4F08A

Discovery and optimization of c-2 methyl imidazo-pyrrolopyridines as potent and orally bioavailable jak1 inhibitors with selectivity over jak2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
290
structure length
288
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery and Optimization of C-2 Methyl Imidazopyrrolopyridines as Potent and Orally Bioavailable JAK1 Inhibitors with Selectivity over JAK2.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 288
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f08A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f08A01
2R3FA 3BYOA 5I9ZA 5HTCA 1PMNA 1JLUE 5HE3A 4GIIA 4FEWA 3RNYA 2W96B 2XK4A 3PVUA 3RM7A 4BWKA 2IZUA 2J6MA 3OHTA 5CX9A 5E9EA 4IWPA 4BR3A 2QOCA 3IS5A 4IFCA 3PY1A 2BDFA 3LCDA 3FMHA 3RKBA 3BLQA 4D58A 3SX9A 4PMTA 3IONA 5M4CA 5ANJA 4FEQA 5F20A 3G0FA 4QMWA 4USEA 1ND4A 3HL7A 4H3PA 5EW9A 3QD4A 4ERKA 5AIKA 4L45A 3D5VA 3E3PA 5I9WA 5CF6A 4FX3A 5EOLA 2PVJA 4RX8A 3R22A 3S3IA 4C58A 4GSBA 2RIOA 3NDMA 5EW3A 2O0UA 5EOBA 3MB7A 4NJ3A 2X39A 4GFMA 3VVHA 3MPAA 3CC6A 4MD9E 4FBXA 4WOVA 1PMEA 3KMUA 5AM7A 3W1FA 3ZH8A 2XM9A 3FPMA 1NT2A 4G2FA 4PDSA 4F9YA 1WBWA 2FUMA 2R9SA 5AP6A 3RINA 4F7SA 4I6HA 2YCFA 4B9DA 2KTYA 3FL5A 3PZEA 5FGKA 3SOAA 1OITA 1JSUA 1PJKA 3F5UA 4UY9A 2WU7A 4BCPA 4LQMA 3UVRA 3PYYA 5HBEA 3Q9WA 4U9AA 3HV7A 4TYHA 5DYJA 4JLCA 4O1PA 3ULIA 4YZBA 2DUVA 4IX6A 2UZDA 4GK2A 3N9XA 3MVJA 4X2GA 2WQBA 3FLQA 4J71A 4PL4A 5K9IA 1XWSA 4XG4A 4G6NA 2VUWA 2QOQA 3AG9A 4YBJA 4OTQA 5HESA 2QC6A 2WOUA 4E6DA 4DG2E 1YXXA 3ORTA 4TPTA 2ZVAA 3BV3A 1TQIA 4JL9A 5AUZA 3O0GA 5ETIA 4XG6A 1BLXA 3K2LA 3LLAA 4BCKA 3F2NA 5HKMA 3OWLA 5AA8A 3M1SA 4PNIA 3WE4A 5GZ9A 5C8KA 3D94A 2PWLA 2X0GA 3POOA 4RQKA 5FXRA 3RPYA 3QRUA 4LOQA 3OT3A 2X4ZA 4XHKB 3QL8A 5CT0A 5CZIA 4C4GA 4BKJA 4EOOA 3CJFA 2VWWA 2VGPA 2XNEA 3NW7A 3O8TA 3P08A 3PY0A 4UEUA 4Q5EA 4ANLA 4FMQA 3KRLA 5EDQA 4M84A 1O6YA 5DMZA 3ATTA 3L8PA 3W18A 4HYUA 5K5XA 2PUIA 2YM3A 2IVUA 3U87A 2XIZA 3ZM4A 3NR9A 3SC1A 2ONLC 3RTPA 5M57A 4HYHA 3KRWA 2QO9A 3RPOA 5CYIA 1BMKA 4X21A 5D41A 3DB8A 3O17A 4C36A 1OL1A 5EQYA 4Z9LA 4ITIA 3GB2A 3GENA 2B53A 3G2FA 3HMIA 4CMTA 4LM5A 4F6WA 3WF5A 5ETFA 4YZDA 3IDBA 4L9IA 4QNYA 1J3HA 4F9WA 1F0QA 2QODA 4U41A 2W0JA 1M14A 4L3JA 2J2IB 4V0GB 2OG8A 4MTAA 4B0GA 3HP2A 4PL3A 3MV5A 2YHVA 2BCJA 4XG3A 4RIOA 4HCVA 5DRDA 3ZRLA 4JAIA 1CM8A 2XNNA 4RT7A 1PMVA 3WZDA 3VQUA 2ZM3A 3T8OA 5CEQA 3IK3A 5D7AA 3WBLA 3RCDA 1XH8A 4O91A 3ZO3A 5HCZA 2ITZA 5HTBA 1UNGA 4JI9A 3R00A 5DR9A 5AFVA 4G6OA 2PK9A 4EOMA 3FMEA 5HE1A 2B54A 2QOIA 3Q52A 3VUHA 3SGCA 1I44A 2WMXA 4R7HA 5IU2A 4GT4A 1ZOHA 5C4LA 2RKUA 2OLCA 1XHAA 3K5VA 2CGVA 4PV0A 5A4LA 2QOOA 1G5SA 2XNPA 4MVFA 3POZA 4K0YA 3EMGA 1WBSA 4A9YA 3P5KA 3CD8A 5C01A 3GQLA 3E93A 1KSWA 3DS6A 3F2RA 3OW3A 4CFVA 3HMPA 1FGIA 3DK6A 2WGJA 3TKHA 4ZAUA 4OTFA 4W9WA 3QTIA 5JRSA 3VS5A 4Y85A 3U6JA 1VJYA 4MXOA 2ZOQA 4MD7E 4CXAA 4EHEA 1GZ8A 2XRWA 4IVDA 4KBAA 4KS7A 3QRJA 4FGRA 3QKLA 4NTSA 4C59A 4O0YA 3H9RA 3T3VA 1K9AA 4ZJIA 1DI8A 3VS4A 3FKOA 5AP7A 3VHEA 5CSXA 3DXPA 2ZM1A 2GDOA 3FQSA 5DR2A 4IB3A 2J0IA 5DRBA 4WNMA 4EH7A 5HG9A 1ATPE 3KXNA 4RVLA 2G15A 5M09A 5AR5A 3RK7A 3V3VA 2KULA 2BDWA 2OF4A 4FIGA 4LOPA 1ERKA 4PWNA 3KU2A 5EQPA 3VIDA 3CKXA 4JBPA 3VAPA 5HU3A 4U5JA 1R78A 3FE3A 3FYKX 5C1QB 3CGFA 4Q5HA 3FBVA 3BKBA 3UC4A 5GINE 3D15A 4C34A 3ZSHA 4UWBA 3R1QA 5ETAA 3Q04A 1FGKA 5K4JA 4WHZA 3MFTA 3VS1A 5BMMA 4OT5A 2G1TA 2VX0A 4TNBA 4D9UA 1E9HA 3EN4A 4LI5A 5E8YA 4AT3A 4NK9A 3S1HA 1J7IA 1CDKA 2BUJA 3F7WA 4YZ9A 4JAJA 2JIVA 4UX9A 3D2KA 5FM2A 3IW7A 5J1WA 3DPKA 4JRNA 4YJPA 3E87A 3C51A 4NT4A 4UXQA 2IJMA 4FKTA 4QMXA 4AN9A 2ZDUA 3OWJA 3O7LB 2FSOX 2YAAA 4ZTMA 1WVWA 5HHWA 2XIXA 4HVGA 2JEDA 5JFWA 4LGHA 4WKQA 5KZIA 4ZTQA 2PL0A 2PUUA 5ANDA 3H0ZA 2CKPA 4RX7A 4PTEA 5CS6A 2P0CA 3RP9A 2J0JA 3AMAA 3LLTA 3NYXA 4FTOA 3FC2A 3NYVA 4ID7A 4KINA 5HEZA 2IW9A 2X9FA 4C4EA 2ITOA 2W99B 1E1XA 3BGZA 1XH6A 4RIYB 1YWVA 4JIKA 4XRLA 4YZCA 4A4OA 1EH4A 2Z2WA 4O0WA 2C5NA 1ZYLA 2ZV9A 3DOGA 4V04A 3ORPA 2FSTX 3HV4A 4M66A 3GU4A 3OWKA 5D1JA 5CF8A 3FKLA 4TW9A 2IZTA 3F9NA 3OD6X 3U9NA 4EH9A 4ZY5A 4I94A 3KMWA 3AD5A 1J91A 3G90X 1SM2A 4RWJA 3B2TA 4F1TA 2AUHA 4MXZA 1FMKA 5BVWA 4YTHA 3PJ1A 1PY5A 2C4GA 4IANA 2R3MA 3TNHA 4ZK5A 4ZTRA 2OZAB 4JT3A 4EOPA 2RL5A 4HPUE 4P5ZA 4AU8A 4HVDA 4A9TA 4QTEA 3LFCA 1U46A 3S00A 2I6LA 3RJCA 2J50A 3GCVA 3ZRMA 5JGDA 3HAMA 4CGAA 3KULA 3JVSA 3MDYA 4E5BA 5EHYA 5A6OA 1H0WA 5I4NA 5I9UA 3V51A 3R1YA 2J9MA 3OCBA 4I41A 3MVHA 4A4LA 4LL5A 3OY3A 3TZMA 1KOAA 2Y7JA 4G31A 3FZRA 5DLSA 4DTKA 3LQ3A 2J5EA 3DT1A 3FZPA 1Q8ZA 5GJGA 1YXTA 4FTNA 3D7TA 5E1EA 5I3OA 4D4VA 3QRKA 5ANEA 4ZMFA 3WYYA 2ZV8A 4GJ2A 2J90A 1V0BA 3DBEA 1H4LA 1F5QA 3O71A 4MXYA 5FUTA 2PMIA 3ZMMA 3PDTA 1LPUA 3ID6C 3NIZA 2CNQA 5EM6A 2WTIA 3SQQA 3ETAA 3P1AA 4MNFA 4KD1A 2WB8A 3QTXA 4PRJA 4FKJA 4YC3A 4BBMA 4EUTA 1O6KA 3U6HA 5EHOA 2ITXA 2BTSA 1WAKA 3OTVA 4DEEA 4RC4A 3WZJA 1VZOA 4BCFA 4XOYA 1Y6AA 1UU3A 5DA3A 3PTGA 3HMNA 3DKOA 4PTCA 2C1AA 3BI6A 2C5VA 3TDVA 3UOKA 4W8DA 1H08A 4J53A 4QQCA 4J1RA 4J95A 4F09A 4ANOA 4HYSA 3R83A 4OUCA 5DPVA 4G34A 4AN3A 2JDSA 4AW2A 4FYOA 2UZBA 4MXCA 4KB8A 4O7LA 4O0XA 1YWRA 4D1XA 5M56A 2P55A 3NNUA 3RAIA 2BZHB 4B7TA 1IAJA 3DXNA 4AQCA 5IEVA 3AT4A 4EOSA 3E8NA 3EZVA 3IG7A 3Q60A 5C27A 4F7JA 4FK6A 4IXPA 5CU0A 4UMPA 3CTHA 4QQ5A 3EH9A 4FTUA 3QA8A 2RFEA 5AIRA 3I81A 2JAVA 5DNRA 4GRBA 1GY3A 5E8TA 1LEZA 4DFBA 3H0YA 1ZYCA 2V7OA 1WMKA 3E8EA 3KN5A 4K9YA 4N6YA 4TWOA 2NRUA 3UO4A 1FVTA 3TL8A 4DEBA 3DBFA 4JG6A 4XS2A 3T9IA 2Z02A 4F70A 2WTKC 3PRFA 3HKOA 2YLFA 3KY2A 4XP0A 5JZJA 5J7HA 3DTWA 3Q4CA 4XJ0A 5ANOA 4AOIA 4CT1A 3EFWA 2UZWE 5IA4A 3CEKA 2ACXA 2QLUA 3FZ1A 3UVPA 2VWVA 2R2PA 5LMBA 2ZDTA 4XG9A 3I6WA 4NWMA 3T3UA 4F9AA 1A9UA 2QOBA 3QWJA 2CCIA 4FIEA 4TWCA 4U80A 1RE8A 2VN9A 4I6QA 4QTAA 4ACDA 5CANA 2GHMA 3C9WA 3LFBA 3H9OA 2X2KA 3PFQA 4QYFA 2WU6A 4KKGA 1HCLA 3CD3A 3MTLA 4GEOA 3MIAA 3ZBFA 4ARKA 5IEXA 3CR0A 2VX1A 5HLWA 2XK7A 1YQJA 4HZSA 5AADA 5BVFA 4EI4A 3DZOA 3C0GA 3GI3A 5DBXA 2YLEA 2CKEA 2ZMCA 2EWAA 4FVRA 4Q2AA 3AT2A 2BFXA 4FKUA 1B6CB 3QKMA 2A27A 4KIOA 2XP2A 3R1SA 4FZ6A 4GG7A 3EQPA 3I0OA 3PG1A 5CY3A 5EKOA 5ACKA 1NVSA 1OB3A 4GVJA 2R3LA 4DBNA 5CAUA 3R01A 4RJ4A 1G3NA 4BDKA 2OF2A 4ZTHA 5KUPA 5DFPA 4Y5HA 1GIHA 4RA5A 3SOCA 1OI9A 5KMOA 3MESA 4KIQA 2FSLX 3TV4A 3VUIA 2UW6A 3R30A 1CKJA 3LJ1A 3LZBA 5FD2A 5IQCA 5J5SA 3U55A 4AGCA 4C7TA 5L2SA 3OBJA 1KE8A 3BWFA 1TKIA 3NZ0A 4ANSA 4C02A 4XV2A 2C6IA 3EQBA 4O82A 5KHXA 4BCIA 2YEXA 3PUPA 5IH6A 1R1WA 5DT4A 4BDHA 1ZY5A 4G3CA 1PKDA 4FC0A 3LMIA 1R0PA 4PMMA 4FV0A 3VS6A 2BMCA 4QMLA 4J7BA 4FTMA 3TZ7A 3FZOA 3JY9A 3FQEA 4HVSA 4NIFB 4BCHA 4DCEA 3FXXA 4AZTA 2YIXA 4WG4A 3UG1A 4P90A 5I3RA 4O7ZA 3CGOA 3KRXA 2OIBA 4HGLA 4DT9A 2VWIA 3DAKA 4BTKA 4K2RA 2WMRA 3ODZX 4AW1A 2C6DA 3UVQA 1Q3DA 3EQRA 3Q9YA 3NMUF 4IEBA 5AM6A 2J51A 4L68A 3NUNA 4FV5A 3SKCA 2C69A 4G1WA 4F65A 5M4IA 3VC4A 5AAFA 4CD0A 5HBJA 3R8UA 3LJ2A 3PJ2A 4MCVA 3KVXA 4RIWB 4WO5A 4AA5A 4BCGA 2QO2A 4O6LA 2W05A 4EH3A 2LGCA 5JGAA 5IQAA 4FKGA 3VUDA 4ZJJA 3KFAA 3DAJA 3ZLWA 4OR5A 3BEGA 2I0VA 4DGGA 4X6QC 2RG5A 3GCSA 4YUQA 2JIIA 3MH2A 3JY0A 3NAXA 4O2ZA 3ZFXA 3MA6A 4DAWA 2WMUA 1M17A 4GCJA 4RFYA 5IA3A 1IA9A 2QG7A 2WQMA 3HMMA 3GU6A 4FKQA 4GL9A 4YZMA 4BCOA 4DH7A 2UW9A 4QP6A 3Q96A 3R2BA 1IG1A 2EU9A 2GCDA 2VWYA 3WILA 4PDPA 4EOJA 5CSPA 1UKIA 1YWNA 5E7RA 4ASXA 1OUKA 1O6LA 2X2MA 4X3FA 2PMLX 4J99A 3F2AA 1LP4A 5J1VA 4DEGA 1W7HA 2UZVA 2AC3A 4I0RA 5LARA 3UE4A 4BGGA 4CKJA 3NNWA 2XNBA 4DF3A 5T3QA 4JVGA 2Q83A 1H1RA 3EOCA 1Z5MA 2BTRA 2QLQA 3ZXTA 5ICPA 5J7BA 4O6EA 5AWMA 4I4EA 3R8MA 4X7QA 2QNJA 3A8XA 4PMSA 4V01A 4F7NA 3ZZEA 5BVNA 5KMKA 3BX5A 2XBJA 1M2RA 4M0YA 3GOPA 4M68A 3O8PA 1K2PA 1OL6A 4NFNA 3QZIA 2F57A 2XK9A 1PRYA 4R3RA 3GOKA 3V04A 4ZJVA 5F94A 3I5ZA 4Y72A 4U8ZA 5CSWA 3MY5A 2BKKA 3CE3A 2ZAZA 5E4HA 5LJJA 4U44A 3O7LD 5CSHA 2QU5A 4M69A 4DFZE 2XMYA 3R7YA 1S9IA 1G8AA 3QAME 4QP9A 4HYIA 3TV7A 4O7WA 1Y6BA 3H9FA 4IVBA 4IX4A 2GNHA 3BU6A 2XIRA 2P3GX 2FB8A 5HIBA 4B99A 3M42A 1U54A 2PVRA 3KCKA 5CEKA 3UJGA 3D9VA 3W33A 3Q2JA 3GC0A 4UMRA 3QQGA 3R8PA 3S95A 2I1MA 4DH5A 2JD5A 4BYIA 2ZB0A 1J7UA 1QPJA 4FIIA 4IQ6A 5EYKA 1FOTA 5L3AA 2GS2A 2PUNA 3EFKA 2LAVA 4X2JA 3FMJA 3REPA 3ZLSA 3CCNA 1OIRA 2HZIA 4AWIA 1UNHA 5TE0A 4D55A 4U43A 1AQ1A 4WSYA 3PPJA 4CFWA 2AC5A 5AUYA 2NPQA 4H3BA 4GKHA 2P33A 4RMZA 4FIFA 2ITTA 3R73A 3LCTA 4YBKA 2ZM4A 3OW4A 4AACA 3E64A 5L6WL 3ODYX 4A06A 2CCHA 3QXOA 4YC6A 3MFRA 3LXNA 3PSDA 5ANIA 2QR8A 4DITA 3AMBA 4EH4A 3AD6A 3QA0A 3KKVA 3R63A 5IF1A 5H9BA 4FKWA 5H3QA 4BZDA 3VULA 5CEOA 3QALE 4LYNA 4JBVA 5EK7A 3HYHA 4YMJA 3RPVA 4YHTA 4ACCA 2R3OA 2XCKA 4O7VA 3TEIA 2FGIA 3COIA 3ET7A 4DH1A 2WZJA 4GFOA 4F6SA 3LMHA 1B39A 4BCJA 3GNIB 4JG7A 4LGDA 3TNWA 3WF8A 1FVVA 5L8JA 5H2UA 2WMWA 4DEHA 4QD6A 2QQ7A 4R7IA 2OKRA 3GU5A 4NM7A 5IH4A 5J9LA 4R5YA 3FZSA 2PE2A 4BDGA 3PXRA 2OU7A 4I1ZA 5ETCA 5HU9A 2YITA 2EB3A 1GIJA 1ZYSA 4FE2A 3TNIA 1UVRA 2IWIA 2JKMA 2OGVA 4QYYA 3FI2A 2YM8A 3QGYA 5J87A 4AE6A 2B0QA 3LIJA 4C8BA 3LFDA 2O2UA 1PYEA 4IMYA 3CIKA 3HZTA 4GH2A 3KK8A 4D5HA 4K6ZA 2C0IA 3Q4TA 3GU8A 3DBDA 4E6QA 4FV2A 1YOLA 3HRFA 3KXGA 4FNZA 4FTQA 4X3FC 3SRVB 1L3RE 2O63A 2YDIA 3W2RA 3QUDA 4UYAA 4CRLA 3U51A 3KGAA 3M2WA 1CKPA 2F7XE 2ZB1A 4RJ7A 3FLNC 4I22A 5HVKA 1H26A 4JQ7A 2HZ4A 3O2MA 4BDFA 1L8TA 3VS7A 2QOFA 3BU3A 2CGWA 2J7TA 4RWIA 4GYIA 2JDRA 3PSBA 5EDPA 1OZ1A 5BVEA 4RX5A 3HGKA 5E8WA 5TKDA 3PIZA 5J95A 3DY7A 4ZSEA 3RM6A 1JBPE 2OH0E 3TJCA 4C62A 3UTOA 4DEDA 4EONA 3BQCA 5DVRA 3T9TA 1SVGA 3KN6A 3PZHA 4TWPA 4UN0C 4IAKA 5FBNC 5GJDA 4FT3A 4JR3A 2PVNA 1H1PA 4N4SA 4QMUA 3UMWA 5EFQA 3DV3A 5FQDC 5C03A 3IGOA 4MQ2A 5KMNA 5HCXA 3EYGA 5GIPE 3R7IA 3DLSA 3HDNA 4NM5A 4UWYA 2PVMA 3ROCA 2QO7A 3ZFMA 4F9BA 4HOKA 3AC3A 3R7GA 4JR7A 4EQCA 3DXQA 1M52A 2FYSA 2GHLA 4IDTA 5IQHA 4I92A 4S2ZA 2XZSA 2VTLA 2WD1A 2W5BA 4JJRA 3C7QA 2R3GA 3JUHA 2IZRA 5FP5A 4WG3A 3RPSA 4PY1A 3PRIA 3TG1A 2Z7QA 1OPKA 4G3GA 4U42A 3W16A 2C1BA 3MH1A 4RWLA 4Z7GA 1BX6A 3IOKA 3ORNA 2C0OA 5LOHA 4NKSA 3IO7A 4E4LA 3QQUA 3V6RA 4U97A 1HOWA 3NUUA 4CTCA 5IKWA 3DQWA 4IZYA 4AS0A 3CTJA 2Z8CA 3MJ2A 4F4PA 3SW7A 4JOAA 5KX8A 3P79A 4ZS4A 1IR3A 1GNGA 2YM6A 4OTWA 3F66A 4U7ZA 3SLSA 1ZZ2A 4FZFB 3L9MA 4NZWB 4RFZA 4DEAA 3BYUA 5TT7A 3NX8A 4HGSA 1OIUA 4RC3A 5HO6A 3VQHA 4FTKA 4FKVA 4CYJA 2NRYA 4WSQA 3MWUA 5M4UA 3ULZA 3TZ9A 4CZYB 4EKKA 3UOJA 5HG7A 3IDCA 3PA4A 4R6VA 1Q61A 3OCGA 1FINA 5JZNA 1I09A 4KKEA 1H1SA 5KCVA 4AOJA 3O23A 2YM7A 5EYMA 3W8LA 1OKVA 5K4IA 2Y4IB 4XP3A 4D4SA 3FXWA 1J7LA 1IASA 3SD0A 3E3BX 4QQJA 5LVOA 2BZKB 2F9GA 4PX6A 1PYXA 2ITYA 3DKFA 4G5PA 4BTFA 3ZM9A 3QLFA 1PXJA 5EH0A 2JIUA 2DQ7X 4RJ8A 1ZAOA 4QMOA 2FA2A 4P4CA 4AGDA 1H1QA 5KHWA 5JKGA 3K3IA 3AGMA 3DCVA 2I40A 3PJ8A 3RAKA 4BCNA 3LXPA 2XCHA 4TYHB 1WBPA 3QRTA 2GTNA 4O27B 2VO7A 3UODA 2QKRA 2QOHA 3VBVA 4FNXA 5CVHA 3VNTA 4NJDA 1MP8A 3FMLA 2XVDA 4CZTA 4YPDA 5KBQA 5BPYA 1XJDA 4MKCA 4E7WA 4TT7A 4LMNA 4M12A 4FEVA 3U54A 3D7ZA 2B52A 3A99A 3CP9A 4S34A 4DCAA 5IQGA 4EBVA 4BDBA 3VBTA 3V5WA 4D2RA 3F69A 2PTKA 4B8LA 3HVCA 4FGBA 1IAHA 3NYOA 4IDVA 2A0CX 4TKSA 4ZZOA 1VR2A 1WBVA 2JLDA 4H36A 4PP9A 4FUYA 1YXSA 3MPTA 5DT3A 4XH6A 5BVDA 5BYZA 1W84A 3IPHA 5B2KA 2FH9A 2WIHA 3I7BA 2R3QA 2HZ0A 4MNEA 2YWVA 4AZEA 2R7IA 4I5MA 5L6PA 4F0FA 2Z7LA 5KMMA 3WIGA 4IB5A 5IG1A 5JRQA 3HAVA 3JS2A 2UZNA 4G9CA 4FZDB 2QURA 2WEVA 5EYCA 2OXYA 2BALA 3EKKA 3C4FA 4FNYA 2W4JA 1GZOA 3DA6A 4KUJA 4CQGA 2H8HA 2JFMA 3KRRA 4RLKA 4BGHA 4DC2A 2WHBA 4QT1A 4RG0A 4RSSA 4YJSA 2QD9A 5CASA 2C68A 4OBOA 1OGUA 4FVQA 3O96A 2BHHA 1PXNA 2CJMA 3VS2A 2VWBA 4OTRA 3QF9A 5AUXA 2C47A 2OJJA 4IJ9A 4J8MA 2V62A 1WFCA 3IDPA 3MJ1A 5KNJA 2OFVA 4CG8A 2BILB 2ESMA 2ZYBA 4F63A 2R5TA 4BC6A 2BFYA 2YISA 4YP8A 2GTMA 2W1ZA 2ZV7A 1LR4A 3TTJA 2RFNA 3V8TA 2C6LA 3U4WA 4DEIA 2Q0NA 2Y4IC 4MHAA 4U0IA 4BHNA 2YZLA 4O22A 3R21A 2I7QA 3K3JA 1WVXA 4EK5A 4FOBA 4EYJA 3ELJA 3OTUA 4TYEA 1OVEA 1P4FA 2Z7RA 4TWNA 3UQCA 4HZRA 4Z3VA 3QQLA 4AZWA 3D5XA 4ANBA 4CKIA 2X4FA 4EJNA 4YJOA 4DG0E 3A7GA 2OJFE 2PVLA 3HECA 4U79A 1T46A 3VRYA 1RDQE 3PVWA 3ZU7A 3DJ6A 3CLYA 4PDOA 3AXWA 4CKRA 5JEBA 2XJ2A 3VO3A 1CSNA 2VO3A 3RAHA 4NW5A 4YPSA 5CQUA 4GU6A 4TY1A 3F5XA 1JQHA 4TL0A 2NP8A 4FZ7A 3V01A 3PA3A 5JK3A 4Y5QA 3WI6A 4C2VA 2W7XA 3GGFA 3QQFA 1GAGA 4CCBA 3A7FA 3MFSA 4XOZA 3RBWA 5BX0A 1PXOA 2EVAA 2W5AA 3R28A 5BQ0A 4WUNA 4QNAA 3PSCA 4I4FA 3THBA 2VO6A 4OTIA 4XLVA 4E8AA 4EH5A 1NVQA 2UW0A 2VTJA 2R3PA 3MN3A 5B2LA 2B9JA 5AR3A 2A1AB 3DAEA 5CF4A 4YC8A 2BRMA 4D2WA 4IAIA 4USFA 1H07A 2PSQA 5H8BA 3UDBA 3GCPA 2C5XA 3ZFYA 1GJOA 3BHTA 2YA9A 2WTWA 2CNVA 5JQ5A 3C13A 3BQRA 4PQNA 5HORA 3R9DA 4XX9A 4AW0A 2HY81 1OL5A 5EW8A 3RWPA 2P2HA 4EQMA 3CPBA 1LUFA 3QBNA 2XEYA 3PIXA 3NNXA 3FV8A 4AZVA 3UOHA 2C30A 4K77A 5C9CA 3EN9A 3N4TA 1JKSA 3MFUA 4CTBA 5B0XA 5EHLA 1Q8UA 4IC8A 1YKRA 5ACBC 3FQHA 3DB6A 1MQ4A 3CXWA 4YSJA 4QMVA 5L2WA 3FUPA 1H1WA 1W8CA 5FEEA 4GG5A 2VNWA 5L8LA 4F7LA 1FPUA 4I5CA 3FAAA 3H3CA 1JPAA 3EYHA 4JQ8A 5HOAA 2GNGA 3A7HA 3BYSA 4FK3A 2UW7A 4KA3A 3S2PA 2OZAA 3OUNB 4EHZA 5JQ8A 3W2QA 1URCA 4FTIA 5A46A 3NNVA 3QQJA 4BKZA 5IQEA 4XEYA 2W06A 4O0VA 5CVGA 2JKQA 3VUKA 3PXKA 2C6TA 4QP4A 4D28A 4E5WA 4EUUA 4QYEA 3KXMA 1OL2A 4JNWA 2HWPA 4V05A 4YLKA 2IW8A 4EK8A 3E5AA 2R0IA 5DI1A 3UNZA 4O2PA 2WTKB 4GIHA 4MF0A 4DYMA 3LFQA 4EWHA 4G6LA 5EYDA 3RALA 5LVMA 5FXSA 3QTQA 2BPMA 2RGPA 4ANNA 1U4DA 2HZNA 3D5WA 3QTRA 2CGUA 3WZEA 2ITWA 3F82A 5A9UA 4BDDA 2CPKE 4BN1A 3NAYA 4FSQA 5CU2A 4FV4A 4JIAA 1LEWA 3OWPA 3MY0A 2YCQA 3BELA 4FT0A 5CAVA 3FI4A 3FMDA 3LW0A 5TR6A 1DM2A 1UU9A 4J96A 4LRMA 4PUZA 2YCRA 5KE0A 3OF0A 2CMWA 2WMTA 4J98A 4XNEA 2XYUA 3CPCA 3QTSA 3RAWA 3C4ZA 3QD2B 4GT3A 3NWWA 4JBOA 4RA4A 2GQSA 2WQNA 5FXQA 2ZJWA 1YDRE 5IISA 4KKHA 5LVNA 4G9RA 2VTNA 4I0SA 4YLJA 4S32A 1XR1A 4BDJA 2CSNA 3UBDA 4HCTA 5FP6A 1X8BA 4FG7A 2BHEA 4LFIA 5DN3A 4BGQA 4XG8A 5J9ZA 2FVDA 3U9CA 3AD4A 1KE9A 4N70A 5HNBA 4BL1A 2C0TA 4CMUA 5AX9A 1XH4A 5BUIA 5HO7A 4I5PA 4A9RA 3F6XA 2CHLA 3VJOA 3EQCA 3QCSA 4JXFA 4R1VA 4ITHA 1ZARA 3OXIA 3HRCA 2VNYA 3IW8A 2C6KA 2VRXA 3FJQE 4GV1A 4EZ5A 2HCKA 4E6AA 3FZTA 2H34A 2SRCA 3R1NA 3JYAA 4FV1A 3BEAA 3ZXZA 5IZFA 3D7TB 3KMMA 5HLNA 4O83A 4BZNA 3G6GA 2X81A 4I6BA 3I4BA 5IDPA 2YDKA 1DAYA 3C4EA 4WA9A 3B8RA 3I5NA 2YIQA 5AV0A 3R8LA 1YHVA 3AC1A 5IPJA 4FKIA 5AP1A 4GU9A 4O1OA 2XIYA 3LCKA 3LFSA 3Q6WA 2WELA 4RVMA 5IA1A 4OAVB 2BZIB 4DBXA 1H8FA 3A61A 3AC5A 5F95A 4AZFA 4S31A 3LCOA 3QD3A 3EQGA 3GUBA 2B55A 4BCMA 1NXKA 3G5DA 3W2PA 2OO8X 4BFMA 4ZY4A 2NNWB 3FL4A 4AW5A 4IZAA 5J9YA 3QUEA 5E8SA 3QYWA 4MBLA 3G33A 2OICA 5L6OA 4MQ1A 3TNPC 3CBLA 4C2WA 5HE2A 5IUGA 3QHRA 3TV6A 3ZRKA 4DTBA 3RMFA 5CALA 5LMAA 2Y6MA 2GMXA 2VTMA 4JDIA 5I9XA 1Q41A 2XNOA 4O7TA 4O96A 4EJ7A 3OOGA 4CFFA 3UIXA 3NW6A 3WF6A 2B1PA 3PWDA 4E1ZA 2BR1A 3AMYA 2X8EA 3UP7A 5HX8A 4R77A 5IEYA 4JBQA 4BRXA 3WE8A 2PMNX 3A60A 2QKWB 4ZIMA 1P4OA 3C0HA 4TYIA 5DWRA 4M7IA 4C3FA 1QMZA 4L42A 3L8XA 4RJ3A 3RK9A 4IZ7A 3FHRA 2A19B 4Y46A 4JX3A 5DG5A 2VWUA 3GFEA 3ALNA 4A7CA 2JKKA 1KWPA 4FT9A 1XBAA 4Z55A 4BDAA 3COHA 5DOSA 4C3RA 1W82A 3VF9A 2P2IA 2WMQA 2O8YA 4FZAB 2IO6A 3QUPA 2WNTA 1ZOGA 2X1NA 2YM4A 2XB7A 4TTHB 4F6UA 3F3ZA 4I24A 5JGBA 2XIKA 3NIEA 1FVRA 5CI7A 3P9JA 3VN9A 4QPAA 4F0GA 2BRNA 4NYEA 5A4TA 2BRBA 3DJ7A 3Q6UA 3FKNA 3FC1X 4R3CA 3DU8A 3H10A 4KSQA 2GNFA 4OBPA 3FEGA 3FMNA 2IPXA 3VRZA 2BAKA 4APCA 4R5SA 4W8EA 2QU6A 3WZUA 1BI8A 3PWYA 2VTHA 4X2NA 1M2PA 4CEGA 5DEYA 1MUOA 4ZTNA 5E91A 3UYTA 4FV3A 2XJ1A 3CQUA 1REJA 4FR4A 4O0TA 3OP5A 3SV0A 5CZHA 3R9HA 3EL8A 3HV6A 2OWBA 3PP0A 4NIFA 4QMMA 1IRKA 4R1YA 2GU8A 3PE2A 3PXQA 2J4ZA 4FKRA 3EIDA 3V5TA 4CCUA 4QMSA 3ZS5A 3SHEA 5BNJA 4K1BA 3UPXA 2WMSA 2ITPA 2YJRA 3NSZA 3ZEWA 3OVVA 4CQEA 3NGAA 5GJFA 3UIUA 3TACA 1OM1A 2RFDA 3KF4A 5AMNA 4AUAA 5L2IA 3C4WA 2XJ0A 4WBOA 4CT2A 3QTWA 4EOLA 2HY0A 4QP2A 4MF1A 3MBLA 4XV3A 4O81A 3OG7A 4O86A 3UIBA 2XK6A 4NM0A 2VZ6A 1V1KA 3WF9A 4E26A 2EB2A 3QLGA 4F0IA 5L2TA 5JT2A 4ALVA 5FM3A 4CNHA 2G01A 5L8KA 4KWPA 1BKXA 5KMJA 2PZRA 1SZMA 3O51A 5AUWA 2OXXA 1YXUA 3R9NA 2X6DA 4YSMA 4D2VA 3F5PA 3NRMA 4YZNA 5CTPA 5LCKA 3G0EA 5AR8A 1JKKA 4ZSLA 3R71A 2OJGA 4ASZA 2XK8A 4WD5A 4YJVA 3ZLYA 2EXEA 1XBBA 4NU1A 3FLSA 4BKYA 5LWNA 4HGTA 3R02A 1V0PA 2B4SB 2WTCA 3HNGA 4J8NA 1QPCA 3R2YA 4X0MA 4FA2A 2C5YA 4HNIA 5FDPA 1XH9A 3IGGA 5M08A 1Q3WA 3TTIA 5A4CA 5KO1A 4RIXB 4FNWA 4I5HA 5F4NA 3TM0A 2G2IA 2QI8A 5HVYA 4EORA 4EEVA 4E5AX 4JQEA 1FQ1B 3L8SA 4R3PA 1OKYA 2RF9A 4FT7A 4W4YA 4CVAA 1ZLTA 3BYMA 4ZLZA 3NLBA 5FEDA 2PVHA 2HYYA 3TUBA 5BMSA 1AD5A 3DKCA 4TXCA 2R4BA 4QMNA 1ZWSA 1YI3A 4DLJA 4EKLA 5E8UA 1TVOA 4XLIA 5IQBA 3LPBA 4U6RA 3LM0A 5DR6A 1Y8YA 3QTZA 4ZXTA 3C5IA 2PULA 1W98A 3OT8A 3U4UA 1KV2A 5ITAA 2X8DA 2W9ZB 2PU8A 4ERWA 2ITQA 2YN8A 3AC8A 1KV1A 3GC7A 4CLIA 3D0EA 2EUFB 4EWQA 3QCXA 3LFFA 4ZZNA 1OKZA 4I3ZA 4MXXA 4ONAA 4C4HA 2PVYA 2WO6A 4KIKA 2X2LA 4G3DA 5IA2A 5BUEA 2G2HA 3EJ1A 2V55A 4M97A 3OS3A 4TRLA 5J79A 1YRPA 3OZ6A 5IMEA 2Y4PA 4J52A 1G8SA 2YM5A 4H39A 4BBFA 4KS8A 5CSVA 4X3FB 2OZOA 2C3KA 5FTOA 4B8MA 2X7GA 2E9OA 3C4XA 4NCTA 4AXAA 5CF5A 5KKRC 4C35A 4ENYA 3UO5A 3ORLA 5AP3A 4KABA 3BLHA 3KXXA 4FSRA 3BWJA 3DZQA 4E4XA 2PYWA 2R7BA 3B8QA 3MI9A 5HO8A 4XRJA 3F5GA 2GFSA 2C5OA 2PZPA 2JITA 2OK1A 3A2CA 4OBQA 2R3RA 3CJGA 3D14A 3EKNA 3QYZA 2GHGA 4HJOA 5EG3A 3V5LA 5AR7A 3RWQA 1BI7A 2ITUA 3LXLA 4O7RA 1UV5A 3GXLA 2XNMA 1OPJA 3QXPA 3FHIA 3I0QA 3Q9XA 3Q5IA 2UW4A 4L53A 4W9XA 3MH3A 4FSNA 3IW5A 4U81A 3QCYA 5ANKA 3COMA 4R7BA 2PHKA 2QHMA 2GPHA 3QC4A 4MEDA 1QCFA 4F1OA 3OROA 2PE1A 3K5UA 4BI0A 4EQUA 1VYZA 2HW6A 2V22A 3A8WA 4GMYA 3ZUVA 4UALA 3A7JA 4D2SA 4BIEA 1SVEA 3ZO1A 4FV6A 3L9NA 4GT5A 3PA5A 4X2FA 5FEQA 5HTIA 3ORZA 2CLQA 2WQOA 3LOKA 2O65A 3MB6A 5FLFA 5G6VA 1S9JA 5B7VA 5IA0A 3Q2MA 3LHJA 3MSSA 3PP1A 4RZVA 4DFXE 3NW5A 2VTIA 5JSMA 5L4QA 5HBHA 3ALOA 4FKOA 4OGRA 5CU6A 3RCJA 2YERA 1E1VA 4IZ5A 3OBGA 4L44A 4UWCA 2JC6A 4BIDA 1JSTA 2A2AA 4IADA 5C26A 3HX4A 4K33A 4RFMA 3IOPA 4FEUA 5J8IA 3UYSA 5AJQA 1PXIA 4NSTA 4U3ZA 5KBRA 5B2MA 3CSVA 4MK0A 3GC8A 3UP2A 4LOOA 4KRCA 4OTPA 2F7ZE 3BLRA 3FI3A 4IBMA 4BWPA 1H01A 3DDQA 4UZDA 4CFMA 5M51A 3Q4UA 3UZPA 1M2QA 4TYJA 1UU7A 3DJ5A 4H1MA 2C3IB 1J1CA 3D83A 4Q9SA 5HVJA 1APME 4CFUA 4EH2A 3D5UA 4UXLA 5JFXA 4AFJA 4GW8A 4NKAA 4JG8A 5HCYA 2OIQA 2XKDA 3NYNA 4AOTA 2UVZA 3KRJA 1UU8A 3FMKA 5L2QA 4DGOA 2UW3A 3LM5A 3GCQA 3WF7A 1MRUA 3Q53A 3SG9A 2WQEA 1U59A 4FSYA 4XBUA 5HIEA 2XBAA 3AGLA 4DGLC 2WAJA 4A9SA 4QYGA 5E90A 4DHFA 3AQVA 3SAYA 3G9LX 5I5ZA 2YIWA 4IC7A 1PHKA 3FDNA 2R3JA 4IAYA 4YLLA 3AC4A 1RW8A 5M53A 1JVPP 5HI2A 3O50A 2JDTA 3Q9ZA 3JXWA 3PE1A 5EM5A 2X8IA 2BAJA 4FKPA 3BRBA 4GKIA 5D10A 3UPZA 1P5EA 1B38A 2ONLA 2GNIA 4C0TA 4L00A 1MRYA 3F3UA 3DK3A 2XUUA 3QQHA 5EM7A 1Q24A 3B2WA 2UZUE 4DGMA 4IACA 3PJCA 1OMWA 2G2FA 4LUEA 4QPMA 5A3XA 5E8XA 4YR8A 1H25A 4BTMA 3IECA 3MH0A 1BL6A 3II5A 1SYKA 5CENA 4Q9ZA 5HD4A 4X6RA 5K0XA 3TDWA 3SG8A 5D11A 3VHKA 4LMUA 3S0OA 5DIAA 5KMIA 1SNUA 4PP7A 4H1JA 5M44A 4BCQA 1KE7A 4BYJA 2Q0BA 5J5TA 3ERKA 2UW5A 3DDPA 3V5JA 3AT3A 1Z57A 3PIYA 4C33A 2PPQA 4DFNA 5BUJA 4NL0A 4XYFA 4ALUA 5E92A 3W2CA 5IA5A 2WMBA 3I6UA 5C8MA 4FOCA 2R3IA 3IW4A 2J5FA 4IW0A 3LMGA 1OECA 3WYXA 5AV2A 3I60A 2CKQA 4IM3A 2QCSA 3RI1A 3UQGA 3PPZA 4CYIA 1QPDA 4NUSA 5HZNA 1XH5A 4P7EA 4ZOGA 5EI8A 2IN6A 3BHVA 2QG5A 3TKUA 3UOLA 2VX3A 4F1MA 1XO2B 2YAKA 4GS6A 3SW4A 4AP7A 2ZMDA 2XKCA 3GP0A 4ZS0A 4O7NA 1K3AA 5AV1A 3PVBA 3ZHPC 4FT5A 3EFJA 4HNFA 4QPSA 3HUBA 1OIQA 3F3WA 4QTBA 4QTCA 4UMTA 4AT4A 4WNOA 5JFVA 4ZP5A 3FY2A 2UVXA 2I0EA 4ZZMA 4N6ZA 3PJ3A 2ZV2A 1PKGA 4RBLA 3RPRA 3VBYA 4AA4A 3JVRA 2QONA 3NCGA 3QU0A 4FSMA 3LE6A 3LXKA 4IX5A 5A6NA 1TQPA 4MBIA 4DG3E 2IW6A 1BL7A 3UO6A 1WZYA 3QX4A 3MYGA 2BDJA 3UQFA 4FYNA 3W2OA 3TIZA 3CKWA 3ZBXA 3A62A 4D4YA 3VBWA 3QHWA 5F9EA 1NW1A 3LCSA 3ZCLA 3MVLA 4QMPA 4F64A 3FXZA 2F4JA 4D2TA 5I9YA 4MYGA 3P23A 2X9EA 4DTAA 2VTQA 3GEQA 3EN6A 3TJDA 5A4EA 1KOBA 3OC1A 4B6LA 2V5QA 4YJUA 3ZC5A 4RVTA 5CI6A 1H00A 1GIIA 2BVAA 2QOLA 3WOWA 2C6EA 3ENHA 3G6HA 4FTLA 3CY3A 3GU7A 3HA6A 4MXAA 4ZLYA 4JDHA 3MVMA 2WEIA 4E6CA 4WUAA 3FSFA 4C38A 5KMLA 3QCQA 5GZAA 4V0GA 2X7FA 2YABA 4RGJA 3P7CA 3WARA 2CN8A 5AP5A 4OTDA 3BE9A 3E88A 4JS8A 3UG2A 4M0ZA 4BICA 2R0UA 3F88A 1U5QA 3LQ8A 3QGWA 4Y83A 2ERKA 2Y8OA 1Q99A 1YI4A 4ZLOA 4QMYA 2W1HA 3O8UA 1GOLA 3BIZA 4ZY6A 2VTTA 3A4OX 5CAQA 3NUXA 4PNKA 1H0VA 4YTFA 4Z16A 1YDSE 4EK6A 4ALWA 4DH8A 3FLWA 3K54A 4CLJA 2OI4X 3GBZA 4GFGA 4J97A 1URWA 4OTGA 3E62A 4P2KA 3UIMA 4AF3A 3DNDA 3NEWA 4UYNA 4OLIA 4OAUC 4KNBA 2XKEA 4EZ3A 4IJPA 4L3PA 1YVJA 4NFMA 4L6QA 5IUHA 2YZAA 1F3MC 4IWDA 3Q32A 4UMUA 4I6FA 2P4IA 2OBJA 1WBNA 2YJSA 1WBOA 4O84A 4K11A 2IVVA 4MNEB 5CQWA 4DFUA 2BAQA 3E63A 3P78A 2W1EA 4FTCA 1KE5A 3KCFA 4FTAA 3VBQA 2VD5A 1ZMUA 1UNLA 3BGQA 2QVSE 2WTVA 3QX2A 4OTHA 4PF4A 4N57A 1QL6A 3KF7A 4E20A 5IQIA 4JRVA 4YTCA 3E7VA 4EOQA 4NM3A 2OSCA 4R8QA 4RVKA 2GFCA 1MQBA 1Q97A 3ZSGA 1YOJA 4QMTA 4RJ5A 3VW8A 3ORXA 1J1BA 4F08A 5BYYA 1R39A 2Z7SA 5DEWA 1M7NA 2Z60A 5AP4A 3VBXA 4EHGA 3F3TA 3KEXA 3OY1A 4EH6A 2WXVA 4M15A 1UWJA 3BE2A 4BY9E 4W4VA 3VUTA 3LVPA 4NTTA 4RWKA 4FIHA 2HOGA 2R64A 4QP7A 5F1ZA 3QZGA 4Y8DA 3OEFX 4YHJA 2J0LA 4L46A 3M11A 5T68A 3ZUUA 2J0MB 2OIDA 1JKTA 5LWMA 5GHVA 2BRGA 4FV7A 4FUXA 3U8WA 3R7EA 1YHSA 3HV3A 3P0MA 3SXFA 1Y57A 2HELA 2ITVA 5CNNA 3W8QA 2JGZA 4ITJA 2XYNA 2YWPA 3PY3A 4C3PA 5BVKA 4YNOA 3EB0A 4IVCA 2YDJA 3DNEA 3HUCA 2X7OA 4U40A 4WRSA 5HIDA 5M55A 3V8SA 5A54A 5AAGA 5JFSA 3V6SA 1BYGA 3R6XA 1Q8YA 4QP8A 1Y8GA 4W4XA 5GNKA 1OL7A 4XV9A 3NUAA 4AFEA 3TUDA 2DS1A 4CRSA 3G51A 2O3PA 2W17A 3N51A 1ZZLA 4YNEA 3F7ZA 3I79A 4GYGA 5CAPA 4USDA 4U45A 3ZDUA 3ZO4A 4UBAA 2Y6OA 4FIJA 3HV5A 4X2KA 2ETMA 3EZRA 3KQ7A 4L52A 3VW6A 4DH3A 4BZOA 2E9PA 5HICA 4K18A 5HNGA 1BUHA 4QYHA 3E8DA 4RIYA 4Y95A 2UZOA 1WVYA 3ACJA 3QRIA 5IUIA 3BCEA 4AE9A 4TYGA 4U3YA 4D1ZA 4E73A 2AYPA 2CLXA 4QP1A 4EC8A 3ORMA 5HNIX 4UZHA 2VAGA 2ERZE 2BIKB 3PLAE 2RSVA 3GC9A 3L9PA 3IKAA 4IAFA 4DA5A 5FDXA 4IIRA 4H05A 2HIWA 3GCUA 4TN6A 4E4MA 4F9CA 4H3QA 3RK5A 3PXFA 3BHUA 3SA0A 3LQ5A 2B9IA 3EL7A 4UMQA 4AZSA 2BZJA 3OUKA 5CXHA 4BI2A 1RJBA 3JPVA 5LXMA 3ZUTA 4I0TA 4KBCA 4WNKA 5LCJA 4BHZA 3DBCA 2YFXA 5CEIA 2ETKA 3BZ3A 2NO3A 4KSPA 5HG8A 2F2CB 4FF8A 4AX8A 4LRKA 4D1SA 3NUSA 3FWQA 1JNKA 4XCUA 2H6DA 2VTPA 4LUDA 3ZZWA 5EI2A 4CMOA 2JBPA 3ZO2A 5AX3A 3KK9A 3CQWA 1JSVA 2B9HA 2UUEA 4QO9A 3R8VA 5BVOA 3CQEA 3KC3A 3ORIA 3R9RA 2PZ5A 4EC9A 4GUEA 4G17A 4M67A 4CV8A 4EHVA 4XP2A 3V5PA 5JMSA 1ZY4A 5D12A 1YW2A 3HEGA 4E4NA 4DE4A 3TNQB 1YOMA 1PXMA 3L8VA 3R7OA 4I21A 4IB0A 4QRCA 3NCZA 3LFAA 3HDMA 1WBTA 4HCUA 4L67A 4N0SA 5CVFA 4YGAA 3TXOA 4KIPA 1SVHA 4FODA 5FBOA 4AA0A 4S33A 5AEPA 2XS0A 2HK5A 4RLLA 4D4RA 3UZTA 3FYJX 4P5QA 1REKA 4PTGA 2WKMA 4D0XA 2F7EE 3C5UA 3ZLXA 4G3EA 5D9HA 3C1XA 2GSFA 3HA8A 5JH6A 3V8WA 2WTDA 2HWOA 1H24A 4UV0A 5CWZA 2B9FA 1XKKA 4O7SA 2DYLA 4EZ7A 5GZ8A 4NH1A 3KULB 3RHKA 5CEPA 2O64A 4FSTA 5GIOE 3VWAA 1OUYA 3RGFA 4WBBB 4RC2A 5CEMA 1KE6A 2WFYA 2WMAA 3OCTA 3DQXA 4I23A 5EI6A 4C4JA 4JDKA 5IMXA 3H30A 4II5A 1YDTE 4BWXA 5HG5A 3GT8A 5LVPA 1AGWA 4PL5A 3FLYA 4FV8A 4AAAA 2ITNA 3R7VA 3TUCA 4CFXA 5FRIA 1XBCA 4L01A 4RPVA 3EFLA 2PMOX 3QZHA 4YJRA 2GNJA 4RX9A 4A9UA 4AGWA 5E8VA 3P7BA 3UZRA 3V5QA 4FL3A 4QMQA 5AR2A 4TZRA 4KBKA 3ANQA 4FTTA 1UA2A 1CTPE 2VWXA 4BI1A 5E1SA 3RZBA 3KXHA 4FL2A 2F49A 2CKOA 3ORKA 2XNGA 4IB1A 2HXLA 5C4KA 3UC3A 2W1DA 4M8TA 3FY0A 3GVUA 4D0WA 2OJ9A 3DFAA 4C57A 5AUUA 4O0UA 1PXLA 1Q5KA 2OW3A 3ZYAA 5AP2A 5AUTA 2V7AA 2OJIA 3MW1A 4YJNA 5TOZA 5A4QA 2CNUA 1OBDA 4ZMEA 5IQFA 3GQIA 1W0XC 4L7FA 3ATSA 2FSMX 1DAWA 4KAOA 3ZONA 1Q8WA 2GS6A 4IWQA 4RZWA 3KREA 3ZSIA 3R04A 3LKMA 4ANQA 2B7AA 5LMKA 5M4FA 4YO6A 1R0EA 1FBNA 3KB7A 1PF8A 4GVAA 4ASDA 3E92A 5IQDA 4RRVA 3SVVA 3W2SA 2WMVA 4ACGA 5AA9A 4FTRA 3EQFA 4XUFA 3BU5A 2GNLA 5AP0A 4W4WA 4FKSA 4EYMA 2UV2A 2W4OA 4D9TA 4E93A 3FI8A 1PW2A 4HVHA 5HLPA 3JR1A 1A06A 4HW7A 1TQMA 4MWIA 3MS9A 3PG3A 2HXQA 2W1CA 3OOMA 3ZOSA 5EKNA 3EQHA 4EK4A 4BB4A 3QD0A 2UZLA 3LJ0A 4DN5A 1OKWA 2UW8A 3C4CA 3OMVA 4DINA 4APPA 4DT8A 1UWHA 4HVIA 4X3JA 4C61A 3RHXA 4BDCA 3N4VA 2BIYA 2HAKA 4XG7A 4YJQA 2BROA 4MWHA 5FWKK 3N4UA 3VS3A 4YU2A 4YTIA 4LRJA 3TKIA 5TF9A 3ACKA 4CZUA 1A48A 2VO0A 4IE9A 1H27A 5CXZA 2CGXA 4IAAA 4FSUA 1DS5A 3Q3BA 3TI1A 2HW7A 4DFLA 2WTJA 1M7QA 2X6EA 3L1SA 3QFVA 5HGIA 4FVPA 2WPAA 3VJNA 3ZTXA 4LGGA 3OEZA 4DLIA 2PY3A 2W1IA 3KVWA 4QOXA 2F2UA 1STCE 2JBOA 2BRHA 4ENXA 4AN2A 1DI9A 2E9NA 2YIYA 3MY1A 3WIKA 1H28A 4C4IA 3P7AA 1FMOE 2IG7A 5I9VA 3EHAA 4M13A 4MAOA 2C3LA 2EXMA 4LV8A 2UZTA 5EDRA 1Y91A 5KKRB 3FMMA 4EK3A 2VGOA 3OFMA 3W32A 4R78A 4PPCA 4ACMA 2PE0A 4G5JA 2BKZA 4RIWA 3KL8A 4ACHA 5AV3A 1ZRZA 5DH3A 2HENA 4RJ6A 1XH7A 3S4QA 3PLSA 1MRVA 5LVLA 2E2BA 1W83A 2RG6A 5DE2A 5AAEA 1ZYDA 5FG8A 3TZ8A 5DT0A 3F3VA 5ANGA 1ZMVA 4FSZA 2CN5A 3CS9A 3AOXA 4A07A 4FI1A 4G16A 2ETRA 3R8ZA 4M14A 3UNJA 3I1AA 3ZEPA 4RIXA 1VEBA 4C37A 2VTSA 5KZ0A 3HMOA 4D2PA 4Z7HA 4RQVA 1Z9XA 1NA7A 3C50A 2XK3A 3ENMA 2C3JA 1IEPA 3H4JA 1U5RA 4A4XA 2C6MA 4QP3A 3Q4ZA 3TIYA 5CU4A 4IFGA 3LFEA 1YHWA 4DFYA 3PXZA 2E9VA 2PVFA 4NW6A 4K8AA 4PDYA 3W10A 1XQZA 3NS9A 3HLLA 3BBWA 5DHJA 1JWHA 3DLZA 5A14A 2FO0A 1PMUA 5CT7A 3COKA 5T6KA 4PPAA 3A4PA 2WOTA 4AG8A 3ITZA 4ORKA 1SMHA 4M3QA 3BV2A 2GS7A 4QMZA 4LV5A 2W1GA 3UGCA 3P86A 5LMKC 4WT6A 2XM8A 3ZC6A 2XRUA 4BDIA 3QQKA 4G3FA 4ASEA 3QKKA 1IA8A 3CTQA 1CKIA 4FG9A 1ZMWA 3VUGA 3D4QA 3E8CA 2Y0AA 4CFNA 3TT0A 4YURA 2O5KA 2W4KA 4WIHA 4EH8A 4MBJA 3TN8A 2PZIA 3OXZA 5CAOA 4HGEA 3DGKA 3WZKA 3F61A 3BPRA 1CMKE 1R3CA 3ANRA 3FLZA 4MH7A 2CDZA 1UKHA 1ZXEA 4O0RA 4OW8A 3DTCA 4BF2A 4FEXA 2XKFA 2IZSA 3DKGA 2XH5A 4YHFA 4FG8A 4IAZA 4EOIA 3P4KA 4MX9A 2GQGA 4Y73A 3MTFA 3QC9A 2C6OA 4IX3A 4WRGA 2VTRA 5HD7A 4DGNA 5E8ZA 4UB7A 4ZTLA 4JX7A 4E3CA 2R3KA 2JFLA 5CLPA 3MPMA 3OXTA 3C0IA 3EWHA 5IH5A 3VUMA 2E9UA 3E7OA 1YXVA 4GJ3A 3KA0A 3BBTB 3LFNA 4FV9A 2JDVA 5TO8A 5H8GA 5K5NA 1ZYJA 3R0TA 4L43A 4KIKB 4ZSGA 4ZEGA 3SXSA 2G9XA 1NVRA 4MD8E 2XA4A 4WG5A 2W1FA 3MGYA 4BBEA 4IHPA 5HX6A 3PXYA 2EXCX 2VV9A 3EN7A 4WNPA 4ZSJA 2RFSA 3R7UA 4CSVA 1OPLA 3NPCA 4M69B 3I7CA 5AV4A 2JDOA 2R3NA 3CY2A 3OCSA 2A4LA 2W9FB 4LG4A 4ANMA 1OBGA 5EQEA 3R9OA 5IDNA 2QR7A 3UMXA 3A7IA 3PPKA 4FKLA 4XG2A 3EQIA 2R3HA 1KUTA 5CNOA 1U54B 5G1XA 1HCKA 2H96A 3UNKA 2QHNA 5AR4A 5BYLA 2OXDA 4FTJA 3RVGA 4AGUA 2V0DA 4BTJA 2I0YA 2XEZA 1PXKA 4L7SA 3D2IA 4GK4A 2YIRA 4EOKA 3AC2A 4L8MA 4S30A 1ZOEA 3HP5A 4O7YA 4AT5A 4IVAA 4L3LA 4YO4A 1P2AA 4NEUA 4F99A 1JKLA 3QTUA 4XBRA 1PXPA 1YI6A 3GFWA 3NVKI 4TNDA 2I0HA 4LL0A 3RZFA 3KXZA 4FSWA 4IH8A 3SXRA 4IWOA 2VWZA 4BVUA 4FL1A 1Q62A 2Y9QA 2QOKA 3FSKA 3DFCB 2VTAA 5CU3A 5LQFA 3QZFA 5HQ0A 5C8NA 1P14A 1Q8TA 4KRDA 2VTOA 2YACA 5K0KA 2OFUA 2OH4A 5EM8A 3SRVA 4FICA 2WIPA 3ROYA 3W55A 3ZDIA 2YCSA 4H58A 3FPQA 4BIBA 4C4FA 2H9VA 2W5HA 5HE0A 3NVMB 2DWBA 1SNXA 4HPTE 2PZYA 5DGZA 4OT6A 4O38A 4GK3A 4ZSAA 1QPEA 4I93A 5K3YA 3BHHA 4EBWA 4CG9A 4XMOA 4D5KA 4YJTA 3IQ7A 4BDEA 4O21A 2UZEA 5I0BA 4ZTSA 5M06A 1GZNA 2J0KA 2PUPA 4QQTA 1JOWB 3IW6A 5FTGA 2XF0A 3MA3A 3G15A 3DBQA 3VF8A 4IM2A 1NY3A 3NUYA 3BYVA 4B4LA 2PVKA 3PVGA 3NUPA 1V0OA 2IVTA 4PPBA 3BGPA 5AUVA 4EL9A 3Q5ZA 2IVSA 2GQRA 3G9NA 5FTQA 1VYWA 3TWJA 2UVYA 3HRBA 2REIA 3VS0A 1O9UA 3L9LA 1JAMA 3DK7A 3SDJA 4JDJA 1Q4LA 5H8EA 1RQQA 3RNIA 3LAUA 3QWKA 3EN5A 4GUBA 2VU3A 4IM0A 3MIYA 4PMPA 4QTDA 5JN2A 1T45A 3TCPA 3U6IA 2JAMA 3BHYA 4I20A 4NCTC 3EQDA 5D7VA 1OIYA 5M07A 4CV9A 2JKOA 1GZKA 4XV1A 4O0SA 1WCCA
chains in the Genus database with same CATH superfamily
2R3FA 3BYOA 5I9ZA 5HTCA 1PMNA 1JLUE 5HE3A 4GIIA 4FEWA 3RNYA 2W96B 2XK4A 3PVUA 3RM7A 4BWKA 2IZUA 2J6MA 3OHTA 5CX9A 5E9EA 4IWPA 4BR3A 2QOCA 3IS5A 4IFCA 3PY1A 2BDFA 3LCDA 3FMHA 3RKBA 3BLQA 4D58A 3SX9A 4PMTA 3IONA 5M4CA 5ANJA 4FEQA 5F20A 3G0FA 4QMWA 4USEA 1ND4A 3HL7A 4H3PA 5EW9A 3QD4A 1W2DA 4ERKA 5AIKA 4L45A 3D5VA 3E3PA 5I9WA 5CF6A 4FX3A 5EOLA 2PVJA 4RX8A 3R22A 3S3IA 4C58A 4GSBA 2RIOA 3NDMA 5EW3A 2O0UA 5EOBA 3MB7A 4NJ3A 2X39A 4GFMA 3VVHA 3MPAA 3CC6A 4MD9E 4FBXA 4WOVA 1PMEA 3KMUA 5AM7A 3W1FA 3ZH8A 2XM9A 3FPMA 1NT2A 4G2FA 4PDSA 4F9YA 1WBWA 2FUMA 2R9SA 5AP6A 3RINA 4F7SA 4I6HA 2YCFA 4B9DA 2KTYA 3FL5A 3PZEA 5FGKA 3SOAA 1OITA 1JSUA 1PJKA 3F5UA 4UY9A 2WU7A 4BCPA 4LQMA 3UVRA 3PYYA 5HBEA 3Q9WA 4U9AA 3HV7A 4TYHA 5DYJA 4JLCA 4O1PA 3ULIA 4YZBA 2DUVA 4IX6A 2UZDA 4GK2A 3N9XA 3MVJA 4X2GA 2WQBA 3FLQA 4J71A 4PL4A 5K9IA 1XWSA 4XG4A 4G6NA 2VUWA 2QOQA 3AG9A 4YBJA 4OTQA 5HESA 2QC6A 2WOUA 4E6DA 4DG2E 1YXXA 3ORTA 4TPTA 2ZVAA 3BV3A 1TQIA 4JL9A 5AUZA 3O0GA 5ETIA 4XG6A 1BLXA 3K2LA 3LLAA 4BCKA 3F2NA 5HKMA 3OWLA 5AA8A 3M1SA 4PNIA 3WE4A 5GZ9A 5C8KA 3D94A 2PWLA 2X0GA 3POOA 4RQKA 5FXRA 3RPYA 3QRUA 4LOQA 3OT3A 2X4ZA 4XHKB 3QL8A 5CT0A 5CZIA 4C4GA 4BKJA 4EOOA 3CJFA 2VWWA 2VGPA 2XNEA 3NW7A 3O8TA 3P08A 3PY0A 4UEUA 4Q5EA 4ANLA 4FMQA 3KRLA 5EDQA 4M84A 1O6YA 5DMZA 3ATTA 3L8PA 3W18A 4HYUA 5K5XA 2PUIA 2YM3A 2IVUA 3U87A 2XIZA 3ZM4A 3NR9A 3SC1A 2ONLC 3RTPA 5M57A 2IEWA 4QDEA 4HYHA 3KRWA 2QO9A 3RPOA 5CYIA 1BMKA 4X21A 5D41A 3DB8A 3O17A 4C36A 1OL1A 5EQYA 4Z9LA 4ITIA 3GB2A 3GENA 2B53A 3G2FA 3HMIA 4CMTA 4LM5A 4F6WA 3WF5A 5ETFA 4YZDA 3IDBA 4L9IA 4QNYA 1J3HA 4F9WA 1F0QA 2QODA 4U41A 2W0JA 1M14A 4L3JA 2J2IB 4V0GB 2OG8A 4MTAA 4B0GA 3HP2A 4PL3A 3MV5A 2YHVA 2BCJA 4XG3A 4RIOA 4HCVA 5DRDA 3ZRLA 4JAIA 1CM8A 2XNNA 4RT7A 1PMVA 3WZDA 3VQUA 2ZM3A 3T8OA 5CEQA 3IK3A 5D7AA 3WBLA 4O4FA 3RCDA 1XH8A 4O91A 3ZO3A 5HCZA 2ITZA 5HTBA 1UNGA 4JI9A 3R00A 5DR9A 5AFVA 4G6OA 2PK9A 4EOMA 3FMEA 5HE1A 2B54A 2QOIA 3Q52A 3VUHA 3SGCA 1I44A 2WMXA 4R7HA 5IU2A 4GT4A 1ZOHA 5C4LA 2RKUA 2OLCA 1XHAA 3K5VA 2CGVA 4PV0A 5A4LA 2AQXA 2QOOA 1G5SA 2XNPA 4MVFA 3POZA 4K0YA 3EMGA 1WBSA 4A9YA 3P5KA 3CD8A 5C01A 3GQLA 3E93A 1KSWA 3DS6A 3F2RA 3OW3A 4CFVA 3HMPA 1FGIA 3DK6A 2WGJA 3TKHA 4ZAUA 4OTFA 4W9WA 3QTIA 5JRSA 3VS5A 4Y85A 1G8JA 3U6JA 1VJYA 4MXOA 2ZOQA 4MD7E 4CXAA 4EHEA 1GZ8A 2XRWA 4IVDA 4KBAA 4KS7A 3QRJA 4FGRA 3QKLA 4NTSA 4C59A 4O0YA 3H9RA 3W0PA 3T3VA 1K9AA 4ZJIA 1DI8A 3VS4A 3FKOA 5AP7A 3VHEA 5CSXA 3DXPA 2ZM1A 2GDOA 3FQSA 5DR2A 4IB3A 2J0IA 5DRBA 4WNMA 4EH7A 5HG9A 1ATPE 1XMMA 3KXNA 4RVLA 2G15A 5M09A 5AR5A 3RK7A 3V3VA 2KULA 2BDWA 2OF4A 4FIGA 4LOPA 1ERKA 4PWNA 3KU2A 5EQPA 3VIDA 3CKXA 4JBPA 3VAPA 5HU3A 4U5JA 1R78A 3FE3A 3FYKX 5C1QB 3CGFA 4Q5HA 3FBVA 3BKBA 3UC4A 5GINE 3D15A 4C34A 3ZSHA 3PFYA 4UWBA 3R1QA 5ETAA 3Q04A 1FGKA 5K4JA 4WHZA 3MFTA 3VS1A 5BMMA 4OT5A 2G1TA 2VX0A 4TNBA 4D9UA 1E9HA 3EN4A 4LI5A 5E8YA 4AT3A 4NK9A 3S1HA 1TZDA 1CDKA 2BUJA 3F7WA 1J7IA 4YZ9A 4JAJA 2JIVA 4UX9A 3D2KA 5FM2A 3IW7A 5J1WA 3DPKA 4JRNA 4YJPA 3E87A 3C51A 4NT4A 4UXQA 2IJMA 4FKTA 4QMXA 4AN9A 2ZDUA 3OWJA 3O7LB 2FSOX 2YAAA 4ZTMA 1WVWA 5HHWA 2XIXA 4HVGA 2JEDA 5JFWA 4LGHA 4WKQA 5KZIA 4ZTQA 2PL0A 2PUUA 5ANDA 3H0ZA 2CKPA 4RX7A 4PTEA 5CS6A 2P0CA 3RP9A 2XAOA 2J0JA 3AMAA 3LLTA 3NYXA 4FTOA 3FC2A 3NYVA 4ID7A 4KINA 5HEZA 2IW9A 2X9FA 4C4EA 2ITOA 2W99B 1E1XA 3BGZA 1XH6A 4RIYB 1YWVA 4JIKA 4XRLA 4YZCA 4O4BB 1EH4A 2Z2WA 4A4OA 4O0WA 2C5NA 1ZYLA 2ZV9A 3DOGA 4V04A 3ORPA 2FSTX 3HV4A 4M66A 3GU4A 3OWKA 5D1JA 5CF8A 3FKLA 4TW9A 2IZTA 3F9NA 3OD6X 3U9NA 4EH9A 4ZY5A 4I94A 3KMWA 3AD5A 1J91A 3G90X 1SM2A 4RWJA 3B2TA 4F1TA 2AUHA 4MXZA 1FMKA 5BVWA 4YTHA 3PJ1A 1PY5A 2C4GA 4IANA 2R3MA 3TNHA 4ZK5A 4ZTRA 2OZAB 4JT3A 4EOPA 4JMQA 2RL5A 4HPUE 4P5ZA 4AU8A 4HVDA 4A9TA 4QTEA 3LFCA 3W0MA 1U46A 3S00A 2I6LA 3RJCA 2J50A 3GCVA 3ZRMA 5JGDA 3HAMA 4CGAA 3KULA 3JVSA 3MDYA 4E5BA 5EHYA 5A6OA 1H0WA 5I4NA 5I9UA 3V51A 2X0OA 3R1YA 2J9MA 3OCBA 4I41A 3MVHA 4A4LA 4LL5A 3OY3A 3TZMA 1KOAA 2Y7JA 4G31A 3FZRA 5DLSA 4DTKA 3LQ3A 2J5EA 3DT1A 3FZPA 1Q8ZA 5GJGA 1YXTA 4FTNA 3D7TA 5E1EA 5I3OA 4D4VA 3QRKA 5ANEA 4ZMFA 3WYYA 2ZV8A 4GJ2A 2J90A 1V0BA 3DBEA 1H4LA 1F5QA 3O71A 4MXYA 5FUTA 2PMIA 3ZMMA 3PDTA 1LPUA 3ID6C 3NIZA 2CNQA 5EM6A 2WTIA 3SQQA 3ETAA 3P1AA 4MNFA 4KD1A 2WB8A 3QTXA 4PRJA 4FKJA 4YC3A 4BBMA 4EUTA 1O6KA 3U6HA 4AXDA 5EHOA 2ITXA 2BTSA 1WAKA 3OTVA 4DEEA 4RC4A 3WZJA 1VZOA 4BCFA 4XOYA 1Y6AA 1UU3A 5DA3A 3PTGA 3HMNA 3DKOA 4PTCA 2C1AA 3BI6A 2C5VA 3TDVA 3UOKA 4W8DA 1H08A 4J53A 4QQCA 4J1RA 4J95A 4F09A 4ANOA 4HYSA 3R83A 4OUCA 5DPVA 4G34A 4AN3A 2JDSA 4AW2A 4FYOA 2UZBA 4MXCA 4KB8A 4O7LA 4O0XA 1YWRA 4D1XA 5M56A 2P55A 3NNUA 3RAIA 2BZHB 4B7TA 1IAJA 3DXNA 4AQCA 5IEVA 3AT4A 4EOSA 3E8NA 3EZVA 3IG7A 3Q60A 5C27A 4F7JA 4FK6A 4IXPA 5CU0A 4UMPA 3CTHA 4QQ5A 3EH9A 4FTUA 3QA8A 2RFEA 5AIRA 3I81A 2JAVA 5DNRA 2NYAA 4GRBA 1GY3A 5E8TA 1LEZA 4DFBA 3H0YA 1ZYCA 2V7OA 1WMKA 3E8EA 3KN5A 4K9YA 4N6YA 4TWOA 2NRUA 3UO4A 1FVTA 3TL8A 4DEBA 3DBFA 4JG6A 4XS2A 3T9IA 2Z02A 4F70A 2WTKC 3PRFA 3HKOA 2YLFA 3KY2A 4XP0A 5JZJA 5J7HA 3DTWA 3Q4CA 4XJ0A 5ANOA 4AOIA 4CT1A 3EFWA 2UZWE 5IA4A 3CEKA 2ACXA 2QLUA 3FZ1A 3UVPA 2VWVA 2R2PA 5LMBA 2ZDTA 4XG9A 3I6WA 4NWMA 3T3UA 4F9AA 1A9UA 2QOBA 3QWJA 2CCIA 4FIEA 4TWCA 4U80A 1RE8A 2VN9A 4I6QA 4QTAA 4ACDA 5CANA 2GHMA 3C9WA 3LFBA 3H9OA 2X2KA 3PFQA 2IF8A 4QYFA 2WU6A 4KKGA 1HCLA 3CD3A 3MTLA 4GEOA 3MIAA 3ZBFA 4ARKA 5IEXA 4DHZA 3CR0A 2VX1A 5HLWA 2XK7A 1YQJA 4HZSA 5AADA 5BVFA 4EI4A 3DZOA 3C0GA 3GI3A 5DBXA 2YLEA 2CKEA 2ZMCA 2EWAA 4FVRA 4Q2AA 3AT2A 2BFXA 4FKUA 1B6CB 3QKMA 2A27A 4KIOA 2XP2A 3R1SA 4FZ6A 4GG7A 3EQPA 3I0OA 3PG1A 5CY3A 5EKOA 5ACKA 1NVSA 1OB3A 4GVJA 2R3LA 4DBNA 5CAUA 3R01A 4RJ4A 1G3NA 4BDKA 2OF2A 4ZTHA 5KUPA 2ZFYA 5DFPA 4Y5HA 1GIHA 4RA5A 3SOCA 1OI9A 5KMOA 3MESA 3W0OA 4KIQA 2FSLX 3TV4A 3VUIA 2UW6A 3R30A 1CKJA 3LJ1A 3LZBA 5FD2A 5IQCA 5J5SA 3U55A 4AGCA 4C7TA 5L2SA 3OBJA 4DHIB 1KE8A 3BWFA 1TKIA 3NZ0A 4ANSA 4C02A 4XV2A 2C6IA 3EQBA 4O82A 5KHXA 4BCIA 2YEXA 3PUPA 5IH6A 1R1WA 5DT4A 4BDHA 1ZY5A 4G3CA 1PKDA 4FC0A 3LMIA 1R0PA 4PMMA 4FV0A 3VS6A 2BMCA 4QMLA 4J7BA 4FTMA 3TZ7A 3FZOA 3JY9A 3FQEA 4HVSA 4NIFB 4BCHA 4DCEA 3FXXA 4AZTA 2YIXA 4WG4A 3UG1A 4P90A 5I3RA 4O7ZA 3CGOA 3KRXA 2OIBA 4HGLA 4DT9A 2VWIA 3DAKA 4BTKA 4K2RA 2WMRA 3ODZX 4AW1A 2C6DA 3UVQA 1Q3DA 3EQRA 3Q9YA 3NMUF 2X0PA 4IEBA 5AM6A 2J51A 4L68A 3NUNA 4FV5A 3SKCA 2C69A 4G1WA 4F65A 5M4IA 3VC4A 5AAFA 4CD0A 5HBJA 3R8UA 3LJ2A 3PJ2A 4MCVA 3KVXA 4RIWB 4WO5A 4AA5A 4BCGA 2QO2A 4O6LA 2W05A 4EH3A 2LGCA 5JGAA 5IQAA 4FKGA 3VUDA 4ZJJA 3KFAA 3DAJA 3ZLWA 4OR5A 3BEGA 2I0VA 4DGGA 4X6QC 2RG5A 3GCSA 4YUQA 2JIIA 3MH2A 3JY0A 3NAXA 4O2ZA 3ZFXA 3MA6A 4DAWA 2WMUA 1M17A 4GCJA 4RFYA 5IA3A 1IA9A 2QG7A 2WQMA 3HMMA 3GU6A 4FKQA 4GL9A 4YZMA 4BCOA 4DH7A 2UW9A 4QP6A 3Q96A 3R2BA 1IG1A 2EU9A 2GCDA 2VWYA 3WILA 4PDPA 4EOJA 5CSPA 1UKIA 1YWNA 5E7RA 4ASXA 1OUKA 1O6LA 2X2MA 4X3FA 2PMLX 4J99A 3F2AA 1LP4A 5J1VA 4DEGA 1W7HA 2UZVA 2AC3A 4I0RA 5LARA 3UE4A 4BGGA 4CKJA 3NNWA 2XNBA 4DF3A 5T3QA 4JVGA 2Q83A 1H1RA 3EOCA 1Z5MA 2BTRA 2QLQA 3ZXTA 5ICPA 5J7BA 4O6EA 5AWMA 4I4EA 3R8MA 4X7QA 2QNJA 3A8XA 4PMSA 4V01A 4F7NA 3ZZEA 5BVNA 5KMKA 3BX5A 2XBJA 1M2RA 4M0YA 3GOPA 4M68A 3O8PA 1K2PA 1OL6A 4NFNA 3QZIA 2F57A 2XK9A 1PRYA 4R3RA 3GOKA 3V04A 4ZJVA 5F94A 3I5ZA 4Y72A 4U8ZA 5CSWA 1OGYA 3MY5A 2BKKA 1W2FA 3CE3A 2ZAZA 5E4HA 5LJJA 4U44A 3O7LD 5CSHA 2QU5A 4M69A 4DFZE 2XMYA 3R7YA 1S9IA 1G8AA 3QAME 4QP9A 4HYIA 3TV7A 4O7WA 1Y6BA 3H9FA 4IVBA 4IX4A 2GNHA 3BU6A 2XIRA 2P3GX 2FB8A 5HIBA 4B99A 3M42A 1U54A 2PVRA 3KCKA 5CEKA 3UJGA 3D9VA 3W33A 3Q2JA 3GC0A 4UMRA 3QQGA 3R8PA 3S95A 2I1MA 4DH5A 2JD5A 4BYIA 2ZB0A 1J7UA 1QPJA 4FIIA 4IQ6A 5EYKA 1FOTA 5L3AA 2GS2A 2PUNA 3EFKA 2LAVA 4X2JA 3FMJA 3REPA 3ZLSA 3CCNA 1OIRA 2HZIA 4AWIA 1UNHA 5TE0A 4D55A 4U43A 1AQ1A 4WSYA 3PPJA 4CFWA 2AC5A 5AUYA 2NPQA 4H3BA 4GKHA 2P33A 4RMZA 4FIFA 2ITTA 3R73A 3LCTA 4YBKA 2ZM4A 3OW4A 4AACA 3E64A 5L6WL 3ODYX 4A06A 2CCHA 3QXOA 4YC6A 3MFRA 3LXNA 3PSDA 5ANIA 2QR8A 4DITA 3AMBA 4EH4A 3AD6A 3QA0A 3KKVA 3ML1A 3R63A 5IF1A 5H9BA 4FKWA 5H3QA 4BZDA 3VULA 5CEOA 3QALE 4LYNA 4JBVA 5EK7A 3HYHA 4YMJA 3RPVA 4YHTA 4ACCA 2R3OA 2XCKA 4O7VA 3TEIA 2FGIA 3COIA 3ET7A 4DH1A 2WZJA 4GFOA 4F6SA 3LMHA 1B39A 4BCJA 3GNIB 4JG7A 4LGDA 3TNWA 3WF8A 4AXFA 1FVVA 5L8JA 5H2UA 2WMWA 4DEHA 4QD6A 2QQ7A 4R7IA 2OKRA 3GU5A 4NM7A 5IH4A 5J9LA 4R5YA 3FZSA 2PE2A 4BDGA 3PXRA 2OU7A 4I1ZA 5ETCA 5HU9A 2YITA 2EB3A 1GIJA 1ZYSA 5BV3A 4FE2A 3TNIA 1UVRA 2IWIA 2JKMA 2OGVA 4QYYA 3FI2A 2YM8A 3QGYA 5J87A 4AE6A 2B0QA 3LIJA 4C8BA 3LFDA 2O2UA 1PYEA 4IMYA 3CIKA 3HZTA 4GH2A 3KK8A 4D5HA 4K6ZA 2C0IA 3Q4TA 3GU8A 3DBDA 4E6QA 4FV2A 1YOLA 3HRFA 3KXGA 4FNZA 4FTQA 4X3FC 3SRVB 1L3RE 2O63A 2YDIA 3W2RA 3QUDA 4UYAA 4CRLA 3U51A 3KGAA 3M2WA 1CKPA 2F7XE 2ZB1A 4RJ7A 3FLNC 4I22A 5HVKA 1H26A 4JQ7A 2HZ4A 3O2MA 4BDFA 1L8TA 3VS7A 2QOFA 3BU3A 3W0RA 2CGWA 2J7TA 4RWIA 4GYIA 2JDRA 3PSBA 5EDPA 1OZ1A 5BVEA 4RX5A 3HGKA 5E8WA 5TKDA 3PIZA 5J95A 3DY7A 4ZSEA 3RM6A 1JBPE 2OH0E 3TJCA 4C62A 3UTOA 4DEDA 4EONA 3BQCA 5DVRA 3T9TA 1SVGA 3KN6A 3PZHA 4TWPA 4UN0C 4AQKA 4IAKA 5FBNC 5GJDA 4FT3A 4JR3A 2PVNA 1H1PA 4N4SA 4QMUA 3UMWA 5EFQA 3DV3A 5FQDC 5C03A 3IGOA 4MQ2A 5KMNA 5HCXA 3EYGA 5GIPE 3R7IA 3AKLA 3DLSA 3HDNA 4NM5A 4UWYA 2PVMA 3ROCA 2QO7A 3ZFMA 4F9BA 4HOKA 3AC3A 3R7GA 4JR7A 4EQCA 3DXQA 1M52A 2FYSA 2GHLA 4IDTA 5IQHA 4I92A 4S2ZA 2XZSA 2VTLA 2WD1A 2W5BA 4JJRA 3C7QA 2R3GA 3JUHA 2IZRA 5FP5A 4WG3A 3RPSA 4PY1A 3PRIA 3TG1A 2Z7QA 1OPKA 4G3GA 4U42A 3W16A 2C1BA 3MH1A 4RWLA 4Z7GA 1BX6A 3IOKA 3ORNA 2C0OA 5LOHA 4NKSA 3IO7A 4E4LA 3QQUA 3V6RA 4U97A 1HOWA 3NUUA 4CTCA 5IKWA 3DQWA 4IZYA 4AS0A 3CTJA 2Z8CA 3MJ2A 4F4PA 3SW7A 4JOAA 5KX8A 3P79A 4ZS4A 1IR3A 1GNGA 2YM6A 4OTWA 3F66A 4U7ZA 3SLSA 1ZZ2A 4FZFB 3L9MA 4NZWB 4RFZA 4DEAA 3BYUA 5TT7A 3NX8A 4HGSA 1OIUA 4RC3A 5HO6A 3VQHA 4FTKA 4FKVA 4CYJA 2NRYA 4WSQA 3MWUA 5M4UA 3ULZA 3TZ9A 4CZYB 4EKKA 3UOJA 5HG7A 3IDCA 3PA4A 4R6VA 1Q61A 3OCGA 1FINA 5JZNA 1I09A 4KKEA 1H1SA 5KCVA 4AOJA 3O23A 2YM7A 5EYMA 3W8LA 1OKVA 5K4IA 3AKKA 2Y4IB 4XP3A 4D4SA 3FXWA 1J7LA 1IASA 3SD0A 3E3BX 4QQJA 5LVOA 2BZKB 2F9GA 4PX6A 1PYXA 2ITYA 3DKFA 4G5PA 4BTFA 3ZM9A 3QLFA 1PXJA 5EH0A 2JIUA 2DQ7X 4RJ8A 1ZAOA 4QMOA 2FA2A 4P4CA 4AGDA 1H1QA 5KHWA 5JKGA 3K3IA 3AGMA 3DCVA 2I40A 3PJ8A 3RAKA 4BCNA 3LXPA 2XCHA 4TYHB 1ST0A 1WBPA 3QRTA 2GTNA 4O27B 2VO7A 3UODA 2QKRA 2QOHA 3VBVA 4FNXA 5CVHA 3VNTA 4NJDA 1MP8A 3FMLA 2XVDA 4CZTA 4YPDA 5KBQA 5BPYA 1XJDA 4MKCA 4E7WA 4TT7A 4LMNA 4M12A 4FEVA 3U54A 3D7ZA 2B52A 3A99A 3CP9A 4S34A 4DCAA 5IQGA 4EBVA 4BDBA 3VBTA 3V5WA 4D2RA 3F69A 2PTKA 4B8LA 3HVCA 4FGBA 1IAHA 3NYOA 4IDVA 2A0CX 4TKSA 4ZZOA 1VR2A 1WBVA 2JLDA 4H36A 4PP9A 4FUYA 1YXSA 3MPTA 5DT3A 4XH6A 5BVDA 5BYZA 1W84A 3IPHA 5B2KA 2FH9A 2WIHA 3I7BA 2R3QA 2HZ0A 4MNEA 2YWVA 4AZEA 2R7IA 4I5MA 5L6PA 4F0FA 2Z7LA 5KMMA 3WIGA 4IB5A 5IG1A 5JRQA 3HAVA 3JS2A 2UZNA 4G9CA 4QEBA 4FZDB 2QURA 2WEVA 5EYCA 2OXYA 2BALA 3EKKA 3C4FA 4FNYA 2W4JA 1GZOA 3DA6A 4KUJA 4CQGA 2H8HA 2JFMA 3KRRA 4RLKA 4BGHA 4DC2A 2WHBA 4QT1A 4RG0A 4RSSA 4YJSA 2QD9A 5CASA 2C68A 4OBOA 1OGUA 4FVQA 3O96A 2BHHA 1PXNA 2CJMA 3VS2A 2VWBA 4OTRA 3QF9A 5AUXA 2C47A 2OJJA 4IJ9A 4J8MA 2V62A 1WFCA 3IDPA 3MJ1A 5KNJA 2OFVA 4CG8A 2BILB 2ESMA 2ZYBA 4F63A 2R5TA 4BC6A 2BFYA 2YISA 4YP8A 2GTMA 2W1ZA 3KIOC 2ZV7A 1LR4A 3TTJA 2RFNA 3V8TA 2C6LA 3U4WA 4DEIA 2Q0NA 2Y4IC 4MHAA 4AXCA 4U0IA 4BHNA 2YZLA 4O22A 3R21A 2I7QA 3K3JA 1WVXA 4EK5A 4FOBA 4EYJA 3ELJA 3OTUA 4TYEA 1OVEA 1P4FA 2Z7RA 4TWNA 3UQCA 4HZRA 4Z3VA 3QQLA 4AZWA 3D5XA 4ANBA 4CKIA 2X4FA 4EJNA 4YJOA 4DG0E 3A7GA 2OJFE 2PVLA 3HECA 4U79A 1T46A 3VRYA 1RDQE 3PVWA 3ZU7A 3DJ6A 3CLYA 4PDOA 3AXWA 4CKRA 5JEBA 2XJ2A 3VO3A 1CSNA 2VO3A 3RAHA 4NW5A 4YPSA 5CQUA 4GU6A 4TY1A 3F5XA 1JQHA 4TL0A 2NP8A 4FZ7A 3V01A 3PA3A 5JK3A 4Y5QA 3WI6A 4C2VA 2W7XA 3GGFA 3QQFA 1GAGA 4CCBA 3A7FA 3MFSA 4XOZA 3RBWA 5BX0A 1PXOA 2EVAA 2W5AA 3R28A 5BQ0A 4WUNA 4QNAA 3PSCA 4I4FA 3THBA 2VO6A 4OTIA 4XLVA 4E8AA 4EH5A 1NVQA 2UW0A 2VTJA 2R3PA 3MN3A 5B2LA 2B9JA 5AR3A 2A1AB 3DAEA 4O4CA 5CF4A 4YC8A 2BRMA 4D2WA 4IAIA 4USFA 1H07A 2PSQA 5H8BA 3UDBA 3GCPA 2C5XA 3ZFYA 1GJOA 3BHTA 2YA9A 2WTWA 2CNVA 4MUQA 5JQ5A 3C13A 4LDTA 3BQRA 4PQNA 5HORA 3R9DA 4XX9A 4AW0A 2HY81 1OL5A 5EW8A 3RWPA 2P2HA 4EQMA 3CPBA 1LUFA 3QBNA 2XEYA 3PIXA 3NNXA 2XALA 3FV8A 4AZVA 3UOHA 2C30A 4K77A 5C9CA 3EN9A 3N4TA 1JKSA 3MFUA 4CTBA 5B0XA 5EHLA 1Q8UA 4IC8A 1YKRA 5ACBC 3FQHA 3DB6A 1MQ4A 3CXWA 4YSJA 4QMVA 5L2WA 3FUPA 1H1WA 1W8CA 5FEEA 4GG5A 2VNWA 5L8LA 4F7LA 1FPUA 4I5CA 3FAAA 3H3CA 1JPAA 3EYHA 4JQ8A 5HOAA 2GNGA 3A7HA 3BYSA 4FK3A 2UW7A 4KA3A 3S2PA 2OZAA 3OUNB 4EHZA 5JQ8A 3W2QA 1URCA 4FTIA 5A46A 3NNVA 3QQJA 4BKZA 5IQEA 4XEYA 2W06A 4O0VA 5CVGA 2JKQA 3VUKA 3PXKA 2C6TA 4QP4A 4D28A 4E5WA 4EUUA 4QYEA 3KXMA 1OL2A 4JNWA 2HWPA 4V05A 4YLKA 2IW8A 4EK8A 3E5AA 2R0IA 5DI1A 3UNZA 4O2PA 2WTKB 4GIHA 4MF0A 4DYMA 3LFQA 4EWHA 4G6LA 5EYDA 3RALA 3VONA 5LVMA 5FXSA 3QTQA 2BPMA 2RGPA 4ANNA 1U4DA 2HZNA 3O5AA 3D5WA 3QTRA 2CGUA 3WZEA 2ITWA 3F82A 5A9UA 4BDDA 2CPKE 4BN1A 3NAYA 4FSQA 5CU2A 4FV4A 4JIAA 1LEWA 3OWPA 3MY0A 2YCQA 3BELA 4FT0A 5CAVA 3FI4A 3FMDA 3LW0A 5TR6A 1DM2A 1UU9A 4J96A 4LRMA 4PUZA 2YCRA 5KE0A 3OF0A 2CMWA 2WMTA 4J98A 4XNEA 2XYUA 3CPCA 3QTSA 3RAWA 3C4ZA 3QD2B 4GT3A 3NWWA 4JBOA 4RA4A 2GQSA 2WQNA 5FXQA 1TFFA 2ZJWA 1YDRE 5IISA 4KKHA 5LVNA 4G9RA 2VTNA 4I0SA 4YLJA 4S32A 1XR1A 4BDJA 2CSNA 3UBDA 4HCTA 5FP6A 1X8BA 4FG7A 2BHEA 4LFIA 5DN3A 4BGQA 4XG8A 5J9ZA 2FVDA 3U9CA 3AD4A 1KE9A 4N70A 5HNBA 4BL1A 3BLAA 2C0TA 4CMUA 5AX9A 1XH4A 5BUIA 5HO7A 4I5PA 4A9RA 3F6XA 2CHLA 3VJOA 3EQCA 3QCSA 4JXFA 4R1VA 4ITHA 1ZARA 3OXIA 3HRCA 2VNYA 3IW8A 2C6KA 2VRXA 3FJQE 4GV1A 4EZ5A 2HCKA 4E6AA 2AEGA 3FZTA 2H34A 2SRCA 3R1NA 3JYAA 4FV1A 3BEAA 3ZXZA 5IZFA 3D7TB 3KMMA 5HLNA 4O83A 4BZNA 3G6GA 2X81A 4I6BA 3I4BA 5IDPA 2YDKA 1DAYA 3C4EA 4WA9A 3B8RA 3I5NA 2YIQA 5AV0A 3R8LA 1YHVA 3AC1A 5IPJA