FKUA 4R5SA 5ACBC 4FT7A 2A2AA 3IDCA 3SXRA 1UU3A 3LIJA 3VS5A 3Q4CA 3U9NA 1RW8A 5TF9A 4AT4A 4LG4A 1JSTA 5JFWA 4XRLA 2XK9A 1JKLA 2C6LA 3CQWA 4BCQA 4QP6A 4EBWA 4DA5A 2X6EA 1DM2A 3GEQA 4CLJA 3S3IA 5G1XA 4AOJA 4JJRA 3QF9A 2OI4X 2I0EA 3E3BX 4JBPA 3IK3A 3UNZA 1OITA 1YHWA 3BLRA 5A14A 4M13A 3QC4A 3AD4A 3EYGA 3GCPA 4IAKA 2OFVA 4W8EA 4YZ9A 3QRKA 3ZXTA 3DBCA 4CCUA 5TR6A 1ZOHA 2VTSA 4EH6A 4MF0A 4EL9A 2FUMA 4EUUA 2EWAA 2VTJA 5M44A 2X4ZA 1RE8A 4Y46A 3UOJA 2BCJA 4KKEA 3CSVA 3D2KA 2FSOX 4RZVA 4CT1A 1BYGA 1J3HA 4FSNA 4MXYA 5EW9A 5EYDA 5A4CA 2GPHA 3EKNA 4XP0A 4JAJA 1WVXA 2W5BA 3SC1A 2VTLA 4FIHA 3ZZWA 5G6VA 2BRHA 4IAZA 4QQJA 5L3AA 3R8ZA 4TNDA 1PKDA 1GY3A 4BWXA 2C0IA 1BLXA 4A9YA 1M17A 2XK7A 3G33A 2XP2A 4EH7A 4O82A 3NMUF 4CT2A 4GUEA 1SYKA 5DRBA 5EW3A 4D2SA 3SW4A 1JSVA 3K2LA 3CY3A 3OS3A 1H4LA 3ROCA 3VS4A 1A9UA 1JQHA 5AP3A 4UMRA 3OXTA 4QPAA 5GZ9A 1XWSA 1WBOA 3IO7A 1BI7A 3P86A 1GOLA 1FGIA 3OBJA 3V04A 4ALVA 2QODA 3QCQA 4FYOA 5KZ0A 5EYMA 3MI9A 5KCVA 1DS5A 2P55A 2XKEA 3OMVA 3BBTB 3IG7A 5M53A 2ACXA 2HXLA 4DC2A 4NIFB 4L7FA 4M14A 3S00A 2PMOX 1R78A 3ZRKA 1WBPA 4KIKB 3LXNA 1W8CA 2R3LA 3LCKA 5I4NA 2BFXA 4DEDA 5IQDA 4UXLA 2JC6A 4MYGA 2C0OA 1CKIA 2J50A 4UALA 2PSQA 4RWKA 2XZSA 4Q5EA 4D0WA 5HU3A 1H0WA 4DINA 5D7VA 4FI1A 4YHJA 4ZTNA 5IUIA 4QMUA 4FNXA 4BCJA 4EOQA 3GBZA 4YO4A 2B53A 1RQQA 3PIXA 4FG7A 4JX3A 2R64A 2XNOA 2VNYA 2CMWA 4L46A 3ODZX 4DG3E 4AN3A 2C6DA 4CNHA 4UZHA 4IB5A 1H1SA 1ZAOA 2PYWA 1AGWA 2H8HA 2XNGA 4RT7A 4AZSA 3U51A 4FT5A 2WOTA 3KULB 2J0IA 2PZYA 1FBNA 3WZUA 1JKSA 4C4GA 5AV4A 4BDHA 5A46A 3SG8A 4HNIA 4RRVA 3K5VA 4UV0A 3DTCA 2WTCA 5EYCA 4G31A 3R28A 4F9AA 1J1CA 2BZIB 3FZTA 4FEVA 3ODYX 3OOMA 5CVFA 4L44A 1E9HA 4YJNA 5KMLA 5B2MA 5IH4A 1SVGA 4JDJA 2W06A 4XOZA 2PZIA 3DAJA 4TN6A 1Q62A 4GL9A 2VU3A 3TKHA 3C9WA 3F88A 4UEUA 4L52A 5KZIA 5HO7A 1AD5A 3CTJA 3I7CA 3L9PA 3M2WA 3QD3A 3ZUVA 4XYFA 2QLUA 2JIVA 4LOQA 2WTVA 3RPYA 4F6SA 5DA3A 5HX6A 3QGYA 3LKMA 5D10A 2IG7A 2CHLA 2IZSA 3DLZA 1U5RA 1JBPE 3QKKA 3QRIA 2XIYA 4PUZA 3ZH8A 3LJ0A 4M68A 2WKMA 5DN3A 3D7ZA 3VS0A 3TV4A 4P5QA 4B0GA 4NJDA 1JLUE 3SXFA 2X8DA 4EUTA 3BLHA 4XV9A 5IMXA 2JDSA 3ZM4A 2EU9A 3LW0A 3R21A 1Q24A 2BRBA 2UZLA 4CZYB 4ALUA 5FXQA 2F49A 3KF7A 4X7QA 3V6SA 3M42A 2BRGA 1BKXA 2OJIA 3QRJA 4IWQA 2PVFA 5IH6A 3F5GA 3N4UA 3PXZA 3SAYA 4C38A 2VWZA 5EH0A 2GS7A 5BMSA 4E4LA 3TZ7A 3R2YA 3CLYA 2PVLA 4EEVA 2QURA 2XK3A 3V6RA 2VWIA 4XG7A 4FICA 5I9YA 3GC8A 4K2RA 3KGAA 4GW8A 1PYEA 4FZ6A 5FEEA 3BHYA 4BTJA 3QYWA 2VWWA 4OTQA 5HX8A 5M51A 5JH6A 3ULZA 4HPTE 2XNPA 4CZUA 5IA4A 2QONA 5HD7A 1BX6A 3ATSA 2R0UA 2CGWA 2OJFE 3PXYA 1URWA 3R2BA 3POZA 5E8TA 3SHEA 3ZLXA 2HOGA 2GNFA 3QQLA 3QKMA 1T45A 4GSBA 3UOHA 2IZRA 4L3JA 4A9UA 4NTTA 4X0MA 2CN8A 3PVUA 4MXOA 2YIRA 4DN5A 4QTAA 3ZO4A 3FEGA 1ZMUA 5CSWA 4DFLA 3ORIA 4GEOA 3ZSGA 3V5TA 1IAHA 1Q8UA 1ZZLA 4MH7A 1XH8A 3MH3A 3VC4A 4EWHA 4PMSA 4S30A 2BHEA 3NYVA 3ZEWA 3NUAA 5IQAA 4XEYA 3MYGA 3Q6WA 3R04A 3HMOA 2IVSA 2YCSA 3VBYA 4MTAA 1FOTA 3LXPA 2YABA 3NW7A 4X3JA 3FI2A 5LVNA 2XIZA 3BX5A 1A48A 3MJ2A 4K18A 3OW4A 3C0IA 2R3PA 5DE2A 3QA0A 2HELA 4QOXA 2JDRA 4U0IA 4QP7A 1LEZA 3G15A 2ESMA 3JYAA 3O7LB 3K3IA 3VHKA 4FTJA 2IWIA 2XIXA 5DMZA 5E8SA 3UO6A 2XVDA 2CGUA 4IX4A 4RIWA 2NP8A 3A60A 3DBEA 3M11A 4YNEA 4DEIA 4BL1A 4BGQA 2YAAA 3E5AA 3FC2A 2BDWA 4R3CA 4BKJA 3PYYA 1SMHA 4KIOA 3LMIA 4WG3A 2OG8A 1JSUA 3EWHA 4PPBA 5A6NA 3EQPA 3RAHA 5IISA 5GJFA 3BGZA 5IUHA 4XG8A 4CFWA 4LRMA 2BPMA 5E8WA 4L43A 4U80A 4FEXA 5EHYA 3WBLA 5EI2A 5EOLA 5TO8A 4FTCA 2OZAA 2IPXA 4CRLA 4USFA 4I6BA 3QX4A 4WNMA 4AA0A 2LGCA 1GIIA 1P5EA 4F7JA 4HNFA 2A4LA 4KBAA 3PP0A 3QD0A 3VS3A 3FI8A 2PZPA 5LMBA 2X7FA 5JGDA 1OMWA 4BI1A 1YXVA 4GU6A 5CX9A 4W4VA 3HUBA 4N6YA 5A6OA 1PMUA 4BDCA 5CANA 3JXWA 5EM8A 4IX3A 3NSZA 3E7VA 3QCYA 4WBBB 5E90A 4L68A 5HE0A 3W2PA 3OTUA 2DWBA 2W0JA 4DH8A 1J7LA 2ITPA 4FKQA 3GU5A 3I7BA 4TNBA 4A4LA 4F9BA 1BMKA 4FF8A 2GQSA 3P7CA 4TWPA 3BE9A 4O6EA 4B6LA 5AM7A 4FTLA 1H0VA 4FKPA 2O2UA 5FM2A 4JXFA 2W1FA 3Q04A 4HYHA 2QOIA 3KXNA 4IC7A 2XS0A 2YAKA 3NIZA 5AX9A 3GCUA 4MAOA 4MD8E 2PWLA 2UW6A 1BL6A 3O8UA 5KKRC 4WIHA 2WFYA 2XK6A 3PTGA 4EOMA 2VWXA 2R9SA 3QX2A 4IMYA 5EM5A 3RPSA 4C4IA 1Q3WA 3AC1A 2OBJA 4AN9A 3WARA 5IQBA 4RFMA 1U4DA 4IDTA 4AACA 3COMA 4H58A 4UWBA 3KN6A 3PDTA 1ZXEA 1SNUA 4G16A 4RC4A 4BHNA 5HD4A 2YCFA 3SQQA 4FKVA 5B2KA 4HCVA 2EVAA 2YCRA 4LV8A 3QQJA 2PE2A 4BTFA 2J90A 3KREA 4QQCA 3S2PA 3OW3A 1UNLA 3QD2B 1CM8A 5HNBA 3ETAA 4MNFA 1PHKA 4OTHA 3W10A 5F95A 4MBJA 1XH5A 3FMHA 1M2QA 4UZDA 2VTRA 5CVGA 3W32A 3QBNA 4UYNA 5DT0A 2VRXA 3G5DA 4AGCA 5M4FA 5H8EA 1YQJA 3GGFA 3NUNA 1UNGA 4ACMA 3DQXA 4EWQA 3ZXZA 2B55A 1Q8WA 4LL5A 4DH7A 3UG1A 4DG0E 4KUJA 4O7YA 2W5AA 1J7IA 3LE6A 4V0GB 1S9IA 5HE2A 4MBLA 5H9BA 4YLLA 3C4EA 5HG7A 5A4QA 1PMVA 4NM7A 1QCFA 4F70A 3R00A 4I5CA 1I09A 4XJ0A 4IE9A 5FTOA 3PG1A 4PDSA 4GMYA 5HGIA 3FZOA 2ITTA 4OBOA 3D7TA 3MB6A 1VYZA 4EH2A 3VNTA 4EHEA 4IZYA 3EH9A 1J91A 2Y4IC 2RIOA 1U46A 3VQHA 4YJPA 1Z57A 3OT8A 1R3CA 4E3CA 3W8QA 5EDPA 3ET7A 5BVDA 3MVJA 1M52A 3S95A 1V0BA 4V05A 3COKA 4FV1A 3WOWA 4JBOA 4CZTA 2QCSA 3ZO1A 4N57A 1Z9XA 4QMPA 4RIXB 2RG5A 3BYMA 3KMWA 3FLYA 5KMJA 2WEIA 3AGLA 4HZRA 4JRNA 3WF7A 4E5BA 2OZOA 5ICPA 1UU9A 3U6HA 1YOLA 3TNHA 5CENA 3LPBA 5M08A 2VO6A 4DGNA 1MRVA 3F2RA 5AFVA 5DYJA 1KV2A 1R39A 4BRXA 5AP6A 4YPDA 3HP2A 4TL0A 2OKRA 3FKNA 1YKRA 3UOLA 4FV2A 4BCGA 5DRDA 2OIDA 2ZM1A 3FLZA 4EZ3A 4NJ3A 5M07A 2G15A 5K5NA 3Q2MA 2XRWA 3ORKA 2X2LA 2FA2A 4Q5HA 4FKJA 4E4MA 3E3PA 4DGLC 2OLCA 5IA0A 1PXMA 4HVDA 4YTHA 3UOKA 5JGBA 4H1JA 3ZFYA 4R1YA 5J9ZA 5LCKA 2C3IB 3QHWA 4ZEGA 4R7BA 3TJCA 4E6DA 1CSNA 1PXOA 5AR7A 4TPTA 3AOXA 3D94A 4KBKA 5CY3A 3Q52A 1APME 2NPQA 2VTNA 3FE3A 3TI1A 4HGSA 4LRJA 3R7IA 5AP4A 4KIKA 2H34A 4ACHA 4IAAA 2OXXA 4RMZA 4J7BA 5H8GA 3ZSIA 2Q0BA 1PRYA 3CQUA 3FPMA 4J99A 4B8MA 1FQ1B 3KXZA 5DR6A 2X7OA 5D9HA 5AV2A 4I0RA 2FB8A 4IQ6A 3R9OA 3HAMA 3R1SA 5I9UA 3EFKA 4HYIA 3PPJA 4YTIA 3KY2A 4EK4A 2W17A 4MK0A 3TIZA 2JITA 2ZB1A 1QPEA 2PZ5A 3EQIA 4QMTA 2G9XA 2BAQA 3AD5A 5CT0A 5FXSA 3RJCA 1SNXA 1XBCA 5DBXA 4BDBA 4ZLZA 3QU0A 5FUTA 3BGPA 4XX9A 5EM7A 4EOKA 1U54B 2OGVA 3GCVA 3IDPA 2FSMX 3MPTA 3QLFA 4KWPA 2ETMA 2JLDA 3IS5A 4AF3A 3EQRA 4AGWA 1CMKE 3KULA 3UYSA 4Z7GA 5HIEA 3EQHA 1OZ1A 3OY1A 1K9AA 3NNXA 4RC3A 2QOOA 1YW2A 2Y6OA 4CG9A 1XQZA 5J5TA 4QPMA 1OUYA 3D5XA 3BKBA
chains in the Genus database with same CATH superfamily
1FVTA 4DFNA 3A8XA 5CSPA 1PXNA 2VX1A 4D9UA 2XAOA 3R8PA 4RQVA 4RX8A 2OIBA 4XH6A 5B0XA 5M4IA 3EKKA 4BKYA 3LFDA 5CQUA 4DF3A 2J2IB 3QQFA 4KBCA 4EKKA 4Z3VA 3ZHPC 3TZ8A 4ZZMA 4EBVA 3MFTA 3ZOSA 3LCSA 3O17A 5A54A 4D1ZA 1H8FA 1IASA 1JOWB 2WB8A 3JY0A 4RVLA 4ZJIA 3B8RA 3RI1A 3ZFMA 4O7VA 4BR3A 4JQ7A 2GS2A 4RG0A 3QKLA 2C6IA 1IA8A 5EHLA 1YXXA 5EK7A 4K0YA 4C3RA 3FMKA 4JVGA 2C1AA 4O0SA 5FD2A 3ZRLA 4PL4A 3T8OA 4F1TA 4QNYA 4U9AA 2R3QA 5BYLA 1OGYA 4K11A 2DS1A 2VZ6A 3NRMA 3TCPA 3Q9ZA 2PY3A 2QI8A 4NW6A 5JEBA 4R78A 4MNEB 4O2ZA 4D9TA 3OZ6A 4FV8A 4YBJA 5JQ5A 4ENYA 4H3QA 4XNEA 4O0RA 3ZC6A 5FBNC 4DEEA 4CTBA 1ZMVA 2CCHA 3NPCA 4IH8A 2W05A 4BF2A 1VR2A 1E1XA 3W1FA 4ID7A 2IW9A 2ZM3A 1WVYA 4O96A 2EXEA 3UYTA 1QL6A 4P5ZA 5CAVA 5I0BA 3R01A 5ANEA 4ZTMA 1V1KA 3W55A 2RFSA 4RVTA 4YR8A 4TRLA 1VZOA 3FHRA 4LFIA 1ZYSA 4U8ZA 3LAUA 5EG3A 2FO0A 2CKEA 2PVYA 3QCSA 4DH5A 4FGRA 4IB3A 3WYYA 3I1AA 3REPA 3QUPA 3BYUA 3R83A 3ZTXA 4BN1A 5CAUA 4FSQA 4FZ7A 4G3CA 2E9UA 3ACKA 3ACJA 4FTIA 4M97A 3PWDA 2BUJA 2WMSA 3SOAA 4BDEA 2I40A 3HLLA 4EOPA 2C69A 2ITZA 2F7EE 4F1OA 3TUCA 4EYJA 3ZO2A 1YRPA 1UKHA 4L67A 4RIYA 4BIEA 2C5VA 2VO3A 3C4CA 4N0SA 5DOSA 3FL5A 4F6WA 2Q83A 4O7SA 2VGPA 2WU7A 2VN9A 4LV7A 4AZFA 4O0WA 4RWLA 4MX9A 3KFAA 3SKCA 4JR3A 3JVRA 5I5ZA 4CFUA 3KMUA 3JR1A 3A2CA 3KRRA 4QPSA 4KRDA 4AUAA 4BZDA 2B0QA 4C61A 1PYXA 4G6LA 3PJ8A 1Y6BA 3BYSA 3KXGA 4XUFA 1H24A 2A1AB 2UZTA 2XEYA 4KD1A 3LOKA 3BLAA 3CKWA 2WAJA 3BU6A 3QYZA 3DB6A 4FV6A 2BROA 4XS2A 5JQ8A 2BZJA 3ORLA 4CFFA 5EQYA 3HECA 2W1HA 5HVYA 1UU7A 3FC1X 2HW6A 3BIZA 4UB7A 3VS2A 3QC9A 2UW9A 3U4WA 3V5PA 3TZMA 5HCZA 4YJTA 4D0XA 4MQ1A 2XKCA 2XM8A 3GU8A 2WO6A 5HG8A 5K9IA 3HV7A 2O5KA 5LXMA 1IR3A 4BDFA 3RPOA 3EFLA 2J51A 2ONLA 4HVIA 2WMXA 4E8AA 1NVQA 3DOGA 1JWHA 3ITZA 4DH1A 3DXPA 2A98A 3K54A 3QA8A 2QG5A 3DNDA 1YDRE 5ETCA 2YIWA 4QYFA 3QZFA 2GMXA 2RGPA 2JIUA 1CKPA 1B38A 4CG8A 4O7ZA 4FTTA 4WNPA 4EHVA 1CTPE 5KMOA 5I9XA 3COHA 4AZVA 1YI6A 2JIIA 3L9LA 2BTSA 3L8VA 3OXIA 4G3DA 1H25A 3OY3A 4JBVA 5EOBA 3PIYA 5L2QA 3BQCA 3PXQA 3HMIA 4TYJA 4XOYA 2JBOA 1OIQA 5EFQA 3CP9A 4FZFB 3U8WA 3UJGA 3IW7A 2GHGA 2XBAA 3NS9A 2YFXA 3FLNC 2UVYA 4X6RA 2VO7A 5IQGA 4AXAA 1FVRA 5EI6A 4L6QA 3M1SA 4C4HA 4WSYA 1REJA 2X8IA 4XRJA 4I0TA 4ZSLA 4E4NA 2WMBA 1KWPA 3HMNA 1NY3A 4M3QA 5CU2A 5HNGA 4APCA 5HLNA 2PUUA 4JT3A 1ZY5A 1JVPP 5BVEA 3K5UA 4KSPA 4RJ3A 3KRWA 2FYSA 2CNVA 3F5XA 5EYKA 4BJJA 5LJJA 1DI8A 2HY81 4O4BB 3PA3A 2JAMA 4H1MA 4NUSA 2C3LA 3VBTA 3R8VA 3F3UA 3HRFA 3I4BA 3W2QA 4RC2A 3S1HA 1RDQE 1GZ8A 3LFQA 4GCJA 4H39A 4J8NA 4O6LA 5IA5A 5IG1A 5KHWA 2QG7A 3P9JA 2B54A 2UVXA 3QCXA 4ZZOA 4YP8A 1GNGA 2HZ4A 4PPCA 5BV3A 3EL8A 3HGKA 3K3JA 4OBPA 3FI3A 2GTNA 4ONAA 2F7ZE 4BIBA 2PULA 2Z7RA 3HA8A 3MH2A 4H05A 5FGKA 3TUDA 3UPZA 3T9IA 4A9SA 2I0YA 4I20A 5BVKA 2XKDA 3VRZA 4MD9E 4GRBA 2OW3A 2JFMA 3ERKA 4R7HA 1ND4A 4F99A 3H0YA 4PP9A 4FRFA 2QU6A 3VRYA 4RX7A 4QYEA 5DR2A 2IF8A 4O4EA 4QMQA 2XK4A 5FEDA 3ENMA 3H10A 5AAGA 5IQHA 4RJ8A 5KMMA 2H6DA 2WMTA 2GNJA 2BIYA 1PXPA 3PJ3A 4RX9A 3GU6A 5ETFA 4CKRA 3UDSA 4ZOGA 2JKQA 2YACA 2Z7SA 5CXHA 1G5SA 3R30A 4AXFA 3A4OX 4YJQA 3RAKA 3MH1A 4C8BA 4OTFA 4YSMA 2ITXA 2PUNA 2UZOA 3VAPA 2R7IA 5F9EA 2PHKA 2JDTA 2R3IA 4APPA 1ZYLA 4EYMA 3C13A 3C4XA 4FIEA 5BYYA 4GFGA 2QR8A 4Q9SA 2V7OA 4O7RA 4Q9ZA 3HL7A 3DKGA 4MQ2A 3GOPA 4O0XA 4I0SA 2UZNA 4YTFA 5GZ8A 5FP5A 4O83A 2H96A 2HZIA 3NUPA 5BYZA 4EQUA 2AEGA 3BPRA 2QNJA 3BV2A 2UW5A 3MPMA 4FNYA 3RK7A 4E7WA 1YWNA 2J5FA 5A4EA 4DCAA 3PA4A 5E1SA 2KULA 4CFNA 1FMKA 1FINA 3IQ7A 4D5KA 4AW1A 2VWVA 4TWOA 5ANJA 3NYNA 3R7GA 3F61A 4RLLA 4RIXA 3FKOA 4HYUA 3A8WA 4TZRA 4ZMFA 3LFBA 1KE5A 4CLIA 2XF0A 3KVWA 4QQ5A 2UW0A 3NEWA 4IAFA 4L3PA 4YBKA 4G6NA 3F6XA 3OWPA 5HG9A 5BNJA 2AQXA 2OXDA 4BBMA 4WRGA 4LGDA 3UDBA 5CALA 3DBDA 2HZNA 2QHNA 4HOKA 2QOHA 4MCVA 1ZYDA 2GFSA 4G1WA 4RA5A 3LCOA 4WHZA 5AV0A 1KOAA 3A99A 1JPAA 3OF0A 5AAEA 4I6HA 4ZJVA 4IVDA 4AQCA 4YZMA 3EOCA 5HE3A 3PUPA 4EJ7A 1ZYJA 4YZDA 3AC2A 3F69A 5HLPA 2C6OA 2GCDA 3RBWA 4AAAA 2SRCA 2W9ZB 4D4SA 3BL7A 2W1DA 4LMNA 3TUBA 2OJGA 3LCTA 3PVWA 5F4NA 3LFNA 3L9MA 1Q5KA 3FHIA 5HE1A 4F7LA 3GT8A 3F66A 3FMDA 3UP2A 1YDSE 4QMXA 3C0GA 3RNIA 3O8TA 2QLQA 4QTCA 4BDIA 5HOAA 3R73A 2ZV7A 1FPUA 4TTHB 4NH1A 1YXUA 3F2NA 4AZTA 4FEUA 3I60A 3SD0A 3Q96A 2P4IA 2EXMA 4QQTA 4ZAUA 3Q9XA 3P7AA 3II5A 3ZC5A 1ZWSA 4JG7A 4ZK5A 2QKWB 2WMWA 2YM4A 4I6QA 2OK1A 3GOKA 3GVUA 2WXVA 3V5LA 3B8QA 5GIOE 1OIYA 5HCXA 4QDEA 4YC6A 3UZRA 3C7QA 3EQBA 4FV7A 3NNWA 5ANDA 3HYHA 2J5EA 2YISA 5J8IA 3RZBA 4EZ7A 4PNIA 4M7IA 4ZTQA 3R8UA 2VV9A 3RMFA 4DDGA 4C4FA 3KXHA 1QMZA 1G3NA 3DJ5A 3W16A 5FRIA 3ZRMA 4AAYA 4M67A 2OIQA 4EH3A 3IW6A 3MN3A 3RWQA 3FSFA 4BZNA 4RZWA 3CKXA 5HO8A 4EHGA 1OUKA 5LMKA 3V5WA 4CYIA 2ITOA 2QHMA 4D2PA 2R3KA 3PVBA 3V8TA 4DYMA 3EHAA 4IVBA 4Y85A 1E1VA 1YXSA 2ONLC 3RZFA 4B9DA 4BGGA 4F7SA 4WOVA 5ITAA 4EQCA 3EYHA 3LZBA 3TDVA 3JY9A 4PL3A 5BVNA 1UWJA 5CVHA 5F20A 3NFGB 3C51A 3QXPA 4XBRA 2CNUA 4QTDA 2BDFA 1JNKA 3BEGA 4FYNA 3WIKA 4E20A 4CMUA 5JT2A 3AMYA 4ZXTA 3MS9A 2R2PA 2BVAA 3WYXA 4FSUA 4DEGA 3ENHA 3U6IA 2AUHA 4D28A 5HO6A 2XARA 5FP6A 1UKIA 4FODA 4ZS4A 3AMAA 3LFFA 1YOJA 1PXLA 3RTPA 4QP1A 4QMNA 5DEWA 1OKVA 3F5PA 4IIRA 2WIPA 5DGZA 4QO9A 2VTQA 2B4SB 3G0EA 3CTHA 3VUDA 2BZKB 4HVGA 4Y5QA 1O6YA 4FL3A 1OBGA 5EQPA 2BR1A 4FIIA 5CXZA 3RK9A 4X2JA 3ZYAA 4DT9A 1MUOA 1W7HA 2B9JA 2QD9A 3OFMA 3ELJA 2F9GA 5AJQA 1IAJA 3DKFA 5AP1A 2CJMA 1OL1A 5AV3A 1R0EA 4QMVA 4C58A 4PTEA 3SGCA 3CXWA 3G6GA 2NYAA 1MRYA 2VTAA 1VEBA 3QHRA 1Y57A 2JEDA 4EORA 4DEHA 5B7VA 4YGAA 4C4EA 5BUEA 4ARKA 1OIUA 3NW5A 2C6KA 3NZ0A 3POOA 4ZSJA 5C03A 5CTPA 3DNEA 3PJ2A 5TOZA 4AG8A 1XBBA 2RSVA 2W4OA 5ANKA 5JZJA 4I21A 5E8VA 3RCDA 2VTHA 3EZVA 2BHHA 4K6ZA 4GVAA 2WQNA 3DB8A 1A06A 3ULIA 4UMQA 2GNLA 4M69A 3T3VA 4EK6A 4FKGA 4MVFA 1LPUA 4LQMA 4X2GA 3FMJA 3SRVB 5CEKA 4W9WA 5EDQA 5CQWA 4RJ4A 4RGJA 3WF9A 4RJ7A 4PDYA 3RHXA 4NZWB 4AOIA 1YI4A 4LDTA 4S33A 4P2KA 1RJBA 3KF4A 3PE2A 4WBOA 1G8AA 4DE4A 4AGDA 4UYAA 4EH5A 1WAKA 1YXTA 3OCGA 1FGKA 3EN7A 3I81A 2E2BA 1VJYA 3DBFA 4H3BA 3MBLA 2XAMA 2DQ7X 3P4KA 4QMLA 2YWVA 4JAIA 3Q4UA 2EB2A 3VBWA 2HY0A 3EIDA 4E5AX 4LUEA 4MD7E 2IJMA 4FNWA 2UZVA 4FZDB 2CNQA 3QZHA 5CAOA 4DDIA 2YM5A 5ANIA 3ZLWA 2PVNA 5I9VA 2BRMA 4DFXE 4YJOA 5CEPA 2YDKA 1FVVA 3GCSA 3HDMA 5HTCA 3N51A 2GNGA 2G1TA 4AGUA 5IA3A 1W82A 3H4JA 5CLPA 3FQEA 2IEWA 4YZBA 2YDIA 3KN5A 4C35A 4R77A 4TT7A 2FSLX 4Y73A 1OPKA 2VX0A 3SV0A 3MV5A 4NU1A 4F0IA 1JAMA 3AC3A 2XIRA 3HUCA 3QTUA 4QRCA 3LFEA 3AQVA 2XANA 2UW3A 3E87A 4IBMA 3ZO3A 5ETIA 2WPAA 4DG2E 4FKWA 2QO7A 3A7IA 5FWKK 2PVMA 3ORZA 4RX5A 5I3RA 5DPVA 3R7VA 2NO3A 5CNOA 2VWUA 4IWDA 3BCEA 2WTKC 1PY5A 2ITNA 2FH9A 4PRJA 4FA2A 4YTCA 4LOOA 4M84A 3KL8A 3TEIA 3DS6A 3ZCLA 3ZS5A 2H9VA 3SW7A 3DU8A 3TV7A 2XJ1A 2B52A 4IC8A 5TT7A 4BKZA 1Q97A 4D1XA 3BLQA 3UG2A 3DZQA 3BHTA 1WVWA 3LFSA 3FLQA 4QP8A 4XMOA 3HAVA 1BI8A 2GQRA 4O22A 5CF8A 4YURA 1IRKA 5DIAA 2BMCA 3FQSA 3PY1A 3SOCA 3FLWA 3WZEA 4QMZA 1H01A 1OI9A 4O4FA 5JRSA 4EOSA 2OWBA 2ZOQA 3NNVA 3AXWA 4GU9A 1H27A 4DTKA 3KCKA 2CPKE 4UWCA 3QAME 5KO1A 3GC9A 4AE6A 3QRTA 4Z7HA 2PMIA 3BHHA 1Y91A 3GQIA 3P78A 2C4GA 4HYSA 5C9CA 4JX7A 5CI7A 5T6KA 4DBNA 5IEYA 3BL9A 3UMXA 4S2ZA 3VJNA 5K0KA 4AT3A 3U55A 2G2IA 4BDJA 4E6CA 3ML1A 3FKLA 3R7YA 1NVRA 4AU8A 3BWFA 3EFWA 1OL5A 3OT3A 4JRVA 3LFAA 5FXRA 2Y8OA 3GXLA 3L1SA 1F5QA 4RQKA 4FIGA 5I3OA 3CJGA 1OKWA 4S34A 4OW8A 4DTBA 1OIRA 3AD6A 1ATPE 3O96A 5HLWA 4LM5A 4YC8A 3MIAA 4NL0A 3QFVA 4M12A 2P33A 4NFMA 4IFCA 1IEPA 4PV0A 3ZSHA 4EC8A 5C8MA 1P4OA 2A27A 2HXQA 4CGAA 1XR1A 2C5YA 4R7IA 3PY0A 4TXCA 1B39A 1XHAA 4O21A 5L4QA 3HRCA 1KSWA 3QALE 4G2FA 2IVTA 2XEZA 5AWMA 3WF6A 5AIRA 3P5JC 4PP7A 4IVCA 3CGOA 3TKIA 4K1BA 1LR4A 4JMQA 2ITWA 3I79A 3F3WA 5LOHA 1M2RA 4IB1A 1W84A 3CIKA 2OXYA 3PJCA 5KMNA 3OUNB 3BBWA 3W33A 1GIJA 4ALWA 5CAQA 3GC0A 5LMKC 4OAVB 1OPLA 4J95A 5KNJA 5F94A 4AP7A 1GZOA 3AMBA 5HIDA 4X3FB 4Q2AA 4R1VA 3I5ZA 4F1MA 4BBEA 5J7HA 2QOLA 3KEXA 2QOBA 5LMAA 4C0TA 5M4UA 1UU8A 2RFDA 1H00A 4OTDA 5D11A 3UBDA 4C57A 5CI6A 4D5HA 4BTMA 5I9WA 5JRQA 1KE6A 3MGYA 4G34A 3F3VA 3A61A 3OD6X 4R5YA 1VYWA 4MHAA 2WMQA 3CPCA 4F09A 3O5AA 5J1VA 5AV1A 3FWQA 2CCIA 5KUPA 2IN6A 2RFEA 3A4PA 4BFMA 5IZFA 2XH5A 2IW6A 3W0RA 3FJQE 3R8LA 3DA6A 5CU0A 4GKHA 3FMLA 1H28A 5K4JA 2J7TA 3N4VA 3IW4A 3Q60A 5HESA 1ZLTA 5EDRA 4NIFA 2BILB 2X2KA 3MTLA 3Q2JA 3FI4A 4GK3A 5ANOA 1R1WA 1SVHA 3C4ZA 4JNWA 1PMEA 2BIKB 4TW9A 4O7NA 5JZNA 3G2FA 2C0TA 3PIZA 3QRUA 3TKUA 5L8LA 3UDTA 4R3RA 4C37A 2JKMA 5IDPA 5J95A 3RNYA 3ZUTA 3BZ3A 4WSQA 2ERZE 5GNKA 3A62A 1M7QA 2HZ0A 5ACKA 5AUTA 4RIOA 3U54A 2ZB0A 3C4WA 2W1IA 1W0XC 3GB2A 1PF8A 3NCGA 3P23A 2R5TA 4BY9E 4LGHA 3HV5A 4EOIA 4H36A 3TWJA 3DK7A 4X21A 4O38A 1KE7A 1WCCA 1UWHA 3UIBA 3C50A 3E8DA 4E6AA 3C0HA 4EHZA 5EHOA 4AX8A 2HAKA 3BI6A 3EQGA 2XNNA 2CKQA 5L2SA 3PLAE 3ZUUA 3QTSA 3CS9A 3IDBA 3VUGA 3VVHA 5KHXA 3IW8A 3Q9YA 2ITQA 3DGKA 5KBQA 2PL0A 1YWRA 5AR8A 5M06A 1F0QA 2ZMDA 3U87A 3G0FA 3NWWA 3PXKA 4I22A 3UGCA 3NNUA 4NKSA 5HEZA 5AADA 3UQFA 3VUTA 4UMPA 2YLEA 5IEXA 3UZTA 3W0OA 2J9MA 3DQWA 5AP7A 2R3RA 4IACA 1Q3DA 2Y4IB 3ANQA 3MVLA 4JR7A 3KVXA 5HBJA 1KV1A 4AZEA 3PSCA 4C2VA 4FKIA 5D7AA 4D58A 4FKTA 5CSVA 4EH8A 5GJGA 3D5WA 4A9TA 3R1QA 1WFCA 3MTFA 1TVOA 3IECA 3PSBA 4FG8A 4FSZA 3BU3A 4EONA 5A4LA 5EQEA 2YM8A 3GCQA 1OVEA 2ZV8A 4HJOA 1O6KA 5CEIA 4A06A 4CFXA 4J1RA 3KKVA 3NYXA 1MRUA 4F78A 4I4EA 4P4CA 4AXDA 5M09A 4I93A 3MFUA 3RAWA 2X2MA 1XO2B 4L9IA 2YIYA 4GUBA 3V01A 4DEBA 2CSNA 5IA1A 3UDZA 4D55A 2XB7A 5T68A 1M14A 2C5XA 2CGXA 1S9JA 4YJSA 2RG6A 3G51A 3LJ2A 5EKNA 5AUVA 3TACA 4YUQA 2WOUA 4DFYA 2I0VA 2W4KA 3LVPA 3N9XA 2UUEA 1XH7A 4FKRA 1BL7A 4ZSAA 1JKKA 1U59A 3F9NA 2E9VA 4GH2A 3PJ1A 2VUWA 2UVZA 4O86A 5KMKA 1WBVA 2UZUE 5BUJA 4F9CA 2P0CA 3WIGA 4GFOA 5I9ZA 5K4IA 5KMIA 5AIKA 3ORMA 3V5JA 5BQ0A 3OP5A 3AT4A 4D1SA 4BB4A 3CCNA 2Y9QA 1H1WA 1PKGA 1YVJA 3WI6A 3GFEA 4PX6A 3R9RA 3VF9A 3NW6A 5AUXA 3KRJA 3R22A 4X2NA 2W5HA 3SX9A 4BYJA 5IUGA 2C47A 2GSFA 4FSRA 3OCTA 3UIXA 4B7TA 4C02A 4DEAA 1HOWA 3Q32A 2GU8A 2XYUA 2X0GA 5M55A 2GNHA 2GNIA 2JFLA 5F1ZA 4ZJJA 2UZEA 4F65A 4FL1A 5EKOA 5C4KA 4ANOA 2WIHA 3FXXA 1OBDA 5HCYA 2V22A 5B2LA 4HGLA 3BYVA 5HTBA 4WUNA 4FTAA 3QWJA 2RKUA 4BZOA 1XKKA 2I6LA 4YJRA 4OTWA 4O84A 4II5A 2PU8A 4NM3A 3G9NA 3TTIA 3V51A 3NVKI 5DH3A 1LEWA 5CT7A 2YZAA 4I3ZA 4CEGA 2OF4A 3E7OA 5CZIA 4QP4A 3PP1A 4WD5A 5IQIA 3DDPA 4XHKB 3AG9A 2UW8A 2J6MA 3CR0A 4XLVA 4E6QA 4QD6A 3PZEA 4IADA 4TYIA 4IM2A 4X6QC 4OLIA 4ANBA 4ASDA 5GZAA 4NWMA 1OGUA 4TWNA 2WMVA 1M7NA 3PFQA 4R3PA 1UVRA 4MKCA 4RIWB 5JK3A 2X4FA 4D2TA 3G90X 3RVGA 5M4CA 1XJDA 4JDKA 3Q3BA 2UW7A 4A7CA 4BVUA 2F2UA 2EXCX 3NUSA 3R9NA 5CF6A 2YERA 4YPSA 2VTOA 5BMMA 1X8BA 2YDJA 2R3GA 3IW5A 4OR5A 4E73A 2E9OA 4JS8A 3JPVA 3ORPA 3D5UA 3DT1A 4OAUC 3HKOA 3QTQA 3RM6A 4L53A 1ZOEA 3HV3A 2OZAB 4OT6A 4J52A 4JDIA 5AX3A 3UZPA 4B99A 5L8KA 4QYYA 2PUPA 2ETKA 4FUXA 1YDTE 4O7TA 5M57A 4J71A 2QVSE 4G3FA 5M56A 4LI5A 3FZSA 5J9YA 3EL7A 4S31A 3QUEA 4PDOA 4YLKA 2V0DA 4XP2A 5CASA 4AS0A 4BDGA 3ZLSA 4E93A 2JKKA 4D4RA 1T46A 2J0LA 4FV5A 5DFPA 4CMOA 1U5QA 3NGAA 5JSMA 4NM5A 5J79A 3TT0A 3IONA 3VBXA 3FZPA 4KA3A 1OM1A 5CF5A 4PNKA 2R3OA 3NCZA 2CN5A 2WQOA 3ORTA 5IEVA 3EZRA 4CYJA 4UN0C 4U3YA 3TNWA 3OEZA 1OECA 2IVVA 2O64A 3EN4A 3PSDA 3BV3A 4N70A 4WNKA 4E26A 5A4TA 2CKOA 3MDYA 5C27A 3N4TA 5JGAA 3AC4A 3MESA 3OTVA 4FT0A 2XNMA 4G5PA 2Y0AA 2YA9A 2RL5A 4D2WA 1OL2A 2O8YA 2Z7LA 4JDHA 4ZTSA 3DK3A 1WMKA 2JBPA 3VQUA 4WG5A 4BWKA 3HDNA 2W1EA 5DVRA 4DBXA 2G2HA 3QD4A 5CU3A 4IX6A 4JLCA 3HNGA 4LUDA 4U40A 3WILA 4BCOA 2ZVAA 3CTQA 3PRFA 3IPHA 2GQGA 3R1NA 4B4LA 1Q99A 4KB8A 5E1EA 2GHMA 4W4XA 2XJ2A 4TWCA 3I5NA 4JIKA 1PXKA 3QQUA 5DHJA 4UMUA 1O9UA 3UO5A 4F63A 5IA2A 3EQFA 2JKOA 2XJ0A 3AC5A 3OCSA 4M0YA 3SA0A 4C7TA 3CD3A 5LVOA 4AFJA 4GV1A 3S4QA 2VTIA 3R71A 5C01A 3SG9A 4ANLA 2YWPA 4LMUA 5AMNA 5FEQA 5HBHA 3BEAA 4GJ3A 4CMTA 4PMPA 4V01A 3TNQB 5KE0A 1W83A 2QOKA 3TNPC 4BI2A 4ERWA 1DAYA 5AP2A 4BTKA 3QLGA 4FK6A 1TFFA 3F2AA 2VWYA 5BPYA 2R3MA 2NNWB 3ID6C 4AW5A 5DT4A 3VONA 3PPKA 3R63A 4RJ5A 4Y95A 2HENA 4O2PA 4FSMA 2X1NA 1IA9A 3KXXA 4EK3A 2OF2A 1DI9A 3L8PA 4GIHA 2R7BA 2O65A 4KKHA 4L42A 2VD5A 4XV3A 3QTXA 1LP4A 1SZMA 4PL5A 4ZTRA 4FSTA 4C4JA 4O7LA 3GENA 1K2PA 4IWOA 4Y83A 4NSTA 3FY0A 3OUKA 4IHPA 1DAWA 2J0JA 3EQDA 3R9HA 1HCLA 4GS6A 3U4UA 4IWPA 2CDZA 2JAVA 4V0GA 4PF4A 4EOLA 4GT5A 4O0YA 4IM0A 3TTJA 2RFNA 3BHVA 1Z5MA 3I0OA 4PMMA 3D7TB 1GJOA 3TV6A 3PVGA 4QP9A 2OO8X 1QPDA 3KXMA 5CNNA 5IU2A 3TL8A 4LGGA 4NK9A 4FUYA 3GFWA 4RA4A 3T9TA 4F0FA 3GC7A 4FIFA 4IANA 5J1WA 2BZHB 4PMTA 1PW2A 1J1BA 4WG4A 3ORNA 4BBFA 2PPQA 5AR4A 2GDOA 4P7EA 5AP0A 1G8JA 5C4LA 1YWVA 3COIA 3MJ1A 4IZAA 4TYGA 4BYIA 1TQMA 3LQ3A 3LQ5A 3MA6A 3NAXA 2W96B 2ITYA 4AE9A 1XMLA 4KRCA 5DEYA 4L7SA 4MEDA 4CD0A 3WE4A 4W9XA 4RWJA 4YU2A 4NKAA 2WZJA 5C8KA 3A7JA 2JD5A 4FZAB 4UWYA 4X3FA 3R7OA 3AGMA 3D5VA 4EK8A 2PTKA 3L8SA 1OKZA 3VWAA 5HZNA 2QKRA 2BKKA 1LUFA 4CTCA 5L2WA 4DHZA 3HP5A 5CZHA 4J96A 2NRYA 4U44A 2E9NA 2CGVA 4O0UA 5K0XA 5DT3A 2OJJA 4ACDA 1F3MC 1KE8A 2ZDTA 3MWUA 4F64A 2PMLX 3DZOA 3L8XA 4DGOA 1JKTA 3DLSA 4YZCA 4G6OA 1H26A 1ST0A 4KAOA 2IO6A 2ZV9A 4G3EA 3A7HA 4IEBA 2UZWE 3S0OA 4O7WA 3FAAA 4CVAA 3ALNA 4I4FA 4N6ZA 5HKMA 4GK4A 2BFYA 3FSKA 5H8BA 4QMOA 1GIHA 2QQ7A 3C5UA 5AAFA 3CY2A 4Y5HA 5HICA 4FV3A 5HORA 2GS6A 3U6JA 2YZLA 3DDQA 1K3AA 3CQEA 3OVVA 4IZ7A 2Y7JA 4KKGA 5C8NA 5D1JA 5JMSA 3DTWA 4KNBA 3WF8A 3LFCA 1KE9A 2XNBA 5E8ZA 4XG9A 4FMQA 1STCE 4G5JA 2ERKA 4FNZA 3LM0A 3NR9A 4H3PA 4FR4A 4RLKA 1PJKA 3RPVA 5E8XA 4AFEA 1SVEA 3QWKA 3FL4A 1ZY4A 2YJRA 2O0UA 3ZM9A 2QC6A 3HA6A 2B9FA 4BDDA 2JDOA 2X9FA 5LWMA 2BAKA 4J98A 4EJNA 4K8AA 3F3TA 2W1GA 3UVQA 4CKJA 2B9HA 4WRSA 3KA0A 3PWYA 5EW8A 4HVSA 5J87A 3C5IA 1U54A 3GP0A 3B2TA 4FTMA 3UP7A 2REIA 4CRSA 3DXNA 5L8JA 4NT4A 4M66A 3QQGA 4CFMA 4EOOA 2J4ZA 4GG5A 4G17A 4PY1A 4W4YA 2YN8A 3G9LX 4FTOA 3ZFXA 1M2PA 2Z2WA 2V5QA 3SDJA 2X0OA 5FTGA 4NEUA 4DCEA