4F08A

Discovery and optimization of c-2 methyl imidazo-pyrrolopyridines as potent and orally bioavailable jak1 inhibitors with selectivity over jak2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
290
structure length
288
Chain Sequence
QFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery and Optimization of C-2 Methyl Imidazopyrrolopyridines as Potent and Orally Bioavailable JAK1 Inhibitors with Selectivity over JAK2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 288
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f08A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f08A01
2VTIA 4L00A 4C62A 4Z7GA 4W9WA 3V6SA 4KBKA 3ULIA 3C51A 2VTRA 4OT5A 5JKGA 2PVFA 3I60A 1YDSE 4UZHA 5A4LA 4AE9A 2CN8A 3BHUA 4GKIA 3PRIA 2QOBA 4ONAA 4IWQA 1XO2B 5LWNA 1WBNA 4RIWA 3QZFA 1PJKA 2ITUA 3FZOA 2G2HA 3LMHA 4BDAA 1YHWA 4FEVA 2XKCA 4FIHA 4DT8A 3EL8A 5BVWA 2OZAB 4QO9A 3NCGA 4KS7A 3BHVA 3A61A 3FMHA 5GIPE 1G8SA 2JDVA 1X8BA 3EQPA 3RNIA 4ALWA 1U59A 2HYYA 3UMXA 2G15A 3RMFA 4EH4A 2QHMA 2NRYA 3SQQA 5FEQA 4AXAA 4EC8A 4FV2A 5L2SA 3ZS5A 2PVHA 3NCZA 4A4LA 4AACA 4BGQA 3ZONA 3SRVB 2LAVA 3MVHA 4BN1A 3JR1A 5EOLA 5AV4A 4C33A 2JKQA 3TM0A 2OLCA 4LI5A 2C1BA 4M13A 4TYHB 1BI7A 1OKWA 3DAJA 4JR7A 4UY9A 4YJSA 4R77A 3AGLA 2Z7QA 4ASXA 3WI6A 4AGUA 3E63A 4BKZA 4IX6A 4X2NA 3OF0A 4MBIA 4O83A 2AUHA 3KXMA 3OD6X 5AUWA 3ZUUA 2CJMA 3C1XA 4RVTA 4BCFA 4ZMFA 1UWHA 4XG4A 2XK9A 5TOZA 4U40A 4EHVA 2PVJA 4E5BA 4IAAA 5LCJA 1H8FA 5FEEA 3VC4A 3QTZA 4O2PA 1F5QA 5CSXA 3EFWA 3I7CA 4D28A 3AT2A 2F9GA 4WSYA 1XH5A 1YWRA 2XRUA 2CSNA 3FDNA 1H1QA 3SDJA 4FIFA 3NAYA 4HOKA 3QBNA 3DJ5A 3SC1A 4TYIA 3CGFA 2UW8A 3MH1A 3R1NA 3MJ1A 5IH6A 4KWPA 1Y57A 3R0TA 4XNEA 4AG8A 4L53A 1W83A 5J7BA 4XBUA 5EYDA 4O82A 1OPLA 4EBWA 5EG3A 4BI1A 4L3JA 4DG0E 2VUWA 4XS2A 3UJGA 4B0GA 2P2IA 4NEUA 1WCCA 5L6PA 4U79A 4TT7A 4BKJA 3GC9A 3VO3A 4ZLZA 3CQUA 5KKRC 4I0RA 5JRSA 1AGWA 4QMVA 2I6LA 3LMGA 4X2GA 4BIBA 5KBRA 2CKEA 4G3FA 3DZQA 4KD1A 4FTOA 3FMKA 4FV6A 4K1BA 3QZIA 4IB3A 5E92A 4K8AA 4QMTA 1Q4LA 3EIDA 4J53A 3UDBA 4CRSA 2XNMA 3FMNA 4E20A 2PUUA 4KRDA 5CZIA 3A8XA 3KMMA 3FLNC 2XNOA 1ZWSA 4JRNA 4KRCA 5ANDA 4O7WA 2JITA 3CR0A 4C2WA 4ZSJA 3RTPA 5EM7A 4DAWA 3P78A 3EH9A 4FF8A 4M0YA 4Y72A 3WYYA 4C2VA 2XB7A 1CSNA 3NYOA 4FV0A 2XNGA 4W4VA 2DQ7X 3KA0A 3PUPA 4EOOA 3FQSA 4EOJA 3A60A 4PMTA 4EOKA 4H36A 4FV9A 3SW4A 3TUCA 2WIHA 2V7AA 4PV0A 1QPDA 3GC7A 4GU9A 5IDPA 3QD0A 3F3ZA 4FUYA 4CG9A 1Q8TA 4WO5A 2QKWB 1CM8A 3HV5A 4MXXA 4DGLC 2C6IA 3Q5ZA 3Q9ZA 4IX5A 4E4XA 4F7SA 2HXLA 3W10A 3QA8A 4RJ3A 5FBOA 3TEIA 1J91A 2X8DA 5FM2A 2WHBA 5K4JA 2GTNA 2R7BA 2XBAA 5I9VA 2QQ7A 3NUUA 5L6OA 3KN6A 3F3TA 3RI1A 2UZUE 4BDDA 4ANLA 3CTQA 2YFXA 4CXAA 3E7OA 2V5QA 3ORXA 2BRHA 5DN3A 4LL5A 4QQ5A 3HEGA 5HESA 4DEEA 4GT3A 2NP8A 4HZRA 3FC2A 1RQQA 3PY3A 3W2PA 1Q5KA 4F7LA 1STCE 2WMXA 3GQIA 3IONA 4FI1A 3VBTA 4BDJA 4IADA 3RNYA 4C3FA 4DE4A 5LVLA 2JAMA 4FKGA 4PPAA 3LCOA 5IUIA 5KZIA 4JAJA 5CVGA 4ZTMA 2WEIA 5K5XA 2WNTA 3GFEA 4U44A 3AC4A 2R3RA 3HV6A 4DCAA 2X1NA 4OTPA 4XP3A 3GCPA 1IA9A 4EOIA 4OR5A 5BUJA 4IFCA 5FXQA 1GIIA 3TNIA 1IASA 5HNGA 2BALA 3DOGA 4K9YA 3UC4A 3AOXA 3PSBA 5B0XA 3AG9A 4M14A 4EK8A 3ZUTA 4EOMA 5J9YA 3KXNA 4O2ZA 1TVOA 2PVRA 3GB2A 5K0XA 2WMAA 3N51A 3O8TA 3COKA 3JS2A 2R3QA 3QQHA 2BRNA 4FL2A 3CTJA 4ANMA 3DZOA 4RWJA 3UP7A 5L3AA 2R64A 3Q4TA 4AAAA 3P5KA 5IQCA 3ZDIA 4BCOA 4D4YA 2X2MA 4EQMA 3V5TA 4EK4A 1S9JA 4OTGA 1NVQA 3I5ZA 4IDTA 3ORKA 5FXRA 4IZ5A 5AP4A 4N6ZA 3BYSA 2VV9A 4JBVA 3D0EA 3R00A 4K2RA 3UO6A 3MB7A 4O0VA 4I41A 2HENA 4JLCA 4MBJA 3IOPA 4RPVA 4WUNA 5EDQA 2C30A 3OWPA 4Q9SA 5KCVA 4UX9A 4M69B 1SYKA 3BEAA 3KB7A 1WMKA 3PXYA 3QTRA 4IVAA 4NK9A 5EI8A 1FGIA 1WAKA 1RW8A 3ET7A 5M55A 3HA6A 2YIWA 5AUXA 4PNKA 1JKKA 2VO7A 4HGLA 5F1ZA 5BVKA 3Q4ZA 3AD4A 4KB8A 4RLKA 4GG5A 4ZEGA 4RA5A 3GUBA 4IHPA 2VTJA 3OY1A 1GJOA 4DT9A 1PXKA 1KOAA 2VTTA 2WMWA 3PPKA 5KKRB 1V0PA 2E9NA 2WQNA 3CP9A 1CTPE 3WZUA 1KE5A 4DC2A 5HCXA 3EMGA 5AAGA 5JGDA 2JBPA 3OG7A 1Q62A 3R9DA 2QU5A 2IW6A 3FMEA 3R1YA 2VU3A 4KIKA 4ZY6A 2RFDA 1GIJA 5EW3A 4FZDB 3LXKA 5DR9A 4TWPA 5C8KA 2BRBA 2HWOA 3VW6A 3DFAA 4OTRA 3QF9A 4D1XA 3TV4A 5E8ZA 4BGGA 4M84A 4MNEB 5F94A 3D5VA 3OT8A 3QQGA 4HGEA 2C3LA 5CU0A 3ZRMA 5IH5A 4IX3A 4NCTA 5AR8A 4C3RA 2A2AA 4GJ2A 4U5JA 1UA2A 4YNEA 3TNPC 5E1EA 2KTYA 1QPJA 4XHKB 2QO9A 3D9VA 4RZWA 4L7FA 3TTJA 3ZUVA 5J5TA 4IDVA 3QFVA 4FGBA 5E8TA 2R5TA 3IW5A 4FK6A 4FZ6A 4Y73A 3VIDA 3K3JA 3ROYA 3QTXA 3RM6A 2RG5A 4DG2E 4LMUA 5M4UA 3QD2B 2W1ZA 3U9NA 4IX4A 4LL0A 4O7VA 1OKYA 2PMLX 5A54A 5J9LA 4FICA 3ZC5A 1XQZA 4PL5A 3PXKA 2R7IA 4CKRA 5DG5A 2OH0E 2YAKA 3LQ3A 3V8WA 3A4OX 3KULA 4QMUA 4UWYA 4AZTA 5BUEA 3OY3A 3E3PA 3E62A 3P86A 4ZK5A 4HCUA 1QCFA 5T68A 3PWDA 3GU8A 4WG5A 3Q6UA 4PL3A 4G3EA 3UOKA 3FMJA 2R0IA 2W1DA 3O50A 1OVEA 4N70A 3UOHA 1VEBA 5HG5A 1BL7A 3VN9A 2GSFA 4IAFA 4U0IA 4FTKA 3RPVA 3EQRA 4KKEA 3FLZA 5CF8A 3DLSA 3Q5IA 3PA3A 4RA4A 2J90A 4M3QA 4YTIA 1OL6A 2YM5A 3CKXA 3SG8A 2OXDA 2UV2A 4MHAA 5CANA 5ANGA 5CAPA 4AFJA 3DB6A 1HCLA 3MPTA 1OGUA 4YZ9A 5AR4A 4FTRA 2EVAA 1M17A 5CQWA 5CSVA 2ESMA 4EOQA 5HBJA 5ANKA 5FP6A 4FSUA 2XKEA 2FA2A 4I92A 3P08A 3DNEA 3U4UA 3MFTA 4XG8A 2OI4X 4U43A 4FV1A 4IJPA 1UKIA 2UW5A 3BE2A 3QLFA 4IAZA 2VTNA 4QYEA 4FT9A 3M42A 4MD7E 3U6IA 1CDKA 4U41A 4ZTRA 4C4EA 4CEGA 5LXMA 4PWNA 3ZFXA 4BYJA 5M06A 2PMOX 3Q9XA 3IGGA 4G5PA 2XK8A 3WZJA 3COHA 4C8BA 2C1AA 4RC4A 4MKCA 4S32A 3RJCA 3LIJA 1M7QA 5I5ZA 4USDA 4YR8A 1SVGA 5HE2A 3RAIA 1Y8GA 1JQHA 2GCDA 4UMTA 3LFEA 4BTJA 5C01A 4DN5A 4XMOA 5AJQA 5JGAA 3HYHA 4QYFA 4I0SA 5E8VA 3U55A 2OG8A 1T46A 2YCQA 3BQCA 2VTPA 3NLBA 4C3PA 2RF9A 3FKOA 5AP3A 2HIWA 3DK3A 3TKUA 5AUUA 5EDRA 4F63A 4F7JA 5LOHA 1H1PA 2YISA 3OCGA 3WF5A 3TACA 2A1AB 1OM1A 2UW9A 5G6VA 3C5IA 2YLFA 3KREA 4FV4A 3QUDA 1IAJA 3EFKA 5ANJA 1REJA 2J0LA 2ONLC 3VS1A 4AF3A 4O7ZA 5KMMA 2R0UA 4ZXTA 3EWHA 4XLIA 4GK2A 4I5MA 4NUSA 5ANOA 3MGYA 1JBPE 2VNWA 1MRUA 4UZDA 4ZS0A 3WZDA 3DV3A 5DT3A 4A7CA 3DKOA 4QP4A 2XM8A 2P4IA 3HL7A 3UYTA 3ZZWA 3CEKA 5HE0A 1GNGA 3LFSA 3WARA 1G8AA 2BAKA 3FZSA 3Q60A 4YBKA 3GEQA 4IVCA 2ZV2A 5IEVA 2DYLA 3MPAA 4BTFA 4JDIA 3RWQA 3EB0A 4OUCA 3SHEA 3G51A 3NGAA 3WZKA 2YCRA 3R02A 4BC6A 4AN2A 4CFNA 2RSVA 3MVMA 3PYYA 4GUEA 1SVEA 1VYWA 3AD6A 3F88A 4G17A 3LAUA 4R3RA 3FWQA 3VULA 4MNFA 3ODYX 4D0WA 4OW8A 3P4KA 2UVZA 2P3GX 5JN2A 2GNIA 4V01A 2J4ZA 5HTBA 3V8SA 5JFVA 3NPCA 4USFA 2RFNA 2PZ5A 3ERKA 1JVPP 2NRUA 3FUPA 4IMYA 3U87A 5CAVA 2GHLA 5B2LA 5EOBA 3PZHA 4CKJA 3FXXA 3GU7A 1KSWA 2HY81 2VX3A 2F4JA 5CNOA 3U9CA 5FEDA 4ANBA 1FPUA 4UXQA 3BIZA 5BYZA 4D2TA 2OIBA 3DCVA 1BL6A 3ELJA 5FLFA 3BHYA 5JK3A 3C4EA 4O91A 2YITA 5HU9A 2WMVA 1S9IA 4NJDA 3MIAA 1RE8A 3ZLWA 4ZSEA 3NYNA 4GYIA 1MP8A 1JLUE 2C3KA 2GHGA 4D2SA 3SXRA 2FGIA 3BWJA 4KIQA 4ZS4A 3V5PA 3CQEA 4QMOA 1LUFA 4ZSAA 1FMKA 3NWWA 4TWNA 2J6MA 5ETIA 3TCPA 4KUJA 1PXMA 2CHLA 4EHEA 4TTHB 5KMKA 2ACXA 4FSRA 5BVEA 4II5A 3G9NA 4L45A 3MYGA 2PVLA 4C4HA 2C0IA 3ZFMA 3PPJA 3QWKA 4XYFA 1R0EA 3A2CA 2Y6OA 1IR3A 3D83A 4ZLOA 3H0YA 5IQIA 2IVUA 4KAOA 3EQBA 3OCBA 3S3IA 3P79A 4P5QA 4L8MA 4F09A 4R7IA 5JMSA 1J7UA 2W4JA 4R3CA 3A7GA 2H96A 2J50A 3MTLA 4I6FA 4J1RA 5L2QA 4CFXA 4BDGA 4O7TA 3JY9A 4JG7A 3WF7A 3MPMA 4IW0A 4V0GA 3L8SA 3T3VA 3ZBXA 3FI8A 4AZWA 4MCVA 3TTIA 4RG0A 5EI2A 3HNGA 4E8AA 3QZGA 2PVKA 4H3PA 3LPBA 3TZ8A 1H25A 3DDPA 3F5PA 1MRYA 4JX3A 1XH9A 5EM5A 5CEQA 4F6WA 4UN0C 1Q24A 5A4CA 3KF4A 3R7VA 1OMWA 4FGRA 1XH6A 3QXPA 5HHWA 5M4IA 3G33A 5E1SA 3IPHA 4NM7A 4GUBA 1FGKA 4E4LA 4NKSA 1SM2A 2EXCX 3EFJA 1Q3WA 3VUKA 2JKOA 3DXPA 3VBVA 3UNJA 1W82A 3R7IA 1GY3A 2R3OA 2W5BA 3BV2A 3MDYA 4RWIA 4V05A 4ENXA 4YU2A 3NNWA 4CYJA 1H28A 5BUIA 2VO3A 3ZXZA 2W4KA 5EKOA 1ZZ2A 4ASDA 3R04A 4FX3A 4DYMA 4HYSA 3TZ7A 3S00A 3F7ZA 3UC3A 3R30A 4FKOA 2XJ2A 4IM0A 3PLAE 4IAYA 3R8PA 3FMMA 4O38A 3UE4A 1PF8A 4P2KA 5AV0A 2YEXA 3GQLA 2B7AA 1ATPE 3HRCA 4CQEA 5M4FA 3R9NA 3C4ZA 3R7GA 4BTMA 2C6MA 4TYHA 2H9VA 2WTWA 2XA4A 4GL9A 3RCJA 3QX2A 3DFCB 3SGCA 4M15A 2F7EE 4U80A 5HO8A 2E9UA 4LUDA 3KF7A 4BL1A 4OBQA 3A8WA 2QC6A 5IA1A 2BCJA 4I94A 1OL5A 3DJ6A 5DEYA 3IS5A 2OJFE 1TQPA 3DKCA 3F2RA 3N9XA 3BLHA 2QG5A 1YOLA 3FHIA 3F82A 2C6KA 4RQKA 4DH7A 3HV4A 1Q61A 4JVGA 4ACDA 4XG3A 5AAEA 3F69A 5JT2A 4DLJA 4J8MA 2EWAA 3RHKA 4D9TA 4C61A 2WXVA 2Z02A 3DQXA 4IXPA 1V0BA 4LFIA 4RX5A 3FZ1A 4E26A 4L6QA 4P7EA 4QT1A 3ALNA 4O0TA 3CXWA 3U4WA 4Z16A 3ORLA 5CEMA 3BYUA 4RC3A 1E9HA 2VX1A 4HVDA 5C03A 1PYEA 3ZXTA 3BU6A 3PE1A 4G1WA 3NNXA 3OUNB 4YLJA 4ZZMA 1ZZLA 2ZDUA 4EKLA 3D7TB 1ZY4A 3ATTA 3TI1A 1O6KA 4BB4A 3M1SA 2PUNA 4ZY5A 3QD3A 3CGOA 3ENMA 3NR9A 3C50A 3Q04A 4PPBA 4EYMA 4DF3A 2RL5A 4PQNA 4RFMA 3KMWA 3ETAA 2GS2A 2JKMA 3ZSGA 2XK7A 3THBA 4FNXA 2P55A 3IW8A 1ZY5A 1R39A 3HGKA 4BCHA 4DFZE 1A48A 4F0FA 2F7XE 2VWBA 5I4NA 2J5FA 4BWXA 5CWZA 5CT0A 5FQDC 1ZOHA 2CCHA 2JDTA 4AA5A 4YJUA 3NUAA 4QNAA 1Y6BA 4GFOA 3L8PA 2REIA 4EUTA 2OFVA 3UQGA 2RFSA 2F49A 4L7SA 1OIRA 4G16A 3GOKA 4R78A 4WA9A 4ERKA 3FAAA 3UIMA 3ULZA 2B55A 1VJYA 4JBOA 2IZTA 2UZDA 4BWPA 5CASA 1XWSA 2Q83A 3OP5A 4LGGA 4CCUA 1GZ8A 5FUTA 5BQ0A 2BHHA 5KHWA 4U81A 5CVFA 2OIDA 4AZEA 1A9UA 3D2KA 4RVMA 1OL2A 2BFXA 1WBSA 4GVJA 3CTHA 4QMSA 5IQAA 5CU3A 4LM5A 3FMLA 4BCIA 3IW4A 2VTHA 3F66A 3R1SA 3IO7A 4DEDA 4NTTA 3RP9A 5KO1A 2X6EA 4FKQA 4RX7A 5C4LA 3ZLXA 2C5VA 1JPAA 1M2PA 2QLUA 4K0YA 3BELA 4LUEA 4CQGA 1VYZA 5DR6A 4EH2A 5IA0A 2DWBA 4YJTA 4U97A 3FEGA 3E8CA 5IQDA 4YSJA 4BBEA 4O81A 2WQBA 4QYHA 5KUPA 2QKRA 2YDKA 3OXIA 4IVBA 4B99A 2UZLA 3R8VA 1W7HA 4XRLA 3LW0A 3ACJA 2BAQA 3ATSA 4GMYA 4NJ3A 4CFMA 2IVSA 3V3VA 4ANSA 1XHAA 1U5QA 2BILB 4QTDA 3E5AA 4AUAA 3VUGA 4QP8A 3AGMA 3V04A 4ACHA 4FVQA 4W8DA 3QUEA 1URWA 2X9EA 4EH9A 3MWUA 2PE0A 1Q8WA 4W8EA 3F3WA 3ORIA 2SRCA 4YC8A 4ZIMA 4C4FA 4CZTA 3TL8A 4XG6A 4YP8A 1JKLA 5GNKA 4KIOA 5HLWA 3H0ZA 4M68A 5HOAA 3H9FA 4JAIA 5FD2A 4M69A 5E9EA 4DEAA 4CV8A 3OTVA 2X9FA 3GFWA 2FSMX 4ITJA 3F5XA 3OOMA 2XCKA 4MXZA 4X3FB 4F70A 1KE8A 4ALVA 4QP2A 4BCPA 1YHSA 5AP5A 1GZKA 4M12A 3SG9A 1YDTE 4TL0A 4O7YA 1Q99A 5B2KA 3PVBA 2BDJA 3PFQA 1J1CA 3LXPA 5LCKA 2X8IA 4OTDA 1I44A 1YXVA 3ZM9A 5AV2A 4BDFA 5CSWA 2C0OA 3M2WA 3ORNA 3QYZA 3VS4A 4E6AA 3LFFA 4ZJJA 5LMBA 4E4NA 3E8EA 3HAMA 2R3NA 1YXSA 4AW2A 3TDVA 3PXFA 5CU6A 4AW0A 3ZEWA 3KKVA 4EONA 4YBJA 3DBEA 4J8NA 4Y46A 3NVKI 4MAOA 3AMYA 3F3UA 4N0SA 4PMSA 2VTOA 5KMIA 1SVHA 2HELA 3PSCA 2O5KA 4YLKA 3FL5A 4FKVA 5E4HA 4I5PA 3LZBA 4A9UA 4TN6A 4KS8A 4QMNA 4FOBA 3GI3A 3OEFX 2CGXA 3BEGA 3CE3A 4G9CA 5C27A 3RBWA 4F7NA 3MS9A 3NUXA 3V5QA 2YHVA 3E64A 3R28A 2C0TA 2EB3A 3CQWA 4MK0A 4TYGA 5AWMA 4DEHA 2RG6A 3FZPA 5IQHA 4EK6A 1PMUA 2VX0A 4RWKA 4GU6A 4AZSA 5GINE 3MSSA 1OIYA 4FODA 2PY3A 3R6XA 3UYSA 1JKSA 4IAKA 5HNBA 3EFLA 3HMMA 3S4QA 3ZEPA 4ZY4A 4PF4A 4HGSA 2C6DA 3EZRA 4QQTA 1AQ1A 4I3ZA 4LGDA 3TJCA 2OIQA 2WTKC 4FTNA 2UZVA 4UMPA 3PZEA 3R2YA 4BCQA 5IQFA 4RSSA 3OWKA 1SNXA 3AC3A 4C37A 3E88A 5A4TA 3V5LA 2UW6A 4F08A 5A14A 3S0OA 5CAUA 3AT4A 2GNGA 2J5EA 3E8DA 3AMAA 3IW6A 3COIA 4G5JA 4BDIA 4QPMA 2W9FB 3NW5A 3DBFA 3GU6A 4A9YA 3AMBA 1JSUA 3VBQA 4BTKA 3MVLA 1GOLA 2R3PA 1YI6A 2E2BA 4D2WA 3ZO4A 1PXNA 3QTSA 4FKTA 3UVQA 2AC3A 4EQUA 2B54A 2LGCA 2XNEA 5CSPA 2WMSA 3LLTA 3NUYA 3OUKA 2WAJA 4RJ6A 4IM3A 5EQYA 3BYVA 3OWLA 4E5WA 4XV2A 5ETFA 3VUHA 3UZTA 2PZRA 4FTJA 4AT3A 2PMIA 1J7LA 3CD8A 2QVSE 2B52A 3MY0A 3ZRKA 4FG9A 3P9JA 5IUGA 3MI9A 3QGWA 3I79A 3R1QA 4NIFB 5EQPA 4H58A 5FTOA 1WVXA 2HW6A 3AC5A 3KMUA 4I4FA 3KU2A 4I4EA 5DH3A 4FUXA 3OXZA 3UIXA 3IOKA 3QRTA 3UQFA 3D7ZA 2CNQA 4AOJA 4J99A 3MFSA 3VF9A 5EM6A 4YPDA 1Y8YA 3IW7A 4RJ8A 4AA0A 3G5DA 3R63A 5TKDA 2UZNA 5ITAA 4FV7A 4QTBA 3FZRA 4L9IA 3UPXA 2W7XA 4C36A 2XK4A 3OBJA 1H08A 1A06A 2C3IB 1PXOA 3RPYA 4NZWB 4ZOGA 2V0DA 3MH2A 3NNVA 4FIIA 5CVHA 3OC1A 2IN6A 3NS9A 2P33A 4AWIA 1OPKA 4QQCA 4XUFA 5KMJA 3CPCA 2J0IA 3OBGA 2W9ZB 3OROA 5KE0A 3SOAA 3ZMMA 3NW6A 2FVDA 4XJ0A 4H39A 3Q2JA 2ZMCA 3PIYA 5KHXA 5FTQA 4HNFA 2VWUA 4WUAA 1H0WA 2HAKA 4H3BA 3VW8A 3IDPA 4Y85A 2YIYA 4G6NA 5DVRA 3T9IA 4C4IA 4CFFA 2CNUA 3VNTA 3B8QA 4U42A 3EN5A 3TNHA 3QTQA 4ZTNA 1PY5A 2OSCA 4FV5A 4FK3A 5A9UA 2YCFA 3FV8A 2V7OA 3KRRA 5M09A 1SZMA 5EYKA 2CGWA 2XIKA 2R3FA 5GJFA 2WU6A 4XG9A 4FL3A 4BHZA 3F2NA 4GCJA 4I5CA 4KSPA 4YZNA 5D1JA 4EZ7A 2GHMA 2OWBA 5J1WA 4DBXA 1BUHA 1IAHA 3II5A 3OOGA 1WZYA 3C4XA 5GHVA 4NM3A 2O63A 5JFSA 4IQ6A 2C5NA 3REPA 2H6DA 2GS6A 4K33A 4BCJA 2ERZE 4OBOA 3LCDA 4E73A 5L2IA 1W8CA 1M2RA 3V8TA 5IF1A 3GXLA 3PA4A 2XCHA 3MBLA 1YOJA 5EM8A 3K3IA 2OU7A 1ZYLA 4JDHA 2C69A 3U51A 1RJBA 3Q96A 2PVYA 2WTKB 4B8MA 4QPAA 3HAVA 3C4WA 3RVGA 3ZSHA 3HX4A 3OMVA 1UU8A 3ZLYA 2W0JA 3DA6A 1NT2A 3RZBA 4G3CA 2WPAA 3QTIA 5DT0A 4D55A 3D15A 2VTMA 4IWPA 4MQ1A 5AMNA 2OK1A 4FKJA 3FLQA 3QL8A 4J7BA 4QTAA 3DK6A 5AV3A 4F4PA 3SVVA 3W8LA 5E8SA 2QO2A 2XUUA 4O6LA 2ZB1A 4ACCA 1R1WA 4F9BA 3ZOSA 2IVVA 3QHWA 2XH5A 3ACKA 4K6ZA 4X21A 4FG8A 4B4LA 5HG7A 3AC1A 3L1SA 5CYIA 5IQGA 2YIRA 3F5UA 4I20A 4TW9A 5JQ5A 4BY9E 2YN8A 3NYVA 4O0YA 4RIYB 1NVSA 4GG7A 5ACKA 1M2QA 1IEPA 3UO4A 3K5VA 2RFEA 3HMPA 3LHJA 4FKLA 2B1PA 1SMHA 3KC3A 4FSMA 2BDWA 4RRVA 1P5EA 1XBBA 5ACBC 1OI9A 3FLWA 4GVAA 3RAKA 3TT0A 1H1WA 3UZPA 4EH8A 4R7HA 2PK9A 4RX9A 4S33A 5J9ZA 5DPVA 4O21A 3NYXA 4EH5A 4RJ5A 4WNMA 3LXNA 3OFMA 1DAYA 2Z7LA 4ZP5A 1FQ1B 3QQFA 2I0VA 3NNUA 3O8UA 3PP0A 4EL9A 4OGRA 2BRGA 5AP2A 3BGZA 5DWRA 3H9RA 2XK6A 4QP9A 2OW3A 4EZ5A 3VQUA 3FSFA 4O84A 4BBFA 5HICA 4AS0A 1B38A 1H07A 1UNLA 4CCBA 3QD4A 4V04A 4UYAA 3BHTA 5G1XA 4D2VA 4YJNA 4O7LA 4U45A 2ZV9A 4J71A 1QMZA 3FC1X 3ORTA 2OGVA 5DGZA 2ZB0A 4L3PA 5JEBA 1ERKA 1R3CA 2GU8A 3O7LB 4APPA 4FBXA 2ITVA 3W32A 4EUUA 1P4OA 3W2SA 2RIOA 4JR3A 1QPCA 4M7IA 4DEGA 5HBEA 3HDNA 5DRBA 3VQHA 2C3JA 2FUMA 3HUBA 3D94A 3NRMA 5CNNA 3ZRLA 5CXZA 3UVPA 3O23A 4OAUC 4G2FA 3P1AA 4BICA 3BBTB 4C02A 4JJRA 4E3CA 3GENA 3PVWA 2YWPA 2XJ1A 5EYCA 4BRXA 3NUNA 4BHNA 4PDPA 4CFVA 4GEOA 4PY1A 5BMSA 2ONLA 2UZWE 2W96B 5J87A 2XIYA 4IWDA 4FTTA 1ND4A 5BX0A 2PPQA 5L8KA 1CKPA 2QOHA 2XF0A 4CFWA 2WELA 4IC7A 2V62A 5DE2A 5HCYA 3IQ7A 1Y6AA 2IW9A 3OW3A 5KMOA 5B2MA 2EU9A 2J0JA 3BI6A 2Y6MA 5GJDA 5IUHA 1W98A 1KE6A 4AU8A 3NX8A 2GDOA 1H4LA 2C47A 3FYJX 4O86A 4O27B 3W55A 2YM4A 4WRSA 2Z7SA 3MJ2A 3MW1A 1J7IA 2BZIB 3OS3A 1H24A 1Q8UA 3KRWA 5AIRA 5DA3A 1ZYJA 3DS6A 4GJ3A 1OB3A 4QPSA 5TO8A 1IA8A 3A7HA 3JXWA 4H05A 2ETRA 5D11A 4QMMA 4C4GA 4EH7A 4KBAA 4MD9E 4QP7A 4EHGA 1T45A 5HZNA 3T8OA 5LVMA 2R3IA 4FT5A 1DM2A 5HNIX 2HZIA 2UW3A 3VAPA 1U54B 3FLYA 2O65A 3R7YA 3LFNA 5HORA 5HU3A 4Z3VA 4DFYA 3DK7A 4QP1A 2YWVA 2OXXA 4JBPA 4KA3A 3ORMA 4UEUA 5HI2A 2WMTA 3R73A 2GMXA 2VWXA 2ITNA 2IG7A 3LCTA 4ORKA 2Y4IC 3IECA 5D41A 3WF6A 1OIUA 3BYMA 4C59A 5C8MA 4YUQA 4IIRA 4IZYA 5KNJA 5LVPA 2WMBA 5DMZA 4ZTLA 4OTQA 1JOWB 4TYEA 4FSTA 4WG4A 1ZYDA 5KZ0A 3UTOA 2XS0A 4FVPA 1KWPA 4C58A 3FQEA 3GBZA 5FM3A 3WF9A 5AX3A 4BDCA 4RC2A 3CIKA 4EK5A 4IE9A 3PJCA 2JFMA 2QR8A 1FVTA 1U5RA 4WSQA 4G3GA 3VHEA 5JRQA 3I4BA 4I93A 4U6RA 3E93A 3QCSA 3OZ6A 4F1OA 2QO7A 1ZARA 3HMOA 3MIYA 2OXYA 2ZAZA 3OTUA 3CKWA 4K11A 4NWMA 2VWYA 5AIKA 4GIIA 4TWOA 3D7TA 5CTPA 3A7FA 4KABA 5LVOA 4DFXE 5HCZA 3C13A 2XEYA 3QC9A 3OW4A 4C7TA 4BVUA 5AFVA 2GNJA 2R9SA 4FTAA 2WGJA 2F2CB 2W17A 3RPRA 2ITXA 3MFUA 2CN5A 3QTUA 4HW7A 3QQLA 4LRMA 5C26A 4I21A 3BRBA 3BX5A 5L4QA 2VGOA 3F6XA 3TIZA 1CMKE 5DNRA 3MA3A 3DB8A 5ANEA 4HPTE 3LCKA 2O3PA 2XYUA 4F6UA 2X2LA 1H1SA 4UBAA 1P4FA 4QOXA 4Y83A 4ZSLA 3Q4CA 5E90A 2PU8A 4BCGA 4FE2A 4D0XA 2GFSA 1YXXA 2JGZA 4NW5A 1LR4A 3EQDA 1YXTA 4RFZA 4FSNA 4TWCA 3VJNA 4D4RA 4CFUA 5HO7A 3PPZA 5CALA 3B2WA 3D5XA 4L67A 1UVRA 2CKOA 4S30A 2YIXA 5I9ZA 4FNWA 2UZOA 3A7JA 2AYPA 2W99B 4BCKA 4IZAA 3R2BA 1ZXEA 4AGWA 4ZLYA 2J2IB 4PP9A 3EQGA 3PJ3A 3LQ5A 4AGDA 4MXCA 4DH3A 4UMRA 3POOA 5HTCA 3LFAA 4PP7A 4WHZA 3WIKA 4LRJA 2QHNA 4DH5A 3RM7A 2C6EA 2VTAA 2XIZA 5B7VA 2JC6A 2X7GA 4CLIA 4DFUA 5CI6A 2O0UA 3FZTA 1H00A 2ZV8A 1JAMA 4MEDA 3PY1A 1WBVA 4HJOA 4AFEA 2WMQA 4HVSA 1HOWA 4R3PA 1WBTA 3KL8A 3QYWA 4BGHA 1E1VA 3LMIA 3ZLSA 2GS7A 3EN9A 4O1OA 5L8LA 4MH7A 4PL4A 4EHZA 2BHEA 4I5HA 3V51A 5BVOA 1E1XA 3MVJA 4FZ7A 1KE9A 3UP2A 4UMQA 5I3OA 3LOKA 1OBGA 4O22A 2WTJA 3LKMA 1YVJA 1LP4A 3W16A 3WBLA 2W5HA 4FKRA 3CJFA 2QI8A 5TE0A 3RAWA 4NSTA 2XJ0A 1H0VA 4TXCA 4F0IA 4AN9A 2VTSA 2Y4IB 4PRJA 4QMYA 2WQEA 4ZTQA 3DXQA 4FTUA 2YIQA 2VNYA 3OT3A 5HLNA 3SLSA 2C6TA 2OZAA 1PMNA 3O71A 3AQVA 4BCNA 3AD5A 4CMUA 2DS1A 2ITZA 2R3GA 3VRZA 3MV5A 1H01A 1XH7A 5AEPA 3UOJA 3DBQA 4D2PA 1MQ4A 3S2PA 3LJ2A 4GKHA 4EJ7A 1ZYSA 4XX9A 2QOQA 1B39A 3K2LA 2IZSA 3SRVA 5HVYA 3E87A 2VWIA 3CS9A 5HVKA 4PDSA 3I0OA 2YERA 4FTCA 4GW8A 4YNOA 3WE4A 4N4SA 1XJDA 4RT7A 4C34A 2UW0A 1TQIA 4E6QA 2G1TA 4L52A 4N6YA 1UU9A 2PE1A 3QRUA 4H1MA 4ZSGA 3EQFA 4YPSA 3TUBA 2QD9A 3P7CA 2Q0NA 5DYJA 4RJ4A 2FH9A 4F99A 3TWJA 5JFWA 2YJSA 3LQ8A 2BKKA 4F6SA 2QU6A 2CMWA 2YM8A 2XBJA 3AT3A 5AUTA 3MH3A 4E5AX 4IEBA 4DFLA 4JL9A 3QCQA 4BYIA 2X2KA 3ZSIA 4D5HA 3NUPA 4YJOA 4CV9A 3HP5A 4GK3A 4KKHA 4XP2A 3QQKA 3MY5A 5C9CA 3VF8A 4F64A 4O7RA 5L2TA 3MY1A 5M44A 3LLAA 4QD6A 3DKGA 4A4OA 4AW1A 3ID6C 2OZOA 4ANNA 3QKMA 1NA7A 2VAGA 2F7ZE 3KK8A 4FTQA 4F65A 4X3FC 1PKDA 3F3VA 1I09A 4J52A 3VVHA 3EN6A 3GVUA 5AP0A 2OBJA 3QQUA 4NFNA 2H8HA 2WU7A 4FSWA 4D1ZA 4RZVA 1W0XC 3EKNA 4FYNA 3EQCA 2UZTA 3QXOA 4FYOA 1VZOA 5JZJA 4JQEA 4XRJA 3S95A 3W18A 4WG3A 5FG8A 3QHRA 4X6QC 3VWAA 1OITA 3KXXA 4APCA 1V1KA 3RAHA 2GNHA 2HWPA 3FYKX 4G3DA 3F5GA 4YSMA 2DUVA 2IWIA 4FR4A 1BYGA 3KK9A 2C5YA 4RFYA 5T3QA 2BIYA 5JFXA 4D5KA 1AD5A 1TQMA 2F57A 3C4FA 1PMVA 2GQGA 3LFDA 1Q97A 3QRKA 4WOVA 2BROA 1GIHA 4CYIA 2BZHB 3NDMA 5J7HA 4ASEA 5HE3A 5AR7A 3WZEA 4Q9ZA 2EUFB 3SD0A 4HYHA 2Y8OA 3FQHA 1BLXA 3PJ2A 4GT4A 4L68A 3W2QA 4FIJA 4EC9A 3BU5A 3ZO1A 1KV2A 5IISA 2QOKA 3R9RA 4M97A 4Q2AA 4C38A 3HRBA 2WB8A 5HTIA 2UUEA 5HKMA 2IZUA 3C0IA 3F7WA 4JQ8A 4DGOA 5FDPA 3PTGA 4BDEA 5IU2A 3SV0A 4ANQA 2A19B 3RPSA 4IVDA 2FO0A 3BE9A 2BTSA 3G6GA 4ITHA 4OTWA 2NPQA 4IB1A 4M66A 3KFAA 4RIXB 3R7EA 4HNIA 4NIFA 4TNDA 4DINA 3GU5A 4FG7A 2X39A 2PL0A 2YJRA 3UBDA 4X3JA 4CZYB 1WBWA 4RVKA 4AT4A 3MB6A 4FV3A 3TKIA 3VS2A 2BMCA 5E8WA 3UIUA 4AP7A 3GCUA 4EQCA 4XBRA 3LCSA 1GZNA 5L6WL 4BR3A 3C0GA 3WF8A 3QLGA 2JBOA 3ENHA 4FKUA 3E8NA 5AP6A 5AUYA 5CEKA 4R5SA 3DJ7A 3FI3A 2VO0A 3RZFA 3UIBA 5CLPA 3FHRA 4JOAA 3ZDUA 5J8IA 4DFBA 4C57A 4CGAA 4FEQA 2IW8A 1NVRA 3R8UA 4NM5A 4YC6A 2IVTA 3C5UA 3CD3A 2CGVA 3P7AA 1UWJA 5CS6A 4J95A 5ETAA 5M08A 1F0QA 5AM6A 1RDQE 2YDJA 4NT4A 3D5WA 3OCSA 4OLIA 3EN4A 3ANQA 4RX8A 3SXSA 3CY3A 3S1HA 5H8BA 4ACMA 2ITWA 3G0FA 3GCSA 4DG3E 3JPVA 4GYGA 4M0ZA 4TPTA 5F20A 2X4ZA 3HUCA 4ALUA 4FNZA 4Y5QA 2Y9QA 1NXKA 2C5XA 1Y91A 4L43A 3CC6A 2BPMA 2PULA 3QX4A 5LMKC 3E3BX 3BQRA 3O96A 1YRPA 3LFCA 4X2JA 4CTBA 5JGBA 2UZBA 3MA6A 3NMUF 3NVMB 1K3AA 3UOLA 4EOPA 5HX6A 3LM5A 1G3NA 5JH6A 4EJNA 2KULA 4BCMA 4CMTA 3FSKA 4HGTA 4NU1A 4RIOA 5IQBA 1TKIA 3PG1A 2CKPA 1OUYA 5AUZA 2WMUA 3TXOA 1PRYA 1K9AA 4D1SA 4R6VA 4DTKA 4IAIA 1WBPA 2QLQA 2QNJA 1DI9A 3FY0A 4XG2A 1LPUA 3E92A 3DU8A 4Y8DA 4LOPA 4BWKA 4LV8A 4QMQA 2B0QA 2XIRA 2ZOQA 4ITIA 4KINA 3DXNA 5KMNA 3GOPA 1UNGA 2GPHA 4GIHA 3TKHA 3PG3A 1JSTA 2IO6A 4YJPA 2XMYA 5CEOA 5AA9A 3HMIA 2E9VA 1OBDA 1KOBA 2WIPA 4MD8E 4OTFA 3FBVA 5F4NA 5DBXA 3N4VA 2ERKA 2FYSA 2Z2WA 2NNWB 5CU4A 4MNEA 4BZOA 2ITQA 2B9FA 3LXLA 3PY0A 1Q8ZA 3BU3A 3CCNA 3KY2A 4A9RA 4WNOA 4QTEA 5A6NA 5IEYA 3E7VA 4Q5HA 2IZRA 4FKIA 5JQ8A 3PIXA 3LM0A 4EK3A 4XCUA 1OKZA 1UU3A 1XBAA 3R8ZA 4ZAUA 5HX8A 3KXHA 3RPOA 4MX9A 3PSDA 2XNPA 5ICPA 5HD4A 3BGQA 3SAYA 4M8TA 4TNBA 4KKGA 3PWYA 4AGCA 4I22A 3I6UA 1H26A 5JZNA 4RIYA 3PE2A 1HCKA 1OZ1A 4WBBB 4BIEA 2A0CX 4PNIA 2UVXA 1ZMUA 2ZM1A 4MQ2A 5CY3A 4G31A 3OEZA 3HKOA 4ARKA 3QKKA 2HXQA 3EKKA 3V5JA 4BDBA 2G2IA 1R78A 3GC0A 5K5NA 3NUSA 3W33A 5IA3A 3I5NA 3LJ1A 3UMWA 2Y7JA 3BCEA 4EKKA 3WYXA 4PDOA 2B9IA 3U8WA 1YOMA 5LJJA 5J5SA 3SX9A 4FA2A 3VS7A 3GC8A 3BYOA 1CKJA 2W4OA 3KGAA 2PUPA 3Q9YA 3RCDA 4FV8A 4RJ7A 3ZC6A 3MH0A 4FSYA 4Z55A 2P0CA 5EHOA 4B8LA 3MN3A 2J0MB 4BDHA 2JEDA 5IPJA 3QRIA 2VTQA 3DLZA 3P7BA 4LV5A 4YJVA 3RINA 4JT3A 4CVAA 3KRXA 4DGMA 5LVNA 3QZHA 4HCVA 4EH3A 3DAKA 5M51A 4L42A 2VZ6A 3QU0A 5HD7A 5HE1A 3ZCLA 3FXZA 2ITOA 4IH8A 3KXZA 4QQJA 4YMJA 4ENYA 3KN5A 1MQBA 4FKWA 1YI3A 4LYNA 5FRIA 1FVVA 1XKKA 4WNKA 4ZMEA 3CLYA 2WTDA 1L3RE 4QTCA 4BI2A 4EWQA 2YM6A 2CKQA 3Q53A 4JRVA 5D10A 3C0HA 4UXLA 4OT6A 3NSZA 3RKBA 3TV6A 1URCA 3SA0A 2HK5A 5J95A 2ETKA 2A27A 4YLLA 2R3JA 4CT2A 2P2HA 2XRWA 3EOCA 3QTWA 5HIEA 5BYYA 4KSQA 4EOLA 3RGFA 5LWMA 3P0MA 2PZIA 4I6BA 1YWNA 2QONA 4Y5HA 5AR5A 4O0WA 4GT5A 1ZOEA 2G01A 3IK3A 4P90A 2B9JA 3NEWA 3ZU7A 4R7BA 1GAGA 1WFCA 4QMXA 3G90X 4DCEA 5AA8A 5KBQA 3UG1A 2BKZA 2C5OA 2G2FA 4O7SA 2X7FA 2WZJA 4MYGA 1J3HA 2E9OA 3HA8A 3V5WA 1BX6A 2X7OA 5E8UA 3L9NA 4ID7A 2WFYA 4PTEA 2IPXA 3BGPA 4JX7A 2YM3A 3MESA 1DAWA 2VGPA 4ZJVA 2RKUA 1U46A 3K54A 3K5UA 1ZAOA 2CLQA 4IJ9A 4CNHA 2OH4A 4GSBA 3B2TA 3F9NA 1U54A 5AUVA 2C4GA 3DTWA 2YA9A 2BZJA 3DGKA 4IB5A 5CXHA 4AZVA 4W4WA 5EYMA 2QOIA 5H3QA 5L2WA 2OJJA 1FVRA 4BF2A 2JDRA 4OTHA 5CEPA 2W06A 3HVCA 1YHVA 3IDCA 1WVYA 4JIAA 4NTSA 5DI1A 4D4SA 4GS6A 4S34A 5LARA 3O17A 4QP3A 3ZO3A 1L8TA 1GZOA 2WQOA 5HBHA 3AXWA 4FNYA 3JVSA 2VO6A 5EHYA 4LQMA 5I3RA 2YAAA 1LEZA 3H10A 4J98A 2PHKA 3RK9A 4QYGA 3PXQA 3FE3A 4C4JA 1SNUA 2J9MA 4RIWB 2RGPA 2XEZA 3G6HA 3RALA 1JKTA 4O6EA 4K77A 1PXJA 3Q4UA 4HVGA 5TR6A 5IZFA 3BLQA 3B8RA 5CQUA 3DPKA 4L44A 3G15A 2XKFA 4P5ZA 1IG1A 4GV1A 4W4YA 3LJ0A 4LMNA 1MUOA 3VHKA 3ZO2A 3FKNA 4F9AA 5M4CA 5DRDA 5CZHA 4HVHA 3EYHA 3O0GA 5K4IA 5CAQA 4CRLA 3QKLA 4RQVA 2OF4A 3FXWA 2GQSA 4NFMA 5HGIA 3I6WA 4WNPA 3QGYA 4O0UA 3I7BA 4LOOA 3HMNA 4QMZA 4I6QA 3VJOA 5KMLA 5IEXA 4OBPA 3FLSA 2OKRA 2YACA 5AP1A 3Q6WA 2QR7A 3FKLA 4F9CA 2OJIA 4C35A 1BKXA 3H9OA 4U3YA 3R9HA 5CF5A 5GZ8A 4WT6A 5EQEA 1F3MC 5FBNC 1O9UA 2YZLA 2EXEA 5CEIA 3U6JA 1UU7A 1PYXA 5DLSA 3ZYAA 3EQIA 4JDJA 4NKAA 5I9UA 2Z60A 2J7TA 5LMAA 3H3CA 2ITTA 4NH1A 4OAVB 4YZBA 4YTHA 1Q3DA 4S2ZA 2Z7RA 5E8YA 4NYEA 3UNKA 2BIKB 4IB0A 3RK7A 4E1ZA 5I9WA 3QAME 5DFPA 3L8VA 5BVNA 2PMNX 3D4QA 4DH8A 3V01A 5I9YA 3PLSA 5HQ0A 4PTCA 3CSVA 4X0MA 4M67A 3C4CA 2B53A 2X81A 3Q2MA 3U6HA 4X6RA 4G34A 2C6OA 2HZNA 3PVGA 5A4QA 1QL6A 3JYAA 2XP2A 3HP2A 1PW2A 2GFCA 3ORPA 3OWJA 4JXFA 1ZRZA 4P4CA 2EXMA 1PXIA 2I0HA 2Y4PA 3D14A 5DR2A 2QCSA 3A99A 3COMA 3DBDA 5TF9A 5TT7A 3SXFA 4ZTHA 4A4XA 3BKBA 3FJQE 4NW6A 4ZZOA 4UYNA 3TNQB 4XH6A 1BMKA 4ZTSA 4FKPA 4J96A 4AQCA 1K2PA 4U9AA 2BFYA 5HEZA 2R4BA 3DY7A 3PVUA 1YWVA 4TYJA 5HO6A 3TIYA 4ACGA 3AC2A 3HV3A 2JLDA 2X6DA 3ZHPC 5C8NA 5C1QB 2PE2A 3ORZA 4YO4A 3RWPA 2XNNA 3BLRA 4Z9LA 3L9MA 5GZ9A 2W05A 3RK5A 5IMEA 4PDYA 1Z57A 2WTVA 4NCTC 1OL7A 3O51A 4Q5EA 1O6YA 4F1MA 4YJQA 2VD5A 5EDPA 3TZMA 4FEWA 2X0GA 2F2UA 2B4SB 2FSOX 3DQWA 3VS3A 2PUIA 4EOSA 4OTIA 1ZMVA 4U8ZA 2R3LA 3TG1A 4UWBA 4FL1A 5GJGA 2R3HA 2GTMA 3FPMA 4EORA 2FB8A 4MWIA 3G2FA 4AOIA 5CF6A 1R0PA 3VUTA 2WD1A 3VS0A 4CSVA 4D2RA 1U4DA 3KRLA 4FZFB 4I6HA 4FTLA 5HG9A 3NIEA 4FT0A 4IWOA 2HCKA 3KVWA 3D2IA 5IKWA 4PX6A 4IM2A 5ANIA 5H8EA 1OECA 2BR1A 2CGUA 3QQJA 3UO5A 5IG1A 1OKVA 3LFBA 3O8PA 2Y0AA 3TNWA 2XNBA 2W1IA 4FMQA 5A6OA 4XG7A 4PTGA 5FTGA 4YHFA 3UPZA 4DBNA 2QG7A 4TRLA 1XR1A 2ITPA 2ZYBA 5IA5A 2XZSA 2NO3A 5FDXA 3R9OA 2J0KA 3KCKA 1JWHA 4HCTA 1JNKA 5K0KA 4BZDA 3SKCA 4B6LA 4PPCA 3F61A 2A4LA 3ITZA 4UWCA 4CT1A 3OVVA 2FSTX 4YURA 1WBOA 4U7ZA 2OJ9A 4FOCA 4HPUE 2W1GA 1B6CB 1LEWA 3FMDA 4DTAA 4DA5A 1KV1A 1OUKA 4FIGA 5DT4A 2I0YA 2VTLA 4IC8A 4JNWA 4RMZA 5CT7A 3VS5A 4KIPA 5D12A 4BKYA 3N4UA 5AR2A 3DBCA 4EBVA 3A4PA 5H9BA 4WRGA 4TZRA 3TN8A 4G6LA 2JIIA 4FTIA 2G9XA 4QRCA 2GNFA 3A62A 5EHLA 5AV1A 2XIXA 3P23A 3KVXA 3Q32A 1FINA 3LE6A 2YDIA 3QCYA 4C0TA 2BRMA 2PZPA 4DEBA 4XV3A 3ODZX 3MTFA 2W5AA 3UVRA 3TDWA 2R3MA 3CJGA 1ZMWA 3EHAA 3GNIB 3R7OA 4N57A 4R5YA 5EW9A 2W1FA 2V22A 3FY2A 2GNLA 3R22A 3SOCA 5M07A 3EZVA 4FSQA 2HOGA 2C68A 3TV7A 1YQJA 4IFGA 4G9RA 4AW5A 4JIKA 3BV3A 4R8QA 2W1HA 4S31A 4H1JA 3VBXA 4DTBA 4RBLA 3PRFA 3W8QA 5DOSA 3NIZA 2ZV7A 2ZVAA 4X7QA 2VWVA 3O7LD 1XH4A 1Z9XA 3DTCA 2PZYA 3ZM4A 5IA2A 4HVIA 3PIZA 3NW7A 5GZAA 4J97A 4KBCA 3ZBFA 4G6OA 4QMPA 4AX8A 4ANOA 1XH8A 1OPJA 2WO6A 2W1CA 3JY0A 5EH0A 4HYIA 1H1RA 3N4TA 2WQMA 2OICA 4A07A 2HZ0A 1XBCA 4KIKB 1ZYCA 4B9DA 3QRJA 4WKQA 3UNZA 3EQHA 2FSLX 3VUIA 4F1TA 5A46A 5I9XA 5IQEA 2YCSA 4YO6A 2R3KA 4EH6A 2PVNA 4XOZA 3KCFA 4JG6A 4IZ7A 4XV1A 1REKA 4XEYA 4YZDA 2CCIA 5CF4A 3SW7A 4GFMA 4MBLA 2X8EA 5D7VA 1Z5MA 4UALA 5E8XA 3O2MA 2OO8X 5AM7A 1NY3A 2CDZA 3V6RA 5BPYA 2UW7A 4GRBA 4FEXA 4R1YA 4ASZA 4CLJA 3BWFA 4E4MA 4E93A 5IA4A 1V0OA 5FWKK 5M53A 3L8XA 3ZFYA 4AOTA 1W84A 2B9HA 2VN9A 2UW4A 1ZOGA 2W1EA 2WMRA 3DT1A 2WEVA 3CPBA 4JDKA 4RIXA 3R83A 4BFMA 3I81A 4DITA 2GQRA 5GIOE 4F9YA 1QPEA 1H27A 5F95A 2QODA 4DEIA 3DKFA 4GH2A 2BTRA 3G9LX 3POZA 3WILA 2ETMA 3JUHA 2JDOA 5EK7A 4RGJA 4CTCA 3UG2A 4PUZA 4PMPA 3GU4A 1UV5A 2XVDA 4AZFA 2O64A 3KULB 3UGCA 5FXSA 1CKIA 4YZMA 5I0BA 4I24A 4BDKA 3I0QA 2PYWA 3QALE 4EEVA 4A9SA 2ZM4A 4WD5A 2UZEA 4L01A 4FIEA 3IGOA 5D7AA 3R8MA 1M7NA 3L9PA 3PXZA 5J1VA 4RWLA 2YLEA 2JFLA 4MVFA 4YGAA 5E91A 5HG8A 1DS5A 2QOCA 3D5UA 3DAEA 3OCTA 5DHJA 5HLPA 4BI0A 4AA4A 3R21A 3VS6A 2ITYA 5EW8A 3VRYA 4Y95A 5CENA 3WE8A 4YJRA 2WKMA 4F0GA 4Z7HA 5FGKA 4NL0A 2XYNA 4FT3A 4QNYA 3NAXA 1VR2A 2AC5A 5HIBA 2HW7A 4JBQA 4TKSA 2JD5A 4YHJA 2I0EA 2VRXA 2YABA 4NM0A 4X2FA 1FOTA 1KE7A 4JQ7A 5CSHA 4YHTA 3FPQA 5E7RA 1YDRE 3QC4A 4QYYA 5EI6A 4A9TA 3AC8A 4QP6A 3TZ9A 4I0TA 4A06A 4O1PA 4CMOA 5LQFA 1FBNA 3OXTA 3M11A 5A4EA 3R7UA 4B7TA 4FVRA 2QURA 5H2UA 4TY1A 3VBWA 1FMOE 2PSQA 1P2AA 1M52A 4R1VA 2WTCA 2JIUA 4IACA 4RLLA 4W9XA 4X2KA 4X3FA 4JI9A 5CI7A 5BVFA 1UNHA 3RHXA 5IMXA 2E9PA 1IRKA 3TJDA 3QCXA 3UZRA 3WIGA 4I1ZA 3BHHA 3ZTXA 4MWHA 3HLLA 3KEXA 5AADA 3KRJA 5AR3A 1NW1A 4IBMA 2QOLA 4YTFA 2OJGA 3QUPA 4W4XA 2YZAA 4AE6A 2UVYA 4BIDA 2BDFA 3CBLA 3BZ3A 3T9TA 1PXPA 3GP0A 5BMMA 3U54A 2BAJA 4ERWA 1PHKA 2XK3A 1EH4A 4YC3A 4YZCA 3MFRA 4FZAB 3PXRA 3VUMA 3CY2A 1ZLTA 2O2UA 2CNVA 3EJ1A 4YTCA 1PXLA 3EL7A 4HZSA 3EYGA 1APME 4E6CA 1P14A 4LGHA 5C4KA 3GT8A 3ZZEA 2J51A 1Q41A 3PDTA 4D58A 4HYUA 5J79A 3FL4A 4EZ3A 4QMWA 3IKAA 4O0RA 3G0EA 1WVWA 3GCVA 4E7WA 1JSVA 5IH4A 4PMMA 4F9WA 3ROCA 3LVPA 2BVAA 5A3XA 4XLVA 4USEA 5T6KA 3W2OA 4DHFA 2I7QA 3ANRA 3C7QA 3IDBA 5BYLA 3W2CA 2WOUA 3HRFA 4D4VA 5CU2A 2HY0A 4MXYA 4GK4A 4MTAA 3GCQA 5H8GA 5KX8A 4FKSA 3Q9WA 5CX9A 3R8LA 3Q3BA 5ETCA 4FEUA 2WOTA 5AAFA 4O0SA 5DIAA 2PTKA 3NZ0A 4XOYA 1OIQA 3VUDA 4DGNA 3KXGA 4GFGA 4JS8A 3W1FA 5HIDA 1YW2A 4CG8A 2QOFA 3HDMA 5BVDA 1YI4A 2BUJA 3IG7A 3PA5A 2JKKA 2I40A 1YKRA 4AT5A 4E6DA 3HV7A 3PJ1A 4EYJA 3KQ7A 2VWWA 3W2RA 2QOOA 3ZH8A 5EKNA 4UB7A 4IANA 5CAOA 1MRVA 2JAVA 2CPKE 3QWJA 1OL1A 3HECA 3LFQA 4WIHA 2CLXA 2XM9A 4LOQA 5IDNA 4MF0A 1KUTA 2Q0BA 3R01A 3QA0A 1UKHA 4DGGA 3C9WA 4FT7A 3I1AA 2X4FA 2ZJWA 1J1BA 4XP0A 5FP5A 3ALOA 5F9EA 2HZ4A 2ZDTA 4MF1A 4RVLA 5BNJA 4LG4A 5HVJA 3WOWA 4CKIA 4L46A 1Q8YA 2H34A 2O8YA 4O96A 3T3UA 4DFNA 4MXAA 3DDQA 3FI2A 2C6LA 3BPRA 2Z8CA 2EB2A 1PMEA 3H30A 3JVRA 1G5SA 4XV9A 4EWHA 3BBWA 4ZZNA 3PP1A 2YM7A 5EFQA 3Q52A 2PWLA 4U3ZA 2OF2A 2VWZA 3A7IA 4K18A 3F2AA 4EI4A 2JDSA 5LMKA 5K3YA 4JG8A 5AX9A 2ZMDA 5L8JA 3PJ8A 4WBOA 1BI8A 3DNDA 3OHTA 4I23A 3GGFA 2PVMA 4BBMA 2XKDA 2ZM3A 4FC0A 5M56A 2IJMA 3FI4A 4AN3A 4D9UA 4MXOA 4O7NA 1DI8A 4DLIA 3R71A 4LRKA 1O6LA 5DEWA 2OFUA 3HZTA 4QMLA 5M57A 4UMUA 3UQCA 4FSZA 1YXUA 4ZJIA 2BZKB 3EN7A 3VBYA 3L9LA 1PKGA 4CD0A 5K9IA 4V0GB 4CZUA 4FTMA 4L3LA 1M14A 2R2PA 2WTIA 5D9HA 4H3QA 4DH1A 3H4JA 4KNBA 4O0XA 4UV0A 5AP7A 3TUDA 5JSMA 2I1MA 4BZNA 2JIVA 3UODA 2V55A
chains in the Genus database with same CATH superfamily
2VTIA 4L00A 4C62A 4Z7GA 4W9WA 3V6SA 4KBKA 3ULIA 3C51A 2VTRA 4OT5A 5JKGA 2PVFA 3I60A 1YDSE 4UZHA 5A4LA 4AE9A 2CN8A 3BHUA 4GKIA 3PRIA 2QOBA 4ONAA 4IWQA 1XO2B 5LWNA 1WBNA 4RIWA 3QZFA 1PJKA 2ITUA 3FZOA 2G2HA 3LMHA 4BDAA 1YHWA 4FEVA 2XKCA 4FIHA 4DT8A 3EL8A 5BVWA 2OZAB 4QO9A 3NCGA 4KS7A 3BHVA 3A61A 3FMHA 5GIPE 1G8SA 2JDVA 1X8BA 3EQPA 3RNIA 4ALWA 3TYKA 1U59A 2HYYA 3UMXA 2G15A 3RMFA 4EH4A 2QHMA 2NRYA 3SQQA 5FEQA 4AXAA 4EC8A 3AKLA 4FV2A 5L2SA 3ZS5A 2PVHA 3NCZA 4A4LA 4AACA 4BGQA 3ZONA 3SRVB 2LAVA 3MVHA 4BN1A 3JR1A 5EOLA 5AV4A 4C33A 2JKQA 3TM0A 2OLCA 4LI5A 2C1BA 4M13A 4TYHB 1BI7A 1OKWA 3DAJA 4JR7A 4UY9A 4YJSA 4R77A 3AGLA 2Z7QA 4ASXA 3WI6A 4AGUA 3E63A 4BKZA 4IX6A 4X2NA 3OF0A 4MBIA 4O83A 2AUHA 3KXMA 3OD6X 5AUWA 3ZUUA 2CJMA 3C1XA 4RVTA 4BCFA 4ZMFA 1UWHA 4XG4A 2XK9A 5TOZA 4U40A 4EHVA 2PVJA 4E5BA 4IAAA 5LCJA 1H8FA 5FEEA 3VC4A 3QTZA 4O2PA 1F5QA 5CSXA 3EFWA 3I7CA 4D28A 3AT2A 2F9GA 4WSYA 1XH5A 1YWRA 2XRUA 2CSNA 3FDNA 1H1QA 3SDJA 4FIFA 3NAYA 4HOKA 3QBNA 3DJ5A 3SC1A 4TYIA 3CGFA 2UW8A 3MH1A 3R1NA 3MJ1A 5IH6A 4KWPA 1Y57A 3R0TA 4XNEA 4AG8A 4L53A 1W83A 5J7BA 4XBUA 5EYDA 4O82A 1OPLA 4EBWA 5EG3A 4BI1A 4L3JA 4DG0E 2VUWA 4XS2A 3UJGA 4B0GA 2P2IA 4NEUA 1WCCA 5L6PA 4U79A 4TT7A 4BKJA 3GC9A 3VO3A 4ZLZA 3CQUA 5KKRC 4I0RA 5JRSA 1AGWA 4QMVA 2I6LA 3LMGA 4X2GA 4BIBA 5KBRA 2CKEA 4G3FA 3DZQA 4KD1A 4FTOA 3FMKA 4FV6A 4K1BA 3QZIA 4IB3A 5E92A 4K8AA 4QMTA 1Q4LA 3EIDA 4J53A 3UDBA 4CRSA 2XNMA 3FMNA 4E20A 2PUUA 4KRDA 5CZIA 3A8XA 3KMMA 3FLNC 2XNOA 1ZWSA 4JRNA 4KRCA 5ANDA 4O7WA 2JITA 3CR0A 4C2WA 4ZSJA 3RTPA 5EM7A 4DAWA 3P78A 3EH9A 4FF8A 4M0YA 4Y72A 3WYYA 4C2VA 2XB7A 1CSNA 3NYOA 4FV0A 2XNGA 4W4VA 2DQ7X 3KA0A 3PUPA 4EOOA 3FQSA 4EOJA 3A60A 4PMTA 4EOKA 4H36A 4FV9A 3SW4A 3TUCA 2WIHA 2V7AA 4PV0A 1QPDA 3GC7A 4GU9A 5IDPA 3QD0A 3F3ZA 4FUYA 4CG9A 1Q8TA 4AXFA 4WO5A 2QKWB 1CM8A 3HV5A 4MXXA 4DGLC 2C6IA 3Q5ZA 3Q9ZA 4IX5A 4E4XA 4F7SA 2HXLA 3W10A 3QA8A 4RJ3A 5FBOA 3TEIA 1J91A 2X8DA 5FM2A 2WHBA 5K4JA 2GTNA 2R7BA 2XBAA 5I9VA 2QQ7A 3NUUA 5L6OA 3KN6A 3F3TA 3RI1A 2UZUE 4BDDA 4ANLA 4DHJA 3CTQA 2YFXA 4CXAA 3E7OA 2V5QA 3ORXA 2BRHA 5DN3A 4LL5A 4QQ5A 3HEGA 5HESA 4DEEA 4GT3A 2NP8A 4HZRA 3FC2A 1RQQA 3PY3A 3W2PA 1Q5KA 4F7LA 1STCE 2WMXA 3GQIA 3IONA 4FI1A 3VBTA 4BDJA 4IADA 3RNYA 4C3FA 4DE4A 5LVLA 2JAMA 4FKGA 4PPAA 3LCOA 5IUIA 5KZIA 4JAJA 5CVGA 4ZTMA 2WEIA 5K5XA 2WNTA 3GFEA 4U44A 3AC4A 2R3RA 3HV6A 4DCAA 2X1NA 4OTPA 4XP3A 3GCPA 1IA9A 4EOIA 4OR5A 5BUJA 4IFCA 5FXQA 1GIIA 3TNIA 1IASA 5HNGA 2BALA 3DOGA 4K9YA 3UC4A 3AOXA 3PSBA 5B0XA 3AG9A 4M14A 4EK8A 3ZUTA 4EOMA 5J9YA 3KXNA 4O2ZA 1TVOA 2PVRA 3GB2A 5K0XA 2WMAA 3N51A 3O8TA 3COKA 2ZFYA 3JS2A 2R3QA 3QQHA 2BRNA 4FL2A 3CTJA 4ANMA 3DZOA 4RWJA 3UP7A 5L3AA 2R64A 3Q4TA 4AAAA 3P5KA 5IQCA 3P5JC 3ZDIA 4BCOA 4D4YA 2X2MA 4EQMA 3V5TA 4EK4A 1S9JA 4OTGA 1NVQA 3I5ZA 4IDTA 3ORKA 5FXRA 4IZ5A 5AP4A 4N6ZA 3BYSA 2VV9A 4JBVA 3D0EA 3R00A 4K2RA 3UO6A 3MB7A 4O0VA 4I41A 2HENA 4JLCA 4MBJA 3IOPA 4RPVA 4WUNA 5EDQA 2C30A 3OWPA 4Q9SA 5KCVA 4UX9A 4M69B 1SYKA 3BEAA 3KB7A 1WMKA 3PXYA 3QTRA 4IVAA 4NK9A 5EI8A 1FGIA 1WAKA 1RW8A 3ET7A 5M55A 3HA6A 2YIWA 5AUXA 4PNKA 1JKKA 2VO7A 4HGLA 5F1ZA 5BVKA 3Q4ZA 3AD4A 4KB8A 4RLKA 4GG5A 4ZEGA 4RA5A 3GUBA 4IHPA 2VTJA 3OY1A 1GJOA 4DT9A 1PXKA 1KOAA 2VTTA 2WMWA 3PPKA 5KKRB 1V0PA 3ML1A 2E9NA 2WQNA 3CP9A 1CTPE 3WZUA 1KE5A 4DC2A 5HCXA 3EMGA 5AAGA 5JGDA 3O5AA 2JBPA 3OG7A 1Q62A 3R9DA 2QU5A 2IW6A 3FMEA 3R1YA 2VU3A 4KIKA 4ZY6A 2RFDA 1GIJA 5EW3A 4FZDB 3LXKA 5DR9A 4TWPA 5C8KA 2BRBA 2HWOA 3VW6A 3DFAA 4OTRA 3QF9A 4D1XA 3TV4A 5E8ZA 4BGGA 4M84A 4MNEB 5F94A 3D5VA 3OT8A 3QQGA 4HGEA 2C3LA 5CU0A 3ZRMA 5IH5A 4IX3A 4NCTA 5AR8A 4C3RA 2A2AA 4GJ2A 4U5JA 1UA2A 4YNEA 3TNPC 5E1EA 2KTYA 1QPJA 4XHKB 2QO9A 3D9VA 4RZWA 4L7FA 3TTJA 3ZUVA 5J5TA 4IDVA 3QFVA 4FGBA 5E8TA 2R5TA 3IW5A 4FK6A 4FZ6A 4Y73A 3VIDA 3K3JA 3ROYA 3QTXA 3RM6A 2RG5A 4DG2E 4LMUA 5M4UA 3QD2B 2W1ZA 3U9NA 4IX4A 4LL0A 4O7VA 1OKYA 2PMLX 5A54A 5J9LA 4FICA 4O4FA 1XQZA 3ZC5A 4PL5A 3PXKA 2R7IA 4CKRA 4BJJB 5DG5A 2OH0E 2YAKA 3LQ3A 3V8WA 3A4OX 3KULA 4QMUA 4UWYA 4AZTA 5BUEA 3OY3A 3E3PA 3E62A 3P86A 4ZK5A 4HCUA 1QCFA 5T68A 3PWDA 3GU8A 4WG5A 3Q6UA 4PL3A 4G3EA 3UOKA 3FMJA 2R0IA 2W1DA 3O50A 1OVEA 4N70A 3UOHA 1VEBA 5HG5A 1BL7A 3VN9A 2GSFA 4IAFA 4U0IA 4FTKA 3RPVA 3EQRA 4KKEA 3FLZA 5CF8A 3DLSA 3Q5IA 3PA3A 4RA4A 2J90A 4M3QA 4YTIA 1OL6A 2YM5A 3CKXA 3SG8A 2OXDA 2UV2A 4MHAA 5CANA 5ANGA 5CAPA 4AFJA 3DB6A 1HCLA 3MPTA 1OGUA 4YZ9A 5AR4A 4FTRA 2EVAA 1M17A 5CQWA 5CSVA 2ESMA 4EOQA 5HBJA 5ANKA 5FP6A 4I6LA 4FSUA 2XKEA 2FA2A 4I92A 3P08A 3DNEA 3U4UA 3MFTA 4XG8A 2OI4X 4LDTA 4U43A 4FV1A 4IJPA 1UKIA 2UW5A 3BE2A 3QLFA 4IAZA 2VTNA 4QYEA 4FT9A 3M42A 4MD7E 3U6IA 1CDKA 4U41A 4ZTRA 4C4EA 4CEGA 5LXMA 4PWNA 3ZFXA 4BYJA 5M06A 2PMOX 3Q9XA 3IGGA 4G5PA 2XK8A 3WZJA 3COHA 4C8BA 2C1AA 4RC4A 4MKCA 4S32A 3RJCA 3LIJA 1M7QA 5I5ZA 4USDA 4YR8A 1SVGA 5HE2A 3RAIA 1Y8GA 1JQHA 2GCDA 4UMTA 3LFEA 4BTJA 5C01A 4DN5A 4XMOA 5AJQA 5JGAA 3HYHA 4QYFA 4I0SA 5E8VA 3U55A 2OG8A 1T46A 2YCQA 3BQCA 2VTPA 3NLBA 4C3PA 2RF9A 3FKOA 5AP3A 2HIWA 3DK3A 3TKUA 5AUUA 5EDRA 4F63A 4F7JA 5LOHA 1H1PA 2YISA 3OCGA 3WF5A 3TACA 2A1AB 1OM1A 2UW9A 5G6VA 3C5IA 2YLFA 3KREA 4FV4A 3QUDA 3W0SA 1IAJA 3EFKA 5ANJA 1REJA 2J0LA 2ONLC 3VS1A 4AF3A 4O7ZA 5KMMA 2R0UA 4ZXTA 3EWHA 4XLIA 4GK2A 4I5MA 4NUSA 5ANOA 3MGYA 1JBPE 2VNWA 1MRUA 1TFFA 4UZDA 4ZS0A 3WZDA 3DV3A 5DT3A 4A7CA 3DKOA 4QP4A 2XM8A 2P4IA 3HL7A 3UYTA 3ZZWA 3CEKA 5HE0A 1GNGA 3LFSA 3WARA 1G8AA 2BAKA 3FZSA 3Q60A 4YBKA 3GEQA 4IVCA 2ZV2A 5IEVA 3UDTA 2DYLA 3MPAA 4BTFA 4JDIA 3RWQA 3EB0A 4OUCA 3SHEA 3G51A 3NGAA 3WZKA 2YCRA 3R02A 4BC6A 4AN2A 4CFNA 2RSVA 3MVMA 3PYYA 4GUEA 1SVEA 1VYWA 3AD6A 3F88A 4G17A 3LAUA 4R3RA 3FWQA 3VULA 4MNFA 3ODYX 4D0WA 4OW8A 3P4KA 2UVZA 2P3GX 5JN2A 2GNIA 4V01A 2J4ZA 5HTBA 3V8SA 5JFVA 3NPCA 4USFA 1G8KA 2RFNA 2PZ5A 3ERKA 1JVPP 2NRUA 3FUPA 4IMYA 3U87A 5CAVA 2GHLA 5B2LA 5EOBA 3PZHA 4AQKA 4CKJA 3FXXA 3GU7A 1KSWA 2HY81 2VX3A 2F4JA 5CNOA 3U9CA 5FEDA 4ANBA 1FPUA 4UXQA 3BIZA 5BYZA 4D2TA 2OIBA 1VLRA 3DCVA 1BL6A 3ELJA 5FLFA 3BHYA 5JK3A 3C4EA 4O91A 2YITA 5HU9A 2WMVA 1S9IA 4NJDA 3MIAA 1RE8A 3ZLWA 4ZSEA 3NYNA 4GYIA 1MP8A 1JLUE 2C3KA 2GHGA 4D2SA 3SXRA 2FGIA 3BWJA 4KIQA 4ZS4A 3V5PA 3CQEA 4QMOA 1LUFA 4ZSAA 1FMKA 3NWWA 4TWNA 2J6MA 5ETIA 3TCPA 4KUJA 1PXMA 2CHLA 4EHEA 4TTHB 5KMKA 2ACXA 4FSRA 5BVEA 4II5A 3G9NA 4L45A 3MYGA 2PVLA 4C4HA 2C0IA 3ZFMA 3PPJA 3QWKA 4XYFA 1R0EA 3A2CA 2Y6OA 1IR3A 3D83A 4ZLOA 3H0YA 5IQIA 2IVUA 4KAOA 3EQBA 3OCBA 3S3IA 3P79A 4P5QA 4L8MA 4F09A 4R7IA 5JMSA 1J7UA 2W4JA 4R3CA 3A7GA 2H96A 2J50A 3MTLA 4I6FA 4J1RA 5L2QA 4CFXA 4BDGA 4O7TA 3AKJA 3JY9A 4JG7A 3WF7A 3MPMA 4AXCA 4IW0A 4V0GA 3L8SA 3T3VA 3ZBXA 3FI8A 4AZWA 4MCVA 3TTIA 4RG0A 5EI2A 3HNGA 4E8AA 3QZGA 2PVKA 4H3PA 3LPBA 3TZ8A 1H25A 3DDPA 3F5PA 1MRYA 4JX3A 1XH9A 5EM5A 5CEQA 4F6WA 4UN0C 1Q24A 5A4CA 3KF4A 3R7VA 1OMWA 4FGRA 1XH6A 3QXPA 5HHWA 5M4IA 3G33A 5E1SA 3IPHA 4NM7A 4GUBA 1FGKA 4E4LA 4NKSA 1SM2A 2EXCX 3EFJA 1Q3WA 3VUKA 2JKOA 3DXPA 3VBVA 3UNJA 1W82A 3R7IA 1GY3A 2R3OA 2W5BA 3BV2A 3MDYA 4RWIA 4V05A 4ENXA 4YU2A 3NFFB 3NNWA 4CYJA 1H28A 5BUIA 2VO3A 3ZXZA 2W4KA 5EKOA 1ZZ2A 4ASDA 3R04A 4FX3A 4DYMA 4HYSA 3TZ7A 3S00A 3F7ZA 3UC3A 3R30A 4FKOA 2XJ2A 4IM0A 3PLAE 4IAYA 3R8PA 3FMMA 4O38A 3UE4A 1PF8A 4P2KA 5AV0A 4LV7A 2YEXA 3GQLA 2B7AA 1ATPE 3HRCA 4CQEA 5M4FA 3R9NA 3C4ZA 3R7GA 4BTMA 2C6MA 4TYHA 2H9VA 2WTWA 2XA4A 4GL9A 3RCJA 3QX2A 3DFCB 3SGCA 4M15A 2F7EE 4U80A 5HO8A 2E9UA 4LUDA 3KF7A 4BL1A 1XMLA 4OBQA 3A8WA 2QC6A 5IA1A 2BCJA 4I94A 1OL5A 3DJ6A 5DEYA 3IS5A 2OJFE 1TQPA 3DKCA 3F2RA 3N9XA 3BLHA 2QG5A 1YOLA 3FHIA 3F82A 2C6KA 4RQKA 4DH7A 3HV4A 1Q61A 4JVGA 4ACDA 4XG3A 5AAEA 3F69A 5JT2A 4DLJA 4J8MA 2EWAA 3RHKA 4D9TA 4C61A 2WXVA 2Z02A 3DQXA 4IXPA 1V0BA 4LFIA 4RX5A 3FZ1A 4E26A 4L6QA 4P7EA 4QT1A 3ALNA 4O0TA 3CXWA 3U4WA 4Z16A 3ORLA 5CEMA 3BYUA 4RC3A 1E9HA 2VX1A 4HVDA 5C03A 1PYEA 3ZXTA 3BU6A 3PE1A 4G1WA 3NNXA 3OUNB 4YLJA 4ZZMA 1ZZLA 2ZDUA 4EKLA 3D7TB 1ZY4A 3ATTA 3TI1A 1O6KA 4BB4A 3M1SA 2PUNA 4ZY5A 3QD3A 3CGOA 3ENMA 3NR9A 3C50A 3Q04A 4PPBA 4EYMA 4DF3A 2RL5A 4PQNA 4RFMA 3KMWA 3ETAA 2GS2A 2JKMA 3ZSGA 2XK7A 3THBA 4FNXA 2P55A 3IW8A 1ZY5A 1R39A 3HGKA 4BCHA 4DFZE 1A48A 4F0FA 2F7XE 2VWBA 5I4NA 2J5FA 4BWXA 5CWZA 5CT0A 5FQDC 1ZOHA 2CCHA 2JDTA 4AA5A 4YJUA 3NUAA 4QNAA 1Y6BA 4GFOA 3L8PA 2REIA 4EUTA 2OFVA 3UQGA 2RFSA 2F49A 4L7SA 1OIRA 4G16A 3GOKA 4R78A 4WA9A 4ERKA 3FAAA 3UIMA 3ULZA 2B55A 1VJYA 4JBOA 2IZTA 2UZDA 4BWPA 5CASA 1XWSA 2Q83A 3OP5A 4LGGA 4CCUA 1GZ8A 5FUTA 5BQ0A 2BHHA 5KHWA 4U81A 5CVFA 2OIDA 4AZEA 1A9UA 3D2KA 4RVMA 1OL2A 2BFXA 1WBSA 4GVJA 3CTHA 4QMSA 5IQAA 5CU3A 4LM5A 3FMLA 4BCIA 3IW4A 2VTHA 3F66A 3R1SA 3IO7A 4DEDA 4NTTA 3RP9A 5KO1A 2X6EA 4FKQA 4RX7A 5C4LA 3ZLXA 2C5VA 1JPAA 1M2PA 2QLUA 4K0YA 3BELA 4LUEA 4CQGA 1VYZA 5DR6A 4EH2A 5IA0A 2DWBA 4YJTA 4U97A 3FEGA 3E8CA 5IQDA 4YSJA 4BBEA 4O81A 2WQBA 4QYHA 5KUPA 2QKRA 2YDKA 3OXIA 4IVBA 4B99A 2UZLA 3R8VA 1W7HA 1W2DA 4XRLA 3LW0A 1ST4A 3ACJA 2BAQA 3ATSA 4GMYA 4NJ3A 4CFMA 4FRFA 2IVSA 3V3VA 4ANSA 1XHAA 1U5QA 2BILB 4QTDA 3E5AA 4AUAA 3VUGA 4QP8A 3AGMA 3V04A 4ACHA 4FVQA 4W8DA 3AKKA 3QUEA 1URWA 2X9EA 4EH9A 3MWUA 2PE0A 1Q8WA 4W8EA 3F3WA 3ORIA 2SRCA 4YC8A 4ZIMA 4C4FA 4CZTA 3TL8A 3VONA 4XG6A 4YP8A 1JKLA 5GNKA 4KIOA 5HLWA 3H0ZA 4M68A 5HOAA 3H9FA 4JAIA 3W0MA 5FD2A 4M69A 5E9EA 4DEAA 4CV8A 3OTVA 2X9FA 3GFWA 2FSMX 4ITJA 3F5XA 3OOMA 2XCKA 4MXZA 4X3FB 4F70A 1KE8A 4ALVA 4QP2A 4BCPA 1YHSA 5AP5A 1GZKA 4M12A 3SG9A 1YDTE 4TL0A 4O7YA 1Q99A 5B2KA 3PVBA 2BDJA 3PFQA 1J1CA 3LXPA 5LCKA 2X8IA 4OTDA 1I44A 1YXVA 3ZM9A 5AV2A 4BDFA 5CSWA 2C0OA 3M2WA 3ORNA 3QYZA 3VS4A 4E6AA 2XALA 3LFFA 4ZJJA 5LMBA 4E4NA 3E8EA 3HAMA 2R3NA 1YXSA 4AW2A 3TDVA 3PXFA 5CU6A 4AW0A 3ZEWA 3KKVA 4EONA 4YBJA 3DBEA 4J8NA 4Y46A 3NVKI 4MAOA 3AMYA 3F3UA 4N0SA 4PMSA 2VTOA 5KMIA 1SVHA 2HELA 3PSCA 2O5KA 4YLKA 3FL5A 4FKVA 5E4HA 4I5PA 3LZBA 4A9UA 4TN6A 4KS8A 4QMNA 4FOBA 3GI3A 3OEFX 2CGXA 3BEGA 3CE3A 4G9CA 5C27A 3RBWA 4F7NA 3MS9A 3NUXA 3V5QA 2YHVA 3E64A 3R28A 2C0TA 2EB3A 3CQWA 4MK0A 4TYGA 5AWMA 4DEHA 2RG6A 3FZPA 5IQHA 4EK6A 1PMUA 2VX0A 4RWKA 4GU6A 4AZSA 5GINE 3MSSA 1OIYA 4FODA 2PY3A 3R6XA 3UYSA 1JKSA 4IAKA 5HNBA 3EFLA 3HMMA 3S4QA 3ZEPA 4ZY4A 4PF4A 4HGSA 2C6DA 3EZRA 4BJJA 4QQTA 1AQ1A 4I3ZA 4LGDA 3TJCA 2OIQA 2WTKC 4FTNA 2UZVA 4UMPA 3PZEA 3R2YA 4BCQA 4F78A 5IQFA 4RSSA 3OWKA 1SNXA 3AC3A 4C37A 3E88A 5A4TA 3V5LA 2UW6A 4F08A 5A14A 3S0OA 5CAUA 3AT4A 2GNGA 2J5EA 3E8DA 3AMAA 3IW6A 3COIA 4G5JA 4BDIA 1OGYA 4QPMA 2W9FB 3NW5A 3DBFA 3GU6A 4A9YA 3AMBA 1JSUA 3VBQA 4BTKA 3MVLA 1GOLA 2R3PA 1YI6A 2E2BA 4D2WA 3ZO4A 1PXNA 3QTSA 4FKTA 3UVQA 2AC3A 4EQUA 2B54A 2LGCA 2XNEA 5CSPA 2WMSA 3LLTA 3NUYA 3OUKA 2WAJA 4RJ6A 4IM3A 5EQYA 3BYVA 3OWLA 4E5WA 4XV2A 5ETFA 3VUHA 3UZTA 2PZRA 4FTJA 4AT3A 2PMIA 3W0PA 1J7LA 3CD8A 2QVSE 2B52A 3MY0A 3ZRKA 4FG9A 3P9JA 5IUGA 3MI9A 3QGWA 3I79A 3R1QA 4NIFB 5EQPA 4H58A 5FTOA 1WVXA 2HW6A 3AC5A 3KMUA 4I4FA 3KU2A 4I4EA 5DH3A 4FUXA 3OXZA 3UIXA 3IOKA 3QRTA 3UQFA 3D7ZA 2CNQA 4AOJA 4J99A 3MFSA 3VF9A 5EM6A 4YPDA 1Y8YA 3IW7A 4RJ8A 4AA0A 3G5DA 3R63A 5TKDA 2UZNA 5ITAA 4FV7A 4QTBA 3FZRA 4L9IA 3UPXA 2W7XA 4C36A 2XK4A 3OBJA 1H08A 1A06A 2C3IB 1PXOA 3RPYA 1ST0A 4NZWB 4ZOGA 2V0DA 3MH2A 3NNVA 4FIIA 5CVHA 3OC1A 2IN6A 3NS9A 2P33A 4AWIA 1OPKA 4QQCA 4XUFA 2XARA 5KMJA 3CPCA 2J0IA 3OBGA 2W9ZB 3OROA 5KE0A 3SOAA 3ZMMA 3PUFC 3NW6A 2FVDA 4XJ0A 4H39A 3Q2JA 2ZMCA 3PIYA 5KHXA 5FTQA 4HNFA 2VWUA 4WUAA 1H0WA 2HAKA 4H3BA 3VW8A 3IDPA 4Y85A 2YIYA 4G6NA 5DVRA 3T9IA 4C4IA 4CFFA 2CNUA 3VNTA 3B8QA 4U42A 3EN5A 3TNHA 3QTQA 4ZTNA 1PY5A 2OSCA 4FV5A 4FK3A 5A9UA 2YCFA 3FV8A 2V7OA 3KRRA 5M09A 1SZMA 5EYKA 2CGWA 2XIKA 2R3FA 5GJFA 2WU6A 4XG9A 4FL3A 4BHZA 3F2NA 4GCJA 4I5CA 4KSPA 4YZNA 5D1JA 4EZ7A 2GHMA 2OWBA 5J1WA 4DBXA 1BUHA 1IAHA 3II5A 3OOGA 1WZYA 3C4XA 5GHVA 4NM3A 2O63A 5JFSA 4IQ6A 2C5NA 3REPA 2H6DA 2GS6A 4K33A 4BCJA 2ERZE 4OBOA 3LCDA 4E73A 5L2IA 1W8CA 1M2RA 4QDVA 3V8TA 5IF1A 3GXLA 3PA4A 2XCHA 3MBLA 1YOJA 5EM8A 3K3IA 2OU7A 1ZYLA 4JDHA 2C69A 3U51A 1RJBA 3Q96A 2PVYA 2WTKB 4B8MA 4QPAA 3HAVA 3C4WA 3RVGA 3ZSHA 3HX4A 3OMVA 1UU8A 3ZLYA 2W0JA 3DA6A 1NT2A 3RZBA 4G3CA 2WPAA 3QTIA 5DT0A 4D55A 3D15A 2VTMA 4IWPA 4MQ1A 5AMNA 2OK1A 4FKJA 3FLQA 3QL8A 4J7BA 4QTAA 3DK6A 5AV3A 4F4PA 3SVVA 3W8LA 5E8SA 2QO2A 2XUUA 4O6LA 2ZB1A 4ACCA 1R1WA 4F9BA 3ZOSA 2IVVA 3QHWA 2XH5A 3ACKA 4K6ZA 4X21A 4FG8A 4B4LA 5HG7A 3AC1A 3L1SA 5CYIA 5IQGA 2YIRA 4DDGA 3F5UA 4I20A 4TW9A 5JQ5A 4BY9E 2YN8A 3NYVA 4O0YA 4RIYB 1NVSA 4GG7A 5ACKA 1M2QA 1IEPA 3UO4A 3K5VA 2RFEA 3HMPA 3LHJA 4FKLA 2B1PA 1SMHA 3KC3A 4FSMA 2BDWA 4RRVA 1P5EA 1XBBA 5ACBC 1OI9A 3FLWA 4GVAA 3RAKA 3TT0A 1H1WA 3UZPA 4EH8A 4R7HA 2PK9A 4RX9A 4S33A 5J9ZA 5DPVA 4O21A 3W0RA 3NYXA 4EH5A 4RJ5A 4WNMA 3LXNA 3OFMA 1DAYA 2Z7LA 4ZP5A 1FQ1B 3QQFA 3W0QA 2I0VA 3NNUA 3O8UA 3PP0A 4EL9A 4OGRA 2BRGA 5AP2A 3BGZA 5DWRA 3H9RA 2XK6A 4QP9A 2OW3A 4EZ5A 3VQUA 3FSFA 4O84A 4BBFA 5HICA 4AS0A 1B38A 1H07A 1UNLA 4CCBA 3QD4A 4V04A 4UYAA 3BHTA 5G1XA 4D2VA 4YJNA 4O7LA 4U45A 2ZV9A 4J71A 1QMZA 3FC1X 3ORTA 2OGVA 5DGZA 2ZB0A 4L3PA 5JEBA 1ERKA 1R3CA 2GU8A 3O7LB 4APPA 4FBXA 2ITVA 3W32A 4EUUA 1P4OA 3W2SA 2RIOA 4JR3A 1QPCA 4M7IA 4DEGA 5HBEA 3HDNA 5DRBA 3VQHA 2AEGA 2C3JA 2FUMA 3HUBA 3D94A 3NRMA 5CNNA 3ZRLA 5CXZA 3UVPA 3O23A 4OAUC 4G2FA 3P1AA 4BICA 3BBTB 4C02A 4JJRA 4E3CA 3GENA 3PVWA 2YWPA 2XJ1A 5EYCA 4BRXA 3NUNA 4BHNA 4PDPA 4CFVA 4GEOA 4PY1A 5BMSA 2ONLA 2UZWE 2W96B 5J87A 2XIYA 4IWDA 4FTTA 1ND4A 5BX0A 2PPQA 5L8KA 1CKPA 2QOHA 2XF0A 4CFWA 2WELA 4IC7A 2V62A 5DE2A 5HCYA 3IQ7A 1Y6AA 2IW9A 3OW3A 5KMOA 5B2MA 2EU9A 2J0JA 3BI6A 2Y6MA 5GJDA 5IUHA 1W98A 1KE6A 4AU8A 3NX8A 2GDOA 1H4LA 2C47A 3FYJX 3UDSA 4O86A 4O27B 3W55A 2YM4A 4WRSA 3BL7A 2Z7SA 3MJ2A 3MW1A 1J7IA 2BZIB 3OS3A 1H24A 1Q8UA 3KRWA 5AIRA 1XMMA 5DA3A 1ZYJA 3DS6A 4GJ3A 1OB3A 4QPSA 5TO8A 1IA8A 3A7HA 3JXWA 4H05A 2ETRA 5D11A 4QMMA 4C4GA 4EH7A 4KBAA 4MD9E 4QP7A 4EHGA 1T45A 5HZNA