4CKIA

Crystal structure of oncogenic ret tyrosine kinase m918t bound to adenosine
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
314
structure length
293
Chain Sequence
GPLSLSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVEEDSVKRSQGRIPVKWTAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET
publication title Oncogenic RET kinase domain mutations perturb the autophosphorylation trajectory by enhancing substrate presentation in trans.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 293
sequence length 314
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ckiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ckiA01
5E92A 4TPTA 2WTIA 3CQUA 4O6LA 3R28A 3FI4A 3POOA 4A7CA 2B53A 4RWJA 1KE9A 1GJOA 1OKVA 4QMTA 4IACA 3R04A 3PPKA 4M0ZA 4DC2A 2WQEA 4TYEA 4BTMA 3R9OA 2FSLX 3UOHA 1KV1A 1PMVA 2QKRA 4IB1A 3RK7A 1OKZA 3D2IA 1XJDA 4XCUA 2ITZA 3UTOA 3LIJA 3KGAA 3UQCA 1OL6A 2ZMCA 5BYZA 5ITAA 2WMAA 1H08A 4BCKA 3MPMA 5C4LA 2PVYA 4R8QA 5HLNA 3I60A 5LMKC 3TIYA 4E4MA 4LI5A 3W2RA 5G1XA 2PMOX 4LGDA 1ZMUA 2P2HA 2WTKB 5CLPA 1PHKA 1ND4A 3D5XA 4X0MA 1S9IA 3B8RA 1P14A 3QZGA 2Q0NA 4FG7A 5HVJA 3A7HA 5BVWA 5IQHA 3NUNA 2QOKA 3LFEA 4M3QA 4NCTA 4QMXA 5HNGA 1M52A 4D4YA 5EHYA 4AGWA 3QD2B 3QL8A 4QPSA 1L8TA 5LARA 4MD9E 4IZ7A 2I0EA 5IEVA 3PJ2A 4AT3A 2RGPA 5KBQA 3AGMA 3BHUA 2R3LA 3P0MA 3VS0A 4QYGA 3I0QA 3C51A 4PWNA 4V0GB 4PNIA 2JIUA 3L8VA 2RG6A 1KE6A 4AU8A 4RQKA 4L53A 1TVOA 4ITHA 4Q2AA 5G6VA 4TW9A 3CGFA 4OAVB 2EXCX 5EDQA 4CXAA 1F0QA 5HBJA 4DGMA 5I9VA 3QTQA 4NU1A 4OTIA 4CFNA 3DXPA 3HMIA 2OXDA 5EDPA 2J5EA 3BV2A 4IWPA 3D7TA 4LG4A 4F99A 4EZ3A 2UV2A 3U9CA 4K9YA 1I44A 5ACBC 4JG6A 5HX8A 4R1YA 4RWIA 2RL5A 3ROCA 2VO7A 2KULA 2XEZA 5EKNA 2R3GA 4RVMA 3BLRA 3P23A 3ZTXA 5EQYA 3RJCA 4FSNA 2YCSA 4M68A 2UVYA 1WVWA 3KQ7A 5DEYA 1Q8ZA 3OXTA 5CSXA 4DCEA 4N0SA 3LE6A 4BGHA 4ZY4A 5ANDA 3SX9A 3GP0A 3DXQA 3BELA 4O7YA 1TQIA 3MVMA 1W98A 3PP1A 3SW4A 2Q83A 5J9ZA 3ZXZA 3O7LD 3JUHA 3RPRA 3HMPA 4R7HA 4IDTA 3GOPA 4EH8A 2XNNA 3LQ3A 3SG8A 4KAOA 4Y5HA 1H27A 4QNAA 4H05A 2XJ1A 4JDKA 5CU6A 4FV6A 4BWKA 4IVCA 2C6MA 4YLKA 4AZEA 5IH4A 3PVUA 2KTYA 5IF1A 5BNJA 4YC6A 3SHEA 4IX4A 3OCTA 3TTIA 3OEZA 4IZYA 3G51A 4IWDA 1ERKA 4M84A 2C0TA 4S2ZA 4M97A 3CP9A 2VTJA 3EB0A 3N4TA 2VWXA 1JLUE 4QTBA 4I5MA 3IPHA 1M17A 3KXGA 3HVCA 3RAKA 4QP4A 5EK7A 2ZB1A 3HNGA 2HY0A 5CEQA 3LQ8A 3FWQA 1V0BA 4XLIA 3ID6C 3FZSA 4GFMA 2IW8A 2BCJA 3A8WA 2R3RA 3H30A 3Q6UA 3Q60A 4KIPA 4F7NA 4GU9A 4IE9A 2VTSA 3TT0A 4JAIA 3O2MA 3ZC6A 2QC6A 5KX8A 1KE7A 2DQ7X 3EKNA 4MK0A 2BAKA 5IA5A 3NRMA 2BIKB 3ZLWA 2IVUA 5GIOE 4DEIA 4D2PA 4I4EA 3TIZA 4CZUA 2UW6A 3VIDA 4ACCA 4ZJJA 3KFAA 3VBQA 3VS3A 3E93A 4QPAA 4DG2E 2OJFE 4ZTMA 4O7ZA 2Y4IB 1IRKA 3HV5A 5E4HA 2ITQA 4JOAA 5DRBA 2XBAA 3DKCA 4FV0A 3KRRA 4CCBA 5K0XA 4GK4A 4CFUA 5FBNC 2ZV7A 3D0EA 4GVJA 2XUUA 3PWDA 1APME 3HGKA 1UU8A 3EQHA 4ENXA 4HVGA 3EJ1A 3F3VA 2UZUE 2PZRA 2ZAZA 2C3KA 3HA8A 3K5UA 5K0KA 4FUXA 4PF4A 4JBQA 5E8SA 3V5WA 2FSOX 4L46A 3TI1A 5KKRB 1PYEA 3QRJA 3RVGA 3ZONA 4TWCA 3ATSA 3R7GA 2J2IB 2G2FA 3Q52A 4ITIA 4JT3A 4AA4A 2UZVA 1GY3A 5KMMA 2XIRA 3HRCA 2AYPA 5BMMA 2UZEA 4AW5A 3EYHA 3UOKA 2F2CB 2QURA 4KKGA 3FMMA 4E5AX 2GHMA 3CKWA 4O0SA 3HMNA 1WBWA 3DT1A 5D7VA 3U6JA 3CEKA 5A4LA 3GEQA 5DE2A 4GKHA 2OGVA 3GU7A 4ENYA 1RDQE 2RFSA 3OBGA 3F3TA 2YA9A 1YWVA 2XIYA 3PVBA 2G1TA 4W9XA 4WRSA 4YTHA 3ODYX 4BFMA 5LXMA 5C03A 1FOTA 4QOXA 5T3QA 4ALVA 5BVKA 2C5VA 5B2KA 4JI9A 4QD6A 3MVLA 5CNOA 5AR7A 3KK8A 4FKOA 2ETKA 5ETAA 4DLJA 4TYGA 5M4IA 4FKLA 4L7SA 3FMHA 3PY3A 3TZ8A 2XJ2A 1Q4LA 1YXUA 3ACKA 4ZTSA 4DG3E 1XH9A 1SNUA 2FYSA 5CEPA 4G3GA 3NYOA 3THBA 5HX6A 1CKJA 2JLDA 5BQ0A 3UIUA 1OPLA 3AD4A 4DLIA 5ANGA 4K8AA 4PPAA 4RIWA 5CVHA 3MYGA 4AZSA 4XP3A 4UEUA 4B6LA 1H4LA 3NAYA 4P5ZA 4C4JA 2GHGA 4FZ6A 4IEBA 4RC4A 2X9FA 4YBJA 5AJQA 4CG8A 4L42A 3IKAA 4O0YA 3BKBA 3E8DA 4G5PA 2A27A 5IQBA 3Q32A 2VTNA 3DBEA 3U9NA 3QRIA 3VBXA 3VJOA 3ZUTA 4FG8A 3HX4A 2YN8A 5EHOA 4MWIA 2XZSA 1XBBA 3QYZA 3DK7A 1QPEA 2E9PA 2UW9A 2JDVA 3BZ3A 4I0RA 2HXLA 1YXTA 3BLQA 2WGJA 4U9AA 4A4OA 4BKZA 3IK3A 3PXRA 2GPHA 3POZA 5D10A 4M15A 3F5UA 3UPZA 1FINA 3H0ZA 4ZSLA 5JRQA 2QI8A 4WRGA 4D4SA 1M14A 1YXXA 3F3ZA 5HE3A 2PVLA 4GCJA 3E8CA 4I21A 3F2AA 4NJ3A 4UB7A 2I1MA 4Y83A 3QX4A 4DGOA 4CLJA 5F20A 4BDGA 4OBOA 4O7RA 3BYMA 4C59A 3EIDA 2XKCA 3VC4A 1J3HA 4E4LA 3I6WA 1JVPP 1T45A 2C6TA 4GIIA 4M66A 4CKIA 1K9AA 2JBOA 2QU6A 4H3PA 2CLQA 4XG7A 5DGZA 2QOFA 5M53A 1GNGA 4HCVA 4IM3A 4U41A 2XB7A 3MPTA 1DS5A 4QMSA 3FMNA 3BGPA 2GNJA 3FZ1A 4G6OA 3PXYA 4FTUA 4J8NA 4QQCA 1H24A 1PXNA 5CU4A 4DCAA 3WZJA 2WOUA 5ETIA 4ERWA 3IONA 2W4KA 5F95A 3PVWA 1OPJA 2H9VA 3K2LA 3MDYA 2VTPA 4U6RA 4W9WA 4WG5A 4QP8A 5ACKA 5HLPA 3MVHA 5KMNA 5IZFA 2R5TA 4NFMA 3OTUA 5LQFA 5CXHA 3KXXA 4G34A 1PKGA 3FKNA 1K2PA 3KMWA 1H1RA 3UNZA 3FAAA 4XH6A 3ROYA 5IA1A 2WHBA 4AT5A 2JKMA 1OKWA 4O7VA 4L00A 3JVRA 4ZSJA 3SOCA 5CF6A 2O64A 3ZRLA 4E1ZA 3I5ZA 3QF9A 2V0DA 3E3BX 3OW4A 3PXFA 2XH5A 3FMDA 3WYYA 2C5NA 4F70A 4HVIA 1G5SA 4RVTA 1WBTA 1NVSA 5EYKA 3F2NA 1XHAA 1HOWA 4GL9A 4GS6A 4V04A 5AUYA 4EWQA 3LOKA 2IZRA 5CTPA 4CYJA 2VTMA 1U54B 1ZYDA 4I94A 4AS0A 4S30A 4ANQA 4R5SA 4WNPA 2YISA 3LXLA 3Q5ZA 4Y85A 4C02A 2BRBA 4NH1A 4FTAA 3N9XA 3R1NA 5AUXA 3HKOA 3RPYA 3VVHA 4CRSA 3DBFA 3C0IA 3Q9ZA 3VF9A 5CAPA 4YSMA 4BCFA 4TKSA 5BUEA 1GAGA 2ZB0A 4TYIA 3SAYA 4GSBA 4BTFA 2X8DA 3UZPA 2V7AA 2YCRA 5DFPA 4EK4A 1NT2A 4JXFA 1OBDA 1IG1A 2OIDA 2VO0A 3BCEA 2UVXA 2XP2A 5EYCA 3DPKA 4YTIA 3RGFA 3R1SA 3RZFA 5CASA 1QPCA 2YEXA 4O7NA 3ZZWA 4FG9A 5IA0A 3UC4A 3C13A 4QP9A 4M69B 3C4ZA 1IAJA 4EOMA 4GJ3A 2ETMA 3OVVA 2PUIA 3Q53A 4O7WA 4DEGA 1Q8TA 3UVRA 3WF9A 3VBYA 3TWJA 4N4SA 4ZAUA 3ZLSA 3NW7A 1P2AA 4OBQA 3TM0A 3IECA 5CVFA 4RX8A 4EWHA 5I9ZA 4O84A 2YITA 3GOKA 2UW4A 2C30A 5ANKA 2ONLC 3IOPA 3SLSA 1AGWA 1YI4A 2ZM1A 2ITWA 3MIAA 5DYJA 3FY0A 4IJPA 4QMOA 4QT1A 3ZHPC 4BDCA 2R3FA 4L44A 1V0OA 3ZFXA 2Y6OA 3FI2A 5AP1A 1ZZ2A 5AP7A 3TACA 3E64A 3GCUA 4BVUA 3UO6A 1BLXA 3ULZA 2WKMA 3SVVA 3T3VA 4CV9A 4DGLC 2JDRA 3C4XA 4WO5A 2XIZA 3V8SA 3NUXA 4RGJA 3R9DA 4IHPA 2B1PA 3ZMMA 3ODZX 2BRMA 2WELA 3FV8A 2XK7A 3QTWA 4XS2A 5HO8A 5K4JA 2XK8A 4OT6A 3R8UA 1PRYA 2JD5A 4FKQA 4UN0C 4Z3VA 5TKDA 2YAAA 4LL5A 2J0IA 4GT3A 5E90A 5J8IA 4AZVA 4NFNA 4FI1A 3N4VA 2W9FB 3G9NA 2CGVA 2JKKA 3O96A 4DBXA 3DLSA 3RAWA 5BUJA 3N4UA 2YABA 4PL5A 2BKZA 4A9YA 1KV2A 3OBJA 4AW2A 2HAKA 3RPVA 4FKIA 3PJ8A 2ZM3A 3RWQA 3T3UA 2OLCA 4EH4A 4FEUA 3LPBA 4RMZA 4CSVA 1NA7A 3S3IA 4U79A 2R3NA 5E8YA 4RWLA 2F4JA 4GYIA 3E88A 2YCFA 3S4QA 4YZDA 4NW5A 5CF8A 3D7TB 4HW7A 3R30A 5AP3A 5L2QA 4JR3A 3KRWA 1G8SA 3LXKA 3WZUA 2GQRA 1I09A 1ZYSA 2YDJA 4XP2A 3S95A 3QKKA 4EYMA 2VGOA 4EORA 4ZY5A 3OEFX 4ANMA 1SVHA 1WBNA 4PP7A 5KHWA 4XV1A 3E7OA 4TRLA 3MFTA 1OGUA 1Y91A 5HLWA 3A4OX 1J1CA 3VHKA 2GS7A 2BKKA 4YGAA 3O7LB 1BI7A 3PIZA 4RJ6A 4RJ3A 4AE9A 3QWKA 4M8TA 5KMIA 2JFLA 4A9UA 4BCHA 5GZAA 3Q4TA 2OG8A 4BRXA 1IAHA 4DYMA 2X81A 1OIRA 4FR4A 5EI6A 3F88A 3BWJA 1XBAA 1J1BA 5HU3A 4WIHA 4X21A 2NRYA 4BCOA 1OMWA 1HCKA 2F9GA 2WMUA 3WI6A 2A19B 3EZRA 2HYYA 5IH6A 5M4UA 5BVOA 4RZVA 3ZXTA 5AUZA 5EI2A 1F3MC 4FL1A 3DBQA 3E3PA 3ZEPA 3QFVA 2OWBA 1NVQA 5HG5A 5CAQA 3WZEA 5L8LA 4YLJA 1M7QA 3FLNC 3AC4A 3AT3A 3FQSA 2CCHA 3NZ0A 4I23A 3GC0A 3AD6A 3PZHA 3Q4CA 5F94A 3MTLA 1B38A 3VUGA 2QOIA 4IVAA 3WE8A 5CNNA 1DAYA 4FODA 4FV7A 2DYLA 2C3IB 4FK3A 2JGZA 2JDSA 2QOOA 1OM1A 3QQJA 3HRBA 5A46A 3TUDA 3QCSA 5FG8A 2J50A 3G0FA 4JDIA 4X2FA 5EW3A 2BZIB 2W7XA 3WF6A 4YMJA 2OI4X 4XG4A 3DNEA 2V55A 3Q04A 4B8LA 5TT7A 2JBPA 2R2PA 2VTTA 4WNMA 3R9HA 4F08A 3R2YA 5GHVA 5DT4A 3E63A 3M1SA 1AD5A 3FE3A 5DR9A 4FIFA 4K0YA 4MXCA 4QMPA 4RLKA 3ORXA 3QD3A 2IVVA 3QXOA 1CTPE 1Y57A 2BRGA 3OFMA 5HCXA 3W55A 4D2SA 4YZNA 2YERA 4E26A 4O22A 2W9ZB 1SNXA 3FQEA 3MB6A 3PSDA 3NNUA 4GT4A 4WD5A 5ANIA 4C61A 3R8VA 2IW6A 3ATTA 3OUKA 2I0VA 2WPAA 2BDWA 4DH1A 4JRVA 3F7WA 1FMOE 3IDBA 2PZ5A 5J9YA 4QP7A 2ZDTA 4JJRA 4I24A 3ZO2A 3AT2A 2IW9A 5JGDA 4CKRA 3KMUA 4KS7A 5CALA 3T8OA 4CD0A 3EFLA 3H9FA 1R3CA 1Y6BA 4G3CA 2VWYA 4Y95A 4BF2A 1TQPA 1TKIA 4PL4A 3GU6A 3RM7A 4C2WA 5IMXA 3KXZA 3L8PA 2UUEA 4FYOA 5FGKA 3QQKA 3IO7A 3LJ0A 5CXZA 4R7IA 4KKHA 3NNWA 3HECA 4C34A 3MY5A 4GH2A 5DH3A 3II5A 1XH7A 4M14A 2V7OA 4EOQA 3V51A 4XUFA 4ASXA 4D5HA 3I1AA 3NCZA 4CYIA 1OVEA 3AC1A 5HEZA 4ACDA 3FXWA 4YJUA 3UE4A 4NT4A 3OTVA 3G2FA 4XBRA 4LUEA 4D28A 4QMNA 4J53A 4H1JA 3KXNA 2XCHA 3OP5A 4G9CA 4E7WA 3GCPA 4EOKA 1MUOA 1TQMA 3WIGA 4BBFA 4IQ6A 1ZYLA 4BZOA 3R7EA 4A4XA 2XA4A 4MBLA 1YI3A 4BDHA 2WTKC 3ORMA 4U81A 3SA0A 2WAJA 2GU8A 3CTHA 4UMQA 3NDMA 3DKGA 3QQLA 3MGYA 4D0XA 3FYJX 1BUHA 1XH6A 3GB2A 1WFCA 3H10A 2ZJWA 1PMUA 1ATPE 3PY0A 4O86A 2GDOA 2C6LA 3TJCA 2C5XA 4EHGA 4HVHA 5IDPA 2BIYA 3AMYA 3F82A 3GT8A 2IWIA 4AOTA 4DEBA 5EYMA 2X6EA 4RA4A 1Q62A 3ORLA 4NK9A 3LXNA 1H0WA 4YHTA 3MH0A 3PZEA 4QYEA 2WEVA 1YRPA 3BIZA 5L6OA 1Q24A 1ZOHA 3SXRA 2BAJA 2WTVA 4L6QA 4KIOA 4RJ8A 4ZLYA 4DEEA 4BCMA 2XKEA 4YO4A 1YI6A 3I6UA 4D2VA 4KINA 3PLSA 4KSPA 5HE1A 4NUSA 3OCSA 3VS5A 4APPA 2HCKA 3GU5A 3QCYA 2UZTA 5J9LA 4WA9A 2VWUA 2C0OA 2ZM4A 3Q4UA 5EM6A 2YIWA 4GIHA 2CPKE 4OBPA 4PMSA 4UWBA 3ZOSA 4CTCA 4E20A 5M55A 4E6CA 3Q9YA 4FIIA 4J99A 4TYHA 4DAWA 2BPMA 4EZ7A 1KSWA 2J90A 5IDNA 2ITTA 3DCVA 1WMKA 5GNKA 4RFMA 4OTFA 4R3PA 4HVDA 3SKCA 5M06A 4O0WA 3MY0A 5M51A 4CFMA 3EFWA 3G33A 4C2VA 3KY2A 2P0CA 4G17A 4DT9A 4R77A 3HRFA 3EQRA 5L8JA 2WTDA 3F9NA 5ETFA 4FZAB 5AUUA 4ZY6A 4I0SA 2VU3A 2PZPA 4QTAA 4RSSA 4ASEA 5A4EA 3KRXA 4RC2A 4RT7A 1MQ4A 1U5QA 1UKIA 2BAQA 5DG5A 5ICPA 1FMKA 3O23A 3PVGA 2W99B 2Y9QA 4JIAA 5A4QA 3PA5A 5DI1A 3BI6A 5CEKA 2QU5A 5DA3A 4BDDA 3UZRA 5JZNA 3DTWA 4H3QA 2WOTA 1NY3A 5H9BA 4JX3A 4PNKA 3CJGA 3NGAA 2PWLA 3FZOA 4J1RA 5JH6A 4FEWA 4HYHA 2VO3A 2YAKA 3OC1A 2J5FA 4HPUE 5E8XA 3SXFA 3TDWA 3DJ6A 4O0UA 5AP6A 4ACHA 2GNGA 4CFWA 2OZAA 3A61A 5IQCA 4YR8A 2FO0A 3M2WA 2W1CA 4KBKA 4QYYA 2HW6A 3C0HA 3FL5A 3NS9A 3QKMA 4C3FA 2P4IA 5HNBA 2J0JA 5DBXA 3COHA 1WBOA 3HUBA 1ZYJA 1OUYA 3ALOA 2GNIA 5C27A 3Q3BA 3RKBA 3RNYA 4UALA 4XOYA 3LCSA 4NL0A 2EXEA 1R0EA 1SYKA 2PMLX 4XG9A 4ZJVA 3QWJA 5HCZA 4BWXA 4NIFA 4FSWA 3IW8A 2R0UA 2QHNA 3R73A 4FKJA 4GK3A 5IUHA 5J5TA 4I0TA 1REKA 3DV3A 2X4FA 1R39A 3NAXA 2WMXA 4RPVA 2JAMA 2Y4IC 4MWHA 1JOWB 3R1QA 2ITUA 3W8LA 1KE5A 3KN6A 4XBUA 3O0GA 3TZ9A 5JFVA 1QPDA 5M44A 3U54A 2VWBA 3VUKA 4I5PA 3SRVA 3BE2A 4BB4A 1OKYA 3EN6A 1OBGA 4YJVA 4DITA 2H8HA 3HLLA 4OW8A 4TWNA 5LCJA 4UXQA 2B52A 3R1YA 4S34A 4X3FC 1Y8GA 3GGFA 1CDKA 1GOLA 2BALA 3MFRA 4FSYA 4IVBA 4FT7A 4JDHA 3TN8A 3BU6A 3R7YA 3TZ7A 4BGQA 4FZFB 5LWNA 4ALUA 3ACJA 3V01A 3LFQA 5F9EA 3RHXA 1E1VA 5KKRC 4YURA 3G90X 3OF0A 4OTQA 1IA8A 3EOCA 5HD7A 5KMJA 4I93A 3CY2A 2A1AB 3DAKA 3GQLA 4QMYA 3S0OA 2FGIA 4L9IA 3G0EA 4TZRA 1H1SA 2GNHA 3AMAA 4KIKA 1S9JA 2C1BA 4H1MA 3UMWA 5K9IA 4MD8E 2HZ0A 5L8KA 4C4EA 5CWZA 2I7QA 4RIXA 2X39A 3NWWA 1PXJA 1H26A 3PFQA 4BYJA 4IZ5A 2V5QA 4E6QA 3QLGA 1URWA 4NYEA 2QVSE 3DZOA 4YJTA 3G9LX 2HIWA 3R7IA 3OMVA 4BY9E 5IUIA 4J7BA 2PU8A 4O2ZA 4AQCA 4B99A 3V8TA 5FTOA 4NKSA 3A7GA 4RQVA 2QD9A 4QP1A 3RMFA 5ANEA 4O0RA 1GIIA 3FMEA 3PSBA 3QD0A 3WOWA 4JNWA 2WNTA 3JVSA 1FQ1B 2X2KA 4KABA 3WYXA 3R0TA 4HYIA 4NEUA 4DF3A 4UXLA 5AR4A 4HGSA 3MTFA 4UMTA 1H00A 3QTXA 5HOAA 1B6CB 3AOXA 2X7FA 4JL9A 4MCVA 1A06A 4TNBA 4EKLA 4FEQA 4ASDA 5HORA 3R8MA 4K6ZA 3H4JA 4L7FA 5EI8A 4AX8A 4EQUA 3DAEA 4PPCA 4RJ7A 5KMKA 3UNKA 4ZMEA 4O6EA 4PDSA 2JKOA 3MA6A 4AZWA 4APCA 5CF5A 4NJDA 3ZH8A 3KMMA 4FV1A 5EW9A 4MTAA 3W1FA 2W96B 3HV6A 4YU2A 3O51A 1SZMA 4GFOA 4Y72A 5JK3A 3EH9A 5AX9A 4DH7A 4A06A 1H1QA 3BE9A 2CNVA 5FXQA 3A99A 4FT0A 2XIKA 1ZMWA 2XNBA 4P4CA 2GFCA 4CTBA 1STCE 4YO6A 4Z16A 3I4BA 1Q8YA 3MJ2A 3HMMA 3RHKA 5I9UA 5AAGA 1R1WA 3SV0A 3LFSA 4GW8A 5FBOA 1FVRA 1BL6A 2CKOA 4U80A 2C5OA 3P7AA 1NVRA 2FVDA 2XJ0A 5TOZA 3W18A 3A62A 3PXQA 3TNQB 3FLQA 2ONLA 4NTSA 2ACXA 2EB3A 4YZ9A 1OL5A 4BIDA 4XEYA 3LFFA 1UNHA 4X3FB 4BCNA 4FVQA 3EZVA 3H3CA 4FSQA 4UMRA 3QGYA 4BCGA 3FLSA 2IVSA 1YWRA 1WAKA 4X2NA 2WQBA 2WMRA 1H28A 4BDEA 3UG2A 3IOKA 3KU2A 4FIJA 4ZZNA 3AD5A 4RFYA 4U3YA 2BTSA 4BBMA 4ZTHA 2F57A 3GC8A 3VS2A 2GCDA 4EYJA 3KVXA 4IX6A 4ZJIA 3TZMA 3H0YA 3OY3A 3M11A 4BDAA 4YZCA 3B8QA 5M07A 5K3YA 2VX0A 4WSYA 2XRUA 3DKOA 3R63A 4AP7A 3L8XA 3ENHA 2B9JA 2CSNA 2ZVAA 3TV4A 4DFLA 5LVMA 3HEGA 5GZ8A 1GIHA 3NSZA 4UY9A 3UVPA 2B54A 3F7ZA 3LVPA 2BHHA 3FI3A 4FT3A 3O17A 4YNEA 1OIUA 1U59A 4IB5A 1V1KA 5AV4A 4QTDA 4I6BA 3MSSA 4M0YA 4OGRA 3QQHA 2NNWB 4XHKB 3BYOA 3PG3A 4MNEA 5KZ0A 3UZTA 4FKPA 1Z57A 1FVVA 5CT7A 3MI9A 3RPOA 3LMGA 2R3IA 2W1DA 3RZBA 3W16A 5J5SA 4BCQA 3BBTB 4EBVA 3PA3A 3DS6A 2YZLA 4AGUA 2G9XA 1XH8A 1BMKA 2BZKB 3CD8A 3QUPA 3WBLA 1FPUA 4FIEA 3PLAE 4I6QA 5HCYA 5AIRA 2B0QA 4QMQA 4LRJA 3FY2A 4YLLA 4JIKA 4E4NA 2WD1A 4BDKA 5DPVA 5AP2A 3GC9A 3NYVA 2PZIA 5KZIA 3FEGA 4QQJA 2UZOA 3PUPA 3V3VA 4KRDA 4IMYA 1J7IA 3GCQA 4LOOA 5AV3A 2VTIA 3EYGA 5FWKK 4IC8A 3FBVA 3RP9A 4CG9A 4NZWB 2XRWA 1E9HA 1MP8A 2WU7A 3QTZA 5CS6A 2YJSA 3D4QA 4MF0A 3GXLA 2W5HA 1NW1A 2ZOQA 3P79A 5FLFA 2BHEA 2AC3A 2VTAA 4WG4A 3M42A 4USEA 1RQQA 2G15A 3A7FA 3F66A 5E1SA 4DGGA 2I0YA 5EG3A 4X3JA 2P55A 5B7VA 3VW6A 5IQIA 4D5KA 4RFZA 3C4CA 1Z5MA 4G2FA 5IMEA 2Q0BA 2VX3A 5CI7A 5DIAA 3E62A 2X8EA 2VWWA 5B2MA 4FTLA 4ACMA 4EUTA 1FGIA 4I5CA 2VRXA 4ANNA 4DFXE 2JAVA 3BYUA 4P90A 4NM3A 5BVFA 3PP0A 2GNFA 4IB3A 2ERZE 4LMNA 4USDA 2BROA 5AM6A 3K5VA 5M4FA 2ZV9A 4FNYA 3EHAA 2RF9A 3MPAA 3QGWA 4YUQA 3NUSA 2ITOA 4FKUA 1OL1A 4NCTC 2V22A 4GYGA 2YM7A 1JQHA 4FF8A 4LFIA 4C36A 4XYFA 3R8ZA 3FI8A 4IANA 4PX6A 2OZOA 4FICA 3Q6WA 4U40A 5JFWA 2W4JA 4XG3A 4XRJA 3QRTA 4FNWA 3E87A 2FSTX 4GUBA 3FHIA 4DFBA 3IW5A 3VUTA 2X8IA 3ALNA 1W82A 2OKRA 4FV4A 5I9YA 2VX1A 1UU9A 4E5WA 5A54A 3K3JA 4E6AA 3QA8A 4F9AA 3PDTA 3UNJA 4C3RA 3OCBA 2W1GA 1GZ8A 3LFCA 1W7HA 4FEVA 3C50A 4ANBA 3BGQA 2RKUA 4TYHB 5CQUA 4BIEA 4HYUA 4L68A 2OJJA 4ZZMA 3V8WA 5BVDA 4EJNA 1PXMA 4WOVA 3REPA 3W8QA 4FBXA 3R7VA 1DAWA 3BLHA 3CD3A 2G2IA 2J6MA 2EUFB 4OTRA 4U45A 4U44A 4EHZA 3E8EA 4FTOA 4KNBA 4QPMA 5L2IA 4ANOA 1MQBA 5CYIA 4EK8A 4D55A 1H1PA 4D2WA 4ERKA 4BICA 5ANOA 3FYKX 4FKVA 5CAUA 1RW8A 3KA0A 3RINA 3TKIA 3RAIA 2XK6A 4ZTNA 2YIYA 4MXXA 3AGLA 2R9SA 3LCTA 5HTCA 4KUJA 4YHJA 4XMOA 4J71A 4UZHA 4CGAA 3DQXA 1X8BA 4ALWA 3NUAA 5DOSA 2IN6A 4G6NA 1RJBA 4O21A 3SXSA 1REJA 2C4GA 2EXMA 3TKUA 4FGRA 1JNKA 2XS0A 3P9JA 4FL2A 4IM0A 2YWVA 5C4KA 4LRMA 2OSCA 4FZDB 3S2PA 2PMIA 3V6SA 4PQNA 5AR8A 2PVRA 2YACA 3W2CA 4Y8DA 3RBWA 3HV7A 3KVWA 4EEVA 3JXWA 4F1OA 3DFCB 1JKKA 2VNWA 5FEEA 5HQ0A 3JS2A 4FSUA 3NUUA 4BKYA 4FUYA 5AR3A 2OF4A 4FYNA 3ZO1A 4HGTA 3PYYA 1JBPE 3A2CA 2VTRA 4P2KA 4WUNA 5EDRA 1JSUA 1OL7A 3VHEA 3F5XA 4IXPA 2W05A 2GHLA 1YOJA 3GENA 4IX3A 4CEGA 3KULA 4D0WA 3KC3A 1JWHA 2CNQA 5FDPA 1MRUA 3U51A 1WBSA 4KKEA 5E9EA 3I81A 3QTIA 4IB0A 4KRCA 3LLAA 4ZSAA 4H39A 2BILB 4NIFB 2XCKA 4I1ZA 4O7SA 2XNGA 4IIRA 3BBWA 5CU2A 3GU8A 4YJSA 5IU2A 4ZLOA 5KMOA 4AUAA 4G3FA 4MXZA 3LHJA 5IA4A 4BDJA 4BZDA 3BHVA 3BU3A 3SRVB 3QZHA 4UMUA 1YXVA 3CS9A 4K77A 3DJ5A 1WVXA 1VEBA 5H3QA 3F61A 4CT1A 3PPJA 3UMXA 5FTGA 1GZKA 4M7IA 4I5HA 5E1EA 5FUTA 2VAGA 4D2RA 3GFEA 2YM4A 1Q61A 4QP2A 3RALA 2XVDA 3C4FA 4IVDA 3QXPA 4PV0A 3RI1A 4A9RA 1LUFA 2DS1A 5IKWA 3TNIA 3CE3A 2CKQA 2WEIA 1XR1A 5L6WL 3HMOA 5LCKA 4DFNA 3C1XA 4KA3A 1PXOA 4RA5A 5AAEA 2IZUA 4KIKB 3DB6A 3U6IA 4O1PA 3EL7A 5E8UA 4ZSEA 4HOKA 5HIBA 3W2SA 3ZUUA 4II5A 4YTCA 4QMLA 3WF5A 1OL2A 4RIXB 3KRLA 4YJPA 3V5TA 2JC6A 4J96A 5H8GA 2XNMA 5AIKA 3QUEA 4FIGA 4KD1A 4BDFA 1FGKA 3PIYA 3GBZA 5HI2A 5CZIA 3FZPA 4B7TA 2R3PA 3RCJA 2YJRA 3S1HA 5GIPE 3DY7A 4HCTA 5AFVA 3DLZA 3EQBA 3OWKA 4DFZE 3QTUA 4KBCA 4PTCA 3QRUA 3CPCA 3ZM9A 3RCDA 5CSVA 4HVSA 3LQ5A 4DEDA 4IAYA 1XKKA 4GEOA 5A6NA 4U42A 5LMKA 4CFXA 4AWIA 1IR3A 2YLFA 4EC9A 2BDJA 4KS8A 1LPUA 3ZDIA 3GNIB 3PIXA 4CFVA 4RVKA 3OWJA 1YXSA 2FUMA 3BU5A 3D5WA 3DBCA 1XBCA 2W1ZA 3PY1A 2I6LA 4O0TA 3WE4A 1Q3WA 2ZV8A 5E8TA 5HO7A 5D1JA 4EQMA 1KOBA 1W0XC 4O38A 5AMNA 4EQCA 1ZXEA 3UJGA 4PTGA 3DK6A 5DR6A 2V62A 3UIXA 5M08A 4OLIA 4E8AA 5CSPA 1W83A 3EQIA 4ACGA 4D9TA 5K4IA 1G3NA 3ZO4A 4AE6A 3QUDA 5KHXA 4RC3A 4W8DA 3CJFA 1ZY5A 3R9NA 4CZTA 3GUBA 2PVNA 2X2MA 1QMZA 3C7QA 3OWLA 5JSMA 2R3HA 4AN2A 1XO2B 2CKEA 4FTIA 4YZBA 3FZTA 2QO9A 3LCDA 1Y6AA 2PL0A 2UZBA 2QOCA 3OCGA 4F9YA 4TN6A 3AT4A 4G5JA 2CLXA 4YTFA 4BIBA 3PG1A 3I5NA 2CKPA 4DH3A 3VBWA 4F6SA 2OIBA 3ET7A 4FTCA 4PL3A 3BEGA 1ZLTA 4JQ8A 4LV8A 2R7BA 3F5GA 2HZIA 4YBKA 4R3CA 1UWJA 3NW6A 5C8MA 4S33A 4IH8A 2O3PA 2QO2A 1ZRZA 2A2AA 4JAJA 4TY1A 3NPCA 3UGCA 5J1WA 2A0CX 4FSZA 2PVFA 4C57A 1LR4A 3A8XA 3CBLA 1OZ1A 3MH2A 2PYWA 3BEAA 3SD0A 3ZSGA 2PVHA 4FTMA 2RFEA 4RRVA 3DU8A 5D11A 4D2TA 3OUNB 4YC8A 4UWYA 3O8TA 3ENMA 2RG5A 4ONAA 5AUVA 5FRIA 3ZS5A 5B0XA 4BC6A 2E9UA 3CQWA 2R3KA 3ZO3A 5L2SA 1P4FA 2QR8A 4C58A 5D12A 2VWIA 5DT0A 2IZTA 3CR0A 2ESMA 3COIA 5A4TA 4FX3A 2CDZA 1PMNA 3KB7A 4XV9A 3VUMA 5JKGA 2GFSA 4IX5A 2HK5A 5EFQA 4FV2A 2OU7A 4QTCA 4Q9SA 4BCIA 4XX9A 4D1XA 2W1FA 4AW1A 4J52A 4O0XA 5LOHA 5BYLA 4LGHA 2ITXA 3CY3A 4IC7A 4QQTA 3LMHA 4RWKA 5JFSA 2W5BA 4K18A 3ZFMA 5I5ZA 1FBNA 2WMSA 4AOJA 2GTMA 3BRBA 4QMUA 4EHVA 2CN5A 5L3AA 2BZJA 3D2KA 4FT9A 4MNEB 1AQ1A 1YDSE 3B2TA 4FTRA 4CKJA 4FKGA 3A4PA 3EQFA 3UODA 4FVPA 4AFJA 4K11A 4PY1A 2BRHA 2UW0A 3RPSA 4EK5A 4QO9A 5IUGA 4MXYA 1EH4A 3OZ6A 4IM2A 4PMPA 2VNYA 5I3OA 4CCUA 1O6KA 4FTTA 4RIWB 3OT3A 2OXYA 1CMKE 4A4LA 2GQSA 5FD2A 2ETRA 4TL0A 3R7UA 4ZSGA 3ZSIA 3JR1A 2IPXA 2OXXA 3DKFA 4PUZA 4ASZA 4HNIA 2NP8A 2E2BA 2FH9A 4EH9A 2VO6A 3NLBA 3QTSA 4ZOGA 1P4OA 3TNPC 2H6DA 3OXIA 3P7CA 4BCJA 4EI4A 3CIKA 4J98A 2ITPA 5CVGA 3CCNA 2X0GA 1B39A 2Y4PA 1BI8A 4U0IA 5DEWA 4GV1A 4EOPA 2GS6A 4RJ5A 4HGEA 4PDOA 1F5QA 4ITJA 4TYJA 5HTIA 3VUHA 3KEXA 4IZAA 4U43A 1VZOA 4AACA 3D94A 2E9OA 5E8VA 3NNXA 4NKAA 2QOLA 2VUWA 5ETCA 5K5NA 5HG8A 3VAPA 3VN9A 4B4LA 2X1NA 4F7LA 2C3LA 3IGGA 5M4CA 2O65A 5EM5A 4C7TA 3ANRA 4QP3A 4F6WA 4FMQA 3U55A 3HP5A 3MWUA 2XM8A 3NYNA 2B9IA 3QALE 2CN8A 3B2WA 3UYSA 3I7BA 1QPJA 3L9PA 3JPVA 4JVGA 4NM7A 4DH5A 4IAZA 4D4VA 1YDRE 4M67A 3FMJA 2LGCA 3QCQA 1JPAA 2UZLA 3K3IA 4P5QA 5I0BA 3MH3A 2PUNA 2WMVA 2XBJA 2XM9A 3RNIA 2X7OA 2YHVA 3QZIA 4OTGA 5AAFA 4LUDA 3UQGA 5HIEA 2WQOA 2UVZA 4G16A 3F5PA 2XF0A 4XG8A 4YHFA 1W8CA 3FC1X 4GK2A 4K33A 3FQHA 3TNHA 3QKLA 1A9UA 4IWOA 3DGKA 4FTJA 4G9RA 2ITYA 5HICA 3D14A 3QQGA 5LVOA 3PRIA 3R8LA 5CU3A 3UIMA 3NVMB 5CY3A 2W1EA 2XIXA 3IQ7A 3VQUA 5JN2A 4W4YA 4JLCA 3VF8A 1M2RA 3L9LA 4I41A 4Z7HA 5M57A 4DEAA 2VTQA 2YIXA 4IAKA 4MAOA 3W33A 1IEPA 4BDIA 4FKRA 5T6KA 3D9VA 3AMBA 4J8MA 3VJNA 2F7EE 4BI1A 5HNIX 2WMBA 3MESA 3ORPA 1OB3A 2PZYA 2JITA 4W4XA 4JG7A 5IH5A 3VRZA 4X6QC 4F65A 3AXWA 4M69A 2C69A 4LM5A 3HYHA 5E8WA 4MNFA 2WTCA 3OD6X 1YVJA 5BX0A 4LMUA 4Q5HA 2WQNA 1YHSA 3P7BA 2E9NA 5E7RA 3HP2A 4OR5A 3ZM4A 4GKIA 5IEYA 2NRUA 1J7UA 4ZS4A 5KUPA 2PUPA 5J7HA 2C47A 3OROA 3RAHA 2H96A 2VWVA 3QHWA 3E92A 4R6VA 4DFYA 3ITZA 4FNXA 4FV8A 3CKXA 4AGDA 4JQ7A 3SG9A 2CGWA 4F6UA 2JKQA 3R22A 4JS8A 3FXXA 4FV3A 4UYNA 4W4WA 4A07A 2YDKA 5AP0A 2G01A 3MB7A 1YW2A 3JYAA 3QC4A 2R3OA 3BWFA 4EOIA 4G31A 2QCSA 4JBVA 3DQWA 3W2OA 2DWBA 4FVRA 4CQEA 4GG7A 2WTWA 3NMUF 3ZCLA 3T9IA 4FTQA 4ANLA 1XQZA 2AC5A 1UV5A 3CTQA 4IW0A 2F7XE 3ORIA 1O6YA 5AP4A 4OAUC 2B55A 3LJ2A 2F2UA 4O91A 3CGOA 4QMWA 3E8NA 4YPSA 5FEDA 3TG1A 4C4HA 5CANA 5TE0A 3KULB 5TO8A 3AG9A 2JDTA 4CMOA 1PXIA 3ZU7A 5GJFA 4BBEA 2B4SB 1YOLA 5JEBA 1QCFA 4XRLA 4RG0A 3DTCA 4NWMA 4WUAA 2QLUA 2YCQA 3VO3A 4CRLA 5IEXA 4J95A 3O8UA 3U6HA 1KUTA 5AP5A 4CLIA 5HBHA 4YJRA 5T68A 5J95A 4MF1A 1Q41A 2OFVA 3FSFA 3FXZA 3ULIA 5CT0A 2CMWA 4G3EA 5IA2A 4PPBA 4ZEGA 4E4XA 5IISA 2WTJA 3WF7A 4UWCA 4BYIA 5I3RA 2GSFA 2G2HA 3LJ1A 4PRJA 5ANJA 3V5QA 4AAAA 4F1MA 4DBNA 2YIRA 1PXLA 3NUYA 4CFFA 4UX9A 1YQJA 5HE2A 3A7JA 2O5KA 2P3GX 5FDXA 3NIZA 3OW3A 3R02A 4YSJA 5C1QB 1IA9A 2PK9A 4S32A 2ZMDA 5DR2A 4AN9A 2R3MA 5CEOA 1PF8A 2VTHA 3EN4A 4X7QA 3QQFA 4IJ9A 4AN3A 1VR2A 2JDOA 4LYNA 4LOPA 3Q2MA 3VULA 1Q5KA 3G6HA 3N51A 4EK6A 4EK3A 4EONA 5AADA 3EQCA 1PXPA 3A7IA 3L9MA 4HZRA 4I6FA 3R01A 3P78A 4USFA 2HZNA 2WMWA 3QZFA 1R0PA 1U5RA 3QHRA 4GUEA 5EM7A 3D83A 2ERKA 3TKHA 2IZSA 4JX7A 2FB8A 2PTKA 3OOGA 2XKDA 4F0GA 4V05A 2PMNX 5LJJA 2XMYA 5EKOA 4F1TA 1OUKA 2CNUA 1H07A 2HWPA 3CC6A 1ZY4A 4PDPA 4W4VA 2W17A 3P1AA 5HG9A 3LZBA 2GQGA 1PMEA 2OIQA 2W4OA 4EBWA 1LEZA 2UZWE 1BKXA 3G6GA 5LVPA 3UYTA 4O82A 1YKRA 2QR7A 4L67A 4EH2A 3OS3A 4GT5A 4TNDA 3RK9A 3GCSA 3PJ1A 2XNEA 3MV5A 3ORNA 4RIOA 4QYFA 4WBBB 4G3DA 3PJCA 4K1BA 5AWMA 3KCKA 3RK5A 5I9WA 5KNJA 4OTDA 3DDQA 5JT2A 4DHFA 4NTTA 3L1SA 5HD4A 1WCCA 3F3UA 4D1ZA 3DFAA 2VN9A 3TTJA 4C4GA 3D5VA 5FQDC 4PDYA 2Y0AA 4DFUA 2W5AA 4I6HA 4IFGA 4QMZA 5GJDA 3FLYA 2WIHA 3T9TA 3UVQA 1PKDA 3TEIA 3Q9XA 4LRKA 2BFXA 2C0IA 3D15A 2WB8A 4M13A 4JDJA 5EQPA 1YWNA 1KE8A 4FOCA 4RX5A 2F7ZE 3AQVA 2QO7A 4TTHB 2HW7A 1YDTE 5EOBA 3OY1A 3NVKI 2PVMA 4F4PA 3ANQA 3UIBA 5HBEA 5IQAA 3I0OA 4OTHA 3R83A 2OFUA 3HDMA 3V5JA 3L9NA 3OWPA 1E1XA 5D41A 1O6LA 3OHTA 3FC2A 3QYWA 4Q5EA 5DRDA 1UU7A 4C38A 5L6PA 4FL3A 1BYGA 1IASA 1Q3DA 3QAME 5AV1A 4AGCA 2PHKA 4IAIA 5LMAA 2ZDUA 4J97A 3FZRA 4WG3A 2J0KA 4XV3A 4F0IA 3F3WA 4F9BA 5D9HA 1H25A 3DDPA 2IJMA 2YM3A 4RJ4A 3PTGA 4RIYA 4Y73A 4CNHA 2HY81 2GTNA 2P33A 2ZV2A 4MYGA 5LWMA 3PJ3A 5L4QA 4AF3A 4RBLA 4L45A 2CCIA 1Q97A 4O27B 2QONA 4GJ2A 3PWYA 3HDNA 1YHVA 4LGGA 2R64A 3UDBA 3MFSA 4AA5A 5JGBA 3HAMA 3EQDA 4F63A 4F64A 4KSQA 4FKSA 3VBTA 3VRYA 3FUPA 3QTRA 4CZYB 4TWOA 3C5IA 3HV4A 4OUCA 5FP6A 4QQ5A 5DT3A 4KBAA 3SW7A 2QQ7A 2PY3A 2C1AA 4IAAA 1QL6A 4FTNA 4W8EA 3NEWA 4JR7A 4X2JA 3NNVA 2R3JA 2A4LA 5H2UA 2OJIA 3TUCA 3R6XA 4O7LA 2C6DA 3BHHA 1SVEA 4EH5A 4U5JA 4FKWA 3RWPA 4NM5A 3ELJA 4O2PA 3UO5A 5BPYA 5AUTA 3CTJA 3MW1A 5EOLA 3G5DA 4YNOA 3I79A 2YDIA 3DNDA 4YJOA 5EW8A 2Z7SA 1ZARA 3BGZA 3KREA 3O50A 2FSMX 4DH8A 2YWPA 5LVLA 3CPBA 5H8EA 3W10A 2XNPA 3UOJA 5JFXA 1CKPA 3U4UA 4DTBA 1M2PA 4BKJA 2W06A 4MBIA 2VV9A 3NX8A 1H8FA 4H58A 4XLVA 4R78A 4ORKA 3TDVA 3Q96A 2W0JA 1HCLA 3KKVA 2VD5A 1DI9A 1XH5A 3VS4A 1DI8A 1UVRA 4O0VA 1A48A 3DK3A 3LW0A 4E6DA 4ZTLA 1BL7A 1R78A 2QKWB 4L8MA 2IVTA 4O83A 4XG2A 4BHZA 1OPKA 3NR9A 1YHWA 2YM8A 3EN5A 4XOZA 3AC8A 2XEYA 3COKA 2WXVA 3LAUA 2YZAA 4JBPA 4H3BA 3O71A 4JBOA 4U3ZA 3BHTA 3KF7A 3QRKA 3QX2A 3HL7A 2R7IA 5CSWA 3TJDA 5DWRA 4UZDA 2RIOA 4EUUA 4EHEA 2OJGA 5EQEA 4HGLA 4CMTA 3WILA 1Y8YA 3W2QA 1SM2A 3HAVA 5J7BA 3BV3A 5GINE 4QP6A 3FHRA 5F1ZA 5HVYA 4JRNA 3UPXA 3ZLXA 4DTAA 5CU0A 3LXPA 3FPQA 3GCVA 4EJ7A 4NW6A 4IADA 3QBNA 1MRVA 4N6YA 3MA3A 3R9RA 3H9RA 2HENA 3E7VA 2BUJA 3AC2A 4BI0A 2J0LA 2GMXA 3LM5A 3VS6A 5KCVA 2QODA 4S31A 3D5UA 4I4FA 4F7JA 2X4ZA 4KB8A 4CMUA 2JEDA 1ZMVA 2VGPA 4X6RA 2UZNA 4FTKA 4R7BA 3R71A 2PE0A 1WVYA 5TR6A 2JIIA 4BWPA 1GIJA 2BFYA 4FGBA 1BX6A 2C6KA 5IQDA 2Z7QA 5C9CA 2HELA 1WBPA 3OOMA 1H1WA 4YJQA 1CSNA 3SOAA 2JIVA 3EMGA 5A9UA 4MX9A 4FV5A 4BTKA 4C35A 3VUDA 4PMMA 3ZZEA 1M7NA 5E8ZA 4EH7A 5IG1A 1Q8UA 3PPZA 5KMLA 5C26A 4YPDA 4Z7GA 4BZNA 2OBJA 3SDJA 4FEXA 3EN9A 1Z9XA 2PSQA 5HG7A 4H36A 2RFNA 5CX9A 3HZTA 5DNRA 4BHNA 4EOSA 3DXNA 2WFYA 4FC0A 1JKTA 1J91A 4JG8A 1JSTA 4TWPA 4F9CA 5AM7A 1P5EA 5DMZA 5I4NA 2PUUA 4DGNA 4O7TA 4D9UA 3EWHA 3WZDA 4ZZOA 4UYAA 4ZTQA 4UBAA 3EQGA 5FP5A 4BI2A 3MIYA 3FSKA 3VW8A 2HXQA 3NYXA 5DVRA 2OZAB 1LEWA 4GFGA 4UV0A 4FK6A 4MQ2A 5HVKA 2R4BA 4CQGA 1PJKA 3TUBA 1Q8WA 1G8AA 5J1VA 5KO1A 2PULA 4FSMA 5BYYA 3EN7A 4UMPA 1UU3A 5CQWA 3LFAA 3C0GA 5IPJA 5BMSA 4A9TA 1U4DA 2X7GA 4Z55A 5BVNA 4XNEA 5HGIA 3ZDUA 3W2PA 4O1OA 2VWZA 2BZHB 2Y8OA 2WZJA 4BGGA 4Y46A 2PPQA 4MD7E 1W84A 4P7EA 4R1VA 3FMKA 3TXOA 3VQHA 4PMTA 4I92A 4V0GA 4MQ1A 4L52A 4DEHA 4L3LA 5A3XA 5KBRA 4ZTRA 1OECA 4A9SA 1ZOEA 3ETAA 1PYXA 3KK9A 1K3AA 4GG5A 5L2WA 1ZWSA 2WIPA 4DG0E 3BX5A 3R7OA 4OTWA 3LFBA 1H0VA 2BDFA 4MHAA 5E91A 5CEIA 4YP8A 3IW4A 2W1IA 5AR5A 5EHLA 3BPRA 5AV0A 2R3QA 4ZK5A 4TXCA 4I20A 4DE4A 1XH4A 3C5UA 2Z2WA 3V5PA 1ZOGA 5JRSA 4RX9A 4JQEA 4N70A 5C8NA 5JMSA 5IQEA 4ZS0A 3ZYAA 4GU6A 2EWAA 2R0IA 3CQEA 4OTPA 5JZJA 2B9HA 3R00A 2BRNA 5CAVA 4K2RA 4B0GA 3I7CA 3LCOA 4I3ZA 4M12A 2E9VA 4AOIA 2C68A 2UZDA 3IS5A 4LQMA 2IG7A 3Q5IA 4WHZA 4ZLZA 4PP9A 3H9OA 3WF8A 2J0MB 3C9WA 5JQ5A 4EOOA 2DUVA 3EQPA 3ERKA 1ZAOA 4IFCA 2XNOA 3A60A 3NIEA 2BVAA 2PVKA 3OT8A 5DN3A 4FZ7A 2WQMA 4QMMA 3PE2A 5GZ9A 1J7LA 2UW5A 2WU6A 1OITA 3ZFYA 2I40A 2OH0E 4HZSA 2ZYBA 1ZZLA 4GMYA 1OIQA 1UA2A 5HO6A 4AZFA 2P2IA 4MXAA 5EH0A 1SMHA 2NO3A 5HE0A 5CSHA 4E93A 1H01A 4ANSA 1U46A 2X9EA 4F7SA 2QHMA 3BHYA 3JY0A 4FKTA 4WBOA 1UWHA 2CJMA 5CENA 4LL0A 4XJ0A 4BTJA 5JGAA 4R3RA 4AXAA 4KIQA 4U97A 4IAFA 4D4RA 2O63A 2W1HA 1LP4A 4ARKA 3DA6A 5KE0A 4DA5A 4AT4A 3Q2JA 2BTRA 2J4ZA 3MFUA 3PA4A 1VYWA 2QOBA 2X2LA 1FVTA 3EFKA 4QRCA 3LMIA 4I22A 4DTKA 3KL8A 4C4IA 2IO6A 2YFXA 3FKLA 3MJ1A 4N6ZA 4ID7A 5JQ8A 5AV2A 3GQIA 5AA9A 2GNLA 3CLYA 1UNGA 3FPMA 3W32A 2B9FA 5M09A 2OW3A 4U8ZA 3LFNA 3SQQA 4G6LA 4ZIMA 3QQUA 2Y6MA 2I0HA 1JKSA 2XKFA 5FEQA 2HOGA 2YM6A 3DOGA 4Z9LA 3LFDA 3OXZA 2CHLA 5HKMA 3VUIA 4FIHA 3WZKA 4HCUA 3ZSHA 3S00A 4Q9ZA 4B8MA 2C3JA 3IG7A 4V01A 4G1WA 5D7AA 4RZWA 2XK9A 5HZNA 2PVJA 2VTOA 1L3RE 3NUPA 3TNWA 4X3FA 2CGUA 1Q99A 1YOMA 3RM6A 5DHJA 3WIKA 2Z02A 2EB2A 3L8SA 3UBDA 2O0UA 1KOAA 2QNJA 5AR2A 5J87A 4C0TA 4QNYA 4BCPA 2OK1A 2ITVA 4GVAA 4WNKA 2OJ9A 3BYVA 5HTBA 3F6XA 3V5LA 3NCGA 5J79A 2WO6A 4E3CA 2RFDA 4EH6A 1T46A 1WZYA 4QMVA 4FV9A 3V6RA 2Z7LA 2BMCA 2Z8CA 4LV5A 2UW7A 3KXHA 4XP0A 4HPTE 2Z60A 3MVJA 3MY1A 5CZHA 4MVFA 3KF4A 4BDBA 5A14A 4OT5A 2B7AA 5AEPA 1V0PA 4FA2A 4IWQA 2PE2A 3FL4A 2OF2A 2F49A 4BR3A 4MXOA 1CKIA 2J7TA 4FT5A 4IBMA 4D1SA 1O9UA 5HIDA 2EVAA 3ZRKA 2QLQA 3PRFA 3UP7A 5TF9A 3TL8A 4DT8A 1PXKA 3QC9A 4RVLA 3GU4A 3PSCA 2OO8X 1OI9A 4DN5A 3DJ7A 2OH4A 3C4WA 3IW6A 2LAVA 2YIQA 1M2QA 3SC1A 3AC3A 4C8BA 2Z7RA 3HUCA 2VZ6A 5GJGA 4NSTA 5BUIA 3IDPA 3VS1A 3PXZA 4NM0A 2ITNA 3UQFA 3C4EA 3P08A 4R5YA 4E73A 4PTEA 4WSQA 2XK3A 2O8YA 3FJQE 3UC3A 2FA2A 4C33A 3LLTA 3RTPA 4BN1A 3ORTA 3MS9A 2X6DA 4L3JA 3P5KA 3D7ZA 3DB8A 4Y5QA 3CSVA 1JAMA 5HESA 4KWPA 2REIA 2J51A 3GI3A 1OIYA 3KCFA 3FDNA 3P86A 4AA0A 5M56A 4QTEA 4RIYB 1SVGA 4AZTA 5CF4A 3CXWA 5FXRA 3K54A 4QYHA 3FLWA 2QG7A 1ZYCA 3NW5A 2HZ4A 4EH3A 3DAJA 3F2RA 3VBVA 3LKMA 4WKQA 4CT2A 5H8BA 4MH7A 3SGCA 4C37A 1UNLA 3QD4A 5EM8A 5AUWA 5LVNA 2YM5A 5AX3A 5IA3A 4YC3A 3F69A 3TV6A 5C01A 3AC5A 4EOJA 3U8WA 1DM2A 1VJYA 3ZEWA 5C8KA 5FTQA 3MH1A 3ZRMA 5CAOA 5L2TA 1GZNA 2O2UA 4FNZA 3ZBXA 4EOLA 3EKKA 3GFWA 1CM8A 2PE1A 3PXKA 4U7ZA 4BL1A 1NXKA 5CI6A 3DZQA 5BVEA 3QA0A 5LMBA 1PY5A 3ORKA 4TT7A 3FKOA 4MBJA 2SRCA 3HA6A 3UOLA 1VYZA 5FM3A 4C3PA 3FMLA 3Q9WA 5EYDA 3P4KA 3KRJA 4O96A 4MKCA 4EL9A 3LM0A 4WT6A 4L3PA 4YJNA 4F09A 1PW2A 4D58A 3EFJA 5HU9A 4EKKA 2WMTA 2GS2A 2UW8A 3ZBFA 4B9DA 2C6OA 2XYUA 3DBDA 1GZOA 4FSTA 2RSVA 2QOQA 2WMQA 3HV3A 3ORZA 4AFEA 4MEDA 3V04A 2CGXA 3LCKA 3VNTA 5DLSA 4X2GA 3KXMA 2H34A 4XV2A 4ZXTA 4HJOA 1JSVA 4FSRA 3ZC5A 3QLFA 2XYNA 5CEMA 1WBVA 1UKHA 2C5YA 4ZMFA 2C6EA 3U4WA 4GRBA 3FLZA 3QU0A 4E5BA 2XK4A 5B2LA 4IDVA 3MBLA 3UG1A 3R21A 3QCXA 4CVAA 4EZ5A 3VS7A 2EU9A 5A4CA 2OICA 2VTLA 4EC8A 5HHWA 3KN5A 4HYSA 4L01A 3WARA 4DINA 3GC7A 5FM2A 3G15A 3E5AA 2NPQA 3O8PA 4F0FA 2AUHA 4O81A 3COMA 2JFMA 1JKLA 4FOBA 2HWOA 5F4NA 4YZMA 4WNOA 3MN3A 4C4FA 5FXSA 3TCPA 4ZP5A 1MRYA 3ZLYA 1U54A 4AW0A 4RLLA 4C62A 5IQGA 5I9XA 4L43A 3R2BA 1XWSA 3JY9A 3UP2A 4LOQA 4AG8A 2Y7JA 4F9WA 2BR1A 3PE1A 5K5XA 1KWPA 3BQRA 3Q4ZA 3IDCA 3ZUVA 4HNFA 5A6OA 4RX7A 2QOHA 2J9MA 5AA8A 3BYSA 3IW7A 3R8PA 4FE2A 3BQCA 4N57A 1URCA 3VWAA 3TV7A 4CV8A 2UW3A 3EL8A 3UO4A 5IQFA 4X2KA 3IGOA 3U87A 2C6IA 3OG7A 2YLEA 2QG5A 3GVUA 4XG6A 1RE8A
chains in the Genus database with same CATH superfamily
5E92A 4TPTA 2WTIA 3CQUA 4O6LA 3R28A 3FI4A 3POOA 4A7CA 2B53A 4RWJA 1KE9A 1GJOA 1OKVA 4QMTA 4IACA 3R04A 3PPKA 4M0ZA 4DC2A 2WQEA 4TYEA 4BTMA 3R9OA 2FSLX 3UOHA 1KV1A 1PMVA 2QKRA 4IB1A 3RK7A 1OKZA 3D2IA 1XJDA 3TMOA 4XCUA 2ITZA 3UTOA 3LIJA 3KGAA 3UQCA 1OL6A 2ZMCA 5BYZA 5ITAA 2WMAA 1H08A 4BCKA 3MPMA 5C4LA 2PVYA 4R8QA 5HLNA 3I60A 5LMKC 3TIYA 4E4MA 4LI5A 3W2RA 5G1XA 2PMOX 4LGDA 1ZMUA 2P2HA 2WTKB 5CLPA 1PHKA 1ND4A 3D5XA 4X0MA 1S9IA 3B8RA 1P14A 3QZGA 2Q0NA 4FG7A 5HVJA 3A7HA 5BVWA 5IQHA 3NUNA 4DDGA 2QOKA 3LFEA 4M3QA 4NCTA 4QMXA 5HNGA 1M52A 4D4YA 5EHYA 4AGWA 3QD2B 3QL8A 4QPSA 1L8TA 5LARA 4MD9E 4IZ7A 2I0EA 5IEVA 4AXDA 3PJ2A 4AT3A 2RGPA 5KBQA 3AGMA 3BHUA 2R3LA 3P0MA 3VS0A 4QYGA 3I0QA 3C51A 4PWNA 4V0GB 4PNIA 2JIUA 3L8VA 2RG6A 1KE6A 4AU8A 4RQKA 4L53A 1TVOA 4ITHA 4Q2AA 5G6VA 4TW9A 3CGFA 4OAVB 2EXCX 5EDQA 4CXAA 1F0QA 5HBJA 4DGMA 5I9VA 3QTQA 4NU1A 4OTIA 4CFNA 3DXPA 3HMIA 2OXDA 5EDPA 2J5EA 3BV2A 4IWPA 3D7TA 4LG4A 4F99A 4EZ3A 2UV2A 3U9CA 4K9YA 1I44A 5ACBC 4JG6A 5HX8A 4R1YA 4RWIA 2RL5A 3ROCA 2VO7A 2KULA 2XEZA 5EKNA 2R3GA 4RVMA 3BLRA 3P23A 3ZTXA 5EQYA 3RJCA 4FSNA 2YCSA 4M68A 2UVYA 1WVWA 3KQ7A 5DEYA 1Q8ZA 3OXTA 5CSXA 4DCEA 4N0SA 3LE6A 4BGHA 4ZY4A 5ANDA 3SX9A 3GP0A 3DXQA 3BELA 4O7YA 1TQIA 3MVMA 1W98A 3PP1A 3SW4A 2Q83A 5J9ZA 3ZXZA 3O7LD 3JUHA 3RPRA 3HMPA 4R7HA 4IDTA 3GOPA 4EH8A 2XNNA 3LQ3A 3SG8A 4KAOA 4Y5HA 3O5AA 1H27A 4QNAA 4H05A 2XJ1A 4JDKA 5CU6A 4FV6A 4BWKA 4IVCA 2C6MA 4YLKA 4AZEA 5IH4A 3PVUA 2KTYA 5IF1A 5BNJA 4YC6A 3SHEA 4IX4A 3OCTA 3TTIA 3OEZA 4IZYA 3G51A 4IWDA 1ERKA 4M84A 2C0TA 4S2ZA 4M97A 3CP9A 2VTJA 3EB0A 3N4TA 2VWXA 1JLUE 4QTBA 4I5MA 3IPHA 1M17A 3KXGA 3HVCA 3RAKA 4QP4A 5EK7A 2ZB1A 3HNGA 2HY0A 5CEQA 3LQ8A 3NFFB 3FWQA 1V0BA 4XLIA 3ID6C 3FZSA 4GFMA 2IW8A 2BCJA 3A8WA 2R3RA 3H30A 3Q6UA 3Q60A 4KIPA 4F7NA 4GU9A 4IE9A 2VTSA 3TT0A 4JAIA 3O2MA 3ZC6A 2QC6A 5KX8A 1KE7A 2DQ7X 3EKNA 4MK0A 2BAKA 5IA5A 4AAYA 3NRMA 2BIKB 3ZLWA 2IVUA 5GIOE 4DEIA 4D2PA 4I4EA 3TIZA 4CZUA 2UW6A 3VIDA 4ACCA 4ZJJA 3KFAA 3VBQA 3VS3A 3E93A 4QPAA 4DG2E 2OJFE 4ZTMA 4O7ZA 2Y4IB 1IRKA 3HV5A 5E4HA 2ITQA 4JOAA 5DRBA 2XBAA 3DKCA 4FV0A 3KRRA 4CCBA 5K0XA 4GK4A 4CFUA 5FBNC 2ZV7A 3D0EA 4GVJA 2XUUA 3PWDA 1APME 3HGKA 1UU8A 3EQHA 4ENXA 4HVGA 3EJ1A 3F3VA 2UZUE 2PZRA 2ZAZA 2C3KA 3HA8A 3K5UA 5K0KA 4FUXA 4PF4A 4JBQA 5E8SA 3V5WA 2FSOX 4L46A 3TI1A 5KKRB 1PYEA 3QRJA 3RVGA 3ZONA 4TWCA 3ATSA 3R7GA 2J2IB 2G2FA 3Q52A 4ITIA 4JT3A 4AA4A 2UZVA 1GY3A 5KMMA 2XIRA 3HRCA 2AYPA 5BMMA 2UZEA 4AW5A 3EYHA 3UOKA 2F2CB 2QURA 4KKGA 3FMMA 4E5AX 2GHMA 3CKWA 4O0SA 3HMNA 1WBWA 3DT1A 2ZFYA 5D7VA 3U6JA 3CEKA 5A4LA 3GEQA 5DE2A 4GKHA 2OGVA 3GU7A 4ENYA 1RDQE 2RFSA 3OBGA 3F3TA 2YA9A 1YWVA 2XIYA 3PVBA 2G1TA 4W9XA 4WRSA 4YTHA 3ODYX 4BFMA 5LXMA 5C03A 1FOTA 4QOXA 5T3QA 4ALVA 5BVKA 2C5VA 5B2KA 4JI9A 4QD6A 3MVLA 5CNOA 5AR7A 3KK8A 4FKOA 2ETKA 5ETAA 4DLJA 4TYGA 5M4IA 4FKLA 4L7SA 3FMHA 3PY3A 3TZ8A 2XJ2A 1Q4LA 1YXUA 3ACKA 4ZTSA 4DG3E 1XH9A 1SNUA 2FYSA 5CEPA 4G3GA 3NYOA 3THBA 5HX6A 1CKJA 2JLDA 5BQ0A 3UIUA 1OPLA 3AD4A 4DLIA 5ANGA 4K8AA 4PPAA 4RIWA 5CVHA 3MYGA 4AZSA 4XP3A 4UEUA 4B6LA 1H4LA 3NAYA 4P5ZA 4C4JA 2GHGA 4FZ6A 4IEBA 4RC4A 2X9FA 4YBJA 5AJQA 4CG8A 4L42A 3IKAA 4O0YA 3BKBA 3E8DA 4G5PA 2A27A 5IQBA 3Q32A 2VTNA 3DBEA 3U9NA 3QRIA 3VBXA 3VJOA 3ZUTA 4FG8A 3HX4A 2YN8A 5EHOA 4MWIA 2XZSA 1XBBA 3QYZA 3DK7A 1QPEA 2E9PA 3BZ3A 2JDVA 2UW9A 4I0RA 2HXLA 1YXTA 3BLQA 2WGJA 4U9AA 4A4OA 4BKZA 3IK3A 3PXRA 2GPHA 3POZA 5D10A 4M15A 3F5UA 3UPZA 1FINA 3H0ZA 4ZSLA 5JRQA 2QI8A 4WRGA 4D4SA 1M14A 1YXXA 3F3ZA 5HE3A 2PVLA 4GCJA 3E8CA 4I21A 3F2AA 4NJ3A 4UB7A 2I1MA 4Y83A 3QX4A 4DGOA 4CLJA 2NYAA 5F20A 4LV7A 4BDGA 4OBOA 4O7RA 3BYMA 4C59A 3EIDA 2XKCA 3VC4A 1J3HA 4E4LA 3I6WA 1JVPP 1T45A 2C6TA 4GIIA 4M66A 4CKIA 1K9AA 2JBOA 2QU6A 4H3PA 2CLQA 4XG7A 5DGZA 2QOFA 5M53A 1GNGA 4HCVA 4IM3A 4U41A 2XB7A 3MPTA 1DS5A 4QMSA 3FMNA 3BGPA 2GNJA 3FZ1A 4G6OA 3PXYA 4FTUA 4J8NA 4QQCA 1H24A 1PXNA 5CU4A 4DCAA 3WZJA 2WOUA 4O4CA 5ETIA 4ERWA 4DDIA 3IONA 2W4KA 5F95A 3PVWA 1OPJA 2H9VA 3K2LA 3MDYA 2VTPA 4U6RA 4W9WA 4WG5A 4QP8A 5ACKA 5HLPA 3MVHA 5KMNA 5IZFA 2R5TA 4NFMA 3OTUA 5LQFA 5CXHA 3KXXA 4G34A 1PKGA 3FKNA 1K2PA 3KMWA 1H1RA 3UNZA 3FAAA 4XH6A 3ROYA 5IA1A 2WHBA 4AT5A 2JKMA 1OKWA 4O7VA 4L00A 3JVRA 4ZSJA 3SOCA 5CF6A 2O64A 3ZRLA 4E1ZA 3I5ZA 2IEWA 2V0DA 3E3BX 3OW4A 3PXFA 2XH5A 3FMDA 3QF9A 2C5NA 3WYYA 4F70A 1G5SA 4RVTA 1WBTA 4HVIA 1NVSA 5EYKA 3F2NA 1XHAA 1HOWA 4GL9A 4GS6A 4V04A 5AUYA 4EWQA 3LOKA 2IZRA 5CTPA 4CYJA 2VTMA 1U54B 1ZYDA 4I94A 4AS0A 4S30A 4ANQA 4R5SA 4WNPA 2YISA 3LXLA 3Q5ZA 4Y85A 4C02A 2BRBA 4NH1A 4FTAA 3N9XA 3R1NA 5AUXA 3HKOA 3RPYA 3VVHA 4CRSA 3DBFA 3C0IA 3Q9ZA 3VF9A 5CAPA 4YSMA 4BCFA 4TKSA 5BUEA 1GAGA 2ZB0A 4TYIA 3SAYA 4GSBA 4BTFA 2X8DA 3UZPA 2V7AA 2YCRA 5DFPA 4EK4A 1NT2A 4JXFA 1OBDA 1IG1A 2OIDA 2VO0A 3BCEA 2UVXA 2XP2A 5EYCA 3DPKA 4YTIA 3RGFA 3R1SA 3RZFA 5CASA 1QPCA 2YEXA 4O7NA 3ZZWA 4FG9A 5IA0A 3UC4A 3C13A 4QP9A 4M69B 3C4ZA 1IAJA 4F78A 4EOMA 4GJ3A 2ETMA 3OVVA 2PUIA 3Q53A 4O7WA 4DEGA 1Q8TA 3UVRA 3WF9A 3VBYA 3TWJA 4N4SA 4ZAUA 3ZLSA 3NW7A 1P2AA 4OBQA 3TM0A 3IECA 5CVFA 4RX8A 4EWHA 5I9ZA 4O84A 2XALA 2YITA 3GOKA 2UW4A 2C30A 5ANKA 2ONLC 3IOPA 3SLSA 1AGWA 1YI4A 2ZM1A 2ITWA 3MIAA 5DYJA 3FY0A 2XARA 4IJPA 4QMOA 4QT1A 3ZHPC 4BDCA 2R3FA 4L44A 3BL7A 1V0OA 3ZFXA 2Y6OA 3FI2A 5AP1A 1ZZ2A 5AP7A 3TACA 3E64A 3GCUA 4BVUA 3UO6A 1BLXA 3ULZA 2WKMA 3SVVA 3T3VA 4CV9A 4DGLC 2JDRA 3C4XA 4WO5A 2XIZA 3V8SA 3NUXA 4RGJA 3R9DA 4IHPA 2B1PA 3ZMMA 3ODZX 2BRMA 2IF8A 2WELA 2XK7A 3FV8A 3QTWA 4XS2A 5HO8A 5K4JA 2XK8A 4OT6A 3R8UA 1PRYA 2JD5A 4FKQA 4UN0C 4Z3VA 5TKDA 2YAAA 4LL5A 2J0IA 4GT3A 5E90A 5J8IA 4AZVA 4NFNA 4FI1A 3N4VA 2W9FB 3G9NA 2CGVA 2JKKA 3O96A 4DBXA 3DLSA 3RAWA 5BUJA 3N4UA 2YABA 4PL5A 2BKZA 4A9YA 1KV2A 3OBJA 4AW2A 2HAKA 3RPVA 4FKIA 3PJ8A 2ZM3A 3RWQA 3T3UA 2OLCA 4EH4A 4FEUA 3LPBA 4RMZA 4CSVA 1NA7A 3S3IA 4U79A 2R3NA 5E8YA 4RWLA 2F4JA 4GYIA 3VONA 3E88A 2YCFA 3S4QA 4YZDA 4NW5A 5CF8A 3D7TB 4HW7A 3R30A 5AP3A 5L2QA 4JR3A 3KRWA 1G8SA 3LXKA 3WZUA 2GQRA 1I09A 1ZYSA 2YDJA 4XP2A 3S95A 3QKKA 4EYMA 2VGOA 4EORA 4ZY5A 3OEFX 4ANMA 1SVHA 1WBNA 4PP7A 5KHWA 4XV1A 3E7OA 4TRLA 3MFTA 1OGUA 1Y91A 5HLWA 3A4OX 4I6LA 1J1CA 3VHKA 2GS7A 2BKKA 4YGAA 3O7LB 1BI7A 3PIZA 4RJ6A 4RJ3A 4AE9A 3QWKA 4M8TA 5KMIA 2JFLA 4A9UA 4BCHA 5GZAA 3Q4TA 2OG8A 4BRXA 1IAHA 4DYMA 2X81A 3W0OA 1OIRA 4FR4A 5EI6A 3F88A 3BWJA 1XBAA 1J1BA 5HU3A 4WIHA 4X21A 2NRYA 4BCOA 4AQKA 1OMWA 1HCKA 2F9GA 2WMUA 3WI6A 2A19B 3EZRA 2HYYA 5IH6A 5M4UA 5BVOA 4RZVA 3ZXTA 5AUZA 5EI2A 1F3MC 4FL1A 3DBQA 3E3PA 3ZEPA 3QFVA 2OWBA 1NVQA 5HG5A 5CAQA 3WZEA 5L8LA 4YLJA 1M7QA 3FLNC 3AC4A 3TYKA 3AT3A 4QDEA 3FQSA 2CCHA 3NZ0A 4I23A 3GC0A 3AD6A 3PZHA 3Q4CA 5F94A 3MTLA 1B38A 3VUGA 2QOIA 1XMLA 4IVAA 3WE8A 5CNNA 1DAYA 4FODA 4FV7A 2DYLA 2C3IB 4FK3A 2JGZA 2JDSA 2QOOA 1OM1A 3QQJA 3HRBA 5A46A 3TUDA 3QCSA 5FG8A 2J50A 3G0FA 4JDIA 4X2FA 5EW3A 2BZIB 2W7XA 3WF6A 3W0SA 4YMJA 2OI4X 4XG4A 3DNEA 2V55A 2XAMA 3Q04A 4B8LA 1TFFA 5TT7A 2JBPA 2R2PA 2VTTA 4WNMA 3R9HA 4F08A 3R2YA 5GHVA 5DT4A 3E63A 3M1SA 1AD5A 3FE3A 5DR9A 4FIFA 4K0YA 4MXCA 4QMPA 4RLKA 3ORXA 3QD3A 2IVVA 3QXOA 1CTPE 1Y57A 2BRGA 3OFMA 5HCXA 3W55A 4D2SA 4YZNA 2YERA 4E26A 4O22A 2W9ZB 1SNXA 3FQEA 3MB6A 3PSDA 3NNUA 4GT4A 4WD5A 5ANIA 4C61A 3R8VA 2IW6A 3ATTA 3OUKA 2I0VA 2WPAA 2BDWA 4DH1A 4JRVA 3F7WA 1FMOE 3IDBA 2PZ5A 5J9YA 4QP7A 2ZDTA 4JJRA 4I24A 3ZO2A 3AT2A 2IW9A 5JGDA 4CKRA 3KMUA 4KS7A 5CALA 3T8OA 4CD0A 3EFLA 3H9FA 1R3CA 1Y6BA 4G3CA 2VWYA 4Y95A 4BF2A 1TQPA 1TKIA 4PL4A 3GU6A 4O4FA 3RM7A 4C2WA 5IMXA 3KXZA 3L8PA 2UUEA 4FYOA 5FGKA 3QQKA 3IO7A 3LJ0A 5CXZA 4R7IA 4KKHA 3NNWA 3HECA 4C34A 3MY5A 4GH2A 5DH3A 3II5A 1XH7A 4M14A 2V7OA 4EOQA 3V51A 4XUFA 4ASXA 4D5HA 3I1AA 3NCZA 4FRFA 4CYIA 1OVEA 3AC1A 5HEZA 4ACDA 3FXWA 4YJUA 3UE4A 4NT4A 3OTVA 3G2FA 4XBRA 4LUEA 4D28A 4QMNA 4J53A 4H1JA 3KXNA 2XCHA 3OP5A 4G9CA 4E7WA 3GCPA 4EOKA 1MUOA 1TQMA 3WIGA 4BBFA 4IQ6A 1ZYLA 4BZOA 3R7EA 4A4XA 2XA4A 4MBLA 1YI3A 4BDHA 2WTKC 3ORMA 4U81A 3SA0A 2WAJA 2GU8A 3CTHA 4UMQA 3NDMA 3DKGA 3QQLA 3MGYA 4D0XA 3FYJX 1BUHA 1XH6A 3GB2A 1WFCA 3H10A 2ZJWA 1PMUA 1ATPE 3PY0A 4O86A 2GDOA 2C6LA 3TJCA 2C5XA 4EHGA 4HVHA 5IDPA 2BIYA 3AMYA 3F82A 3GT8A 2IWIA 4AOTA 4DEBA 5EYMA 2X6EA 4RA4A 1Q62A 3ORLA 4NK9A 3LXNA 1H0WA 4YHTA 3MH0A 3PZEA 4QYEA 2WEVA 1YRPA 3BIZA 5L6OA 1Q24A 1ZOHA 3SXRA 2BAJA 2WTVA 4L6QA 4KIOA 4RJ8A 4ZLYA 4DEEA 4BCMA 2XKEA 4YO4A 1YI6A 1W2CA 3I6UA 4D2VA 4KINA 3PLSA 4KSPA 5HE1A 4NUSA 3OCSA 3VS5A 4APPA 2HCKA 3GU5A 3QCYA 2UZTA 5J9LA 3BLAA 4WA9A 2VWUA 2C0OA 2ZM4A 3Q4UA 5EM6A 2YIWA 4GIHA 2CPKE 4OBPA 4PMSA 4UWBA 3ZOSA 4CTCA 4E20A 5M55A 4E6CA 3Q9YA 4FIIA 4J99A 4TYHA 4DAWA 2BPMA 4EZ7A 1KSWA 2J90A 5IDNA 2XANA 2ITTA 3DCVA 1WMKA 5GNKA 4RFMA 4OTFA 4R3PA 4HVDA 3SKCA 5M06A 4O0WA 3MY0A 5M51A 4CFMA 3EFWA 3G33A 4C2VA 3KY2A 2P0CA 4G17A 4DT9A 4R77A 3HRFA 3EQRA 5L8JA 2WTDA 3F9NA 5ETFA 4FZAB 1W2FA 5AUUA 4ZY6A 4I0SA 2VU3A 2PZPA 4QTAA 4RSSA 4ASEA 5A4EA 3KRXA 4RC2A 4RT7A 1MQ4A 1U5QA 1UKIA 2BAQA 5DG5A 5ICPA 1FMKA 3O23A 3PVGA 2W99B 2Y9QA 4JIAA 5A4QA 3PA5A 5DI1A 3BI6A 5CEKA 2QU5A 5DA3A 4BDDA 3UZRA 5JZNA 3DTWA 4H3QA 2WOTA 1NY3A 5H9BA 4JX3A 4PNKA 3CJGA 3NGAA 2PWLA 3FZOA 4J1RA 5JH6A 4FEWA 4HYHA 2VO3A 2YAKA 3OC1A 2J5FA 4HPUE 5E8XA 3SXFA 3TDWA 3UDZA 3DJ6A 4O0UA 5AP6A 4ACHA 2GNGA 4CFWA 2OZAA 3A61A 5IQCA 4YR8A 2FO0A 3M2WA 2W1CA 4KBKA 4QYYA 2HW6A 3C0HA 3FL5A 3NS9A 3QKMA 4C3FA 2P4IA 5HNBA 2J0JA 5DBXA 3COHA 3P5JC 1WBOA 3HUBA 1ZYJA 1OUYA 3ALOA 2GNIA 5C27A 3Q3BA 3RKBA 3RNYA 4UALA 4XOYA 3LCSA 4NL0A 2EXEA 1R0EA 1SYKA 2PMLX 4XG9A 4ZJVA 3QWJA 5HCZA 4BWXA 4NIFA 4FSWA 3IW8A 2R0UA 2QHNA 3R73A 4FKJA 4GK3A 5IUHA 5J5TA 4I0TA 1REKA 3DV3A 2X4FA 1R39A 3NAXA 2WMXA 4RPVA 2JAMA 2Y4IC 4MWHA 1JOWB 3R1QA 2ITUA 3W8LA 1KE5A 3KN6A 4XBUA 3O0GA 3TZ9A 5JFVA 1QPDA 5M44A 3U54A 2VWBA 3VUKA 4I5PA 3SRVA 3BE2A 4BB4A 1OKYA 3EN6A 1OBGA 4YJVA 4DITA 2H8HA 3HLLA 4OW8A 4TWNA 5LCJA 4UXQA 2B52A 3R1YA 4S34A 4X3FC 1Y8GA 3GGFA 1CDKA 1GOLA 2BALA 3MFRA 4FSYA 4IVBA 4FT7A 4JDHA 3TN8A 3BU6A 3R7YA 3TZ7A 4BGQA 4FZFB 5LWNA 4ALUA 3ACJA 3V01A 3LFQA 5F9EA 3RHXA 1E1VA 5KKRC 4YURA 3G90X 3OF0A 4OTQA 1IA8A 3EOCA 5HD7A 5KMJA 4I93A 3CY2A 4BJJB 2A1AB 3DAKA 3GQLA 4QMYA 3S0OA 2FGIA 4L9IA 3G0EA 4TZRA 1H1SA 2GNHA 3AMAA 4KIKA 1S9JA 2C1BA 4H1MA 3UMWA 5K9IA 4MD8E 2HZ0A 5L8KA 4C4EA 5CWZA 2I7QA 4RIXA 2X39A 3NWWA 1PXJA 1H26A 3PFQA 4BYJA 4IZ5A 2V5QA 4E6QA 3QLGA 1URWA 4NYEA 2QVSE 3DZOA 4YJTA 3G9LX 2HIWA 3R7IA 3OMVA 3W0PA 4BY9E 5IUIA 4J7BA 2PU8A 4O2ZA 4AQCA 4B99A 3V8TA 5FTOA 4NKSA 3A7GA 4RQVA 2QD9A 4QP1A 3RMFA 5ANEA 3W0RA 4O0RA 1GIIA 3FMEA 3PSBA 3QD0A 3WOWA 4JNWA 2WNTA 3JVSA 1FQ1B 2X2KA 4KABA 3WYXA 3R0TA 4HYIA 4NEUA 4DF3A 4UXLA 5AR4A 4HGSA 3MTFA 4UMTA 1H00A 3QTXA 5HOAA 1B6CB 3AOXA 2X7FA 4JL9A 4MCVA 1A06A 4TNBA 4EKLA 4FEQA 4ASDA 5HORA 3R8MA 4K6ZA 3H4JA 4L7FA 5EI8A 4AX8A 4EQUA 3DAEA 4PPCA 4RJ7A 5KMKA 3UNKA 4ZMEA 4O6EA 4PDSA 2JKOA 3MA6A 4O4BB 4AZWA 4APCA 1G8JA 5CF5A 4NJDA 3ZH8A 3KMMA 4FV1A 5EW9A 1XMMA 4MTAA 3W1FA 2W96B 3HV6A 4YU2A 3O51A 1SZMA 4GFOA 4Y72A 5JK3A 3EH9A 5AX9A 4DH7A 4A06A 1H1QA 3BE9A 2CNVA 5FXQA 3A99A 4FT0A 2XIKA 1ZMWA 2XNBA 4P4CA 3ML1A 2GFCA 4CTBA 1STCE 4YO6A 4Z16A 3I4BA 1Q8YA 3MJ2A 3HMMA 3RHKA 5I9UA 5AAGA 1R1WA 3SV0A 3LFSA 4GW8A 5FBOA 1FVRA 1BL6A 2CKOA 4U80A 2C5OA 3P7AA 1NVRA 2FVDA 2XJ0A 5TOZA 3W18A 3A62A 3PXQA 3TNQB 3FLQA 2ONLA 4NTSA 2ACXA 2EB3A 4YZ9A 1OL5A 4BIDA 4XEYA 5BV3A 3LFFA 1UNHA 4X3FB 4BCNA 4FVQA 3EZVA 3H3CA 4FSQA 4UMRA 3QGYA 4BCGA 3FLSA 2IVSA 1YWRA 1WAKA 4X2NA 2WQBA 2WMRA 1H28A 4BDEA 3UG2A 3IOKA 3KU2A 4FIJA 4ZZNA 3AD5A 4RFYA 4U3YA 2BTSA 4BBMA 4ZTHA 2F57A 3GC8A 3VS2A 2GCDA 4EYJA 3KVXA 4IX6A 4ZJIA 3TZMA 3H0YA 3OY3A 3M11A 4BDAA 4YZCA 3B8QA 5M07A 5K3YA 2VX0A 4WSYA 2XRUA 3DKOA 3R63A 4AP7A 3L8XA 3ENHA 2B9JA 2CSNA 2ZVAA 3TV4A 4DFLA 5LVMA 3HEGA 5GZ8A 1GIHA 3NSZA 4UY9A 3UVPA 2B54A 3F7ZA 3LVPA 2BHHA 4O4DA 3FI3A 4FT3A 3O17A 4YNEA 1OIUA 1U59A 4IB5A 1V1KA 5AV4A 4QTDA 4I6BA 3MSSA 4M0YA 4OGRA 3QQHA 2NNWB 4XHKB 3BYOA 3PG3A 4MNEA 5KZ0A 3UZTA 4FKPA 1Z57A 1FVVA 5CT7A 3MI9A 3RPOA 3LMGA 2R3IA 2W1DA 3RZBA 3W16A 5J5SA 4BCQA 3BBTB 4EBVA 3PA3A 3DS6A 2YZLA 4AGUA 3PUFC 2G9XA 1XH8A 1BMKA 2BZKB 3CD8A 3QUPA 4JMQA 3WBLA 1FPUA 4FIEA 3PLAE 4I6QA 5HCYA 5AIRA 2B0QA 4QMQA 4LRJA 3FY2A 4YLLA 4JIKA 4E4NA 2WD1A 4BDKA 5DPVA 5AP2A 3GC9A 3NYVA 2PZIA 5KZIA 3FEGA 4QQJA 2UZOA 3PUPA 3V3VA 4KRDA 4IMYA 1J7IA 3GCQA 4LOOA 5AV3A 2VTIA 3EYGA 5FWKK 4IC8A 3FBVA 3RP9A 4CG9A 4NZWB 2XRWA 1E9HA 1MP8A 2WU7A 3QTZA 5CS6A 2YJSA 3D4QA 4MF0A 3GXLA 2W5HA 1NW1A 2ZOQA 3P79A 5FLFA 2BHEA 2AC3A 2VTAA 4WG4A 3M42A 4USEA 1RQQA 2G15A 3A7FA 3F66A 5E1SA 4DGGA 2I0YA 5EG3A 4X3JA 2P55A 5B7VA 3VW6A 5IQIA 4D5KA 4RFZA 3C4CA 1Z5MA 4G2FA 5IMEA 2Q0BA 2VX3A 5CI7A 5DIAA 3E62A 2X8EA 2VWWA 5B2MA 4FTLA 4ACMA 4EUTA 1FGIA 4I5CA 2VRXA 4ANNA 4DFXE 2JAVA 3BYUA 4P90A 4NM3A 5BVFA 3PP0A 2GNFA 4IB3A 2ERZE 4LMNA 4USDA 2BROA 5AM6A 3K5VA 5M4FA 2ZV9A 4FNYA 3EHAA 2RF9A 3MPAA 3QGWA 2A98A 4YUQA 3NUSA 2ITOA 4FKUA 1OL1A 4NCTC 2V22A 4GYGA 2YM7A 1JQHA 4FF8A 4LFIA 4C36A 4XYFA 3R8ZA 3FI8A 2X0QA 4IANA 4PX6A 2OZOA 4FICA 3Q6WA 4U40A 3UDTA 5JFWA 2W4JA 4XG3A 4XRJA 3QRTA 4FNWA 3E87A 2FSTX 4GUBA 3FHIA 4DFBA 3IW5A 3VUTA 2X8IA 3ALNA 1W82A 2OKRA 4FV4A 5I9YA 2VX1A 1UU9A 4E5WA 5A54A 3K3JA 4E6AA 3QA8A 4F9AA 3PDTA 3UNJA 4C3RA 3OCBA 4DHIB 2W1GA 1GZ8A 3LFCA 1W7HA 4FEVA 3C50A 4ANBA 3BGQA 2RKUA 4TYHB 5CQUA 4BIEA 4HYUA 4L68A 3KIOC 2OJJA 4ZZMA 3V8WA 5BVDA 4EJNA 1PXMA 4WOVA 3REPA 3W8QA 4FBXA 3R7VA 1DAWA 3BLHA 3CD3A 2G2IA 2J6MA 2EUFB 4OTRA 4U45A 4U44A 4EHZA 3E8EA 4FTOA 4KNBA 4QPMA 5L2IA 4ANOA 1MQBA 5CYIA 4EK8A 4D55A 1H1PA 4D2WA 4ERKA 4BICA 5ANOA 3FYKX 4FKVA 5CAUA 1RW8A 3KA0A 3RINA 3TKIA 3RAIA 2XK6A 4ZTNA 2YIYA 4MXXA 3AGLA 2R9SA 3LCTA 5HTCA 4KUJA 4YHJA 4XMOA 4J71A 4UZHA 4CGAA 3DQXA 1X8BA 4ALWA 3NUAA 5DOSA 2IN6A 4G6NA 1RJBA 4O21A 3SXSA 1REJA 2C4GA 2EXMA 3TKUA 4FGRA 1JNKA 2XS0A 3P9JA 4FL2A 4IM0A 2YWVA 5C4KA 4LRMA 2OSCA 4FZD