5F95A

Crystal structure of gsk3b in complex with compound 18: 2-[(cyclopropylcarbonyl)amino]-n-(4-phenylpyridin-3-yl)pyridine-4-carboxamide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
348
structure length
345
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glycogen synthase kinase-3 beta
publication title Discovery of Isonicotinamides as Highly Selective, Brain Penetrable, and Orally Active Glycogen Synthase Kinase-3 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 345
sequence length 348
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5f95A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5f95A01
1QPCA 5GZAA 4S33A 3L9NA 5CYIA 5GNKA 2ZM4A 2BRGA 3D7TA 5ITAA 4RSSA 4I6QA 3RK5A 2X39A 3QC9A 3BU6A 3LFCA 3ZRLA 3C4CA 3GNIB 3V5JA 5ETCA 2QOHA 5C1QB 4BTFA 3LCKA 4IXPA 3I1AA 4ZXTA 3HKOA 3ZZEA 3FQSA 3PA5A 1WBWA 3HNGA 4D2PA 3QRJA 4EKKA 2QU6A 4L43A 2WQEA 3UO5A 3DAJA 4LRJA 2OICA 2WMQA 2HYYA 1VYZA 3TNQB 5FEDA 5CAPA 3QQFA 2YCFA 4UY9A 3VBQA 4GSBA 2CLQA 4UZHA 3H10A 5JT2A 3AMAA 2BDWA 4QMOA 5J9YA 5EQPA 5HX8A 1OL2A 2QOQA 3UIUA 3ZUUA 4DLJA 3Q9XA 3A7JA 4C4IA 4C2WA 3PSBA 3PXZA 4IQ6A 5I0BA 4O91A 4BDFA 4BCIA 1W84A 4X2FA 3EQHA 4ANNA 5CQUA 2WMAA 3HYHA 5FTQA 3UVPA 3VUHA 2UVYA 3GBZA 1U46A 2C6TA 2ITTA 4D0WA 4DE4A 4X6RA 4EC9A 1PXLA 2QG7A 5A4CA 5IKWA 1H28A 3ZO1A 2RSVA 2R3LA 3HV3A 4JT3A 1ZWSA 4B99A 3DBEA 4E93A 1G8SA 2PVYA 2NNWB 4APCA 3NW5A 1H0VA 2AYPA 2GNIA 5JFSA 3HECA 4BHZA 4O0RA 3RPSA 4CRSA 5IEYA 3FEGA 3PVUA 1PRYA 2WNTA 1YOMA 3GFEA 2WTKC 3GVUA 3N9XA 4M67A 2YIQA 3PPZA 1RDQE 5E1SA 1YW2A 4V04A 5KX8A 2XVDA 3FZ1A 3Q9WA 3SXSA 3ZSIA 1YDSE 3WF8A 3IW8A 3KRWA 4RIWB 5AP4A 5AP0A 4LFIA 2XKCA 4BZDA 5CENA 1OBGA 4H05A 1Y91A 4FMQA 3D83A 3GXLA 2REIA 5GJFA 3EL8A 4BDHA 4O0UA 3ZM4A 4N4SA 4TWNA 4I5CA 3DK3A 1G8AA 1MQ4A 4DFXE 4EH3A 4HYHA 4KKHA 5AJQA 2PVLA 3SD0A 3TV4A 3MPTA 4MK0A 2GQSA 4DBXA 4JL9A 3B8QA 4NM0A 4QP9A 2ZDTA 3U4WA 3FMNA 3LAUA 4A9SA 4IAZA 3NW6A 4C3RA 4YO6A 4IM2A 4MVFA 1AGWA 4PP9A 4XP2A 5ACBC 4IAKA 3KCFA 3MH3A 4J8MA 3DK6A 3H9RA 4PP7A 1P5EA 2XIYA 3K3IA 3HMOA 4GJ2A 2W06A 2F9GA 4QYEA 4UWBA 4DGNA 1P4OA 1FOTA 3KMMA 4OTFA 1V1KA 5AM7A 4CFXA 4A7CA 3IW4A 3CTJA 4XHKB 4GK4A 1FMKA 4J96A 3NVMB 3NVKI 4LYNA 4PMTA 4K8AA 2XNBA 3SXRA 2VN9A 1MUOA 1SVGA 4D2TA 3PJ8A 2OH0E 5LWNA 4C37A 3ULIA 2EB3A 4KRCA 3F88A 3TKIA 1XBAA 4Z3VA 3TNWA 2YCQA 2XJ2A 3HEGA 3LFBA 3QL8A 4BDBA 1ZMWA 1O9UA 2DS1A 3BYOA 2I0HA 4TY1A 3H9OA 4QMUA 3POZA 4CVAA 3UZTA 3JVSA 2GNGA 4CCUA 2WTVA 4A4LA 3RHKA 4XS2A 3F3ZA 3VBYA 2DUVA 2PZ5A 3EZVA 4GEOA 4KWPA 3ACJA 4LL0A 3WZUA 4TYGA 1SZMA 2R3GA 3HMNA 5DH3A 4AWIA 2AC3A 5BVEA 1J3HA 1KSWA 3OWKA 4PPCA 2BALA 4MBLA 1H8FA 4AW1A 1R1WA 5AR4A 3ZOSA 5IA1A 5K0KA 3SXFA 4FTTA 3G15A 3ZU7A 3R1QA 4IX3A 4JJRA 5HG7A 4NYEA 3DFCB 1OKVA 4A9UA 4YJPA 4BI1A 2JAVA 3O7LD 4R3RA 3WF7A 3KXXA 4JDKA 3CIKA 3BX5A 1BYGA 2YACA 3PP1A 3PE1A 3VS6A 4EK6A 4EBWA 4FKPA 5KMNA 1JKSA 5HG9A 4F6SA 4YO4A 3DTCA 3MB7A 5L6PA 3DBFA 4XNEA 3ZFMA 2JEDA 4UMRA 1WBOA 2PMLX 4QYFA 4JBVA 5TR6A 4BN1A 1YHSA 4I0SA 4QRCA 4E4NA 5KNJA 2ITPA 2J7TA 2FSLX 5GJDA 5CF6A 5HIEA 2QU5A 3HA8A 4FKWA 2OGVA 3OBGA 4G6LA 4H58A 4XOZA 4O7YA 3RWPA 2PHKA 3POOA 2CNQA 4FV4A 1XR1A 3BV2A 5IUHA 2XK3A 4Q2AA 4DH7A 3C4FA 5HOAA 4CGAA 2BZIB 3EQFA 5L4QA 2PUPA 2UZDA 3QA8A 4HGLA 4HNFA 4LV8A 3OY1A 5CVGA 3MPAA 3PJ1A 2R3OA 2UW8A 2PVMA 3W8LA 2HK5A 3FBVA 1LPUA 1OUKA 3LXNA 1JOWB 4I93A 4RIYA 3CBLA 2LAVA 3PXFA 4NUSA 3T3UA 3VUDA 2CPKE 3V04A 3IK3A 4ZAUA 5CAOA 4A4OA 5B2KA 4M66A 4KNBA 4MX9A 3VS1A 1FPUA 3F5PA 5K5NA 4GYIA 3D14A 4GCJA 4L9IA 4OT6A 4ACCA 3D4QA 4RQKA 2XNPA 1QPEA 3N4VA 2A27A 2HZIA 3Q6WA 3IOKA 3S2PA 1M17A 5JFVA 2FO0A 4PPBA 3WE4A 2VV9A 2W0JA 5FG8A 3VRZA 3QZIA 3WIKA 2X4FA 1FVRA 2JIUA 1BKXA 3ZFXA 4GW8A 4U8ZA 4E1ZA 1YWVA 4F99A 4G6NA 3V8WA 3WZKA 2J0IA 5HGIA 2BCJA 5FXSA 3OMVA 3HDMA 5CWZA 4EZ7A 2Q83A 4FV0A 2OJGA 5BUEA 3C7QA 3U9CA 1H1QA 4G3CA 1U4DA 4YLJA 4FA2A 3MVLA 3NAXA 2WFYA 4EOKA 3ZM9A 1XWSA 3HAVA 5DYJA 5IQBA 1SMHA 4NCTC 2HENA 3CGFA 4JDIA 3KF7A 2BAKA 2GPHA 3NMUF 2C3JA 3D7ZA 2JAMA 2ERKA 4AOJA 3KULB 4FR4A 4Z7HA 4NEUA 4RWLA 1WAKA 3D2KA 4GK3A 4B6LA 4MF1A 2ZM1A 4MNFA 3OEZA 4HVGA 1P4FA 1S9IA 2F49A 3ZTXA 5KKRB 3FKOA 3OG7A 4TNBA 4BF2A 4C4HA 4BVUA 5L6OA 2XYNA 5LWMA 4DTKA 4DGLC 3F9NA 3O8UA 2F7XE 4ZSGA 3RNIA 3AXWA 4RJ4A 3S00A 3PP0A 5CT0A 5HTCA 3KK8A 3PXKA 3SW4A 4BTKA 5CQWA 5F1ZA 2E9UA 2PU8A 3GC8A 5HE3A 4FVQA 4GKIA 2A1AB 2HW7A 4O2ZA 1PXNA 1K3AA 2HXLA 3LM0A 1KE7A 1OKYA 1JQHA 4MNEA 3UZPA 4NIFB 4FL2A 4NM7A 4USDA 2RF9A 5E90A 1Q99A 1PHKA 3BE9A 3MPMA 1YXTA 4ZTLA 3GGFA 4PL4A 3WI6A 4QTEA 2IO6A 4NW5A 4U7ZA 4W4WA 4MHAA 1H1PA 2OI4X 4BCPA 5AP7A 1H25A 4OBQA 1ZXEA 1M2RA 1H1SA 2F4JA 3QALE 4DG3E 2NP8A 4HVIA 2X7GA 3UYSA 4NL0A 1XKKA 2VTPA 3RCJA 3QHRA 3W8QA 2R3JA 4RC3A 5K4IA 5BPYA 5DI1A 1A48A 1NT2A 3WYXA 2BAQA 3R1YA 4DITA 4PTCA 5T68A 4JQ7A 2GQGA 5C4KA 2PZPA 5CNNA 4ZLZA 3OBJA 4M97A 4EQCA 1Q62A 3LFNA 2EWAA 2O3PA 3PSDA 5DA3A 5EKOA 4ZTHA 4AZWA 4EWHA 5AR5A 3MDYA 1SVEA 4U97A 2CKPA 3O8TA 4FL1A 4ITIA 3ERKA 4IIRA 4WRGA 5AIKA 4DC2A 2BKKA 4V01A 4BDIA 4GS6A 4NM3A 5IQAA 1REJA 2I0YA 3D9VA 1ZAOA 3HUBA 3JR1A 4L01A 3MTLA 3DGKA 4XLVA 3K3JA 3ZZWA 3C50A 4RIXA 4FKTA 3DPKA 2YN8A 2GS7A 3A99A 5TF9A 2P55A 4JRNA 4FV9A 4IDVA 3P5KA 3OXIA 3V8TA 3CPBA 3LCSA 4J97A 3E92A 2OF2A 5F9EA 5KUPA 3Q6UA 3AC4A 2Y7JA 1X8BA 3AQVA 2XNMA 3QTWA 2XNEA 3RTPA 4EOMA 2R3FA 3EN7A 2UW4A 1Q61A 5CY3A 4W8DA 2PVFA 4KIPA 2B4SB 4GKHA 3Q4ZA 2YIXA 5HG8A 3MVMA 3LLAA 2UW6A 3F3TA 3LHJA 3NWWA 4IANA 4ANSA 2J6MA 4I5MA 4BKYA 4D9TA 5A6NA 3HV6A 2A0CX 2VO3A 2XEZA 3QA0A 5CASA 4FSZA 2EVAA 4QTAA 2OJJA 3VF8A 3ENMA 3HDNA 4FUYA 3BI6A 5F20A 1DI9A 3T3VA 4C35A 4RJ3A 3LQ5A 3MY5A 3I5NA 3ATSA 3WF6A 2O0UA 3TIZA 3IS5A 4EOJA 1IEPA 4DF3A 2RG5A 3GOKA 3AD6A 4BCNA 4BWKA 1LEZA 3FMJA 1P2AA 4EZ5A 4DEBA 2UVXA 5FP6A 4TWPA 3K54A 4E26A 4F9WA 3R0TA 5ANIA 3F7WA 3FL4A 4R1YA 4IVDA 5LXMA 3VQUA 2ITOA 5LOHA 3QYZA 3E93A 4F7SA 4L68A 4JX3A 3QRTA 1YRPA 2R3KA 4YTHA 4OW8A 4F09A 4I23A 4EK4A 1UWJA 3DS6A 4PPAA 2R9SA 5E7RA 4W4YA 5JKGA 3TDVA 3NUSA 2XK7A 4DGOA 1GZNA 2XBAA 5JFWA 5JK3A 4LMNA 4TXCA 4G3GA 4XG8A 5EM5A 2OLCA 4RVMA 5E8UA 4WOVA 4QTBA 3BPRA 4XBUA 5E8VA 4ANOA 5KHWA 1I44A 4AFEA 3LQ3A 3V3VA 4X6QC 5TE0A 2XS0A 1LUFA 1YDTE 4L46A 5JZJA 4IVAA 4GV1A 2WQNA 4DN5A 3MI9A 4ANQA 3QUEA 5H8EA 1KE5A 4MXAA 3FDNA 4FUXA 4LV5A 1WVWA 1ZARA 3C1XA 4FZ6A 3VW6A 1JSUA 2P4IA 3ZRMA 5EHOA 1ND4A 4U45A 3RNYA 3PFQA 1Y8GA 4F1TA 2FUMA 1DAWA 1UU9A 5D10A 3MGYA 4FKLA 4LMUA 3H3CA 3PYYA 4O2PA 4ENYA 5A46A 3FLQA 1WMKA 4R1VA 3ZO2A 4CQGA 5IF1A 2GSFA 1OUYA 5KHXA 4FYNA 3R83A 2HXQA 4G16A 4U80A 4R78A 4I6HA 3EB0A 2CCHA 4FT9A 4WHZA 5H2UA 3CXWA 1M14A 1BUHA 2CJMA 5FXQA 2VWZA 3VJNA 2ITNA 3R9OA 1KE6A 2ZB1A 3VN9A 4ZJVA 3DBDA 3ZONA 2PVNA 3KRJA 2G1TA 3BKBA 3KVWA 1R0PA 3QC4A 4GVJA 5CAUA 3IW6A 4H39A 4O81A 3Q60A 2O8YA 4O82A 4TYIA 1MQBA 2XF0A 4IB0A 2B0QA 3GC7A 4L6QA 2I0VA 4OTGA 4O7LA 2QR7A 4EJNA 1FBNA 3UNZA 1W83A 2J50A 4PTEA 4DH1A 4RIWA 4G17A 1UA2A 4CG9A 4PL5A 4D4RA 4PDOA 1OL6A 3QTSA 3MYGA 4EOQA 3BLRA 5CVHA 3CKWA 3MW1A 3R7IA 5DEYA 2Y4IC 3DKOA 3G5DA 4P90A 4X7QA 4IVBA 3O71A 4BIBA 5I5ZA 5EI8A 1BI7A 3U51A 4WNMA 4XUFA 5I9WA 2W4OA 1ZLTA 1YXXA 3LFFA 4ZY6A 3VUKA 3ZO3A 1Q8WA 3BIZA 1GIHA 2B55A 2NRYA 2YJRA 3QBNA 4HJOA 5IPJA 3D5VA 3TCPA 1JKLA 4PRJA 4AXAA 3DAKA 3LPBA 4M7IA 3VJOA 4IE9A 3KY2A 4I1ZA 3OFMA 2ZV7A 4K33A 1F5QA 3OUKA 2OIDA 4FNYA 3ULZA 3GFWA 4DFBA 2XEYA 4D1SA 3R7EA 4L45A 3O51A 2VTMA 4OBOA 4AT4A 2VX3A 2YM6A 4DEAA 4L3JA 4NFNA 5HO8A 3R71A 2UZEA 3RJCA 1IA9A 2C6MA 2UZTA 4FF8A 3SX9A 3R30A 5LVPA 5IUIA 5G6VA 3FSFA 2FSMX 4R7HA 2VNYA 4FKGA 4RVLA 1CTPE 4CKJA 4NU1A 4O21A 5DOSA 5I3RA 3WILA 4ARKA 4RJ6A 3QX4A 3DOGA 3L8XA 3NYNA 3TN8A 3TT0A 4DFLA 3SKCA 1O6KA 4CCBA 3NUNA 3Q32A 2Y0AA 2OKRA 2X7OA 4H3PA 4ZTMA 5M4CA 3GCSA 5CSXA 4DHFA 2G2FA 3HRCA 4G5JA 4GFMA 4H1JA 3VS3A 4UB7A 4DFNA 3ORPA 1TVOA 4BWXA 3D5WA 2X2LA 2CMWA 2PMNX 4BDJA 2Y6OA 5AUTA 4QMYA 1PF8A 4YP8A 5I9YA 5BVNA 4PMPA 5BMSA 5HO7A 5FXRA 5EHYA 5IQDA 4HVSA 4ZS4A 3ORLA 2H9VA 3R21A 4IHPA 4O7VA 3QQJA 3IGOA 2XMYA 4NCTA 3O96A 4FTCA 4E4LA 1Y57A 3QTXA 4BZOA 5IQCA 5JRSA 1FGIA 3CTQA 5IQGA 1PXJA 2ONLC 4ASDA 5GZ8A 5FQDC 4FKJA 1WBNA 3JPVA 3PRIA 2RFSA 2UW5A 4HCVA 4ZS0A 1YQJA 3RVGA 3LKMA 3ELJA 4GT3A 2ZDUA 4M84A 3CQWA 2GFSA 4YZBA 1WBSA 3FYKX 4QP4A 3ODYX 3R7GA 4BCFA 4U6RA 4BGQA 4YZCA 1T45A 3UIXA 1EH4A 2WMRA 4RX5A 2BUJA 3DKGA 4JXFA 5AUXA 3TV7A 3UG2A 5CI7A 1UNLA 4CZYB 3QKLA 3UC4A 4GYGA 3TZMA 3DQXA 4U40A 3H0YA 3V6RA 3SG8A 3G6HA 4D9UA 4YZ9A 2ITWA 5IH5A 1VZOA 4JOAA 2UZWE 3H30A 4NJDA 2OXYA 2OJFE 2RKUA 4RVTA 3F5XA 1OMWA 4ZK5A 1GNGA 4ASXA 1WVYA 2BPMA 5EYKA 1PKGA 5DR2A 3TACA 2A19B 4RC2A 3FMHA 3L8PA 4U79A 5E92A 4E73A 4N57A 2VTIA 3ET7A 4RIXB 1ZYSA 5H9BA 4EZ3A 1U54B 2C1BA 2EB2A 1QPJA 3QQKA 3F3WA 4FYOA 5CEIA 2PVRA 3EIDA 3MBLA 4ZJJA 4BRXA 5CALA 4QMXA 5IEVA 4PV0A 3AMBA 2G9XA 2I40A 3V5TA 4D55A 2W96B 5AEPA 2EXEA 1IA8A 4ERKA 4AX8A 3R28A 1H00A 2NPQA 4FV1A 2OBJA 2CGXA 4UMQA 1PYXA 3FZPA 1FQ1B 3D5UA 3FY2A 2YM5A 3P1AA 3A60A 4C57A 4DH5A 4K9YA 4FTIA 4ACHA 1FGKA 3DY7A 5E8YA 4MYGA 5C03A 5DG5A 1PMNA 5JQ8A 4W4XA 3EFJA 3ATTA 4E6QA 4XV2A 4O7ZA 4OAVB 1TQPA 4MAOA 3TUBA 1PXMA 3FPMA 3KULA 4C34A 4MWIA 4XG7A 3IECA 1H0WA 4RZWA 3TWJA 3RM6A 4KBKA 5L8KA 4EUUA 2WTKB 3QKMA 2YM8A 3R9HA 3E88A 4OTIA 2V62A 4Q5HA 4AW5A 4I20A 3P23A 4I21A 3TV6A 4OTHA 3W2QA 4FKQA 3P4KA 4FKVA 4L00A 4FG8A 2W1CA 3F82A 2XP2A 5EHLA 4YNEA 4AAAA 3VULA 4W9WA 2UZOA 1QPDA 5EW3A 3N51A 1BL6A 3EZRA 4JG6A 4QYGA 2ITVA 4DEIA 4EH6A 4DEDA 3F5GA 2VWYA 4JBQA 4NIFA 4R3PA 3NCZA 4KS7A 4YHTA 2YIRA 5E1EA 4FTUA 3BBTB 4YJOA 3HL7A 3QD3A 1YHVA 3T9TA 3V5LA 1R0EA 2WQMA 3I7CA 5HNBA 1RW8A 2O64A 3CR0A 3HX4A 2W1EA 3KKVA 5HTIA 4IM3A 5CNOA 4DG2E 1ERKA 4F6UA 3BGQA 2XYUA 3IOPA 4ZZMA 2YA9A 4IMYA 3SHEA 5IDNA 3OROA 3PSCA 2VTAA 4JAIA 1AQ1A 5CEQA 4F63A 4BR3A 3LCTA 2Z7SA 3LXLA 1ZRZA 2V5QA 3WF5A 3L9MA 4BBFA 2QG5A 3QZGA 4GUEA 5E91A 4Y5HA 4NM5A 4IB3A 4RQVA 4MWHA 5C01A 4RX8A 2XK8A 4LGGA 2XM9A 4MXYA 1QL6A 2YWPA 5IQEA 5L8JA 2PZYA 1PMVA 4TW9A 1YWRA 1R78A 4G6OA 2JIIA 2WTCA 3SV0A 4FTNA 3D15A 4YLLA 3UP2A 4ZMFA 2B1PA 2IZRA 4EYJA 1JLUE 4LRMA 2WIHA 1NVQA 5CXHA 4EJ7A 1PXKA 3R1SA 3C4ZA 4D4VA 3C5IA 3VIDA 5IA3A 3BV3A 3MFSA 1JAMA 4RBLA 3M2WA 4MXXA 1ZYCA 2W1GA 5IUGA 4XH6A 3SRVB 5JZNA 3OP5A 5LMKA 4YC3A 4NW6A 4QMVA 2R7BA 4J53A 3DJ5A 3GEQA 4S34A 4NZWB 3EQPA 3RAHA 3UNJA 3Q53A 2CCIA 4WNKA 4QMTA 3PIZA 4BCKA 3VS5A 4K11A 5CX9A 4D28A 5ACKA 2ETRA 2QO2A 1W7HA 3ZBFA 3GCPA 1SM2A 3DAEA 3QTQA 1W98A 4M14A 2UVZA 5A6OA 3VS7A 1UU8A 5M4UA 3BYVA 4JRVA 3DV3A 4QNAA 3PIYA 4MF0A 2VZ6A 2XBJA 3QWJA 3QCYA 4CT2A 4B8LA 3BEAA 2PWLA 4O84A 3KL8A 3BLHA 2QKWB 4FTAA 3EYGA 3LE6A 4EH2A 5LQFA 5TO8A 4XMOA 3BQRA 4ALVA 2JDVA 3EFLA 2BFYA 3BCEA 5DMZA 2ITXA 1VEBA 2BRNA 3A8XA 3BHYA 3L9LA 3MH2A 4CLIA 5I9VA 4ZP5A 4RFZA 1H4LA 3A4OX 3E8DA 4HCTA 2W1DA 4L7SA 4J71A 2OXXA 5DT0A 3E3PA 3OT8A 2PE2A 3RHXA 3DNEA 4DINA 2H96A 3ORNA 5LMKC 4I0TA 3UQFA 3U55A 4L7FA 1M52A 4IBMA 5A4QA 4QQ5A 5AA8A 3I4BA 2YHVA 1CSNA 3MB6A 4NWMA 3QTIA 3FHRA 2WMBA 5HKMA 4PUZA 4GVAA 5TKDA 3MY0A 4BBMA 3BELA 2HZ4A 4WRSA 3D94A 4FBXA 5IQIA 4KUJA 2C6DA 4FSWA 4MH7A 4JBPA 4UWCA 3Q4TA 5GIPE 4E5BA 3II5A 3KN6A 3OW4A 4UBAA 5AM6A 2JD5A 4ACMA 4B0GA 4C62A 4DFYA 5M4IA 4AW0A 3BHTA 2IVTA 2QHNA 4JDJA 3PG1A 4JG8A 4D0XA 3HV5A 3OXZA 5EG3A 3E8CA 3BRBA 3VO3A 2RG6A 1Q41A 4FNWA 4FZAB 1UVRA 4O27B 3EQRA 3CCNA 2XUUA 4ZSJA 3VUTA 1OITA 4BI2A 4IX5A 4ZEGA 4YHFA 2WAJA 3SOAA 5FLFA 5AP5A 3P7AA 5EOLA 3RINA 4JI9A 4P4CA 4JQ8A 2X6EA 3UOHA 4DG0E 2WOUA 3I7BA 5C8MA 5HX6A 4GU6A 5IH6A 1J7UA 1XO2B 4AOTA 3FSKA 5A9UA 3A7HA 3I81A 4J95A 3KRLA 4FSRA 2BRHA 3QTZA 4GL9A 4AFJA 3MA6A 4BHNA 3R7YA 5CEPA 2BIYA 3FZSA 3FKLA 4XX9A 2YIYA 4EOOA 4D5HA 4AT3A 4FEWA 4UYAA 4XP0A 2HELA 4Q9SA 3VBVA 2BTRA 2QOCA 5L8LA 2BVAA 4HGEA 4X3FC 3O50A 2BDFA 5LMAA 4FSQA 2AUHA 3JY9A 1ZOGA 5ETIA 4AGUA 4LGHA 4JDHA 3ZS5A 2GTMA 1H08A 3BU3A 3MSSA 4KABA 5IDPA 5LJJA 1KWPA 5DT3A 2X8DA 5M44A 4QO9A 1XBCA 3ZCLA 3QFVA 4II5A 3R01A 3W2SA 3DXNA 5ANKA 3TNIA 3NAYA 5EYCA 1U59A 4X3JA 5AP2A 2UW9A 1H07A 3MJ1A 2BZKB 3VBTA 3V5QA 3ZDIA 4N6ZA 5CF4A 4CQEA 2E9NA 1URCA 3DZOA 4I3ZA 2ZV2A 3OT3A 2WMXA 4CV8A 5FUTA 2Z02A 4YSMA 5AAGA 3P78A 3VVHA 3MV5A 5C27A 2JKQA 3F3UA 1KOAA 3U8WA 5FDPA 5ETFA 4JBOA 4YJVA 4ANLA 4IZ7A 5DIAA 3AT4A 3QTUA 4YBKA 4Z16A 5M51A 4R77A 3ORTA 2YITA 3PVBA 1JKKA 3QGWA 2WU6A 3R63A 3EQDA 2YAKA 5D1JA 3KEXA 5CZHA 1WBVA 2J90A 4MXZA 3O7LB 2C4GA 3UMWA 5DRDA 1STCE 3P9JA 3LQ8A 3QHWA 4R5YA 5ANDA 4XV1A 2R3NA 4AZTA 1OB3A 2I6LA 5I9ZA 3GCVA 4DTAA 2WB8A 4TYJA 4X2KA 3TUDA 4OTRA 4EH9A 4HYIA 3O8PA 5K0XA 3MIAA 2A2AA 4TYHB 5CEOA 3KXGA 3FLWA 5AR7A 4CXAA 5HEZA 2Z2WA 3I60A 2PUUA 5AP1A 2UZBA 4DT8A 5LCJA 4FX3A 4N70A 2UW3A 4NKSA 3MFTA 2CNVA 4Y8DA 3H9FA 4EH5A 3RPRA 2E9VA 5FP5A 2NRUA 4C7TA 4S30A 3VUIA 3OVVA 3D0EA 4ACGA 4F7JA 3KMUA 3CQEA 4F65A 2QQ7A 3BEGA 4L3PA 5DHJA 1UWHA 5EW8A 3W55A 4IB5A 3EYHA 2W1ZA 2R3RA 2VWVA 3S4QA 4EOPA 3HMMA 4QQCA 5HNGA 5EI2A 5EFQA 3RMFA 4O0VA 4CMTA 2ITYA 4XEYA 2WMVA 3ALNA 3W1FA 4YZDA 4CD0A 2ESMA 4PDYA 4IWPA 3G6GA 4RJ5A 2ZV8A 3KXHA 4KS8A 4RA4A 5AP6A 4O0WA 1CM8A 4KAOA 4E4MA 2XK4A 2BILB 4PTGA 1W0XC 3ZUVA 4EK3A 3GC0A 2XNNA 5IG1A 5LVLA 1TKIA 5TT7A 4ZZNA 4C8BA 4UX9A 2YM3A 4Y95A 3DBCA 5DGZA 3PUPA 3GQIA 3ZLXA 3OHTA 1PKDA 1BX6A 1OKZA 3KFAA 2PULA 4ZTSA 2R3MA 5D12A 4ZMEA 3LW0A 4FSTA 4BDKA 4FIHA 3V5PA 4NK9A 2X7FA 3IKAA 4G31A 1WCCA 2DQ7X 3ALOA 3AC3A 4FSNA 3P08A 2IWIA 4ID7A 5AIRA 5AMNA 4C2VA 2YFXA 1A9UA 1OPKA 2BAJA 1U5QA 2B7AA 3ODZX 3AC5A 4FC0A 4R3CA 5J5TA 2XA4A 4JR7A 1K9AA 2X8EA 1ZOEA 2J5EA 4FTKA 2UUEA 3VAPA 4O7SA 3R8MA 3QQUA 4O38A 5AR8A 4BCJA 3NYXA 3Q52A 2W9FB 2IW8A 3DKCA 4O7NA 2GU8A 4QP8A 2UZNA 5CF5A 3KCKA 3BYMA 3AGMA 5DVRA 2IPXA 3WE8A 2C3IB 3HVCA 3RI1A 1YDRE 2O65A 5HBHA 3KB7A 4EORA 1U54A 3NNXA 3B8RA 5J87A 5ANJA 5A3XA 2XK9A 4MD7E 3KXZA 5J8IA 3ZXZA 4PWNA 3LCOA 4U9AA 1VR2A 3FV8A 3NIZA 3PDTA 1YVJA 4FNXA 4D2RA 5CT7A 4BDCA 5AUZA 5J79A 2Y6MA 3ZC5A 4IC8A 4KIKB 2X0GA 1L3RE 2J0KA 4J98A 3R8LA 1PYEA 2WOTA 3R02A 4QPMA 4YR8A 4Z9LA 3R9NA 3CS9A 3M42A 1FINA 2H8HA 4WSQA 2V7AA 3QGYA 1SYKA 2WO6A 5CEKA 4JIAA 5M56A 4KSPA 2C1AA 2VRXA 3QZFA 3TNHA 3ZBXA 4USEA 3OWLA 4QP1A 1QCFA 5H8GA 2YZLA 4XP3A 4JX7A 1GIJA 4M15A 3Q4CA 4AZVA 4CZTA 2RFDA 4TTHB 4ASZA 4B4LA 5HNIX 5A4LA 5GIOE 3HRBA 1CDKA 4XG9A 2P2IA 3A8WA 4ZZOA 3R7OA 3QXPA 4BTJA 5CU2A 2C6EA 4U43A 3COMA 3ZMMA 5CXZA 5IA2A 4RVKA 1YXUA 4HVHA 3NSZA 4YURA 3EFKA 2CLXA 3AGLA 1NVSA 4G1WA 3BYUA 1YOJA 2HW6A 3FZTA 2IJMA 4HYSA 4EEVA 3G33A 4KBAA 5FWKK 3ENHA 3JUHA 4UALA 1F3MC 3A61A 1XHAA 2BZJA 1XH5A 3TNPC 3TZ9A 5AWMA 5DPVA 4RX9A 3OS3A 2EXMA 2JDTA 3LVPA 1RQQA 1YXVA 2Y4IB 1O6YA 4ZJIA 4FV7A 4LL5A 5AR3A 4QNYA 2O5KA 2PL0A 2CGUA 4WG5A 4ZOGA 3EFWA 1ZYJA 2WEVA 4FTQA 3FXZA 4D2VA 3UG1A 4CLJA 3DCVA 2C5XA 4CYIA 2Z8CA 3F5UA 1XH9A 3ZSGA 4FGBA 4FSMA 4HCUA 2XKFA 4FT7A 1AD5A 4BCOA 4UMUA 5I9UA 4OBPA 4OAUC 1M2PA 2VTQA 3FMLA 4O0XA 5HBEA 5AV4A 4N0SA 4IX4A 2XRUA 4H36A 4JLCA 3K2LA 4LG4A 4F70A 2GQRA 4F9AA 1DS5A 4IAFA 4EH7A 3U6HA 1ZMVA 1H26A 4G34A 1PMUA 2WD1A 3LM5A 2C3KA 3NW7A 5AFVA 2WMSA 3F2NA 4BL1A 2YZAA 3CEKA 3UQGA 5AUUA 2G2IA 2IZTA 3MTFA 5EDPA 4DT9A 3M1SA 4RC4A 4YJQA 3LJ0A 3OZ6A 4RZVA 4EOIA 2GNLA 4ZLOA 2CN5A 4TN6A 5CSVA 4D4SA 5M06A 2F2CB 1HCKA 3ETAA 5FTGA 5JGDA 3R8ZA 3CD8A 5C9CA 3UOLA 2WTDA 2C5OA 3PXQA 4CFWA 3ZUTA 4MTAA 3SRVA 3EKNA 3RKBA 2WZJA 4GIIA 2I1MA 2JKOA 4YJTA 4C3FA 3VW8A 3KRRA 3OTUA 2YABA 2BIKB 1OIUA 4M12A 1IASA 3P79A 5IQFA 1TQMA 2ITQA 3GI3A 3TTJA 5EDRA 4IFGA 4ZSAA 4QMQA 4IZAA 5HESA 4PDSA 3FMDA 3G51A 3PY1A 4B8MA 4C4FA 2VUWA 5K3YA 4F0FA 3UNKA 3CGOA 4NTTA 3R8PA 1Q3WA 3KC3A 1B6CB 1BLXA 3FWQA 3FC1X 1OIYA 3CD3A 2GHGA 4YTCA 3SGCA 2C5VA 3VQHA 3U6JA 2BROA 4IDTA 2XK6A 4P5ZA 1XBBA 5K4JA 3E8EA 5G1XA 3TZ7A 4GG5A 4Y85A 4CV9A 1IG1A 3RAIA 3EL7A 4E6CA 5LVMA 4GIHA 5GINE 4J7BA 3RAWA 4K0YA 4PMMA 3A7FA 3QCXA 5BNJA 3KU2A 5FGKA 4F9YA 4NFMA 4BY9E 5KMOA 5DN3A 4FTMA 4Y73A 3WZDA 4AA4A 2H6DA 5JRQA 4EK5A 4EH8A 2WQBA 2QNJA 2VWUA 3DB6A 2OU7A 2XH5A 3JVRA 4NTSA 4QP3A 4DEHA 2HAKA 4DH8A 3K5VA 4CFUA 3NR9A 3DQWA 2X1NA 4IJPA 1Q8YA 3PVWA 4QP2A 5T6KA 3RBWA 3WIGA 3E3BX 4E4XA 3UQCA 5E4HA 2VAGA 5E9EA 5AV2A 3BZ3A 3T9IA 2ITZA 2R64A 2VTJA 3ZEWA 5HORA 4E8AA 2PTKA 3R2BA 1MRVA 2ACXA 2VTSA 4OTWA 3FI2A 3E87A 1SNXA 3FY0A 3I0OA 4YHJA 4EHVA 2BZHB 2KTYA 2Y9QA 3A4PA 1UU7A 3UBDA 2HWOA 3QF9A 4ZSEA 4CMOA 3S3IA 4IWDA 3CY2A 3CSVA 4MXOA 4YTFA 3ZEPA 3HP2A 4C36A 5K5XA 5AX9A 4DGGA 4IZYA 2YDKA 4QPAA 3OC1A 3UPXA 3D2IA 3R73A 3QQLA 2R4BA 4Z55A 1H27A 4AGWA 4ZTNA 2IW9A 4RWIA 4AN3A 2Z7QA 4YZMA 3BYSA 2PE0A 4FZDB 4WG4A 3V6SA 5J9ZA 4PX6A 3I0QA 4P2KA 4TRLA 1JSVA 2ZVAA 4C4GA 2ERZE 4EC8A 2GS2A 2V7OA 5M08A 2JGZA 2GMXA 4FT5A 4HZSA 5EYDA 3W32A 4DYMA 4AE6A 5IH4A 4QTDA 4YC6A 4KKEA 4UWYA 3AMYA 1KUTA 3ZHPC 4M69A 4MCVA 5AP3A 3FQEA 2OIQA 4IH8A 3OY3A 3VBXA 4K18A 3IDBA 1R3CA 2RIOA 3DBQA 3DZQA 4RFMA 4WD5A 1JBPE 5C8NA 2B9IA 4C38A 4GT4A 3UYTA 4WA9A 2R2PA 5AUYA 1IAJA 1KE9A 3W2CA 4AS0A 4RG0A 4BC6A 4FODA 1Q3DA 4ZTQA 2BHEA 3U54A 3G9LX 3KVXA 5D9HA 4EHGA 3ORIA 3FXXA 3Q2MA 2CKEA 5HHWA 5JMSA 3NUYA 5HE0A 4HGSA 2OZOA 4ZIMA 4LM5A 4IM0A 3RM7A 3MN3A 2PVJA 3SDJA 3TDWA 5C8KA 5J9LA 1Q97A 2ZV9A 3F6XA 2XCHA 4O0SA 4AGCA 5J7HA 3ZYAA 4DEEA 3NS9A 4A9TA 2R3PA 3CE3A 3UOJA 5AUVA 5CANA 3EQGA 4JQEA 5B0XA 3UO6A 3CC6A 2X2KA 2JDSA 4OTDA 5CU4A 3OWJA 2BRMA 1KOBA 2C30A 2GTNA 3RWQA 4ANMA 4BZNA 4DEGA 5EI6A 4A9YA 4Z7GA 3O23A 3EN6A 3PLSA 2UZLA 4Q5EA 1HOWA 2EUFB 5FDXA 5BVFA 3FQHA 5I3OA 3IPHA 4QYHA 3FLZA 2YM4A 2FYSA 4W4VA 4CFMA 5A4TA 5AAEA 3LMIA 2C0OA 1OZ1A 3MVHA 2O63A 2XCKA 3SC1A 3BWFA 4HVDA 4ASEA 3GT8A 4YLKA 2FVDA 3WARA 3QRIA 3O17A 2EXCX 3BGPA 4TYHA 3ACKA 4LGDA 3I79A 3QU0A 5HE1A 2YCRA 2RGPA 3PG3A 1UKHA 4DTBA 4DA5A 1GIIA 5D7VA 3VWAA 4HNIA 3ZO4A 3NUAA 5BYLA 4XV3A 4IAIA 4YSJA 4O7TA 4IX6A 4CFNA 2PPQA 3FKNA 1PXIA 3DXPA 1OL5A 2VTRA 3EWHA 4LRKA 5KZIA 4TT7A 5E8SA 2R3QA 4OLIA 5GHVA 4DAWA 2E2BA 2QCSA 4FOBA 3R9RA 2B9JA 3HA6A 3M11A 3F2AA 4FVRA 3CTHA 3U6IA 2XIZA 2YAAA 3DK7A 4O1OA 5EM8A 5C26A 3EQCA 5EK7A 4F4PA 5HD4A 4YU2A 1JVPP 2YM7A 3S1HA 4YJRA 5IMEA 2ZMCA 4M3QA 1TQIA 1BL7A 4BCHA 3IW5A 3R2YA 3LFAA 2HY0A 3EKKA 4BB4A 4BFMA 3C4EA 4AACA 4C02A 1L8TA 4MXCA 4ALUA 4W9XA 4F0IA 3PXRA 4MKCA 3C0HA 4TPTA 5CZIA 5HG5A 5HLNA 5DT4A 4X21A 5IA0A 4CZUA 3TJDA 2X9EA 4V05A 5J95A 1NXKA 4ACDA 1Y8YA 5KMIA 2ZMDA 1OECA 2XKDA 4PQNA 4Y72A 5H3QA 2GNHA 4L3LA 3FI3A 4L8MA 5J1WA 2X4ZA 4C33A 1Q8ZA 4IAYA 2VGOA 3C0GA 2X8IA 3QUDA 5LARA 1OM1A 3DT1A 4QMZA 4U44A 4UV0A 3RK7A 1GAGA 3UJGA 2OH4A 5HCYA 1T46A 2YCSA 1QMZA 3CPCA 4FIGA 1J91A 4AGDA 4BBEA 4JR3A 3PVGA 2C5NA 2J2IB 3NCGA 3LFQA 4QP6A 4EKLA 5DBXA 4S31A 3VS2A 4O6LA 4J52A 4GT5A 3COHA 3THBA 1PXPA 1APME 5IA4A 2E9OA 3G9NA 3S95A 1XH6A 4I94A 4G2FA 5CS6A 1Q8TA 2RL5A 2IW6A 3SAYA 1CKIA 3NZ0A 1Z57A 3G0FA 1E9HA 4X2GA 3JS2A 3P7BA 2UW0A 2OF4A 3BE2A 3TKHA 5IZFA 5I4NA 1OGUA 5I9XA 4OTQA 4MEDA 4KKGA 4GH2A 4YNOA 4E6AA 4PNIA 4C3PA 1MRYA 1W8CA 3D5XA 4TYEA 2VWWA 2WTIA 2XB7A 1YOLA 1PMEA 2B52A 4WO5A 2WIPA 3HZTA 5DLSA 3SVVA 4R5SA 4HPUE 4NKAA 2EU9A 5BVKA 3KN5A 2P2HA 2J0JA 3IO7A 4AT5A 3LJ1A 4UMPA 3PZEA 1PY5A 4FKUA 1BMKA 4F08A 1H1RA 4KIKA 3HLLA 3MWUA 4AP7A 2JIVA 2ZYBA 4I0RA 5AV3A 3UIMA 2Z7LA 2QD9A 2XJ1A 2ZB0A 5T3QA 4BIEA 3F61A 3Q5ZA 5CSPA 2IVUA 4FE2A 4NT4A 5FEEA 5HBJA 2X9FA 1R39A 2V55A 1Z5MA 3BHHA 2CSNA 3FC2A 4U42A 4X3FB 3ZH8A 5LMBA 4KRDA 4X2NA 4L44A 5F95A 3Q9ZA 3EMGA 4I92A 1DAYA 4RJ8A 2OO8X 2QO9A 2JKKA 4QQJA 4X2JA 3W2OA 2F7EE 4BGHA 2WQOA 4D1XA 3OOMA 2VTLA 2XJ0A 4C58A 4ENXA 1GZ8A 2J9MA 4ONAA 4FGRA 4PL3A 3TJCA 3NDMA 4E7WA 4LUEA 1J7IA 3E7VA 4U41A 3QRKA 4JG7A 4Y83A 5ANGA 3V01A 2VX1A 4AOIA 5TOZA 4RFYA 5M53A 3A2CA 4LOOA 3DKFA 2G15A 3HRFA 5DRBA 4WUAA 5DE2A 3CP9A 2P3GX 3HV7A 3EH9A 3HV4A 4I5PA 5AR2A 1FMOE 4DCEA 5KMKA 3BLQA 3QX2A 1MRUA 1GY3A 2VWXA 4OT5A 2JFMA 5L2QA 2GNJA 3VHKA 4JNWA 3WBLA 4PY1A 4FI1A 2X6DA 3UDBA 4BIDA 3QRUA 4FTRA 3TM0A 2OXDA 2ZJWA 3QCSA 4UZDA 5D41A 3RZFA 4DH3A 3K5UA 4IFCA 3HMPA 3VF9A 1DI8A 4U5JA 3ZXTA 3RGFA 4EI4A 5CSHA 1JPAA 2QI8A 2B9FA 4M8TA 3IQ7A 4UXQA 4V0GB 4Y46A 5DNRA 3C9WA 5DWRA 4QPSA 4G3EA 4BWPA 4RIOA 3AOXA 1GZOA 4E5WA 2AC5A 3EHAA 4GMYA 5CLPA 4YJSA 4JAJA 4X0MA 5AV1A 4KIQA 3E8NA 4D58A 3F2RA 2Q0BA 2P33A 3OTVA 1IAHA 2WMTA 4CFFA 2HIWA 3BHUA 1LR4A 1M7NA 1H24A 3FMEA 3QLGA 3R9DA 1OKWA 4BKJA 4FEVA 2QC6A 2PK9A 3PXYA 2BDJA 4K77A 3G0EA 4G3DA 3BGZA 2Y4PA 5KZ0A 3WZJA 4BTMA 2PZIA 5HLWA 5KO1A 4GFOA 2NO3A 2XIKA 4M69B 4EONA 4ZY4A 3OOGA 3OCTA 4K6ZA 1U5RA 2WHBA 5DR6A 3GCUA 3MY1A 3PY0A 1YHWA 3IG7A 5EOBA 4AN2A 3HMIA 5EYMA 2OW3A 2W4JA 3LFSA 4QMSA 4WIHA 5JEBA 2GS6A 2WXVA 3CLYA 4QMMA 1Q24A 4O0YA 2IG7A 2QLQA 3KXMA 4U3YA 4HW7A 3W10A 5FBOA 3U9NA 2QONA 3QLFA 5KCVA 1XJDA 2WMUA 3LIJA 4XRJA 5KMMA 2E9PA 4D4YA 4AZFA 3F66A 3QXOA 4WKQA 4BYJA 5HI2A 4J1RA 3GU5A 4G5PA 3R04A 4FV2A 5F94A 2CNUA 3BQCA 3MJ2A 2VO6A 3W18A 4IC7A 2OK1A 4EUTA 5FM3A 4GU9A 3RPYA 2VO0A 3IGGA 5KBRA 2CKOA 5CI6A 5M09A 2QOOA 3NUUA 2ONLA 4HPTE 4CYJA 4MBIA 4YGAA 1P14A 4CRLA 3G90X 5JH6A 4FK3A 4HGTA 3COKA 4OUCA 5HU9A 1ZYLA 2PZRA 3NNWA 1UV5A 1H1WA 3KK9A 1OIRA 4CFVA 3PLAE 4QOXA 3GCQA 3QTRA 4PMSA 4XRLA 3JY0A 2C3LA 3PY3A 2WMWA 3SOCA 4XCUA 2ZOQA 3R6XA 4YC8A 3UVQA 5B2MA 5L2WA 3GOPA 4M68A 3PRFA 2FA2A 3H4JA 4E5AX 3LOKA 3EQBA 4FT3A 2QODA 3KF4A 2W4KA 1PJKA 4M0YA 3QD4A 4RX7A 4BDGA 2WTWA 4HZRA 3HAMA 3L1SA 4KB8A 1BI8A 3UODA 3SA0A 4R8QA 4K1BA 3OD6X 2VTTA 3MS9A 2V0DA 3P0MA 5FBNC 3ZLWA 2W99B 3B2TA 1KV1A 3FHIA 3I6UA 3ZRKA 4LOQA 4C0TA 5D7AA 1SNUA 3EOCA 4FSUA 3DU8A 1OVEA 2X2MA 4F7LA 5L2TA 4XOYA 2JFLA 3KA0A 4O96A 4J8NA 2YERA 4WNPA 1NVRA 2PUIA 3UMXA 2XRWA 1V0OA 4YBJA 4I6FA 3R8UA 1WBTA 5HLPA 3GU8A 3RP9A 2GHLA 4IVCA 3PA4A 4I6BA 2W1FA 2OWBA 4GJ3A 5AA9A 5AAFA 5AADA 3RAKA 4APPA 2OG8A 1O6LA 4F7NA 3DLSA 3TZ8A 4NSTA 4FIFA 3V8SA 5M07A 2WU7A 2B54A 4FV8A 3FI8A 3CJGA 3EJ1A 3OW3A 2XM8A 1W82A 2XZSA 4FTJA 1YI4A 4JVGA 4GUBA 5FEQA 4XG3A 1F0QA 4I41A 2W17A 4FV6A 4IZ5A 4TKSA 3MA3A 5FRIA 2PMIA 4BYIA 2PYWA 4DFUA 1OIQA 1XH7A 4F0GA 1MP8A 3ZSHA 4QT1A 4FK6A 4MD8E 2JITA 3Q96A 4XG6A 4IAAA 1OL7A 4ZTRA 3C51A 5GZ9A 5CSWA 2OZAB 2F2UA 3TEIA 2QOLA 2YLEA 2YEXA 3AD5A 4N6YA 3ZLYA 3GQLA 4AZEA 2IZSA 2JKMA 4E3CA 4IWOA 5E8ZA 3S0OA 5LCKA 3QKKA 1SVHA 5HCXA 3NEWA 1HCLA 2C6KA 4BGGA 5EM6A 2WGJA 4L53A 3T8OA 1YI3A 4AN9A 3PZHA 3D7TB 4LOPA 5BUJA 4XBRA 4DCAA 1LP4A 3A62A 3F7ZA 3ANRA 4KIOA 2V22A 1Z9XA 2C6OA 5ETAA 5CU0A 2QO7A 4O22A 1K2PA 1IR3A 3Q9YA 5BUIA 1WFCA 2ETKA 3KGAA 2HWPA 3PTGA 3ZLSA 5CAVA 4OR5A 4QD6A 3GU6A 3R1NA 4BDAA 5M4FA 3FLYA 2QHMA 2OSCA 2BMCA 2R5TA 2W1IA 2VD5A 3NUXA 3DLZA 2HCKA 4G9CA 3AT3A 4IWQA 3FZOA 3AC2A 3DTWA 3MVJA 3E62A 3TTIA 1XH8A 3EQIA 4FIEA 4OTPA 4YJNA 3QCQA 2W5HA 3DB8A 4QQTA 5A54A 1J1BA 2FB8A 4RRVA 2F7ZE 4EYMA 5M57A 3NGAA 3Q5IA 4FT0A 1ATPE 1GZKA 4MBJA 3ROYA 4E20A 2DWBA 5IU2A 3L8SA 5HVJA 3H0ZA 4C4EA 2PVHA 3TIYA 4D2WA 3BBWA 2UZUE 3Q3BA 2QOBA 2W7XA 4OGRA 4RGJA 4DLIA 5AX3A 4BI0A 3OUNB 3LMHA 2W1HA 3KREA 3Q04A 5JGBA 4IEBA 4ZSLA 2W5BA 3FLSA 3SQQA 3KRXA 4I22A 1M2QA 2YISA 3RZBA 1ZMUA 5EQYA 1H01A 3IDCA 4LI5A 3NNUA 2YDJA 3NYVA 3RALA 3W2RA 3UE4A 5LVNA 4EHEA 3AT2A 4FG7A 2IZUA 2VGPA 2WELA 4GRBA 4QTCA 1Q4LA 2Z60A 4I4FA 1YKRA 3ID6C 2C68A 3OEFX 2PUNA 4HYUA 4ZY5A 5KKRC 2P0CA 5L2IA 3GUBA 5HCZA 2G2HA 4CEGA 4WT6A 2C0IA 3NRMA 3RPVA 3A7IA 4O83A 3LZBA 2Q0NA 3C13A 2JDRA 5FTOA 5BVWA 4L67A 3LLTA 5HVYA 3DDQA 4YJUA 1XH4A 3PPKA 4AU8A 3Q2JA 3CKXA 3B2WA 4MQ1A 4WBBB 1OPLA 1KV2A 1GJOA 3PA3A 3AC1A 4EH4A 3JXWA 1NA7A 4UEUA 2UZVA 4TWCA 3VBWA 3L9PA 4R6VA 3HUCA 5CEMA 2ZAZA 3PJCA 1V0BA 2VO7A 2WTJA 3QAME 4FG9A 4QMWA 5BYYA 4CKIA 4BCGA 4FTLA 1URWA 5HD7A 4D1ZA 2QKRA 4IJ9A 1Y6BA 2PY3A 2WEIA 3GB2A 3FMMA 2A4LA 2C6IA 4O86A 2R7IA 4FZFB 4HOKA 2X81A 4KSQA 2C5YA 4R7BA 3WF9A 1A06A 2JBPA 4RWKA 2HOGA 4EHZA 4XLIA 1Q5KA 5B2LA 1UNGA 2J51A 4O1PA 2G01A 3HP5A 3ORKA 3Q4UA 4RA5A 4RMZA 5KE0A 4A06A 2JDOA 2IVSA 3DJ6A 2R0IA 4GK2A 1Y6AA 3UVRA 4QMNA 5J5SA 2QOIA 4GG7A 4IACA 5BX0A 2IVVA 1JKTA 1UNHA 3ORXA 3CQUA 4AG8A 1J7LA 4J99A 3GU7A 1V0PA 1S9JA 1PW2A 4CNHA 4S32A 4K2RA 3BWJA 3MFRA 1UU3A 5ANEA 2OJ9A 3OWPA 2C0TA 5B7VA 4PNKA 5IEXA 3V51A 4AUAA 4C61A 4RPVA 5F4NA 4MD9E 4DFZE 1OL1A 2BTSA 2GCDA 3RCDA 5E8TA 1Q8UA 3DA6A 3QUPA 3DJ7A 5HO6A 3LFDA 2R3IA 3JYAA 2QOKA 3FXWA 5J1VA 1CKJA 1VYWA 4QMLA 5C4LA 2YJSA 5CU6A 2KULA 2C47A 4D5KA 4FEXA 3DDPA 3IONA 3KQ7A 5L2SA 4TL0A 4C4JA 2R3HA 2VNWA 3N4UA 3MESA 3I5ZA 4RT7A 3KXNA 5HQ0A 5L3AA 3U4UA 4UN0C 3UO4A 4JS8A 3U87A 2QR8A 3O0GA 4USFA 5BVOA 3FE3A 1REKA 5FM2A 4DGMA 4CG8A 3R7UA 2PMOX 5IISA 2BRBA 3QZHA 1YWNA 4KA3A 5A4EA 2QOFA 2OFVA 4RLKA 3SG9A 3ORMA 3VC4A 3F69A 4QYYA 3NX8A 3TL8A 5H8BA 4I24A 4FL3A 3MIYA 4FNZA 5KMLA 1JWHA 1E1VA 4X3FA 1PXOA 2DYLA 2GNFA 4EQMA 4FTOA 1IRKA 4PDPA 1CMKE 4RWJA 3UPZA 1LEWA 4KBCA 4EOSA 4RJ7A 4AF3A 4CMUA 4FKRA 5AUWA 1J1CA 3BHVA 5EKNA 2CHLA 3HGKA 4YPSA 4XYFA 5DFPA 3FMKA 3R7VA 3DXQA 3KMWA 5DR9A 4AA0A 3UIBA 4RIYB 3N4TA 4BCMA 3IW7A 1CKPA 4XG4A 3C0IA 3VS4A 4A07A 2J5FA 3PIXA 4C59A 3UOKA 4F9CA 3UGCA 4TWOA 3OCBA 3QD2B 4CTBA 4FV5A 3OCSA 5HICA 2O2UA 3UTOA 3NYOA 4H3QA 4XJ0A 3W16A 2BFXA 4AA5A 4O7RA 3E64A 2FGIA 5FD2A 3DFAA 2I0EA 4F1OA 4U81A 4LUDA 2Z7RA 5CTPA 2HZ0A 3OF0A 4YTIA 4F6WA 5ICPA 4L52A 3C4WA 5HZNA 5BMMA 4BKZA 2HZNA 2JC6A 1ZZ2A 1ZZLA 1WVXA 1ZOHA 3WYYA 4M0ZA 3LMGA 4V0GA 3L8VA 3R22A 5HU3A 4AZSA 2W05A 5K9IA 2OIBA 4ANBA 3SW7A 2QVSE 2VTNA 4FVPA 3ITZA 3FZRA 4H3BA 2GHMA 4WNOA 4LQMA 2H34A 2JLDA 4B7TA 5L6WL 4FZ7A 1RE8A 3DNDA 3EN9A 3PWDA 4G3FA 4D2SA 2CKQA 3W33A 4H1MA 2J4ZA 1ZY4A 4YMJA 1WZYA 3C4XA 3BU5A 3NPCA 4F1MA 4UXLA 4NJ3A 1YXSA 3FJQE 5EW9A 3NIEA 5LVOA 4BICA 5HIBA 3F3VA 5GJGA 4Q9ZA 5HIDA 3OXTA 2VWIA 5EH0A 4IW0A 4UMTA 4CTCA 2WPAA 5D11A 4E6DA 5A14A 1JNKA 4L42A 3O2MA 3QQHA 1NY3A 3LXPA 3AG9A 3G2FA 2W9ZB 4ORKA 1UKIA 2CN8A 2VWBA 3VS0A 2YIWA 5BVDA 2QURA 3TG1A 4EQUA 2QLUA 2XIXA 4WG3A 4I4EA 1I09A 2FH9A 4A4XA 4QP7A 3RK9A 4P5QA 3TXOA 4MNEB 3C5UA 2RFEA 3A7GA 4Y5QA 1OBDA 3TUCA 2CGVA 2J0MB 4R7IA 3UC3A 3MFUA 3QYWA 3R8VA 4MQ2A 3W2PA 1B38A 4ALWA 2LGCA 2UW7A 4WUNA 4FKOA 4FICA 4I5HA 5EQEA 1ZY5A 2HY81 4YZNA 2ETMA 2Y8OA 3FL5A 5ANOA 2ITUA 4BDDA 3VRYA 3PWYA 4ZLYA 5E8WA 2VTOA 3QD0A 4EL9A 1E1XA 4WBOA 4A9RA 1ZYDA 4ITJA 1OI9A 5CAQA 3FUPA 4U0IA 5CU3A 2GFCA 5EDQA 3WOWA 1G5SA 2SRCA 1FVTA 1VJYA 2PE1A 3PPJA 5M55A 1XQZA 4GFGA 1DM2A 2VX0A 3FPQA 4CKRA 5JN2A 4S2ZA 2RFNA 3REPA 3GP0A 3ROCA 3V5WA 4FOCA 4KD1A 3GU4A 4AW2A 4F9BA 2BHHA 3E63A 2YWVA 1JSTA 5KBQA 3CJFA 3IDPA 4ITHA 5IA5A 5CVFA 4FIIA 5EM7A 5J7BA 5HE2A 4BDEA 5JSMA 5IQHA 1G3NA 2C69A 3LCDA 2PVKA 2JBOA 4F64A 4WSYA 3VUMA 4AQCA 4YUQA 3AC8A 4IADA 4CSVA 1NW1A 4AE9A 2FSOX 3EN4A 3FAAA 1KE8A 3PE2A 4EBVA 2XNGA 3E5AA 4UYNA 3LFEA 3AD4A 3ORZA 4EWQA 1RJBA 5JFXA 2CGWA 3P7CA 3FI4A 1B39A 2I7QA 4O7WA 5BQ0A 3FYJX 4YPDA 4FEQA 4G9RA 4TNDA 5JQ5A 3P86A 4DBNA 3I6WA 2W5AA 5JGAA 2YLFA 2OFUA 5DEWA 2VU3A 4NH1A 4FKSA 4P7EA 3RPOA 3FLNC 4XV9A 2B9HA 3NUPA 4XG2A 3LJ2A 2PSQA 2BKZA 3WZEA 3ZDUA 4FEUA 3E7OA 1GOLA 4FIJA 3PJ3A 3VUGA 3VHEA 3ZFYA 2IN6A 2J0LA 5HTBA 1YI6A 1OPJA 4FSYA 2C6LA 3COIA 4EK8A 3VNTA 2WKMA 3MH1A 4JIKA 2F57A 5CF8A 1FVVA 3SLSA 4CT1A 3OCGA 5BYZA 4O6EA 4W8EA 3GC9A 2YDIA 3NNVA 4M13A 3UZRA 3ANQA 3CY3A 4FV3A 4BCQA 2FSTX 3TKUA 5IMXA 4RLLA 2VTHA 2OZAA 3LXKA 4O0TA 5KMJA 4TZRA 2UV2A 2XIRA 4PF4A 4EOLA 2XKEA 3ZC6A 3NLBA 3MH0A 3EN5A 4FKIA 2OJIA 2ZM3A 4U3ZA 2CDZA 2R0UA 4QMPA 5E8XA 3PJ2A 3UP7A 1M7QA 2XNOA 3QQGA 3QWKA 2GDOA 4IB1A 5AV0A 3R00A 1WBPA 3GENA 5HVKA 3TI1A 2B53A 4B9DA 2BR1A 4ERWA 4KINA
chains in the Genus database with same CATH superfamily
1QPCA 5GZAA 4S33A 3L9NA 5CYIA 5GNKA 2ZM4A 2BRGA 3D7TA 5ITAA 4RSSA 4I6QA 3RK5A 2X39A 3QC9A 3BU6A 3LFCA 3ZRLA 3C4CA 3GNIB 3V5JA 5ETCA 2QOHA 5C1QB 4BTFA 3LCKA 4IXPA 3I1AA 4ZXTA 3HKOA 3ZZEA 3FQSA 3PA5A 1WBWA 3HNGA 4D2PA 3QRJA 4EKKA 2QU6A 4L43A 2WQEA 3UO5A 3DAJA 4LRJA 2OICA 2WMQA 2HYYA 1VYZA 3TNQB 5FEDA 5CAPA 3QQFA 2YCFA 3UDZA 4UY9A 3VBQA 4GSBA 2CLQA 4UZHA 3H10A 5JT2A 3AMAA 2BDWA 4QMOA 5J9YA 5EQPA 5HX8A 1OL2A 2QOQA 3UIUA 3ZUUA 4DLJA 3Q9XA 3A7JA 4C4IA 4C2WA 3PSBA 3PXZA 4IQ6A 5I0BA 4O91A 4BDFA 4BCIA 1W84A 4X2FA 3EQHA 4ANNA 5CQUA 2WMAA 3HYHA 1W2FA 5FTQA 3UVPA 3VUHA 2UVYA 3GBZA 1U46A 2C6TA 2ITTA 4D0WA 4DE4A 4X6RA 4EC9A 1PXLA 2QG7A 5A4CA 5IKWA 1H28A 3ZO1A 2RSVA 2R3LA 3HV3A 4JT3A 1ZWSA 4B99A 3DBEA 4E93A 1G8SA 2PVYA 2NNWB 4APCA 3NW5A 1H0VA 2AYPA 2GNIA 5JFSA 3HECA 4BHZA 4O0RA 3RPSA 4CRSA 5IEYA 3FEGA 3PVUA 1PRYA 2WNTA 1YOMA 3GFEA 2WTKC 3GVUA 3N9XA 4M67A 2YIQA 3PPZA 1RDQE 5E1SA 1YW2A 4V04A 5KX8A 2XVDA 3FZ1A 3Q9WA 3SXSA 3ZSIA 4DDGA 1YDSE 3WF8A 3IW8A 3KRWA 4RIWB 5AP4A 5AP0A 4LFIA 2XKCA 4BZDA 5CENA 1OBGA 4H05A 1Y91A 4FMQA 3D83A 3GXLA 2REIA 5GJFA 3EL8A 4BDHA 4O0UA 3ZM4A 4N4SA 4TWNA 4I5CA 3DK3A 1G8AA 1MQ4A 4DFXE 4EH3A 4HYHA 4KKHA 5AJQA 2PVLA 3SD0A 3TV4A 3MPTA 4MK0A 2GQSA 4DBXA 4JL9A 3B8QA 4NM0A 4QP9A 2ZDTA 3U4WA 3FMNA 3LAUA 4A9SA 4IAZA 3NW6A 4C3RA 4YO6A 4IM2A 4MVFA 1AGWA 4PP9A 4XP2A 5ACBC 4IAKA 3KCFA 3MH3A 4J8MA 3DK6A 3H9RA 4PP7A 1P5EA 2XIYA 3K3IA 4MUQA 3HMOA 4GJ2A 2W06A 2F9GA 4QYEA 4UWBA 4DGNA 1P4OA 1FOTA 3KMMA 4OTFA 1V1KA 5AM7A 4CFXA 4A7CA 3IW4A 3CTJA 4XHKB 4GK4A 1FMKA 4J96A 3NVMB 3NVKI 4LYNA 4PMTA 4K8AA 2XNBA 3SXRA 2VN9A 1MUOA 1SVGA 4D2TA 3PJ8A 2OH0E 5LWNA 4C37A 3ULIA 2EB3A 4KRCA 3F88A 3TKIA 1XBAA 4Z3VA 3TNWA 2YCQA 2XJ2A 3HEGA 3LFBA 3QL8A 4BDBA 1ZMWA 1O9UA 2DS1A 3BYOA 2I0HA 4TY1A 3H9OA 4QMUA 3POZA 4AXCA 4CVAA 3UZTA 3JVSA 2GNGA 4CCUA 2WTVA 4A4LA 3RHKA 4XS2A 3F3ZA 3VBYA 2DUVA 2PZ5A 3EZVA 4GEOA 4KWPA 3ACJA 4LL0A 3WZUA 4AAYA 4TYGA 1SZMA 2R3GA 3HMNA 5DH3A 4AWIA 2AC3A 5BVEA 1J3HA 1KSWA 3OWKA 4PPCA 2BALA 4MBLA 1H8FA 4AW1A 1R1WA 5AR4A 3ZOSA 5IA1A 5K0KA 3SXFA 4FTTA 3G15A 4BJJB 3ZU7A 3R1QA 4IX3A 4JJRA 5HG7A 4NYEA 3DFCB 1OKVA 4A9UA 4YJPA 4BI1A 2JAVA 3O7LD 4R3RA 3WF7A 3KXXA 4JDKA 3CIKA 3BX5A 1BYGA 2YACA 3PP1A 3PE1A 3VS6A 4EK6A 4EBWA 4FKPA 5KMNA 1JKSA 5HG9A 4F6SA 4YO4A 3DTCA 3MB7A 5L6PA 3DBFA 4XNEA 3ZFMA 2JEDA 4UMRA 1WBOA 2PMLX 4QYFA 4JBVA 5TR6A 4BN1A 1YHSA 4I0SA 4QRCA 4E4NA 5KNJA 2ITPA 2J7TA 2FSLX 5GJDA 5CF6A 5HIEA 5BV3A 2QU5A 3HA8A 4FKWA 2OGVA 3OBGA 4G6LA 4H58A 4XOZA 4O7YA 3RWPA 2PHKA 3POOA 2CNQA 4FV4A 1XR1A 3BV2A 5IUHA 2XK3A 4Q2AA 4DH7A 3C4FA 5HOAA 4CGAA 2BZIB 3EQFA 5L4QA 2PUPA 2UZDA 3QA8A 4HGLA 4HNFA 4LV8A 3OY1A 5CVGA 3MPAA 3PJ1A 2R3OA 2UW8A 2PVMA 3W8LA 2HK5A 3FBVA 1LPUA 1OUKA 3LXNA 1JOWB 4I93A 4RIYA 3CBLA 2LAVA 3PXFA 4NUSA 3T3UA 3VUDA 2CPKE 3V04A 3IK3A 4ZAUA 5CAOA 4A4OA 5B2KA 4M66A 4KNBA 4MX9A 3VS1A 1FPUA 3F5PA 5K5NA 4GYIA 3D14A 4GCJA 4L9IA 4OT6A 4ACCA 3D4QA 4RQKA 2XNPA 1QPEA 3N4VA 2A27A 2HZIA 3Q6WA 3IOKA 3S2PA 1M17A 5JFVA 2FO0A 4PPBA 3WE4A 2VV9A 2W0JA 5FG8A 3VRZA 3QZIA 3WIKA 2X4FA 1FVRA 2JIUA 1BKXA 3ZFXA 4GW8A 4U8ZA 4E1ZA 1YWVA 4F99A 4G6NA 3V8WA 3WZKA 2J0IA 5HGIA 2BCJA 5FXSA 3OMVA 3HDMA 5CWZA 4EZ7A 2Q83A 4FV0A 2OJGA 5BUEA 3C7QA 3U9CA 1H1QA 4G3CA 1U4DA 4YLJA 4FA2A 3MVLA 3NAXA 2WFYA 4EOKA 3ZM9A 1XWSA 3HAVA 5DYJA 5IQBA 1SMHA 4NCTC 3BL7A 2HENA 3CGFA 4JDIA 4AQKA 3KF7A 1G8KA 2BAKA 2GPHA 3NMUF 2C3JA 3D7ZA 2JAMA 2ERKA 4AOJA 3KULB 4FR4A 4Z7HA 4NEUA 4RWLA 1WAKA 3D2KA 4GK3A 4B6LA 4MF1A 2ZM1A 4MNFA 3PUFC 3OEZA 4HVGA 1P4FA 1S9IA 2F49A 3ZTXA 5KKRB 3FKOA 3OG7A 4TNBA 4BF2A 4C4HA 4BVUA 5L6OA 2XYNA 5LWMA 4DTKA 4DGLC 3F9NA 3O8UA 2F7XE 4ZSGA 3RNIA 3AXWA 4RJ4A 3S00A 3PP0A 5CT0A 5HTCA 3KK8A 3PXKA 3SW4A 4BTKA 5CQWA 5F1ZA 2E9UA 2PU8A 3GC8A 5HE3A 4FVQA 4GKIA 2A1AB 2HW7A 4O2ZA 1PXNA 1K3AA 2HXLA 3LM0A 1KE7A 1OKYA 1JQHA 4MNEA 3UZPA 4NIFB 4FL2A 4NM7A 4USDA 2RF9A 5E90A 1Q99A 1PHKA 3BE9A 3MPMA 1YXTA 4ZTLA 3GGFA 4PL4A 3WI6A 4QTEA 2IO6A 4NW5A 4QEBA 4U7ZA 4W4WA 4MHAA 1H1PA 2OI4X 4BCPA 5AP7A 1H25A 4OBQA 1ZXEA 1M2RA 1H1SA 2F4JA 3QALE 4DG3E 2NP8A 4HVIA 2X7GA 3UYSA 4NL0A 1XKKA 2VTPA 3RCJA 3QHRA 3W8QA 2R3JA 4RC3A 5K4IA 5BPYA 5DI1A 1A48A 1NT2A 3WYXA 2BAQA 3R1YA 4DITA 4PTCA 5T68A 4JQ7A 2GQGA 5C4KA 2PZPA 5CNNA 4ZLZA 3OBJA 4M97A 4EQCA 1Q62A 3LFNA 2EWAA 2O3PA 3PSDA 5DA3A 5EKOA 4ZTHA 4AZWA 4EWHA 5AR5A 3MDYA 1SVEA 4U97A 2CKPA 3O8TA 4FL1A 4ITIA 3ERKA 4IIRA 4WRGA 5AIKA 4DC2A 2BKKA 4V01A 4BDIA 4GS6A 4NM3A 5IQAA 1REJA 2I0YA 3D9VA 1ZAOA 3HUBA 3JR1A 4L01A 3MTLA 3DGKA 4XLVA 3K3JA 3ZZWA 3VONA 3C50A 4RIXA 4FKTA 3DPKA 2YN8A 2GS7A 3A99A 5TF9A 2P55A 4JRNA 4FV9A 4IDVA 3P5KA 3OXIA 3V8TA 3CPBA 3LCSA 4J97A 3E92A 2OF2A 5F9EA 5KUPA 3Q6UA 3AC4A 2Y7JA 1X8BA 3AQVA 2XNMA 3QTWA 2XNEA 3RTPA 4EOMA 2R3FA 3EN7A 2UW4A 1Q61A 5CY3A 4W8DA 2PVFA 4KIPA 2XAOA 2B4SB 4GKHA 3Q4ZA 2YIXA 5HG8A 3MVMA 3LLAA 2UW6A 3F3TA 3LHJA 3NWWA 2IF8A 4IANA 4ANSA 2J6MA 4I5MA 4BKYA 4D9TA 5A6NA 3HV6A 2A0CX 2VO3A 2XEZA 3QA0A 5CASA 4FSZA 2EVAA 4QTAA 2OJJA 3VF8A 3ENMA 3HDNA 4FUYA 3BI6A 5F20A 1DI9A 3T3VA 4C35A 2X0QA 4RJ3A 3LQ5A 3MY5A 3I5NA 3ATSA 3WF6A 2O0UA 3TIZA 3IS5A 4EOJA 1IEPA 4DF3A 2RG5A 3GOKA 3AD6A 4BCNA 4BWKA 1LEZA 3FMJA 1P2AA 4EZ5A 4DEBA 2UVXA 5FP6A 4TWPA 3K54A 4E26A 4F9WA 3R0TA 5ANIA 3F7WA 3FL4A 4R1YA 4IVDA 5LXMA 3VQUA 2ITOA 5LOHA 3QYZA 3E93A 4F7SA 4L68A 4JX3A 3QRTA 1YRPA 2R3KA 4YTHA 4OW8A 4F09A 4I23A 4EK4A 1UWJA 3DS6A 4PPAA 2R9SA 5E7RA 4W4YA 5JKGA 3TDVA 3NUSA 2XK7A 4DGOA 1GZNA 2XBAA 5JFWA 5JK3A 4LMNA 4TXCA 4G3GA 4XG8A 5EM5A 2OLCA 4RVMA 5E8UA 4WOVA 4QTBA 3BPRA 4XBUA 5E8VA 4ANOA 5KHWA 1I44A 4AFEA 3LQ3A 3V3VA 4X6QC 5TE0A 2XS0A 1LUFA 1YDTE 4L46A 5JZJA 4IVAA 4GV1A 2WQNA 4DN5A 3MI9A 4ANQA 3QUEA 5H8EA 1KE5A 4MXAA 3FDNA 4FUXA 4LV5A 1WVWA 1ZARA 3C1XA 4FZ6A 3VW6A 1JSUA 2P4IA 3ZRMA 5EHOA 1ND4A 4U45A 3RNYA 3PFQA 1Y8GA 4F1TA 2FUMA 1DAWA 1UU9A 5D10A 3MGYA 4FKLA 4LMUA 3H3CA 3PYYA 4O2PA 4ENYA 5A46A 3FLQA 1WMKA 4R1VA 3ZO2A 4CQGA 5IF1A 2GSFA 1OUYA 5KHXA 4FYNA 3R83A 2HXQA 4G16A 4U80A 4R78A 4I6HA 3EB0A 2CCHA 4FT9A 4WHZA 5H2UA 3CXWA 1M14A 1BUHA 2CJMA 5FXQA 2VWZA 3VJNA 2ITNA 3R9OA 1KE6A 2ZB1A 3VN9A 4ZJVA 3DBDA 3ZONA 2PVNA 3KRJA 2G1TA 3BKBA 3KVWA 1R0PA 3QC4A 4GVJA 5CAUA 3IW6A 3W0SA 4H39A 4O81A 3Q60A 2O8YA 4O82A 4TYIA 1MQBA 2XF0A 3P5JC 4IB0A 2B0QA 3GC7A 4L6QA 2I0VA 4OTGA 4O7LA 2QR7A 4EJNA 1FBNA 3UNZA 1W83A 2J50A 4PTEA 4DH1A 4RIWA 4G17A 1UA2A 4CG9A 4PL5A 4D4RA 4PDOA 1OL6A 3QTSA 3MYGA 4EOQA 3BLRA 5CVHA 3CKWA 3MW1A 3R7IA 5DEYA 2Y4IC 3DKOA 3G5DA 4P90A 4X7QA 4IVBA 3O71A 4BIBA 5I5ZA 5EI8A 1BI7A 3U51A 4WNMA 4XUFA 5I9WA 2W4OA 1ZLTA 1YXXA 3LFFA 4ZY6A 3VUKA 3ZO3A 1Q8WA 3BIZA 1GIHA 2B55A 2NRYA 2YJRA 3QBNA 4HJOA 5IPJA 3D5VA 3TCPA 1JKLA 4PRJA 4AXAA 3DAKA 3LPBA 4M7IA 3VJOA 4IE9A 3KY2A 4I1ZA 3OFMA 2ZV7A 4K33A 1F5QA 3OUKA 2OIDA 4FNYA 3ULZA 3GFWA 4DFBA 2XEYA 4D1SA 3R7EA 4L45A 3O51A 4FRFA 2VTMA 4OBOA 4AT4A 2VX3A 2YM6A 4DEAA 4L3JA 4NFNA 5HO8A 3R71A 2UZEA 3RJCA 1IA9A 2C6MA 2UZTA 4FF8A 3SX9A 3R30A 5LVPA 5IUIA 5G6VA 3FSFA 2FSMX 4R7HA 2VNYA 4FKGA 4RVLA 1CTPE 4CKJA 4NU1A 4O21A 5DOSA 5I3RA 3WILA 4ARKA 4RJ6A 3QX4A 3DOGA 3L8XA 3NYNA 3TN8A 3TT0A 4DFLA 3SKCA 1O6KA 4CCBA 3NUNA 3Q32A 2Y0AA 2OKRA 2X7OA 4H3PA 4ZTMA 5M4CA 3GCSA 5CSXA 4DHFA 2G2FA 3W0RA 3HRCA 4G5JA 4GFMA 4H1JA 3VS3A 4UB7A 4DFNA 3ORPA 1TVOA 4BWXA 3D5WA 2X2LA 2CMWA 2PMNX 4BDJA 2Y6OA 5AUTA 4QMYA 1PF8A 4YP8A 5I9YA 5BVNA 4PMPA 5BMSA 5HO7A 5FXRA 5EHYA 5IQDA 4HVSA 4ZS4A 3ORLA 2H9VA 3R21A 4IHPA 4O7VA 3QQJA 3IGOA 2XMYA 4NCTA 1W2CA 3O96A 4FTCA 4E4LA 1Y57A 3QTXA 4BZOA 5IQCA 5JRSA 1FGIA 3CTQA 5IQGA 1PXJA 2ONLC 4ASDA 5GZ8A 5FQDC 4FKJA 1WBNA 3JPVA 3PRIA 2RFSA 2UW5A 4HCVA 4ZS0A 1YQJA 3RVGA 3LKMA 3ELJA 4GT3A 2ZDUA 4M84A 3CQWA 2GFSA 4YZBA 1WBSA 3FYKX 4QP4A 3ODYX 3R7GA 4BCFA 4U6RA 4BGQA 4YZCA 1T45A 3UIXA 1EH4A 2WMRA 4RX5A 2BUJA 3DKGA 4JXFA 5AUXA 3TV7A 3UG2A 5CI7A 1UNLA 4CZYB 3QKLA 3UC4A 4GYGA 3TZMA 3DQXA 4U40A 3H0YA 3V6RA 3SG8A 3G6HA 4D9UA 4YZ9A 2ITWA 5IH5A 1VZOA 4JOAA 2UZWE 3H30A 4NJDA 2OXYA 2OJFE 2RKUA 4RVTA 3F5XA 1OMWA 4ZK5A 1GNGA 4ASXA 1WVYA 2BPMA 5EYKA 1PKGA 5DR2A 3TACA 2A19B 4RC2A 3FMHA 3L8PA 4U79A 5E92A 4E73A 4N57A 2VTIA 3ET7A 4RIXB 1ZYSA 5H9BA 4EZ3A 1U54B 2C1BA 2EB2A 1QPJA 3QQKA 3F3WA 4FYOA 5CEIA 2PVRA 3EIDA 3MBLA 4ZJJA 4BRXA 5CALA 4QMXA 5IEVA 4PV0A 3AMBA 2G9XA 2I40A 3V5TA 4D55A 2W96B 5AEPA 2EXEA 1IA8A 4ERKA 4AX8A 3R28A 1H00A 2NPQA 4FV1A 2OBJA 2CGXA 4UMQA 1PYXA 3FZPA 1FQ1B 3D5UA 3FY2A 2YM5A 3P1AA 3A60A 4C57A 4DH5A 4K9YA 4FTIA 4ACHA 1FGKA 3DY7A 5E8YA 4MYGA 5C03A 5DG5A 1PMNA 5JQ8A 4W4XA 3EFJA 3ATTA 4E6QA 4XV2A 4O7ZA 4OAVB 1TQPA 4MAOA 3TUBA 1PXMA 3FPMA 3KULA 4C34A 4MWIA 4XG7A 3IECA 1H0WA 4RZWA 3TWJA 3RM6A 4KBKA 2X0OA 5L8KA 4EUUA 2WTKB 3QKMA 2YM8A 3R9HA 3W0NA 3E88A 4OTIA 2V62A 4Q5HA 4AW5A 4I20A 3P23A 4I21A 3TV6A 4OTHA 3W2QA 4FKQA 3P4KA 4FKVA 4L00A 4FG8A 2W1CA 3F82A 2XP2A 5EHLA 4YNEA 4AAAA 3VULA 4W9WA 2UZOA 1QPDA 5EW3A 3N51A 1BL6A 3EZRA 4JG6A 4QYGA 2ITVA 4DEIA 4EH6A 4DEDA 3F5GA 2VWYA 4JBQA 4NIFA 4R3PA 3NCZA 4KS7A 4YHTA 2YIRA 5E1EA 4FTUA 3BBTB 4YJOA 3HL7A 3QD3A 1YHVA 3T9TA 3V5LA 1R0EA 2WQMA 3I7CA 5HNBA 1RW8A 2O64A 3CR0A 3HX4A 2W1EA 3KKVA 5HTIA 4IM3A 5CNOA 4DG2E 1ERKA 4AXEA 4F6UA 3BGQA 2XYUA 3IOPA 4ZZMA 2YA9A 4IMYA 3SHEA 5IDNA 3OROA 3PSCA 2VTAA 4JAIA 1AQ1A 5CEQA 4F63A 4BR3A 3LCTA 2Z7SA 3LXLA 1ZRZA 2V5QA 3WF5A 3L9MA 4BBFA 2QG5A 3QZGA 4GUEA 5E91A 3UDSA 4Y5HA 4NM5A 4IB3A 4RQVA 4MWHA 5C01A 4RX8A 2XK8A 4LGGA 2XM9A 4MXYA 1QL6A 2YWPA 5IQEA 5L8JA 2PZYA 1PMVA 4TW9A 1YWRA 1R78A 4G6OA 2JIIA 2WTCA 3SV0A 4FTNA 3D15A 4YLLA 3UP2A 4ZMFA 2B1PA 2IZRA 4EYJA 1JLUE 4LRMA 2WIHA 1NVQA 5CXHA 4EJ7A 1PXKA 3R1SA 3C4ZA 4D4VA 3C5IA 3VIDA 5IA3A 3BV3A 3MFSA 1JAMA 4RBLA 3M2WA 4MXXA 1ZYCA 2W1GA 5IUGA 4XH6A 3SRVB 5JZNA 3OP5A 5LMKA 4YC3A 4NW6A 4QMVA 4LDTA 2R7BA 4J53A 3DJ5A 3GEQA 4S34A 4NZWB 3EQPA 3RAHA 3UNJA 3Q53A 2CCIA 4WNKA 4QMTA 3PIZA 4BCKA 3VS5A 4K11A 5CX9A 4D28A 5ACKA 2ETRA 2QO2A 1W7HA 3ZBFA 1TZDA 3GCPA 1SM2A 3DAEA 3QTQA 1W98A 4M14A 2UVZA 5A6OA 3VS7A 1UU8A 5M4UA 3BYVA 4JRVA 4F78A 3DV3A 4QNAA 3PIYA 4MF0A 2VZ6A 2XBJA 3QWJA 3QCYA 4CT2A 4B8LA 3BEAA 2PWLA 4O84A 3KL8A 3BLHA 2QKWB 4FTAA 3EYGA 3LE6A 4EH2A 5LQFA 5TO8A 4XMOA 3BQRA 4ALVA 2JDVA 3EFLA 2BFYA 3BCEA 5DMZA 2ITXA 1VEBA 2BRNA 3A8XA 3BHYA 3L9LA 3MH2A 4CLIA 5I9VA 4ZP5A 4RFZA 1H4LA 3A4OX 3E8DA 4HCTA 2W1DA 4L7SA 4J71A 2OXXA 5DT0A 3E3PA 3OT8A 2PE2A 4O4BB 3DNEA 3RHXA 2H96A 3ORNA 4DINA 4I0TA 5LMKC 3UQFA 3U55A 4L7FA 1M52A 4IBMA 5A4QA 4QQ5A 5AA8A 3I4BA 2YHVA 1CSNA 3MB6A 4NWMA 3QTIA 3FHRA 2WMBA 5HKMA 4PUZA 4GVAA 5TKDA 3MY0A 3W0PA 4BBMA 3BELA 2HZ4A 4WRSA 3D94A 4FBXA 5IQIA 4KUJA 2C6DA 4FSWA 4MH7A 4JBPA 4UWCA 3Q4TA 5GIPE 4E5BA 3II5A 3KN6A 3OW4A 4UBAA 5AM6A 2JD5A 4ACMA 4B0GA 4C62A 4DFYA 5M4IA 4AW0A 3UDTA 3BHTA 2IVTA 2QHNA 4JDJA 3PG1A 4JG8A 4D0XA 3HV5A 3OXZA 5EG3A 3E8CA 3BRBA 3VO3A 2RG6A 1Q41A 4FNWA 4FZAB 1UVRA 4O27B 3EQRA 3CCNA 2XUUA 4ZSJA 3VUTA 1OITA 4BI2A 4IX5A 4ZEGA 4YHFA 2WAJA 3SOAA 5FLFA 5AP5A 3P7AA 5EOLA 3RINA 4JI9A 4P4CA 4JQ8A 2X6EA 3UOHA 4DG0E 2WOUA 3I7BA 5C8MA 5HX6A 4GU6A 5IH6A 1J7UA 1XO2B 4AOTA 3FSKA 5A9UA 3A7HA 3I81A 4J95A 3KRLA 4FSRA 2NYAA 2BRHA 3QTZA 4GL9A 4AFJA 3MA6A 4BHNA 3R7YA 5CEPA 2BIYA 3FZSA 3FKLA 4XX9A 2YIYA 4EOOA 4D5HA 4AT3A 4FEWA 4UYAA 4XP0A 1OGYA 2HELA 4Q9SA 3VBVA 2BTRA 2QOCA 5L8LA 2BVAA 4HGEA 4X3FC 3O50A 2BDFA 5LMAA 4FSQA 2AUHA 3JY9A 1ZOGA 5ETIA 4AGUA 4LGHA 4JDHA 3ZS5A 2GTMA 1H08A 3BU3A 3MSSA 4KABA 5IDPA 5LJJA 1KWPA 5DT3A 2X8DA 5M44A 4QO9A 1XBCA 3ZCLA 3QFVA 4II5A 3R01A 3W2SA 3DXNA 5ANKA 3TNIA 3NAYA 5EYCA 1U59A 4X3JA 5AP2A 2UW9A 1H07A 3MJ1A 2BZKB 3VBTA 3V5QA 3ZDIA 4N6ZA 5CF4A 4CQEA 2E9NA 1URCA 3DZOA 4I3ZA 3NFGB 2ZV2A 3OT3A 2WMXA 4CV8A 5FUTA 2Z02A 4YSMA 5AAGA 3P78A 3VVHA 3MV5A 5C27A 2JKQA 3F3UA 1KOAA 3U8WA 5FDPA 3W0QA 4O4EA 3BLAA 5ETFA 4JBOA 4YJVA 4ANLA 4IZ7A 5DIAA 3AT4A 3QTUA 4YBKA 4Z16A 5M51A 4R77A 3ORTA 2YITA 3PVBA 1JKKA 3QGWA 2WU6A 3R63A 3EQDA 2YAKA 5D1JA 3KEXA 5CZHA 1WBVA 2J90A 4MXZA 3O7LB 2C4GA 3UMWA 5DRDA 1STCE 3P9JA 3LQ8A 3QHWA 4R5YA 5ANDA 4XV1A 2R3NA 4AZTA 1OB3A 2I6LA 5I9ZA 3GCVA 4DTAA 2WB8A 2A98A 4TYJA 4X2KA 3TUDA 4OTRA 4EH9A 4HYIA 3O8PA 5K0XA 3MIAA 2A2AA 4TYHB 5CEOA 3KXGA 3FLWA 5AR7A 4CXAA 5HEZA 2Z2WA 3I60A 2PUUA 5AP1A 2UZBA 1ST0A 4DT8A 5LCJA 4FX3A 4N70A 2UW3A 4NKSA 3MFTA 2CNVA 4I6LA 4Y8DA 3H9FA 4EH5A 3TMOA 3RPRA 2E9VA 5FP5A 2NRUA 4C7TA 4S30A 3VUIA 3OVVA 3D0EA 4ACGA 4F7JA 3KMUA 3CQEA 4F65A 2QQ7A 3BEGA 4L3PA 5DHJA 1UWHA 5EW8A 3W55A 4IB5A 3EYHA 2W1ZA 2R3RA 2VWVA 3S4QA 4EOPA 3HMMA 4QQCA 5HNGA 5EI2A 5EFQA 3RMFA 4O0VA 4CMTA 2ITYA 4XEYA 2WMVA 3ALNA 3W1FA 4YZDA 4CD0A 2ESMA 4PDYA 4IWPA 3G6GA 4RJ5A 2ZV8A 3KXHA 4KS8A 4RA4A 5AP6A 4O0WA 1CM8A 4KAOA 4E4MA 2XK4A 2BILB 4PTGA 1W0XC 3ZUVA 4EK3A 3GC0A 2XNNA 5IG1A 5LVLA 1TKIA 5TT7A 4ZZNA 4C8BA 4UX9A 2YM3A 4Y95A 3DBCA 5DGZA 3PUPA 3GQIA 3ZLXA 3OHTA 1PKDA 1BX6A 1OKZA 3KFAA 2PULA 4ZTSA 2R3MA 5D12A 4ZMEA 3LW0A 4FSTA 4BDKA 4FIHA 3V5PA 4NK9A 2XARA 2X7FA 3IKAA 4G31A 1WCCA 2DQ7X 3ALOA 1VLRA 3AC3A 4FSNA 3P08A 2IWIA 4ID7A 5AIRA 5AMNA 4C2VA 2YFXA 1A9UA 1OPKA 2BAJA 1U5QA 2B7AA 3ODZX 3AC5A 4FC0A 4R3CA 5J5TA 2XA4A 4JR7A 4AXDA 1K9AA 2X8EA 1ZOEA 2J5EA 4FTKA 2UUEA 3VAPA 4O7SA 3R8MA 3QQUA 4O38A 5AR8A 4BCJA 4FJVA 2XANA 3NYXA 3Q52A 2W9FB 2IW8A 3DKCA 4O7NA 2GU8A 4QP8A 2UZNA 5CF5A 3KCKA 3BYMA 3AGMA 5DVRA 2IPXA 3WE8A 2C3IB 3HVCA 3RI1A 1YDRE 2O65A 5HBHA 3KB7A 4EORA 1U54A 3NNXA 3B8RA 5J87A 5ANJA 5A3XA 2XK9A 4MD7E 3KXZA 5J8IA 3ZXZA 4PWNA 3PFYA 3LCOA 4U9AA 1VR2A 3FV8A 3NIZA 3PDTA 1YVJA 4FNXA 4LV7A 4D2RA 5CT7A 4BDCA 5AUZA 5J79A 2Y6MA 3ZC5A 4IC8A 4KIKB 2X0GA 1L3RE 2J0KA 4J98A 3R8LA 1PYEA 2WOTA 3R02A 4QPMA 4YR8A 4Z9LA 3R9NA 3CS9A 3M42A 1FINA 2H8HA 4WSQA 2V7AA 3QGYA 1SYKA 2WO6A 5CEKA 4JIAA 3AKJA 5M56A 4KSPA 2C1AA 2VRXA 3QZFA 3TNHA 3ZBXA 4USEA 3OWLA 4QP1A 1QCFA 5H8GA 2YZLA 4XP3