4CKIA

Crystal structure of oncogenic ret tyrosine kinase m918t bound to adenosine
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
314
structure length
293
Chain Sequence
GPLSLSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVEEDSVKRSQGRIPVKWTAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Oncogenic RET kinase domain mutations perturb the autophosphorylation trajectory by enhancing substrate presentation in trans.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET
total genus 95
structure length 293
sequence length 314
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ckiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ckiA01
5EM8A 4BDKA 1KV2A 2UZUE 3KB7A 4FSZA 2DQ7X 2F7ZE 1W83A 4NW6A 1QPJA 2FB8A 1XH6A 4IAIA 4ZTQA 4H36A 4S31A 2YLEA 3LQ5A 4A4LA 4M66A 3FSFA 4TY1A 3PP1A 5EYDA 2WMWA 4CZUA 2WMTA 3GU7A 4WG3A 4KSPA 4OUCA 2ZAZA 4L9IA 2YCSA 4DFNA 1U54B 1WBPA 1WVXA 1H24A 2R4BA 2WHBA 3KK9A 4LQMA 4ITIA 4TWNA 4W9WA 2XS0A 4IC7A 3BHHA 4MKCA 5AX3A 4ACDA 4XBUA 4MF0A 4I5CA 4QTCA 2EXCX 1H01A 4F70A 3OWLA 1Q8WA 1KOAA 2VWIA 2H9VA 3DQWA 3Q4TA 5IA4A 3QL8A 2WIHA 3IGOA 1OM1A 1NVSA 2F7EE 5IQFA 3DXNA 3DS6A 3W2OA 1NY3A 5CENA 3RTPA 1OIRA 2XKCA 4FKUA 4O82A 1JVPP 4M0YA 2FA2A 4FUXA 3ZFXA 4MD9E 5C8NA 2QURA 3ZO1A 3QRUA 1Q8YA 4F9CA 1URCA 4AA0A 3V8TA 2R3NA 2YM3A 5CT0A 3DJ5A 3MSSA 1BUHA 5EHYA 3FQHA 4C58A 3UVPA 3ZO4A 3RHXA 3UIUA 3MWUA 4FL2A 3BYVA 4FSRA 2Q0NA 4G1WA 2QOHA 1L3RE 5KMOA 3FL4A 5JGDA 3LQ3A 1FQ1B 2OH0E 3BBTB 3KULB 5CTPA 4DH5A 4LOPA 2XCKA 2J5EA 4FSQA 4ZSAA 2VTAA 5J87A 5BYZA 4FEVA 1YW2A 3PIYA 5HE0A 4K2RA 3NSZA 4L44A 3TJDA 3CJGA 2IW8A 4QPSA 4DFYA 5JRQA 4KIQA 5GZ8A 2VTJA 4D2TA 2VD5A 2YCFA 4IEBA 3QLGA 5F94A 4IB3A 3ORPA 4IH8A 5D12A 1GZOA 4U6RA 4QMOA 3VULA 2VTQA 3ORMA 3GCPA 2IW9A 1R0PA 1Q3DA 1UVRA 2X8IA 5CAVA 5F9EA 4R7HA 2PVMA 3D15A 3ORKA 3QQGA 4J99A 4Y5HA 5BVWA 5ACKA 2BIKB 2VV9A 4FI1A 4XOYA 3V6SA 4IAKA 3ZRMA 4Z3VA 1WBOA 5B2MA 2E9UA 3CKWA 5D7AA 5FG8A 2EWAA 3RGFA 5FTGA 4YSJA 2CN5A 1YI4A 4ZSGA 4KAOA 4XG6A 5J95A 1JKTA 5FEDA 4F0FA 3QUEA 4BZDA 4UX9A 4K9YA 3D2IA 4I0TA 2HZ0A 1VR2A 3KRXA 4GCJA 3AC1A 4HYSA 2C69A 4I5HA 2XKDA 2OXDA 2WFYA 1G3NA 1YOLA 4G17A 3TIZA 2R3RA 4YJRA 4K8AA 4BBFA 4AW2A 4C4GA 4K33A 4F1TA 4WG5A 3M2WA 3UIMA 4E4XA 3ZDUA 3E87A 5CF5A 4P2KA 5KHXA 2JDRA 2OF4A 4IW0A 5M55A 4TYJA 2R3HA 5AR3A 3GC9A 3PSBA 4EUUA 1MP8A 4CFWA 5LVOA 3JY0A 2YZLA 2W1DA 2ZV8A 4HVIA 2OZOA 4NFMA 4ZAUA 3MTFA 2GMXA 3VN9A 2GQRA 3F3ZA 4FV2A 4C4EA 2IO6A 3LIJA 3PA4A 4KRDA 5J79A 3BGPA 2UW8A 3ENMA 3FZ1A 3LXNA 3MY5A 4O7LA 1VYWA 2QU6A 3P7CA 3HA6A 2W17A 2CJMA 3FV8A 1FVRA 1OL1A 3HMMA 4K6ZA 4RVLA 3CS9A 3VRZA 4EORA 1J1CA 3CY3A 4XV2A 3ZZEA 4DFXE 4TL0A 3D7TA 4W4WA 3R21A 4QMYA 4O0YA 5IQDA 5BQ0A 3F2RA 4YO6A 4MXOA 1BX6A 5DYJA 3AMAA 2R64A 3VBXA 5EI8A 2ERZE 1H4LA 4FZDB 3C1XA 1ZOHA 4LUDA 2VWYA 5EHLA 5HG7A 3U54A 2RFEA 3OXTA 3BYSA 2WEVA 1ZYDA 3IW7A 4L3LA 4AFJA 5CF4A 3SXFA 3VW6A 2YDJA 3QU0A 4Y5QA 2JKOA 4EOLA 4AFEA 4O96A 4RBLA 5CT7A 5I3RA 5KBRA 2VO6A 4QP6A 4GK2A 4YU2A 4EK4A 2WOTA 1JPAA 5HICA 5TKDA 3PA5A 2CKEA 3FKLA 3OUKA 4G6NA 3QX2A 4KS7A 4RJ8A 3BHUA 4HCTA 4CV9A 3ZLWA 2GFCA 5I9XA 4TWPA 5CNOA 4MD8E 5EKOA 5FXRA 4D0WA 4O7SA 4N0SA 4O7ZA 4FTIA 4J71A 5AUUA 1YXVA 4II5A 4J53A 2E9NA 5AUZA 5DN3A 4WUNA 2C4GA 3UNKA 4PTEA 1W0XC 4AE9A 3RPRA 5BYLA 4D4RA 3ORXA 3C5UA 2JIVA 4FZAB 4HCVA 2GQGA 2PVHA 4XV9A 1IAJA 4IB0A 2ITWA 4CQEA 4R3PA 4JIAA 5FEEA 5BUJA 3LKMA 3UQCA 4PPAA 3FZRA 5DE2A 2RGPA 3NUSA 4BI0A 2QLQA 3FHRA 4W8EA 1T45A 1U54A 1YWRA 3PA3A 4FV0A 3S3IA 3Q53A 4C61A 4IWQA 3TZMA 2X39A 3AMBA 4CMUA 4ORKA 4I21A 3ZEWA 4BF2A 3IPHA 3DJ7A 4CNHA 1SVEA 4M84A 5CEIA 3QTIA 2J5FA 2PUNA 4DEHA 1OPJA 3Q5IA 3UO4A 4ACCA 4EHEA 5EQEA 1B39A 5EOLA 4AW1A 3EHAA 3FE3A 3TNIA 4NCTC 2PUUA 3C4WA 2BROA 3VVHA 2DS1A 1WBWA 2PUPA 4F99A 3BV2A 3FXXA 1WAKA 3RJCA 3SD0A 5C26A 4GT4A 4BC6A 4WD5A 4XG3A 1KUTA 2EXEA 5IA1A 4WHZA 2OIQA 3RALA 4ZZNA 2ONLA 3ZRKA 4BFMA 2X4FA 4RJ3A 2ZM3A 3EJ1A 3GU6A 4BIBA 5HLWA 5LJJA 1QPDA 2OI4X 3DT1A 3VS4A 2W96B 3KULA 1GZKA 3D14A 2JDOA 4Q9SA 4RVMA 5I3OA 5TE0A 5CEOA 1PMVA 5KCVA 5IA2A 3CXWA 3DGKA 4ERKA 3K3IA 3KRWA 4NIFB 5C01A 4G9CA 3R63A 5AJQA 5KMMA 1G8SA 3RP9A 2QU5A 3HEGA 3U55A 3RAWA 1JKKA 3D5WA 3KMMA 2GNLA 2VTTA 4FZ6A 5CYIA 5F20A 5HTIA 5JKGA 1ZOEA 4TXCA 4CKRA 2XK3A 3I60A 4QYYA 4YZ9A 5AM6A 2LAVA 4TZRA 3TEIA 5CI6A 2GHMA 4JBVA 3R1NA 3R71A 3G90X 4DA5A 2UW6A 4NTTA 5DBXA 2QQ7A 5EYMA 2WMAA 5ANDA 3PLSA 1QPEA 5HG8A 4TYHB 3R02A 3QD3A 3JVRA 3W1FA 2CKOA 2H6DA 4QMSA 4BCNA 4EK3A 1RJBA 4GFMA 5FTOA 2XH5A 4FE2A 4GYGA 4IZAA 3SXRA 2WOUA 4EC8A 3LW0A 1P4OA 3KXGA 3OWKA 2OJFE 4NFNA 1XBAA 3ORLA 3GQIA 2JC6A 3OZ6A 1ZOGA 3A7JA 3FLSA 5IQIA 3V5QA 5DRBA 3A62A 2YFXA 4I23A 4XMOA 2QI8A 4FK6A 5HOAA 3UP7A 4O7VA 3IDCA 5K0KA 3LCOA 4PWNA 1JBPE 4ENYA 4BTMA 3LMHA 2HYYA 2HZIA 4FKPA 4ONAA 1OMWA 2ZMDA 4PTCA 4XG8A 3M11A 4BWKA 4I6BA 2UZEA 2C6DA 1PYEA 4BDAA 2HY81 4HVHA 3ZO3A 5AUYA 1PW2A 5IH4A 3P08A 5HIDA 4FV4A 1UV5A 2V62A 2JBPA 3PSDA 4CEGA 4EZ5A 5C4LA 4WNMA 1CM8A 4ZP5A 2X81A 1Q8UA 3EL7A 3HNGA 4QMMA 2W4KA 5E90A 2J2IB 5HLNA 4XG4A 3A99A 1GY3A 3PVWA 4NL0A 4DGMA 1M7QA 3PZEA 4RA5A 1OKYA 2PZIA 2XIKA 2ITYA 3POOA 2F9GA 4FV1A 4RFZA 4BCFA 4E93A 5JGBA 1Y6AA 4YLJA 3ODYX 3M42A 2JLDA 2OK1A 2R3JA 4XX9A 3KN5A 2IJMA 4P5ZA 3QZFA 4QYFA 3UC4A 4LI5A 2R3FA 3PRFA 2V7OA 3R7GA 5A4CA 3GU5A 3IOKA 4WO5A 2RFDA 5FGKA 2B9JA 2XNGA 3JS2A 4FZFB 4EC9A 2GTNA 1PF8A 4FSUA 3VS2A 2A4LA 3DV3A 4F4PA 2SRCA 3EL8A 2YJSA 3HLLA 4LV8A 4ZK5A 3BLHA 3CC6A 5IPJA 2R7IA 2WMQA 4EI4A 2WTJA 2XK8A 3TV7A 2GDOA 2W5AA 4YGAA 3QUPA 4LRMA 5DG5A 4M3QA 3VAPA 1STCE 3R9NA 4M15A 3ROYA 2I6LA 3NEWA 4DINA 1W7HA 4RIWB 3A4PA 1CKIA 1J3HA 2O3PA 4OT5A 4RWJA 3DA6A 2XNOA 3GI3A 4FKWA 3MDYA 4XRJA 2YACA 3RKBA 1G8AA 2AUHA 3UNZA 3Q2JA 2BVAA 4GV1A 4DEEA 5M09A 2BTRA 3QRKA 4RIOA 5E92A 4OTPA 3W2PA 4H39A 4FNXA 3DB6A 4CT2A 2GNJA 2IZSA 5A6OA 4U5JA 2C47A 4FT7A 2YJRA 1YVJA 2EVAA 1CTPE 3F61A 4I20A 4C2VA 3HDMA 3MH3A 4UWYA 4ANNA 4HGEA 3NNWA 3SOCA 4ANSA 4E4LA 5M4IA 2B0QA 1OKZA 3HMPA 3TT0A 1Z9XA 1R39A 5C1QB 5KMNA 2J0IA 1H27A 4S30A 3GU8A 2B9IA 3AT3A 3MVMA 4Q9ZA 3LMIA 5D7VA 1R1WA 4G3GA 3QLFA 2JGZA 4DH3A 4L68A 3FMHA 3LOKA 4ALWA 4C57A 1SNXA 3LM5A 3FMDA 3VS3A 2YITA 3FHIA 3HRBA 4A06A 3ITZA 2VTHA 2X9EA 5L2QA 4FR4A 1MQ4A 4CFXA 5KO1A 4MYGA 1A9UA 5AP3A 4MXXA 4DGNA 4TRLA 2OF2A 3QQKA 4HYHA 4CGAA 2I0VA 3WF8A 3G15A 3BE2A 4IE9A 5AP2A 3DLSA 3VBWA 5CU3A 5EQPA 4K1BA 4PDYA 2UZTA 3W18A 3P86A 3MPTA 4RWKA 2E9PA 3QKLA 4XOZA 3ZBXA 4EOJA 4I6QA 3OXIA 4YZMA 4BDDA 5CALA 4Y95A 2Y4IC 3EIDA 4KIKA 5LVMA 3PUPA 3KVWA 4U41A 1UNLA 2ZM1A 4N6ZA 5BUEA 5M06A 4MX9A 1IAHA 3AT2A 3DKOA 3IGGA 4D2VA 4R3RA 3MPMA 4FBXA 4DLIA 2VGPA 2UZWE 4F7SA 4OTGA 4FICA 3PXZA 3QAME 3R6XA 2YA9A 5AMNA 4DYMA 1CMKE 3R0TA 1Q4LA 2QHNA 3QCYA 4IDTA 4JG7A 3PJ1A 2C68A 3QC4A 5EI6A 4MBJA 2X7OA 5CSHA 2CGWA 5KNJA 4XLIA 5LMKA 4PPBA 4ENXA 3R8ZA 3FDNA 4RX8A 3BU3A 3OWPA 5CLPA 3H9OA 4D4SA 2CCHA 1E1XA 4KABA 5A9UA 3V51A 5CEPA 3MVJA 3O8PA 1YDTE 2PZPA 1H1SA 1RQQA 5FEQA 3E3BX 2VX0A 4UXQA 3MH0A 5ANGA 3UDBA 4YURA 4NM5A 4TYHA 4U42A 4AU8A 5A4EA 4TYIA 4XV3A 2BALA 4O7YA 2FVDA 2F49A 5LCJA 3QQLA 1UNGA 1PKGA 1R3CA 1BL7A 3E92A 3E7OA 2C6TA 3IW8A 3LFCA 4CCUA 5I9VA 1O6LA 3ORTA 2YWPA 4HOKA 4TWCA 4ANQA 2BUJA 4K18A 4C36A 2F2UA 4UYAA 3WZEA 3PPZA 3W55A 1WBTA 1BLXA 3ZLYA 4D1XA 5JQ5A 2GQSA 3EKNA 2WTVA 3THBA 3TTJA 2VWXA 5CASA 3H10A 4JQEA 5BVFA 1FMKA 1GIHA 4EYMA 4YTFA 3S2PA 3ALOA 3R7OA 2IVUA 3F5XA 2ITOA 3GCQA 3UG2A 3EN7A 3MIYA 4G34A 2W05A 1TQIA 4C34A 5AADA 1PMUA 3QQFA 2R3LA 3NNUA 5HQ0A 1MQBA 3R22A 2I40A 1CSNA 1ZARA 4EH5A 4RVTA 3QCSA 3E8DA 4YC8A 3QA0A 4J97A 4IQ6A 4X3FB 5CU6A 2CPKE 2C1AA 2W0JA 1JWHA 3HP2A 4E26A 3UPXA 3IG7A 3NYVA 4F9BA 5E8SA 4MAOA 4LMNA 2PMNX 3BHVA 3KL8A 4XV1A 3CCNA 5M4FA 3S0OA 4EK5A 4MBIA 3Q96A 4OTRA 3KXHA 3EB0A 3VS1A 4W4XA 3DJ6A 4FV9A 3MBLA 4DLJA 4F65A 4AN9A 3DKCA 3G6HA 3R01A 4ZJJA 2CNQA 3CKXA 2OJ9A 2GU8A 3FL5A 4UWBA 4O7RA 3L8PA 3PDTA 3E63A 5EYKA 4AXAA 2XEZA 2YCRA 5T6KA 3U6HA 4IACA 4K0YA 2P2HA 5I9YA 4E6DA 3OCGA 5JT2A 3SAYA 3PSCA 2VWVA 3UE4A 1BL6A 3R8UA 5HBHA 2GNHA 4DEIA 4LL0A 3R1YA 3UQGA 4QTDA 5HE1A 3OOMA 2RFSA 5LMKC 1G5SA 1JQHA 2XM8A 3NAYA 2WTKC 3OEZA 4FTJA 4G9RA 4AWIA 4BCHA 4EWQA 4PP9A 3RNIA 1IASA 3DAKA 3ULIA 4DGOA 4CRSA 3CP9A 3I0QA 4RA4A 4E5WA 4S32A 4D1ZA 2WXVA 4MCVA 2XK4A 3G6GA 3VUMA 2ZV7A 4EOKA 4O86A 3F3WA 3KF4A 1FBNA 3BI6A 4APPA 4ID7A 3H9FA 3I7CA 1H26A 3OWJA 2WGJA 3R9DA 3IK3A 3HZTA 4X6RA 3OY1A 1OGUA 4M0ZA 5HORA 3P5KA 4PMTA 3U6IA 2R2PA 3F6XA 2O5KA 3F69A 5HNBA 4ZOGA 1TQPA 3KGAA 3FXZA 1ZY4A 2BRBA 4H1MA 1XH4A 2WAJA 5M51A 3MFRA 3UO6A 4JDIA 4KD1A 5CEMA 4BHZA 5IU2A 2ITNA 4A9RA 5CS6A 3GB2A 5DR9A 2YWVA 2R3MA 4MXZA 4Y83A 1J91A 1IRKA 4KKHA 3BWFA 4NW5A 3CQEA 4GKIA 3EN9A 2ZV2A 2JDSA 4RX7A 3I6UA 2G15A 2W1CA 3NW6A 5E9EA 4CTCA 4G3DA 4GMYA 3QRJA 4DEBA 4BL1A 1P5EA 1Q97A 3W33A 4GH2A 1YQJA 4PY1A 4NIFA 5CANA 3QXPA 4DGGA 3QQJA 4AGCA 2DUVA 4UEUA 4PQNA 3GBZA 3VRYA 2YIXA 4DAWA 2JKMA 3H0ZA 4FKGA 2BDJA 3BQRA 3I79A 4YC3A 4QYHA 3W10A 4MNFA 5K4JA 5GJGA 3MVHA 4RQKA 4U81A 2ITPA 2OKRA 5A14A 5IA0A 3HV3A 2HENA 4IFCA 1ERKA 4NWMA 3POZA 2O2UA 4YTCA 3U87A 3PPKA 3UIBA 5CSXA 5E8TA 3WIGA 3O7LD 5H2UA 3U4WA 1NT2A 2CGVA 3QA8A 3EQDA 5J8IA 3G9LX 5L6OA 3L9LA 3MB6A 4V01A 5K3YA 4NM7A 4E6AA 4RIXA 3ET7A 4IBMA 2W1EA 1MUOA 2QHMA 4BCIA 4FMQA 5CQWA 4BDJA 3OG7A 4K77A 1O6KA 4FVPA 4OTIA 2GHGA 2R3KA 4GU9A 1LPUA 1DM2A 2O63A 3R8MA 3B2TA 1K3AA 1UU9A 2RF9A 4FTNA 4FUYA 4J52A 5IH6A 4QMTA 1MRYA 2PWLA 3RNYA 2GNGA 5C4KA 1VZOA 2QOIA 1YRPA 5GNKA 4ZTSA 4A9SA 3LXPA 2PTKA 3MH2A 3V5LA 4CFVA 2RL5A 2O64A 4CKIA 3LJ1A 3FMEA 3PJCA 4L52A 3WILA 1J7UA 2E2BA 3JXWA 1BMKA 2VTLA 3PVBA 3ZO2A 1ZAOA 3TTIA 4QNYA 4MD7E 3ZSGA 2VTMA 3NX8A 4JAIA 1ZY5A 4CSVA 5CY3A 4FSNA 3AD4A 4EK6A 3FPQA 4OR5A 3HMOA 3DBQA 4GFGA 1OKVA 5AAGA 3DKFA 4YJQA 4AQCA 5KUPA 2PVFA 4BCJA 3I1AA 4YC6A 3D5VA 4FOCA 3KMUA 3G33A 3A8XA 4YZDA 2Q83A 2XP2A 5LQFA 4FKOA 4O6LA 1YXXA 4RWLA 2Z60A 1M17A 4W4YA 5CZIA 5I9UA 2R3OA 3OMVA 3RWQA 3PY3A 4AN3A 3QKKA 4GIIA 3T3UA 4ZTMA 3L9NA 4UYNA 2VU3A 5GJDA 4KBKA 3UOLA 3WF9A 5L2WA 2FYSA 4DTKA 4BHNA 3N9XA 1ZMWA 2BTSA 4IM3A 4LRJA 3O2MA 4E7WA 4JOAA 3R7IA 2V7AA 4QP4A 5BYYA 5CAOA 4HYUA 5FBOA 3Q3BA 4YR8A 4USDA 4RSSA 1ZMVA 1WCCA 3PYYA 1QPCA 4FNYA 4ITHA 4MEDA 4EOSA 1H1WA 4D4VA 5HIEA 5DMZA 3LE6A 4IM2A 4FZ7A 5K9IA 4EQUA 3F9NA 3QXOA 4TYEA 4EKKA 3B2WA 5HO7A 1NW1A 2AYPA 3JR1A 5BNJA 5DLSA 5JFSA 3LCDA 3II5A 3DY7A 4H58A 3GXLA 3DK6A 4FTLA 3PZHA 3EQGA 1I09A 4NEUA 3R1SA 3A7GA 3ZM9A 3KU2A 3MA3A 4S2ZA 4CD0A 3PXQA 2VX3A 1TVOA 3CJFA 5HGIA 3HRFA 4G6OA 3DLZA 2XZSA 1OB3A 2B7AA 3U6JA 3CLYA 1OI9A 1IA8A 2QNJA 3LM0A 4NJ3A 4U45A 5TOZA 3C0HA 2BFXA 4HNIA 1H0WA 4FTCA 1NVQA 4JDJA 3GQLA 3DXPA 2VTRA 3PTGA 4J98A 3R8VA 4CG8A 4ZS4A 1CKJA 1VEBA 3RAKA 4EOQA 3KXNA 2XB7A 1P14A 3O8UA 1JSUA 2IZUA 3BIZA 1FOTA 2ESMA 5AP0A 3RI1A 3RK5A 3R04A 4D2PA 4YO4A 4YPSA 3FZTA 4FF8A 3I6WA 5DIAA 3DDPA 3O71A 2BAJA 4P4CA 4TNBA 2F57A 3DKGA 4JIKA 4OT6A 3HL7A 2C3LA 2B9FA 4NYEA 4B99A 4M97A 4ASDA 4ZY5A 1WBNA 3BYMA 4AAAA 4BCQA 1VJYA 4AGWA 3GU4A 5HTCA 3BEAA 4EH8A 3P1AA 3OT3A 4GYIA 4I4FA 2HW6A 3QTXA 4U8ZA 3LLTA 3ATTA 5KMJA 3C5IA 2GTMA 4I0RA 5A4LA 4OTDA 5CF6A 2QOKA 4JAJA 3ZUUA 2PSQA 4UWCA 5DGZA 4IHPA 3ANQA 2QO7A 4O0XA 1W82A 4NH1A 4DF3A 3DNEA 4X2FA 2UW4A 5A6NA 2X7GA 3EYGA 2WMXA 4KKGA 3ACKA 2ITTA 4MWIA 4O27B 3ZEPA 5M56A 4KINA 3AXWA 3PXRA 4E20A 1L8TA 2C30A 2VZ6A 4N6YA 2X2LA 3AOXA 3PXKA 3QC9A 3CBLA 4UMPA 4ARKA 1GJOA 1LUFA 3N51A 2Q0BA 3SV0A 2WTDA 4FC0A 5JN2A 3V5WA 1FGIA 3WF7A 2CSNA 3VQHA 1JAMA 1URWA 1BYGA 2QO2A 2WZJA 4QMUA 4BIDA 5B7VA 3Q4CA 2P55A 2UZDA 3HAMA 4YMJA 4PV0A 3GT8A 5IEYA 3VBYA 4AP7A 4YTHA 3Q2MA 4QMPA 3TZ9A 4XEYA 4DH1A 4KS8A 3SVVA 4FEXA 4A9TA 4E4NA 1ZYSA 2C3JA 4C2WA 4ASZA 1H0VA 2PVJA 3FY0A 4E3CA 2CGXA 3MYGA 2BR1A 1JSVA 2I0EA 1LP4A 2X1NA 2OU7A 3O96A 5DT0A 5C27A 2X8DA 4EYJA 4OAVB 4F9AA 5CAUA 2GFSA 5AWMA 4ZTNA 5I0BA 4HGLA 5AR8A 4RWIA 2HW7A 3TNPC 4MBLA 3UIXA 2C0TA 5LWNA 3OW3A 4K11A 3TUBA 2Y8OA 2BFYA 2A19B 5ITAA 5CI7A 3FMJA 5LOHA 4PMPA 4WA9A 1K9AA 4UY9A 5AP5A 1TQMA 4FIHA 4BGHA 4L3JA 3VHKA 5CAPA 3BGQA 3NMUF 3UNJA 3R73A 4XLVA 3G0FA 5HVJA 4LG4A 1Q3WA 1HOWA 2ITUA 3T3VA 2XIZA 2W1HA 3NIZA 4BKJA 4IB1A 3P78A 1BI8A 5M53A 1YI6A 5IISA 3W32A 4JRVA 1UU7A 4D9UA 2OSCA 3RBWA 4CYIA 3VNTA 1SM2A 3PLAE 1OL2A 2VWBA 2XCHA 3ORIA 3QZGA 4BDFA 5IA3A 2CCIA 2YIRA 3NAXA 2HZNA 3FMLA 4HGSA 3E8CA 4DFZE 4D4YA 3OROA 2O8YA 3I5NA 5E8VA 2OICA 1R78A 2B55A 3FWQA 3QTZA 3HUBA 4MQ2A 4BDBA 4ZIMA 2W5BA 1UU8A 5HCXA 5L4QA 2B4SB 3IQ7A 3NVMB 2R0UA 4XUFA 5ICPA 3QHRA 4DEGA 3FC1X 4S34A 2I0YA 3LPBA 3I81A 4PDOA 2PL0A 3AC4A 4FEQA 3SHEA 4AG8A 4A07A 4BGGA 4JG8A 3QQHA 5HEZA 4C4IA 3MJ2A 1Z57A 4D55A 4I41A 3NGAA 3IOPA 3VUGA 3DK3A 2X6DA 4OBOA 4WBOA 4FTUA 4EONA 4EHGA 1XBBA 3P0MA 3UMXA 3QTSA 3S00A 3UO5A 1YDSE 4GU6A 2UW3A 1Y8GA 4TYGA 4AUAA 4AW0A 3FLQA 4IX3A 3UP2A 4JT3A 3CIKA 5IQAA 3F7ZA 5J5TA 2NNWB 3ALNA 1PXOA 2FSMX 4RVKA 3OBJA 4ERWA 2ZB0A 3ELJA 3K3JA 3SRVA 2YAKA 2WMBA 2YZAA 3RK9A 4IVDA 4NTSA 5C9CA 2BAQA 3D0EA 2GNFA 3R7VA 4F6UA 2I1MA 3BRBA 4RT7A 5HCYA 5HO6A 2P4IA 4DEAA 1Y57A 4RC3A 3TZ8A 2YERA 5EKNA 4P7EA 2CHLA 4JRNA 4M12A 4D2SA 3TUCA 1W98A 2PPQA 1YXUA 2O65A 2GS2A 2VTPA 4Z55A 3ZONA 3V04A 5TO8A 4FX3A 2JDVA 5IQGA 3QTQA 4QNAA 3DFCB 5EH0A 5GINE 1WFCA 2B53A 2C5YA 3VC4A 1WVYA 3OT8A 4ZZOA 1YOJA 4C35A 4ASXA 4BCKA 4CQGA 4QP8A 3BZ3A 3W2CA 3VUDA 4IB5A 3FI2A 5EDQA 4GKHA 5BVKA 3OBGA 5IUIA 4I0SA 2XKFA 2XNMA 2ACXA 2YLFA 1YDRE 5IUGA 3OHTA 1PMEA 3QZHA 3EQHA 2ITVA 3TV6A 1E9HA 4XP3A 5E7RA 1H8FA 2YN8A 4JS8A 3UOHA 3LFAA 3ZM4A 2RKUA 4J7BA 1YI3A 2Z7LA 3TI1A 4E5AX 3A7HA 3F88A 3HYHA 5CZHA 5ETCA 4C7TA 2P3GX 4FGBA 4DFLA 2JBOA 3EMGA 2EU9A 4KUJA 3F3VA 5KKRB 3TNQB 3WYYA 4QQJA 1H00A 2J0KA 1OIUA 4YSMA 5AR2A 3VF8A 3C0GA 2XA4A 1OVEA 4Q5EA 5CEQA 4QP9A 5IEXA 5JFWA 3WZDA 4N70A 3EFJA 4YZCA 5IG1A 4AA5A 3Q9WA 4P90A 4QTBA 3VIDA 5CVHA 5B0XA 1LEZA 4OAUC 1M52A 3NYXA 1WVWA 4N4SA 3ZCLA 4E73A 3D2KA 4ZEGA 4FODA 5J7HA 2VAGA 2W1GA 3KC3A 3WE8A 3ZYAA 4C0TA 4IXPA 2JEDA 4MXAA 1DI8A 2V5QA 4OLIA 2I0HA 4XG9A 3KQ7A 4ALVA 4BTFA 4ZY4A 2C3IB 1OITA 1VYZA 3RHKA 2BRMA 4J1RA 2GS7A 3DQXA 4XBRA 3REPA 3EQIA 1XKKA 3EFKA 3NVKI 3FZSA 4FA2A 1DAYA 2BHHA 3E5AA 1CKPA 3NCZA 4A9YA 4F7LA 3ANRA 4ZSLA 4O0RA 4JVGA 3VBQA 5AUXA 3ZDIA 1ZLTA 4GRBA 4IWPA 3NYOA 4GS6A 5ETAA 2JITA 2QOBA 3LJ2A 4DBNA 4QYGA 4R6VA 4YJTA 3VUKA 4HVSA 1RE8A 2CLQA 3GUBA 2UVXA 2X8EA 5I5ZA 2CKQA 4GK3A 3CPBA 5DOSA 3E93A 4YHJA 4Q5HA 3QF9A 1Q8ZA 3DOGA 5KE0A 1KE8A 4MNEB 5KMIA 4GL9A 3LQ8A 1U46A 2R0IA 2X2MA 3BKBA 1FVVA 2QOLA 3GENA 4H3PA 3EFWA 4RPVA 5GHVA 4IVBA 4F7NA 5DI1A 4M68A 3AT4A 5KZ0A 3CY2A 1O9UA 3O8TA 2Y4PA 4OBPA 4DG2E 2YAAA 2OJGA 1OL7A 3BU6A 3TKIA 5EI2A 4IVAA 2Z7SA 4OBQA 1YWNA 2IW6A 3C4FA 4GVJA 4RJ7A 4HW7A 3HMIA 2CNVA 3OD6X 2QODA 3S1HA 2JIUA 3QTRA 3QD4A 2OLCA 3ZLXA 2HOGA 5HLPA 2LGCA 2RG5A 4QRCA 3ERKA 4S33A 4BTKA 3ENHA 3SX9A 3CGOA 2UZVA 3VS5A 4ALUA 2W1ZA 4PMMA 4U97A 4O81A 2A27A 2R7BA 2C5XA 2YEXA 3U4UA 4FL1A 3EZVA 3ZFMA 2OFVA 4I93A 5H8GA 2WQMA 3F3UA 3PIXA 4YLKA 1Q62A 4QQCA 3SQQA 2C0OA 5EDRA 4BCPA 2ITZA 5M57A 4DHFA 1V0OA 3P9JA 4Y8DA 3BYOA 5EM7A 4AS0A 4CFMA 3F5GA 2O0UA 4Z9LA 1FMOE 3L8SA 3PJ2A 4WG4A 2OXYA 3SGCA 3V5PA 4PL5A 1V1KA 3BU5A 3FUPA 5DVRA 4FGRA 3I4BA 2YM4A 1OPKA 3Q04A 1A48A 4EQCA 3UTOA 4CKJA 5IQBA 3G5DA 2XEYA 4CVAA 2XYUA 2JDTA 3CTHA 5CNNA 4NUSA 1XBCA 4C8BA 2E9OA 1OECA 2FSTX 3Q32A 2W1FA 2UV2A 3DB8A 4HZSA 4BWXA 4DTAA 3FAAA 2AC3A 2OFUA 3MJ1A 4E5BA 3VBTA 4G3CA 2C6OA 3QWKA 5D10A 5ANOA 4A4OA 3AGLA 2HWPA 2VNWA 3P7AA 2E9VA 4IAFA 4NM0A 4WNKA 3OTUA 3UJGA 3QTWA 3MGYA 1J1BA 4NM3A 1Q8TA 2PHKA 4M67A 1UA2A 4KSQA 2R3IA 1E1VA 2YHVA 3HGKA 3QTUA 5HKMA 3L1SA 5HVYA 3VW8A 3PJ8A 5CQUA 4PP7A 4EHVA 4X2GA 3TKHA 2JAMA 3KRJA 4OTHA 1U4DA 4QPAA 2XMYA 3KY2A 3NRMA 4XS2A 2R3PA 4BDGA 5DFPA 2JKKA 2QOCA 5JGAA 4I3ZA 3WZUA 5CXZA 5KX8A 2OGVA 2V55A 4ANMA 5J9YA 4C33A 4KIOA 4CT1A 4E8AA 4IZ7A 3ZZWA 3P79A 2GCDA 4YJOA 5AV3A 4RJ5A 4O7WA 1PXMA 3GOKA 3FEGA 3OC1A 4NCTA 5AR7A 1YHWA 3F82A 3G51A 3QZIA 2QG5A 4AN2A 3UZTA 4P5QA 3FPMA 3TACA 4C59A 2GHLA 4O1OA 4UZDA 2X9FA 3NW7A 3TL8A 3ZSIA 3UPZA 3GFEA 3BV3A 2QVSE 2C6EA 4O0WA 4IADA 4FIGA 1H28A 5D1JA 5EHOA 5FQDC 3NUPA 4JBPA 4YBKA 1J7IA 3ZS5A 5BVOA 5KZIA 5H9BA 3ZH8A 1REJA 4GFOA 3TJCA 1U59A 4X21A 1OIYA 1H1PA 3O51A 3NLBA 2IPXA 2VTNA 2F2CB 1U5RA 3VUTA 2QKWB 2WMRA 2RIOA 1IR3A 4JQ8A 5AP7A 2WD1A 2V0DA 3COHA 4NK9A 3OEFX 4PDSA 4FKRA 4I1ZA 3DBCA 4BCGA 3V01A 4PX6A 3BE9A 2Y6MA 3MPAA 2J0MB 2X0GA 4PNIA 3D83A 3R9HA 4JBOA 5TT7A 3SKCA 4R8QA 4WNOA 1Y91A 1MRUA 3Q6UA 5A3XA 4XHKB 1JSTA 3QGYA 4RLKA 4U43A 2XIYA 2XF0A 4JL9A 2VTIA 1LEWA 2UW0A 5HIBA 4ZLYA 1DS5A 2BKZA 5F95A 4BTJA 5HVKA 4CRLA 1M14A 4U7ZA 3VF9A 1OIQA 5LVLA 3MFUA 2WU6A 3GC0A 3OW4A 5IQCA 4FKIA 4AZEA 4Z16A 1CDKA 5LWMA 3TXOA 2PMLX 5JRSA 2C6MA 3OTVA 3TIYA 3IECA 4FV3A 4LOQA 4ACMA 1OBGA 2X4ZA 3VQUA 4MXYA 3UG1A 5DA3A 4EH2A 4U79A 2RG6A 3C4ZA 2PE2A 2IVVA 2OZAB 3LFDA 4DCEA 3E8NA 4RX5A 5HNIX 5M44A 3VS0A 4EH3A 4GJ3A 4R5YA 2WELA 4FT0A 3COMA 3WZKA 3ZBFA 2ETKA 2A0CX 2OXXA 4IC8A 3BBWA 3D4QA 5C03A 4ZJVA 3VHEA 1XHAA 3TNWA 1JOWB 2REIA 1RW8A 4H1JA 4UB7A 5H8EA 3PG1A 3AC3A 4DN5A 1S9IA 4EJ7A 4HVGA 4C62A 3V3VA 1YXSA 3AQVA 4BVUA 2BRGA 4FIFA 2ZVAA 4B8MA 3DFAA 4F0GA 3DNDA 4RQVA 4GT3A 1Q41A 3F2AA 1B6CB 1QMZA 3C50A 2W06A 4G5PA 1FINA 4E1ZA 4ZSJA 2G2IA 4CTBA 4IANA 1B38A 5CU4A 2ZYBA 4JQ7A 4F6SA 4TPTA 4FT5A 2QOOA 3HDNA 3MN3A 2PULA 3DXQA 4YJPA 3E64A 2B1PA 3HX4A 4BIEA 1M2QA 3FMNA 1H07A 4PUZA 2EUFB 3E88A 4JDHA 3BQCA 3FMMA 5EDPA 2CNUA 2R9SA 4C4JA 3K5UA 1PXNA 1PYXA 2H34A 4ANBA 2C5NA 5IMEA 1OUKA 3HMNA 2QC6A 5JH6A 3VO3A 4KKEA 1M2RA 5HG9A 2G2HA 3SW7A 3UGCA 4WOVA 4CFNA 4MXCA 4CYJA 3S4QA 3GVUA 1OKWA 3BLRA 3KRRA 1UWJA 4M7IA 4J8MA 4XRLA 3TN8A 2IZRA 4N57A 5JEBA 3R9RA 5L8JA 2HIWA 4FV6A 4FEWA 4FSMA 4EH9A 4W8DA 5D9HA 2PZ5A 3A7IA 4L8MA 5AV2A 2J0JA 5HNGA 3NR9A 3OFMA 4F63A 4E4MA 3ZFYA 1J7LA 3RMFA 4CLIA 5AAEA 3R00A 4X3FC 3Q4UA 4I92A 2WNTA 3R28A 1YXTA 4DG3E 5JK3A 1DI9A 4MTAA 1BKXA 5C8MA 5M4CA 3UMWA 2WO6A 4YHFA 3S95A 4DFBA 3EQCA 2C1BA 2V22A 2WKMA 2UW7A 3UVRA 2PY3A 4YJUA 5DT4A 5FBNC 4FKTA 5AV4A 3ZC5A 3H0YA 2WTKB 3FQEA 3W8LA 3RM6A 4AX8A 4B4LA 3ZUVA 3I0OA 2UZOA 2JD5A 5LVNA 2JKQA 2PYWA 2XBAA 3C13A 2F4JA 2IG7A 3NIEA 4HVDA 4EOPA 2J6MA 1SVGA 3QRIA 5CX9A 2J51A 3R7YA 4Y85A 2XJ2A 4D1SA 3AC5A 3RZFA 4YUQA 4CZYB 4FYNA 4R1YA 3FQSA 3OCSA 1PJKA 2DWBA 5G6VA 4FIJA 4I6HA 3C51A 5AUWA 2G1TA 1KWPA 3EOCA 4BKZA 4GG5A 4RFMA 4QMXA 4FKQA 3VJNA 3GC8A 4ZTRA 4IZ5A 4IIRA 3WBLA 5L8LA 2VWWA 5HU9A 3MI9A 5L6WL 3ZHPC 3FI3A 4X7QA 2NO3A 3IW4A 3QWJA 4QOXA 3WI6A 5E8WA 4FTAA 4FSYA 3RPOA 4AACA 1YKRA 3GCUA 1PKDA 2WQNA 3F7WA 4U0IA 4WRSA 3ZC6A 4L45A 3E7VA 1UKHA 5AA8A 5A54A 1P2AA 5DEYA 5AV0A 5CSPA 5DHJA 4QT1A 4C38A 4F08A 4YJSA 4ZMFA 2ZMCA 2G9XA 3LFQA 4NKSA 5I4NA 4MVFA 2ZDUA 5J9ZA 2UZNA 5F1ZA 4C4HA 4TT7A 3EH9A 3HV5A 3KREA 2YM5A 4AOJA 1GIIA 2ZB1A 1NVRA 3DBEA 4UMTA 3UZPA 3A7FA 3AGMA 4QD6A 4BBMA 2CDZA 4RRVA 1HCLA 3ZRLA 2W4OA 3LLAA 2PK9A 4ITJA 3TG1A 2VWZA 3EN4A 3KXMA 3VWAA 2P33A 4FT9A 4RG0A 4FKLA 3HV6A 3A2CA 3MA6A 5HTBA 3ORZA 4J8NA 2JAVA 3UYSA 2VWUA 5E8UA 4CG9A 4Y46A 4X3JA 1HCKA 2VUWA 4QO9A 2OZAA 3MESA 4ACGA 3TDVA 3EWHA 4IVCA 5CSWA 5CSVA 4FTQA 2BRHA 3VS7A 4BGQA 4QMVA 5HE3A 5JMSA 3KFAA 5CXHA 2BPMA 3O50A 3DAJA 4HNFA 3HP5A 4C37A 4FSTA 4WKQA 3QD0A 4CXAA 4CFUA 3ZXZA 3H30A 3I5ZA 1GAGA 4KIKB 3GEQA 3U9NA 3MFTA 4FG9A 4L7SA 4IMYA 5M07A 5EM5A 3VS6A 5FXQA 4YHTA 2QG7A 3UOJA 2VTOA 4I22A 2J7TA 5HU3A 3OXZA 4CCBA 4BN1A 4BYIA 3N4UA 5EYCA 4AGDA 4FG8A 2HZ4A 1XH8A 3RVGA 4A4XA 2ETMA 5AM7A 5FDXA 4BCMA 4L53A 2C3KA 4O2PA 4CMOA 1OBDA 3SW4A 5FP5A 4DBXA 1BI7A 4GG7A 1OPLA 4FTMA 4BI2A 5JZJA 1XR1A 3D9VA 4EJNA 2Z7RA 3V6RA 3IS5A 3HUCA 4IX4A 1O6YA 2QR8A 5BMMA 4ZMEA 4WIHA 3BGZA 4MK0A 3RAIA 2OO8X 4YNOA 2QOQA 5HCZA 1KV1A 4LRKA 4RC2A 4A7CA 5AP6A 2W4JA 4QQ5A 3QYWA 4R3CA 2XNBA 3D7ZA 1UU3A 2VNYA 2Y6OA 3PWDA 2GNIA 4TTHB 2ETRA 3PVUA 2W7XA 2YIQA 3HAVA 3QKMA 2J0LA 3EZRA 3MY0A 1SYKA 4HPTE 4EKLA 2Z02A 3VUHA 4AZSA 4IX6A 5AA9A 3DTWA 3JYAA 3Q52A 4PNKA 2Z8CA 2HY0A 3FKOA 4F9YA 5DH3A 5KKRC 1I44A 5CVGA 3A8WA 5TF9A 3UQFA 4UMQA 4JI9A 2G2FA 2ZM4A 4O0SA 3KF7A 4KWPA 3WE4A 4FKSA 4RFYA 2XK9A 3QQUA 3K2LA 4C3RA 3TCPA 5AEPA 3ETAA 3F66A 4Z7GA 1YHVA 4BICA 3QYZA 4D28A 2A2AA 4YPDA 5AR5A 1PRYA 5E91A 2XJ1A 2BKKA 5IUHA 4LGGA 5C8KA 3TNHA 2BZKB 4BI1A 5HX8A 5K5XA 5FWKK 3P7BA 3GOPA 3KXZA 1XO2B 3GP0A 3Q5ZA 4FNWA 1AQ1A 1SZMA 2WTIA 4XH6A 4R7BA 3SG8A 5HBJA 3IKAA 2YDKA 3QRTA 5LMBA 1TKIA 4G3EA 5HG5A 5EM6A 4YJVA 4PRJA 3D94A 2XM9A 4U3ZA 1WZYA 4X3FA 3JPVA 2C6KA 5IDNA 4EK8A 5AUTA 1XH5A 5DT3A 4WBBB 4HPUE 2QR7A 4DH7A 2X6EA 5IQHA 3TWJA 4OTWA 5FLFA 4AZTA 4B8LA 4ASEA 3BCEA 1XH9A 3ODZX 5D11A 3OF0A 3W2RA 4F09A 1ZMUA 4U40A 3MH1A 4QMWA 1PY5A 2B9HA 4GEOA 3LXKA 2WU7A 4AE6A 4U44A 1XWSA 3ZTXA 2XYNA 3ZXTA 5IMXA 2W9FB 1H08A 5E8ZA 3PVGA 4L7FA 4CMTA 3Q60A 4KRCA 5M4UA 2AC5A 3SXSA 2CKPA 4QP1A 3IO7A 4IM0A 4QMQA 4FK3A 5HO8A 3BHTA 4UMRA 3DZQA 4D2WA 3CD8A 3PE2A 5ANEA 4RZWA 2JIIA 4FV7A 5EK7A 2VRXA 3NYNA 2B52A 5JFXA 2YM6A 4EUTA 4XNEA 4GVAA 5CAQA 1SNUA 3R9OA 4XP0A 4FKJA 4JNWA 1APME 1ZRZA 3VJOA 1PMNA 4BBEA 2EXMA 2Z2WA 4JLCA 4UXLA 3A61A 1DAWA 1Q24A 2A1AB 3LCSA 4OW8A 3KXXA 4AT3A 3RCJA 4EBWA 1QCFA 2PVYA 3W16A 4AGUA 1PXLA 3K54A 3O0GA 3DTCA 3NZ0A 4QP2A 4DGLC 4ZTLA 5ANKA 4GIHA 4HJOA 4MWHA 4EEVA 3C9WA 3FKNA 4G16A 2BZIB 2VN9A 4MF1A 3V5JA 4O1PA 2ZOQA 4NKAA 3H4JA 5DR2A 4V05A 3BEGA 5J9LA 1JLUE 1ZXEA 4O21A 3ZU7A 2X7FA 2ZV9A 3T9IA 4C3FA 4ZXTA 5J1WA 3FXWA 4FVRA 4EHZA 2YM8A 1YOMA 1JNKA 3PE1A 4UBAA 3T8OA 3CEKA 5IDPA 5L6PA 2WMSA 4O38A 4QMNA 2FUMA 4FL3A 3NPCA 3L8XA 4H05A 1IG1A 3NDMA 3Q6WA 4AZFA 3PFQA 2FO0A 3FI4A 5CU2A 4IJ9A 4CV8A 3DU8A 1PHKA 4QMLA 1F3MC 4EQMA 1X8BA 4YLLA 2VTSA 3FSKA 5IKWA 5A4TA 4O0VA 2JFMA 3OUNB 3FY2A 4LOOA 3RK7A 3KKVA 3LFEA 2OH4A 4ZSEA 4YJNA 4I5PA 3RWPA 4H3BA 3WF6A 2WPAA 4RX9A 3COIA 3MTLA 4G5JA 4XG7A 4FV5A 5ANIA 3R7EA 3PY1A 4FG7A 2PVKA 4IWDA 3P4KA 3RPSA 2J4ZA 3RM7A 4O91A 4NT4A 3DBFA 3KEXA 4FVQA 2KULA 4AW5A 4AT4A 2VGOA 3Q9YA 5K5NA 3A4OX 1V0BA 3JY9A 5CEKA 4USEA 4I6FA 4ZLOA 1A06A 3FLWA 3N4TA 3KN6A 3E62A 4H3QA 2Y0AA 2QD9A 4J96A 4YBJA 1UKIA 5FM2A 1OZ1A 3JUHA 4FTTA 5FXSA 5H8BA 4AOIA 4F7JA 2WB8A 2BILB 4LFIA 3SDJA 4DEDA 2UZBA 3ULZA 4TWOA 5M08A 4EH7A 2WQOA 3EQPA 4RJ6A 3UC3A 3PJ3A 5BMSA 4RMZA 4IAYA 3FZPA 4GW8A 1REKA 2OBJA 1SMHA 1AGWA 3PXYA 3GGFA 2VO7A 4LV5A 3Q9XA 3EQRA 4JXFA 5GZ9A 5KHWA 2QKRA 4BZOA 4C02A 5ETFA 3EYHA 2W5HA 4EOOA 4E6QA 2CMWA 1FGKA 2UVYA 3GFWA 3MIAA 5AP4A 2C5VA 4AOTA 3IDBA 4V04A 3AC2A 3LFNA 4QMZA 3WOWA 4CZTA 4BWPA 4M69B 5D41A 5L3AA 4JJRA 5EW9A 3HV7A 4WSYA 3FLNC 1FPUA 3CQUA 3WIKA 5BVDA 5FP6A 2PVLA 3P23A 2VX1A 3OCTA 4GUEA 3U8WA 5B2LA 2ERKA 3GC7A 4Q2AA 5E8YA 3C4EA 1KE7A 4BCOA 2XBJA 4IDVA 3I7BA 1KSWA 3LFSA 3ZLSA 4I4EA 4O6EA 1KE9A 4DG0E 3V8WA 4LL5A 3Q4ZA 3DBDA 2BRNA 2XIRA 4FT3A 2WEIA 4D2RA 5HD7A 4U3YA 3QCXA 4M13A 4APCA 2PE0A 3IW6A 3NNVA 4J95A 4RIYB 4R77A 2YDIA 3A60A 3TV4A 3K5VA 5I9ZA 5K0XA 4DT9A 2C6LA 3HVCA 4KIPA 4RZVA 3MY1A 3TUDA 4DT8A 5LMAA 4Y72A 3OP5A 2XKEA 3C4CA 2R5TA 3C4XA 3HECA 4D0XA 4BYJA 1ZYLA 5AIRA 4HZRA 4I94A 2RSVA 5BVEA 4JDKA 5A4QA 5CWZA 3UOKA 1JKSA 3SLSA 5L2TA 2I7QA 5A46A 3PG3A 3B8QA 3OS3A 2EB3A 4XP2A 3CD3A 5EW3A 3CSVA 5IZFA 3LCTA 2ONLC 3Q9ZA 4XYFA 3F3TA 2JFLA 1W8CA 5HESA 1JKLA 3R2BA 2EB2A 1Z5MA 4L46A 4I5MA 3E8EA 5CF8A 3NS9A 3HA8A 2W1IA 5IQEA 1ZWSA 4F1OA 3AC8A 2IVSA 3FYJX 4WRGA 5AFVA 5GIOE 1XJDA 5EW8A 4EL9A 4X0MA 3COKA 3FJQE 4YZNA 3SRVB 4R7IA 1P4FA 4FTOA 2OJIA 2WTWA 3H3CA 2PZYA 2YCQA 3L9MA 4RIWA 4U80A 4ZJIA 3NNXA 4AF3A 3IONA 4W4VA 5L2SA 3RCDA 3H9RA 3KCKA 4IFGA 3IW5A 1F0QA 4L01A 5T68A 1U5QA 3EN6A 2PUIA 4JR3A 3SG9A 2QOFA 2H8HA 2XVDA 3G9NA 2DYLA 1Q5KA 4FKVA 4HYIA 2PZRA 2J90A 2UUEA 4V0GA 2B54A 4OGRA 4WT6A 2HELA 2ITXA 5DR6A 3ID6C 3E3PA 4NJDA 3AG9A 3U9CA 2FSLX 4CFFA 3F5UA 4EZ3A 1WBVA 4A9UA 4BRXA 5HX6A 1K2PA 4PF4A 5EG3A 3WF5A 3M1SA 4B0GA 3QGWA 4EH4A 1QL6A 4YTIA 2PU8A 2BDWA 4L00A 4R78A 2XRWA 1FVTA 4L42A 1S9JA 1Y8YA 3QUDA 4MNEA 5AAFA 4G2FA 2R3QA 5FDPA 4QYEA 4ZLZA 2J50A 2NP8A 4IWOA 2ZJWA 1ND4A 2NRUA 3OOGA 2YIYA 4IJPA 4JX3A 2WTCA 5E1EA 1ZZ2A 5EOBA 3QHWA 4B9DA 5AUVA 4DITA 4KNBA 4L6QA 3UBDA 2GSFA 2PVNA 3UZRA 2OW3A 4RJ4A 4O22A 4DH8A 4EOIA 4U9AA 2C6IA 2KTYA 1KE6A 5AX9A 5EQYA 4BDIA 3O17A 5T3QA 4BDCA 3NUXA 2Y9QA 3UYTA 1IA9A 2CLXA 2FSOX 1AD5A 3ORNA 5KMKA 3CPCA 3ACJA 3F5PA 4PMSA 2GPHA 3G0EA 3LMGA 5LARA 1M7NA 4MH7A 2PVRA 1YHSA 2Y7JA 3WZJA 4C4FA 3QFVA 2C0IA 3ZMMA 5I9WA 4EZ7A 1ATPE 4G6LA 3TDWA 1NXKA 2XNPA 1H25A 3TM0A 3NCGA 3C0IA 3UODA 1PXIA 1UWHA 2BZJA 4RC4A 1GIJA 3RPVA 5KMLA 3LCKA 3KA0A 3R1QA 4KBAA 3ZSHA 1KE5A 2OJJA 3BYUA 4GUBA 5J1VA 3EQFA 4WUAA 1Y6BA 3HV4A 4M14A 2XUUA 2H96A 5G1XA 3RZBA 2XRUA 4EWHA 4C3PA 3CE3A 4YP8A 3LVPA 4F0IA 4OTFA 3SC1A 2QLUA 2G01A 4F64A 5BX0A 5GZAA 2VO3A 4UV0A 5HBEA 3MW1A 5E8XA 5HZNA 3IDPA 4UMUA 4GSBA 5AV1A 3JVSA 2XK6A 3LFFA 3ROCA 5GIPE 5CVFA 4FYOA 3V8SA 4EOMA 4NZWB 5L2IA 4UN0C 1NA7A 3PP0A 4JX7A 3NUNA 4B7TA 2HXQA 4NSTA 4B6LA 2BZHB 3OY3A 4O2ZA 3GCSA 3SOAA 2C5OA 4EBVA 2VO0A 4D5HA 5H3QA 2FH9A 1H1QA 5LCKA 1XH7A 3TZ7A 4FEUA 2BDFA 4I24A 1SVHA 5ANJA 4BZNA 5J5SA 3EN5A 4FTRA 3WYXA 5CU0A 3FI8A 4PPCA 4BR3A 2UW5A 3GNIB 5EFQA 5DRDA 3FMKA 1ZYCA 1IEPA 4KB8A 3CGFA 4KBCA 5HD4A 5K4IA 3QD2B 3NW5A 5LVPA 3NUAA 3UVQA 4ANOA 1W84A 4IX5A 4BKYA 3ATSA 4LUEA 2BCJA 3FBVA 3KVXA 4ACHA 4O7NA 2QCSA 4HGTA 3MVLA 2ZDTA 4USFA 4DE4A 3DCVA 3FZOA 5BUIA 3KK8A 3R7UA 2NPQA 3W2SA 1WBSA 2W99B 3LFBA 4FIIA 5DWRA 4D9TA 5IH5A 1UNHA 4UZHA 4BB4A 1EH4A 4LMUA 3AD5A 5FRIA 4O84A 2YIWA 3G2FA 3KRLA 4RIYA 4TKSA 1PXPA 3DZOA 4X2NA 5B2KA 4AT5A 5IEVA 4XCUA 2WMUA 2IN6A 2OIDA 5ETIA 4GK4A 4F6WA 4YNEA 4W9XA 4D58A 5BPYA 3D5UA 3SA0A 3PXFA 3MV5A 4QTEA 3BWJA 4IAZA 3HRCA 4MQ1A 4LGHA 3FC2A 3C7QA 3PIZA 3LXLA 4L43A 3O7LB 1WMKA 4BDEA 4EH6A 1Q99A 3OVVA 4QPMA 1XQZA 5JFVA 5DPVA 4FNZA 1Q61A 2XNNA 3RPYA 1H1RA 4D5KA 1PXKA 5AP1A 2CN8A 4QQTA 4PTGA 3VBVA 3BHYA 3R30A 3D5XA 3NUYA 1GOLA 3DPKA 3ZUTA 5FM3A 2YISA 3T9TA 5FUTA 3MB7A 3EKKA 4MHAA 2IWIA 4DTBA 2J9MA 3F2NA 4FOBA 4JG6A 3LAUA 4M69A 3OCBA 3DAEA 2CGUA 3KMWA 3BELA 2QONA 1KOBA 3CTJA 3QBNA 4QP3A 3QX4A 4RIXB 2QO9A 1F5QA 4AZWA 2PMIA 3N4VA 5ACBC 4DCAA 4AZVA 1ZYJA 4JBQA 3W8QA 2XJ0A 1YWVA 3MS9A 4LGDA 4E6CA 1OL6A 3R8LA 2BHEA 2IZTA 5AR4A 2WQBA 2PMOX 4CLJA 4O83A 4DFUA 5L8KA 3LHJA 3QCQA 4PDPA 3LZBA 4Z7HA 4XJ0A 4O0UA 3HKOA 3KCFA 4KA3A 4O7TA 1GZNA 4R1VA 4FV8A 5IA5A 5J7BA 4QP7A 2XIXA 3PRIA 5FD2A 2BIYA 3GCVA 4UALA 3L8VA 4HCUA 4G3FA 1GZ8A 4L3PA 5AIKA 4ZTHA 4TN6A 4WNPA 4LM5A 3WARA 1OL5A 2F7XE 4X2KA 5KBQA 1RDQE 2FGIA 3FYKX 2XK7A 2HXLA 3AD6A 4V0GB 5JQ8A 4NU1A 1R0EA 4X2JA 3D7TB 3NWWA 4ZS0A 5TR6A 1LR4A 4F1MA 3BPRA 3LJ0A 3MFSA 4FIEA 4ZZMA 2WIPA 2Y4IB 3AMYA 4RGJA 2RFNA 4WSQA 3QALE 4ZY6A 1PXJA 3VUIA 5HI2A 2P0CA 5IF1A 2BAKA 4BY9E 2UW9A 1OUYA 3DDQA 4LYNA 4QTAA 2W9ZB 2YM7A 5E4HA 3L9PA 4GT5A 3TKUA 4PL4A 3PY0A 5E1SA 2WMVA 4L67A 4JR7A 2R3GA 3CR0A 3NUUA 3PWYA 5HE2A 2ITQA 5LXMA 4XG2A 3CTQA 2OWBA 5JSMA 3RINA 3V5TA 3B8RA 5JZNA 3BLQA 1T46A 3O23A 4Y73A 3R8PA 4FTKA 4G31A 5F4NA 4TNDA 2GS6A 4RLLA 2Z7QA 2OIBA 2WQEA 1M2PA 4O0TA 2HCKA 2PE1A 1MRVA 2HK5A 3EFLA 3U51A 4IZYA 5DEWA 3CQWA 4AA4A 4DC2A 4F9WA 3W2QA 2UVZA 3ZOSA 2X2KA 2BMCA 1ZZLA 2HAKA 3R2YA 4FSWA 2OG8A 4M8TA 4X6QC 2HWOA 4OTQA 1GNGA 3R83A 2P2IA 3BX5A 4YZBA 4ANLA 5BVNA 4PL3A 5DNRA 2XNEA 3RAHA 1V0PA 3FLYA 4R5SA 4TW9A 2YABA 4BDHA 5GJFA 2IVTA 5FTQA 3PPJA 2UZLA 5HHWA 3EQBA 3FLZA 4IAAA 2NRYA 3DK7A 4GJ2A
chains in the Genus database with same CATH superfamily
5EM8A 4BDKA 1KV2A 2UZUE 3KB7A 4FSZA 2DQ7X 2F7ZE 1W83A 4NW6A 1QPJA 2FB8A 1XH6A 4IAIA 4ZTQA 4H36A 4S31A 2YLEA 3LQ5A 4A4LA 4M66A 3FSFA 4TY1A 3PP1A 5EYDA 2WMWA 4CZUA 2WMTA 3GU7A 4WG3A 4KSPA 4OUCA 2ZAZA 4L9IA 2YCSA 4DFNA 1U54B 1WBPA 1WVXA 1H24A 2R4BA 2WHBA 3KK9A 4LQMA 4ITIA 4TWNA 4W9WA 2XS0A 4IC7A 3BHHA 4MKCA 5AX3A 4ACDA 4XBUA 4MF0A 4I5CA 4QTCA 2EXCX 1H01A 4F70A 3OWLA 1Q8WA 1KOAA 2VWIA 2H9VA 3DQWA 3Q4TA 5IA4A 3QL8A 2WIHA 3IGOA 1OM1A 1NVSA 2F7EE 5IQFA 3DXNA 3DS6A 3W2OA 1NY3A 5CENA 3RTPA 1OIRA 2XKCA 4FKUA 4O82A 1JVPP 4M0YA 2FA2A 4FUXA 3ZFXA 4MD9E 5C8NA 2QURA 3ZO1A 3QRUA 1Q8YA 4F9CA 1URCA 4AA0A 3V8TA 2R3NA 2YM3A 5CT0A 3DJ5A 3MSSA 1BUHA 5EHYA 3FQHA 4C58A 3UVPA 3ZO4A 3RHXA 3UIUA 3MWUA 4FL2A 3BYVA 4FSRA 2Q0NA 4G1WA 2QOHA 1L3RE 5KMOA 3FL4A 5JGDA 3LQ3A 1FQ1B 2OH0E 3BBTB 3KULB 5CTPA 4DH5A 4LOPA 2XCKA 2J5EA 4FSQA 4ZSAA 2VTAA 5J87A 5BYZA 4FEVA 1YW2A 3PIYA 5HE0A 4K2RA 3NSZA 4L44A 3TJDA 3CJGA 2IW8A 4QPSA 4DFYA 5JRQA 4KIQA 5GZ8A 2VTJA 4D2TA 2VD5A 2YCFA 4IEBA 3QLGA 5F94A 4IB3A 3ORPA 4IH8A 5D12A 1GZOA 4U6RA 4QMOA 3VULA 5BV3A 2VTQA 3ORMA 3GCPA 2IW9A 1R0PA 1Q3DA 1UVRA 2X8IA 5CAVA 5F9EA 4R7HA 2PVMA 3D15A 3ORKA 3QQGA 4J99A 4Y5HA 5BVWA 5ACKA 2BIKB 2VV9A 4FI1A 4XOYA 3V6SA 4IAKA 3ZRMA 4Z3VA 1WBOA 5B2MA 2E9UA 3CKWA 5D7AA 5FG8A 2EWAA 3RGFA 5FTGA 4YSJA 2CN5A 1YI4A 4ZSGA 4KAOA 4XG6A 5J95A 1JKTA 5FEDA 4F0FA 3QUEA 4BZDA 4UX9A 4AQKA 4K9YA 3D2IA 4I0TA 2HZ0A 1VR2A 3KRXA 4GCJA 3AC1A 4HYSA 2C69A 4I5HA 2XKDA 2OXDA 2WFYA 1G3NA 1YOLA 4G17A 3TIZA 2R3RA 4YJRA 4K8AA 4BBFA 4AW2A 4C4GA 4K33A 4F1TA 4WG5A 3M2WA 3UIMA 4E4XA 3ZDUA 3E87A 5CF5A 4P2KA 5KHXA 2JDRA 2OF4A 4IW0A 5M55A 4TYJA 2R3HA 5AR3A 3GC9A 3PSBA 4EUUA 1MP8A 4CFWA 5LVOA 3JY0A 2YZLA 2W1DA 2ZV8A 4HVIA 2OZOA 4NFMA 4ZAUA 3MTFA 2GMXA 3VN9A 2GQRA 3F3ZA 4FV2A 4C4EA 2IO6A 3LIJA 3PA4A 4KRDA 5J79A 3BGPA 2UW8A 3ENMA 3FZ1A 3LXNA 3MY5A 4O7LA 1VYWA 2QU6A 3P7CA 3HA6A 2W17A 2CJMA 3FV8A 1FVRA 1OL1A 3HMMA 4K6ZA 4RVLA 3CS9A 3VRZA 4EORA 1J1CA 3CY3A 4XV2A 3ZZEA 4DFXE 4TL0A 3D7TA 4W4WA 3NFFB 3R21A 4QMYA 4O0YA 5IQDA 5BQ0A 3F2RA 4YO6A 4MXOA 1BX6A 5DYJA 3AMAA 2R64A 3VBXA 5EI8A 2ERZE 1H4LA 4FZDB 3C1XA 1ZOHA 4LUDA 2VWYA 5EHLA 5HG7A 3U54A 2RFEA 3OXTA 3BYSA 2WEVA 1ZYDA 3IW7A 4L3LA 4AFJA 5CF4A 3SXFA 3VW6A 2YDJA 3QU0A 4Y5QA 2JKOA 4EOLA 4AFEA 4O96A 4RBLA 5CT7A 5I3RA 5KBRA 2VO6A 4QP6A 4GK2A 4YU2A 4EK4A 2WOTA 1JPAA 5HICA 5TKDA 3PA5A 2CKEA 3FKLA 3OUKA 4G6NA 3QX2A 4KS7A 4RJ8A 3BHUA 4HCTA 4CV9A 3ZLWA 2GFCA 5I9XA 4TWPA 5CNOA 4MD8E 5EKOA 5FXRA 4D0WA 4O7SA 4N0SA 4O7ZA 4FTIA 4J71A 5AUUA 1YXVA 4II5A 4J53A 2E9NA 5AUZA 5DN3A 4WUNA 2C4GA 3UNKA 4PTEA 1W0XC 4AE9A 3RPRA 5BYLA 4D4RA 3ORXA 3C5UA 2JIVA 4FZAB 4HCVA 2GQGA 2PVHA 4XV9A 1IAJA 4IB0A 2ITWA 4CQEA 4R3PA 4JIAA 5FEEA 5BUJA 3LKMA 3UQCA 4PPAA 3FZRA 1W2FA 5DE2A 2RGPA 3NUSA 4BI0A 2QLQA 3FHRA 4W8EA 1T45A 1U54A 1YWRA 3PA3A 4FV0A 3S3IA 3Q53A 4C61A 4IWQA 3TZMA 2X39A 3AMBA 4CMUA 4ORKA 4I21A 3ZEWA 4BF2A 1W2CA 3IPHA 3DJ7A 4CNHA 1SVEA 4M84A 5CEIA 3QTIA 2J5FA 2PUNA 4DEHA 1OPJA 3Q5IA 3UO4A 4ACCA 4EHEA 5EQEA 1B39A 5EOLA 4AW1A 3EHAA 3FE3A 3TNIA 4NCTC 2PUUA 3C4WA 2BROA 3VVHA 2DS1A 1WBWA 2PUPA 4F99A 3BV2A 3FXXA 1WAKA 3RJCA 3SD0A 5C26A 4GT4A 4BC6A 4WD5A 4XG3A 1KUTA 2EXEA 5IA1A 4WHZA 2OIQA 3RALA 4ZZNA 3W0PA 2ONLA 3ZRKA 4BFMA 2X4FA 4RJ3A 2ZM3A 3EJ1A 3GU6A 4BIBA 5HLWA 5LJJA 1QPDA 2OI4X 3DT1A 3VS4A 2W96B 3KULA 1GZKA 3D14A 2JDOA 4Q9SA 4RVMA 5I3OA 5TE0A 5CEOA 1PMVA 5KCVA 5IA2A 3CXWA 3DGKA 4ERKA 3K3IA 3KRWA 4NIFB 5C01A 4G9CA 3R63A 5AJQA 5KMMA 1G8SA 3RP9A 2QU5A 3HEGA 4LV7A 3U55A 3RAWA 1JKKA 3D5WA 3KMMA 2GNLA 2VTTA 4FZ6A 5CYIA 5F20A 5HTIA 5JKGA 1ZOEA 4TXCA 4CKRA 2XK3A 3I60A 4QYYA 4YZ9A 5AM6A 2LAVA 4TZRA 3TEIA 5CI6A 2GHMA 4JBVA 3R1NA 3R71A 3G90X 4DA5A 2UW6A 4NTTA 5DBXA 2QQ7A 5EYMA 2WMAA 5ANDA 3PLSA 1QPEA 5HG8A 4TYHB 3R02A 3QD3A 3JVRA 3W1FA 2CKOA 2H6DA 4QMSA 4BCNA 4EK3A 1RJBA 4GFMA 5FTOA 2XH5A 4FE2A 4GYGA 4IZAA 3SXRA 2WOUA 4EC8A 3LW0A 1P4OA 3KXGA 3OWKA 2OJFE 4NFNA 1XBAA 3ORLA 3GQIA 2JC6A 3OZ6A 1ZOGA 3A7JA 3FLSA 5IQIA 3V5QA 5DRBA 3A62A 2YFXA 4I23A 4XMOA 2QI8A 4FK6A 5HOAA 3UP7A 4O7VA 3IDCA 5K0KA 3LCOA 4PWNA 1JBPE 4ENYA 4BTMA 3LMHA 2HYYA 2X0QA 2HZIA 4FKPA 4ONAA 1OMWA 2ZMDA 4PTCA 4XG8A 3M11A 4BWKA 4I6BA 2UZEA 2C6DA 1PYEA 4BDAA 2HY81 4HVHA 3ZO3A 5AUYA 1PW2A 5IH4A 3P08A 5HIDA 4FV4A 1UV5A 2V62A 2JBPA 3PSDA 4CEGA 4EZ5A 5C4LA 4WNMA 1CM8A 4ZP5A 2X81A 1Q8UA 3EL7A 3HNGA 4QMMA 2W4KA 5E90A 2J2IB 5HLNA 4XG4A 3A99A 1GY3A 3PVWA 4NL0A 4DGMA 1M7QA 3PZEA 4RA5A 1OKYA 2PZIA 2XIKA 2ITYA 3POOA 2F9GA 4FV1A 4RFZA 4BCFA 4E93A 5JGBA 1Y6AA 4YLJA 3ODYX 3M42A 2JLDA 2OK1A 2R3JA 4XX9A 3KN5A 2IJMA 4P5ZA 3QZFA 4QYFA 3UC4A 4LI5A 2R3FA 3PRFA 2V7OA 3R7GA 5A4CA 3GU5A 3IOKA 4WO5A 2RFDA 5FGKA 2B9JA 2XNGA 3JS2A 4FZFB 4EC9A 2GTNA 1PF8A 4FSUA 3VS2A 2A4LA 3DV3A 4F4PA 2SRCA 3EL8A 2YJSA 3HLLA 4LV8A 4ZK5A 3BLHA 3CC6A 5IPJA 2R7IA 1TZDA 2WMQA 4EI4A 2WTJA 2XK8A 3TV7A 2GDOA 2W5AA 4YGAA 3QUPA 4LRMA 5DG5A 4M3QA 3VAPA 1STCE 3R9NA 4M15A 3ROYA 2I6LA 3NEWA 4DINA 4QDEA 1W7HA 4RIWB 3A4PA 1CKIA 1J3HA 2O3PA 4OT5A 4RWJA 3DA6A 2XNOA 3GI3A 4FKWA 3MDYA 4XRJA 2YACA 3RKBA 1G8AA 2AUHA 3UNZA 3Q2JA 2BVAA 4GV1A 4DEEA 1XMLA 5M09A 2BTRA 3QRKA 4RIOA 5E92A 4OTPA 3W2PA 4H39A 4FNXA 3DB6A 4CT2A 2GNJA 2IZSA 5A6OA 4U5JA 2C47A 4FT7A 2YJRA 1YVJA 2EVAA 1CTPE 3F61A 4I20A 4C2VA 3HDMA 3MH3A 4UWYA 4ANNA 4HGEA 3NNWA 3SOCA 4ANSA 4E4LA 5M4IA 2B0QA 1OKZA 3HMPA 3TT0A 1Z9XA 1R39A 5C1QB 5KMNA 2J0IA 1H27A 4S30A 3GU8A 2B9IA 3AT3A 3MVMA 4Q9ZA 3LMIA 5D7VA 1R1WA 4G3GA 3QLFA 2JGZA 4DH3A 4L68A 3FMHA 3LOKA 4ALWA 4C57A 1SNXA 3LM5A 3FMDA 3VS3A 2YITA 3FHIA 3HRBA 4A06A 3ITZA 2VTHA 2X9EA 5L2QA 4FR4A 1MQ4A 4CFXA 5KO1A 4MYGA 1A9UA 5AP3A 4MXXA 4DGNA 4TRLA 2OF2A 3QQKA 4HYHA 4CGAA 2I0VA 3WF8A 3G15A 3BE2A 4IE9A 5AP2A 3DLSA 3VBWA 5CU3A 5EQPA 4K1BA 4PDYA 2UZTA 3W18A 3P86A 3MPTA 4RWKA 2E9PA 3QKLA 4XOZA 3ZBXA 4EOJA 4I6QA 3OXIA 4YZMA 4BDDA 5CALA 4Y95A 2Y4IC 3EIDA 4KIKA 5LVMA 3PUPA 3KVWA 4U41A 1UNLA 2ZM1A 4N6ZA 5BUEA 5M06A 4MX9A 1IAHA 3AT2A 3DKOA 3IGGA 4D2VA 4R3RA 3MPMA 4FBXA 1OGYA 4DLIA 2VGPA 2NYAA 2UZWE 4F7SA 4OTGA 4FICA 3PXZA 3QAME 3R6XA 2YA9A 5AMNA 4DYMA 1CMKE 3R0TA 1Q4LA 2QHNA 3QCYA 4IDTA 4JG7A 3PJ1A 2C68A 3QC4A 5EI6A 4MBJA 2X7OA 5CSHA 2CGWA 5KNJA 4XLIA 5LMKA 4PPBA 4ENXA 4O4FA 3R8ZA 3FDNA 4RX8A 3BU3A 3OWPA 5CLPA 3H9OA 4D4SA 2CCHA 1E1XA 4KABA 5A9UA 3V51A 4O4EA 5CEPA 3MVJA 3O8PA 1YDTE 2PZPA 1H1SA 1RQQA 5FEQA 3E3BX 2VX0A 4UXQA 3MH0A 5ANGA 3UDBA 4YURA 4NM5A 4TYHA 4U42A 4AU8A 5A4EA 4TYIA 4XV3A 2BALA 4O7YA 2FVDA 2F49A 5LCJA 3QQLA 1UNGA 1PKGA 1R3CA 1BL7A 3E92A 3E7OA 2C6TA 3IW8A 3LFCA 4CCUA 5I9VA 1O6LA 3ORTA 2YWPA 4HOKA 4TWCA 4ANQA 2BUJA 4K18A 4C36A 2F2UA 4UYAA 3WZEA 3PPZA 3W55A 1WBTA 1BLXA 3ZLYA 4D1XA 5JQ5A 2GQSA 3EKNA 2WTVA 3THBA 3TTJA 2VWXA 5CASA 3H10A 4JQEA 5BVFA 1FMKA 1GIHA 4EYMA 4YTFA 3S2PA 3ALOA 3R7OA 2IVUA 3F5XA 2ITOA 3GCQA 3UG2A 3EN7A 3MIYA 4G34A 2W05A 1TQIA 4C34A 5AADA 4AXCA 1PMUA 3QQFA 2R3LA 3NNUA 5HQ0A 1MQBA 4QDVA 3R22A 2I40A 1CSNA 1ZARA 4EH5A 4RVTA 3QCSA 3E8DA 4YC8A 3QA0A 4J97A 4IQ6A 4X3FB 5CU6A 2CPKE 2C1AA 2W0JA 1JWHA 3HP2A 4E26A 3UPXA 3IG7A 3NYVA 4F9BA 4DDIA 5E8SA 4MAOA 4LMNA 2PMNX 3BHVA 3KL8A 4XV1A 3CCNA 5M4FA 3S0OA 4EK5A 4MBIA 3Q96A 4OTRA 3KXHA 3EB0A 3VS1A 4W4XA 3DJ6A 4FV9A 3MBLA 4DLJA 4F65A 4AN9A 3DKCA 3G6HA 3R01A 4ZJJA 2CNQA 3CKXA 2OJ9A 2GU8A 3FL5A 4UWBA 4O7RA 3L8PA 3PDTA 3E63A 5EYKA 4AXAA 2XEZA 2YCRA 5T6KA 3U6HA 4IACA 4K0YA 2P2HA 5I9YA 4E6DA 3OCGA 5JT2A 3SAYA 3PSCA 2VWVA 3UE4A 2AEGA 1BL6A 3R8UA 5HBHA 2GNHA 4DEIA 4LL0A 3R1YA 3UQGA 4QTDA 5HE1A 3OOMA 2RFSA 5LMKC 1G5SA 1JQHA 2XM8A 3NAYA 2WTKC 3OEZA 4FTJA 4G9RA 4AWIA 4BCHA 4EWQA 4PP9A 3RNIA 1IASA 3DAKA 3ULIA 4DGOA 4CRSA 3CP9A 3I0QA 4RA4A 4E5WA 4S32A 4D1ZA 2WXVA 4MCVA 2XK4A 3G6GA 3VUMA 2ZV7A 4EOKA 4O86A 3F3WA 3KF4A 1FBNA 3BI6A 4APPA 4ID7A 3H9FA 3I7CA 1H26A 3OWJA 2WGJA 3R9DA 3IK3A 3HZTA 4X6RA 3OY1A 1OGUA 4M0ZA 5HORA 3P5KA 4PMTA 3U6IA 2IEWA 2R2PA 3F6XA 2O5KA 3F69A 5HNBA 4ZOGA 1TQPA 3KGAA 3FXZA 1ZY4A 2BRBA 4H1MA 1XH4A 2WAJA 5M51A 3MFRA 3UO6A 4JDIA 4KD1A 5CEMA 4BHZA 5IU2A 2ITNA 4A9RA 5CS6A 3GB2A 5DR9A 2YWVA 2R3MA 4MXZA 4Y83A 1J91A 1IRKA 4KKHA 3BWFA 4NW5A 3CQEA 4GKIA 3EN9A 2ZV2A 2JDSA 4RX7A 3I6UA 2G15A 2W1CA 3NW6A 5E9EA 4CTCA 4G3DA 4GMYA 3QRJA 4DEBA 4JMQA 4BL1A 1P5EA 1Q97A 3W33A 4GH2A 1YQJA 4PY1A 4NIFA 5CANA 3QXPA 4DGGA 3QQJA 4AGCA 2DUVA 1G8JA 4UEUA 4PQNA 3GBZA 3VRYA 2YIXA 4DAWA 2JKMA 3H0ZA 4FKGA 2BDJA 3BQRA 3I79A 4YC3A 4QYHA 3W10A 4MNFA 5K4JA 5GJGA 3MVHA 4RQKA 4U81A 2ITPA 2OKRA 5A14A 5IA0A 3HV3A 2HENA 4IFCA 1ERKA 4NWMA 3POZA 2O2UA 4YTCA 3U87A 3PPKA 3UIBA 5CSXA 5E8TA 3WIGA 3O7LD 5H2UA 3U4WA 1NT2A 2CGVA 3QA8A 3EQDA 5J8IA 3G9LX 5L6OA 3L9LA 3MB6A 4V01A 5K3YA 4NM7A 4E6AA 4RIXA 3ET7A 4IBMA 2W1EA 1MUOA 2QHMA 4BCIA 4FMQA 5CQWA 4BDJA 3OG7A 4K77A 1O6KA 4FVPA 4OTIA 2GHGA 2R3KA 4GU9A 1LPUA 1DM2A 2O63A 3R8MA 3B2TA 1K3AA 1UU9A 2RF9A 4FTNA 4FUYA 4J52A 5IH6A 4QMTA 1MRYA 2PWLA 3RNYA 2GNGA 5C4KA 1VZOA 2QOIA 1YRPA 5GNKA 4ZTSA 4A9SA 3LXPA 2PTKA 3MH2A 3V5LA 4CFVA 2RL5A 2O64A 4CKIA 3LJ1A 3FMEA 3PJCA 4L52A 3WILA 1J7UA 2E2BA 3JXWA 1BMKA 2VTLA 3PVBA 3ZO2A 1ZAOA 3TTIA 4QNYA 4MD7E 3ZSGA 2VTMA 3NX8A 4JAIA 1ZY5A 4CSVA 5CY3A 4FSNA 3AD4A 4EK6A 3FPQA 4OR5A 3HMOA 3DBQA 4GFGA 1OKVA 5AAGA 3DKFA 4YJQA 4AQCA 5KUPA 2PVFA 4BCJA 3I1AA 4YC6A 3D5VA 4FOCA 3KMUA 3G33A 3A8XA 4YZDA 2Q83A 2XP2A 5LQFA 4FKOA 4O6LA 1YXXA 4RWLA 2Z60A 1M17A 4W4YA 5CZIA 5I9UA 2R3OA 3OMVA 3RWQA 3PY3A 4AN3A 3QKKA 4GIIA 3T3UA 4ZTMA 3L9NA 4UYNA 2VU3A 5GJDA 4KBKA 3UOLA 3WF9A 5L2WA 2FYSA 4DTKA 4BHNA 3N9XA 1ZMWA 2BTSA 4IM3A 4LRJA 3O2MA 4E7WA 4JOAA 3R7IA 2V7AA 4QP4A 5BYYA 5CAOA 4HYUA 5FBOA 3Q3BA 4YR8A 4USDA 4RSSA 1ZMVA 1WCCA 3PYYA 1QPCA 4FNYA 4ITHA 4MEDA 4EOSA 1H1WA 4D4VA 5HIEA 5DMZA 3LE6A 4IM2A 4FZ7A 5K9IA 4EQUA 3F9NA 3QXOA 4TYEA 4EKKA 3B2WA 5HO7A 1NW1A 2AYPA 3JR1A 5BNJA 5DLSA 5JFSA 3LCDA 3II5A 3DY7A 4H58A 3GXLA 3DK6A 4FTLA 3PZHA 3EQGA 1I09A 4NEUA 3R1SA 3A7GA 3ZM9A 3KU2A 3MA3A 4S2ZA 4CD0A 3PXQA 2VX3A 1TVOA 3CJFA 5HGIA 3HRFA 4G6OA 3DLZA 2XZSA 1OB3A 2B7AA 3U6JA 3CLYA 1OI9A 1IA8A 2QNJA 3LM0A 4NJ3A 4U45A 5TOZA 3C0HA 2BFXA 4HNIA 1H0WA 4FTCA 1NVQA 4JDJA 3GQLA 3DXPA 2VTRA 3PTGA 4J98A 3R8VA 4CG8A 4ZS4A 1CKJA 1VEBA 3RAKA 4EOQA 3KXNA 2XB7A 1P14A 3O8UA 1JSUA 2IZUA 3BIZA 1FOTA 2ESMA 5AP0A 3RI1A 3RK5A 3R04A 4D2PA 4YO4A 4YPSA 3FZTA 4FF8A 3I6WA 5DIAA 3DDPA 3O71A 2BAJA 4P4CA 4TNBA 2F57A 3DKGA 4JIKA 4OT6A 3HL7A 2C3LA 2B9FA 4NYEA 4B99A 4M97A 4ASDA 4ZY5A 1WBNA 3BYMA 4AAAA 4BCQA 1VJYA 4AGWA 3GU4A 5HTCA 3BEAA 4EH8A 3P1AA 3OT3A 4GYIA 4I4FA 2HW6A 1W2DA 3QTXA 4U8ZA 3LLTA 3ATTA 5KMJA 3C5IA 2GTMA 4I0RA 5A4LA 4OTDA 5CF6A 2QOKA 4JAJA 3ZUUA 2PSQA 4UWCA 5DGZA 4IHPA 3ANQA 2QO7A 4O0XA 1W82A 4NH1A 4DF3A 3DNEA 4X2FA 4AXDA 2UW4A 5A6NA 2X7GA 3EYGA 2WMXA 4KKGA 3ACKA 2ITTA 4MWIA 4O27B 3ZEPA 5M56A 4KINA 3AXWA 3PXRA 4E20A 1L8TA 2C30A 2VZ6A 4N6YA 2X2LA 3AOXA 3PXKA 4DHIB 3QC9A 3CBLA 4UMPA 4ARKA 1GJOA 1LUFA 3N51A 2Q0BA 3SV0A 2WTDA 4FC0A 5JN2A 3V5WA 1FGIA 3WF7A 2CSNA 3VQHA 1JAMA 1URWA 1BYGA 2QO2A 2WZJA 4QMUA 4BIDA 5B7VA 3Q4CA 2P55A 2UZDA 3HAMA 4YMJA 4PV0A 3GT8A 5IEYA 3VBYA 4AP7A 2XAMA 4YTHA 3Q2MA 4QMPA 3TZ9A 4XEYA 4DH1A 4KS8A 3SVVA 4FEXA 4AXFA 4A9TA 4E4NA 1ZYSA 2C3JA 4C2WA 4ASZA 1H0VA 2PVJA 3FY0A 4E3CA 2CGXA 3MYGA 2BR1A 1JSVA 2I0EA 1LP4A 2X1NA 2OU7A 3O96A 5DT0A 5C27A 2X8DA 4EYJA 4OAVB 4F9AA 5CAUA 2GFSA 5AWMA 4ZTNA 5I0BA 4HGLA 5AR8A 4RWIA 2HW7A 3TNPC 4MBLA 3UIXA 2C0TA 5LWNA 3OW3A 4K11A 3TUBA 2Y8OA 2BFYA 2A19B 5ITAA 5CI7A 3FMJA 5LOHA 4PMPA 4WA9A 1K9AA 4UY9A 5AP5A 1TQMA 4FIHA 4BGHA 4L3JA 3VHKA 5CAPA 3BGQA 3NMUF 3UNJA 4O4BB 3R73A 4XLVA 3G0FA 5HVJA 4LG4A 1Q3WA 1HOWA 2ITUA 3T3VA 2XIZA 2W1HA 3NIZA 4BKJA 4IB1A 3P78A 1BI8A 5M53A 1YI6A 5IISA 3W32A 4JRVA 1UU7A 4D9UA 2OSCA 3RBWA 4CYIA 3VNTA 1SM2A 3PLAE 1OL2A 2VWBA 2XCHA 3ORIA 3QZGA 4BDFA 5IA3A 2CCIA 2YIRA 3NAXA 2HZNA 3FMLA 4HGSA 3E8CA 4DFZE 4D4YA 3OROA 2O8YA 3I5NA 5E8VA 2OICA 1R78A 2B55A 3FWQA 3QTZA 3HUBA 4MQ2A 4BDBA 4ZIMA 2W5BA 1UU8A 5HCXA 5L4QA 3NFGB 2B4SB 2IF8A 3IQ7A 3NVMB 2R0UA 4XUFA 5ICPA 3QHRA 4DEGA 3FC1X 4S34A 2I0YA 3LPBA 3I81A 4PDOA 2PL0A 3AC4A 4FEQA 3SHEA 4AG8A 4A07A 4BGGA 4JG8A 3QQHA 5HEZA 4C4IA 3MJ2A 1Z57A 4D55A 4I41A 3NGAA 3IOPA 3VUGA 3DK3A 2X6DA 4OBOA 4WBOA 4FTUA 4EONA 4EHGA 1XBBA 3P0MA 3UMXA 3QTSA 3S00A 3UO5A 1YDSE 4GU6A 2UW3A 1Y8GA 4TYGA 4AUAA 4AW0A 3FLQA 4IX3A 3UP2A 4JT3A 3CIKA 5IQAA 4F78A 3F7ZA 5J5TA 2NNWB 3ALNA 1PXOA 2FSMX 4RVKA 3OBJA 4ERWA 2ZB0A 3ELJA 3K3JA 3SRVA 2YAKA 2WMBA 2YZAA 3RK9A 4IVDA 4NTSA 5C9CA 2BAQA 3D0EA 2GNFA 3R7VA 4DHZA 4F6UA 2I1MA 3BRBA 4RT7A 5HCYA 5HO6A 2P4IA 4DEAA 1Y57A 4RC3A 3TZ8A 2YERA 5EKNA 4P7EA 2CHLA 4JRNA 4M12A 4D2SA 3TUCA 1W98A 2PPQA 1YXUA 2O65A 2GS2A 2VTPA 4Z55A 3ZONA 3V04A 5TO8A 4FX3A 2JDVA 5IQGA 3QTQA 3BL7A 4QNAA 3DFCB 5EH0A 5GINE 1WFCA 3TYKA 2B53A 2C5YA 3VC4A 1WVYA 2A98A 3OT8A 1YOJA 4ZZOA 4C35A 2ZFYA 4ASXA 4BCKA 4CQGA 4QP8A 3BZ3A 3W2CA 3VUDA 4IB5A 3FI2A 5EDQA 4GKHA 5BVKA 3OBGA 5IUIA 4I0SA 2XKFA 2XNMA 2ACXA 2YLFA 1YDRE 5IUGA 3OHTA 1PMEA 3QZHA 3EQHA 2ITVA 3TV6A 1E9HA 4XP3A 5E7RA 1H8FA 2YN8A 4JS8A 3UOHA 3LFAA 3ZM4A 2RKUA 4J7BA 1YI3A 2Z7LA 3TI1A 4E5AX 3A7HA 3F88A 3HYHA 5CZHA 5ETCA 4C7TA 2P3GX 4FGBA 4DFLA 2JBOA 3EMGA 2EU9A 4KUJA 3F3VA 3AKKA 5KKRB 3TNQB 4BJJB 3WYYA 4QQJA 1H00A 2J0KA 1OIUA 4YSMA 5AR2A 3VF8A 3C0GA 2XA4A 1OVEA 4Q5EA 5CEQA 4QP9A 5IEXA 5JFWA 3WZDA 4N70A 3EFJA 4YZCA 5IG1A 4AA5A 3Q9WA 4P90A 4QTBA 3VIDA 5CVHA 5B0XA 1LEZA 4OAUC 1M52A 3NYXA 1WVWA 4N4SA 3ZCLA 4E73A 3D2KA 4ZEGA 4FODA 5J7HA 2VAGA 2W1GA 3KC3A 3WE8A 3ZYAA 4C0TA 4IXPA 2JEDA 4MXAA 1DI8A 2V5QA 4OLIA 2I0HA 4XG9A 3KQ7A 4ALVA 4BTFA 4ZY4A 2C3IB 1OITA 1VYZA 3RHKA 2BRMA 4J1RA 2GS7A 3DQXA 4XBRA 3REPA 3EQIA 1XKKA 3EFKA 3NVKI 3FZSA 4FA2A 1DAYA 2BHHA 3E5AA 1CKPA 3NCZA 4A9YA 4F7LA 3ANRA 4ZSLA 4O0RA 4JVGA 3VBQA 5AUXA 3ZDIA 1ZLTA 4GRBA 4IWPA 3NYOA 4GS6A 5ETAA 2JITA 2QOBA 3LJ2A 4DBNA 4QYGA 4R6VA 4YJTA 3VUKA 4HVSA 1RE8A 2CLQA 3GUBA 2UVXA 2X8EA 5I5ZA