1Q8TA

The catalytic subunit of camp-dependent protein kinase (pka) in complex with rho-kinase inhibitor y-27632
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein kinase A in complex with Rho-kinase inhibitors Y-27632, Fasudil, and H-1152P: structural basis of selectivity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
total genus 110
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q8tA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q8tA02
5DI1A 5KMMA 3KFAA 3RPYA 3DBEA 3R8UA 4X0MA 3MVMA 2PUUA 4GU9A 3ROCA 1JSTA 4IX4A 5CQWA 5CX9A 2WQBA 2Y6MA 2JDSA 3F61A 4TNBA 3BGZA 3D14A 3QKKA 2BTRA 1WVWA 1LEWA 5TOZA 3NMUF 2WXVA 4QNYA 3L9MA 5CVFA 4MF0A 5GIPE 4F6UA 5CU6A 4O0VA 4UBAA 3K54A 3PXRA 3P7BA 4FNYA 3QTZA 4XP3A 3R9RA 2RFEA 3QRTA 5ETCA 4IB1A 2XNBA 5G6VA 2WO6A 4O96A 3VRZA 4ALVA 3OT8A 3MWUA 3HX4A 3AOXA 1H1QA 3BGQA 5IH4A 2Y6OA 5EM8A 4FTLA 4KS8A 2HXQA 1YOJA 3HV3A 3FI3A 4EJ7A 4JNWA 4DC2A 2W99B 4D4YA 5JN2A 3QWJA 3LLAA 2XNMA 3Q9ZA 1XJDA 2X9FA 1VYWA 5B7VA 3ZLSA 4C4HA 2I40A 1M2QA 3QTXA 4U79A 3D7TA 3CGOA 2VGOA 4N6YA 1FOTA 3JVRA 1CSNA 3V6RA 2ITNA 4LRKA 5D12A 4FSQA 5EYKA 4IACA 3PP0A 4BGHA 4ZLZA 4GFGA 4PMTA 4IM3A 1XWSA 3DTWA 5K3YA 3TZ9A 4QMQA 1H28A 3FY2A 3EOCA 1ZYLA 4M97A 1URCA 3EJ1A 4JRNA 2ZB0A 3FI4A 4MXCA 3CJGA 4N0SA 5EM5A 1SNUA 5IMXA 3MJ2A 5BYLA 2OFUA 1IA9A 4HGLA 3COIA 3I79A 3M2WA 4IAKA 5DR2A 1BX6A 4B4LA 2ESMA 3GQIA 2F7EE 2W1CA 2OJGA 3LCKA 3OCGA 4AS0A 1O6LA 3OG7A 3S0OA 3L8XA 2WQNA 2FA2A 3HRBA 2O64A 4GT3A 4OBOA 4EHEA 4IEBA 2Q0BA 2PU8A 2WMVA 4O0WA 1UU8A 4YPDA 3C4ZA 3CBLA 3ZOSA 4OTFA 4PDSA 4R77A 4UB7A 5EI2A 3RZBA 5C8MA 2E9UA 2R3JA 4YHTA 1F3MC 3GB2A 4L3JA 4IVAA 4AT5A 4YSJA 3EQBA 1Q8UA 2GTMA 4HYSA 5AV0A 3HUCA 2R3NA 3ZO3A 4EHZA 4ANNA 3SW7A 3CE3A 3A99A 1YQJA 4RC2A 3G2FA 4RPVA 4DINA 3ZZWA 4BCOA 1OPKA 3ZSIA 4UX9A 3BQCA 4FIGA 4PTGA 5J9YA 3UPXA 2X39A 3LQ3A 3GT8A 4S31A 3NUAA 2J6MA 2OXDA 1FMKA 3EKKA 4IX5A 5A4CA 3AMBA 3FZRA 3NW7A 3NUSA 5AWMA 3EYGA 5FTOA 4G1WA 2IJMA 2XJ1A 1YW2A 4AA0A 1QPJA 3CPCA 4LG4A 5TT7A 2JGZA 3AT2A 3TJDA 1P4OA 4R8QA 4NU1A 5IA2A 2V5QA 1JWHA 3JXWA 4O1PA 4DGOA 3FLNC 5CEQA 3DDPA 3SDJA 3ZO1A 4FKQA 4BFMA 3W33A 3TDWA 3MESA 3QRJA 2BMCA 3NUPA 3QYZA 4MBIA 1XR1A 3FKOA 3C1XA 4RIOA 2VTTA 4AZSA 5KZIA 3CD3A 4XV2A 2R3GA 4YZNA 4H36A 3F5PA 3R73A 4BCMA 3BIZA 3OCSA 4NTSA 2J0LA 3BHUA 4A9SA 4GUEA 3FMJA 4FTOA 4HNFA 2YM8A 3PPKA 1GAGA 3E87A 3OEFX 2B53A 2F9GA 3TM0A 3NWWA 1IAJA 2BZIB 3VUMA 4E7WA 5HORA 3ZYAA 2DWBA 2GQGA 3LZBA 4B0GA 4WA9A 2J4ZA 5AJQA 3QRUA 2W96B 4S33A 2IVSA 4ZTLA 5GJDA 3UDBA 4NT4A 2CHLA 2F7ZE 3F3TA 5DT3A 5HTCA 4RFMA 2FSTX 3HVCA 3E8NA 2X6EA 2CKOA 2VO0A 3G51A 5L6WL 2XS0A 2R9SA 4FSWA 3DLZA 3DFAA 3R04A 1H0WA 2QLQA 4TXCA 2JBPA 4CD0A 5AR5A 5JFSA 2C5NA 4BCQA 4DFUA 3DLSA 2Z60A 2CLXA 4I0SA 4EBVA 4FSTA 4WT6A 3RWPA 1H1PA 3QAME 3DY7A 3UIMA 4C35A 4UMRA 4NL0A 2XKDA 3BHTA 4JXFA 3RAHA 5L2WA 3LFBA 4I6BA 5HD4A 4BY9E 4KSQA 3OOGA 4W8DA 1H1RA 3PXYA 4LL0A 2FB8A 5TE0A 2XK8A 1OL5A 4D2RA 4UALA 4L3PA 1OL2A 3UZRA 3DK7A 3NUNA 5CSPA 1R3CA 1XHAA 3D5VA 3NAYA 3BU5A 1JBPE 5FTQA 4AFJA 2C6EA 3RAWA 3QC9A 3EL8A 3IW8A 1XH6A 3G90X 4MD9E 4QP2A 3DK6A 4FTQA 4QMPA 5AR7A 4EC9A 3FEGA 5KO1A 4X3FB 4P2KA 4C37A 4HVSA 4PX6A 3UOKA 1OVEA 3EIDA 3Q6UA 2X8EA 3KULB 4FG8A 5HG5A 3Q4UA 4L7FA 2W0JA 4U9AA 4E4LA 4JR7A 2J7TA 4UV0A 4ZMFA 3V01A 5K4IA 4FV2A 5IUHA 2GDOA 5IUIA 2XVDA 3QRKA 4DGMA 5HX6A 3MY5A 1TKIA 2C5OA 4J7BA 4C34A 2I0HA 3NRMA 2ERKA 4IQ6A 3QKLA 4I6HA 3ANQA 5KCVA 3R30A 4R1YA 1OBGA 4YLKA 5HGIA 4HVGA 4I21A 4AN2A 4O0XA 3ORMA 3I7CA 4QPAA 3WF9A 4YC3A 4EWQA 4ENXA 4LI5A 5J5SA 1FGKA 2PZRA 4MXYA 1K3AA 4WRSA 1OUKA 4RJ5A 5AFVA 2QU6A 1WBPA 3QGWA 3OBGA 4PDYA 4CFVA 5L2QA 5J1VA 1PXIA 1MUOA 1OL1A 1Q8TA 4DLIA 1ZRZA 4S2ZA 5EDPA 3RBWA 2B4SB 1Q61A 4E5AX 5EW9A 2PMLX 4JR3A 2NNWB 3LCTA 5JMSA 5DEWA 3PPJA 4II5A 2PVNA 4TYJA 3VBQA 5J5TA 4P90A 3QTWA 4LOQA 2Q0NA 5CEOA 5E8YA 4FT5A 2CNUA 2J90A 2VU3A 1YI4A 3CQWA 4IXPA 3ORNA 4UXQA 5ANEA 2HZIA 5H8EA 2VNYA 4V01A 3FQEA 5H9BA 3UMWA 3AMAA 3E63A 3TL8A 2XYUA 3QD3A 5T6KA 3ZFMA 4UMPA 2XEYA 5CAPA 2QOCA 3IKAA 2IVVA 3E88A 2YZLA 4JBQA 3KULA 1OKYA 3PIYA 4ZTSA 5JGBA 5DYJA 4TRLA 2IW6A 2QODA 4X3FA 5KHWA 4KKHA 3GOKA 4AGDA 3MGYA 5A14A 5IQCA 2WEIA 4M13A 4Y72A 4YTCA 3QALE 5AX3A 5AUVA 2R3RA 1UU9A 4N4SA 4LMNA 3AC1A 4ZEGA 1KE7A 3F2NA 4PRJA 1JVPP 2WIPA 4QMUA 3NNXA 4FEVA 3DA6A 4RQVA 4GKIA 4MX9A 4BKZA 5D9HA 2WMRA 4WSYA 4DBXA 3C4XA 1J91A 2JIIA 3L9NA 2FVDA 4EZ3A 4YLLA 1ZMVA 4AW1A 2R64A 3BE2A 5IA4A 2B9IA 3QZIA 1KE5A 3GU8A 4GEOA 3RMFA 3KN6A 3PYYA 4LV5A 4P4CA 4YBJA 3SA0A 5L2IA 2XM8A 3DKOA 5HBEA 4C2VA 3I81A 2RF9A 3L8VA 3QL8A 4XMOA 4D2TA 3QQGA 5I3RA 2WMWA 5C4LA 1UWHA 3O8UA 4IX6A 4U6RA 2I7QA 1OPLA 4FSNA 3HAMA 3PIZA 1G5SA 2XP2A 4XX9A 4C3PA 2UW5A 2H8HA 2UW4A 3KA0A 2JAMA 4C4FA 4U7ZA 4QMLA 4FZ7A 4TN6A 4WBOA 4AU8A 3AD5A 1WBWA 3E64A 4A4OA 2PZPA 3W2PA 3NNWA 5AM7A 4WNKA 4A9UA 4KIQA 4XYFA 3U4UA 3NYVA 3JS2A 4X2KA 3MH2A 4AN9A 3A7GA 3W10A 4NKSA 3TACA 4EKLA 3EZRA 3PG1A 3HP2A 2W9FB 1H01A 3I7BA 3VIDA 3MJ1A 4PPAA 3P5KA 4ZZMA 3Q2MA 2QOKA 4GRBA 4EQUA 4EZ5A 3R8VA 2EB3A 3ZBXA 3LM0A 4CGAA 4IE9A 1OGUA 1OKWA 4O7TA 3PSCA 4MXXA 3K3JA 3UYTA 4FKJA 2BALA 4FTUA 5CSXA 4CFXA 4ZMEA 3OW4A 4GV1A 1LUFA 1ZLTA 4Q9SA 4QP9A 5AP5A 3IQ7A 5L3AA 3DS6A 2JKQA 3ENHA 3UQCA 2OKRA 3HV5A 2Z02A 3CSVA 3CGFA 3I0QA 2QHNA 4L01A 4EUTA 5H2UA 2XBAA 4OTGA 3GC9A 4IZYA 2YWVA 4BDDA 4USDA 4LM5A 4WG4A 2BZKB 5AA8A 2ACXA 5HIEA 4ZLYA 3U9CA 2C6IA 4CXAA 3W16A 3GU6A 1W0XC 4S30A 5AUUA 4GKHA 5HLPA 4H1MA 2WTIA 4RQKA 3B8QA 1AQ1A 4E3CA 3LMHA 2VWIA 4MEDA 2GQSA 4X6QC 4G9CA 3WF5A 3ORZA 4I4EA 4JX3A 2UZVA 3RAKA 5IQIA 3NYXA 3S2PA 4LFIA 3S3IA 5JQ5A 3VS3A 2HZ4A 3ODYX 3GCUA 1SNXA 4FKSA 3VN9A 2R3MA 3FSKA 2CMWA 1Q97A 4XBRA 3VS2A 1YHWA 2ERZE 2JDOA 3H9FA 1V0PA 2OU7A 3EZVA 3FDNA 4FUXA 4YZCA 3UC4A 1PF8A 2BAQA 3Q04A 5E9EA 3BX5A 4K11A 4RFYA 5T3QA 3N4UA 4F4PA 5ANOA 2UW6A 4HGSA 4O0RA 5KMLA 3FMLA 1RE8A 2C3JA 2J51A 4O6LA 4DAWA 2CPKE 4YBKA 2YCRA 2X8DA 5C01A 3C5UA 4E6AA 5CNNA 4ZXTA 4EOPA 4HYIA 3SW4A 4NKAA 2VTOA 4EH4A 3QLGA 4JDHA 3S4QA 4C61A 5CAQA 4NM0A 4BZNA 5CF4A 4CLJA 5L8JA 2JAVA 4TT7A 3IS5A 4X7QA 4FIHA 3MVLA 5ANGA 3SXRA 4Y95A 3UPZA 5AUZA 3O23A 3ZEWA 4EQCA 2XYNA 4FTCA 4FEWA 1W98A 4DEDA 2IVTA 4B7TA 3VS1A 3QXOA 4ZS4A 2C3LA 3MIYA 5BQ0A 3Q4ZA 3D7TB 2REIA 1PXNA 2YIWA 3FLZA 3FMHA 5CZIA 3G0EA 1NY3A 5DPVA 4ZAUA 1Q8WA 2X8IA 4K6ZA 3AC3A 3QHRA 2UW7A 2VNWA 2JIUA 2YLFA 2QI8A 4W4WA 5LCKA 3VAPA 3H9RA 4AZTA 5HICA 2R3PA 3RPOA 2OIQA 5DVRA 4EK4A 3WZKA 1CMKE 3FQHA 3HMIA 3HRCA 2C6OA 3LOKA 3OF0A 3U6IA 5CTPA 5CEKA 1W84A 1RQQA 5KNJA 3FZTA 2WQMA 1KSWA 3R1YA 3AG9A 4FKUA 4F65A 1ZYDA 2J0IA 3SKCA 1MQBA 1YXSA 5FDXA 2HELA 3LFSA 4FNXA 3SX9A 4CG8A 4R3CA 5KMJA 3BHVA 4OLIA 5CZHA 2NPQA 1RW8A 2WB8A 3KKVA 4O7LA 3F5GA 3QU0A 4IVCA 5EDQA 5EYCA 2C1BA 2C6LA 3QCSA 4BCKA 2OWBA 2QO2A 2RGPA 3ETAA 5E7RA 5EH0A 4XP0A 3ZH8A 4CV9A 2NRYA 3BRBA 1MP8A 4QPSA 4FGRA 4GVJA 2WKMA 2XIXA 2YDIA 4GT4A 2W1GA 1X8BA 1J7IA 4HPUE 5BVNA 3K2LA 1E1VA 5F1ZA 3V5TA 4B6LA 1Q24A 2F57A 2QVSE 5FBOA 1YWVA 5JRSA 2ITPA 4CSVA 2ITXA 4CCBA 1E9HA 4C36A 3FLWA 4FT3A 3UBDA 1WVYA 4PTCA 1UNGA 3G9NA 4QP3A 3M11A 4R3RA 2YISA 4M7IA 5DFPA 4AQCA 1Q5KA 4TWCA 2X1NA 1FMOE 4TW9A 2WAJA 1VJYA 1JAMA 1Y57A 3EN4A 4C33A 4FV3A 4M68A 4X21A 5J7HA 5K4JA 3GXLA 4J8MA 3UQFA 3HL7A 4F9WA 3TUDA 3ZLYA 4EORA 4ZP5A 5BVKA 5JT2A 5F20A 1BYGA 4HNIA 2OO8X 5J7BA 1A06A 2W4KA 3PJ3A 4KB8A 4YJNA 4FOBA 3OS3A 3ALNA 3EQDA 1F0QA 1H26A 4FEUA 3PY0A 3ORLA 4WHZA 4EOJA 2VUWA 4G6NA 3LJ0A 3D0EA 2BRNA 4CZTA 4BDJA 3NNVA 3UOLA 4FKGA 4RJ6A 3WF7A 2HENA 5M4UA 1O9UA 4DITA 4L7SA 2WU7A 3AD4A 4RZVA 3FWQA 4FTNA 2YDKA 4KKGA 2X4ZA 2GNFA 3DNDA 1UWJA 3BHYA 2YITA 4AZEA 4I5MA 3ZFXA 4E4MA 3R6XA 4NW5A 4BCFA 4QYEA 2WEVA 4U5JA 4D55A 4FBXA 5LOHA 2CGWA 3CS9A 5I9YA 2X0GA 2JFLA 4JDIA 3PXQA 4ANMA 4OTDA 4FZFB 2G1TA 4NIFB 3R7UA 3ACKA 4JOAA 5BVWA 3EQPA 3GC8A 2P33A 3ORPA 3GI3A 4UY9A 1HCKA 2YDJA 5CLPA 4O27B 4DFBA 3ROYA 1DI8A 4BTJA 3OCBA 2WNTA 1YWNA 4H3BA 5JK3A 5FP6A 3WZEA 2E9OA 3D94A 2X2MA 3IG7A 3SXFA 3VQHA 3PSBA 5HE3A 5DT0A 1LR4A 3FKLA 2B0QA 4APPA 3R71A 5CT0A 3VRYA 3D83A 3A2CA 4G3GA 3C4CA 3DXNA 5CF5A 4FEXA 3UTOA 3GU4A 4IFGA 3KMMA 4AZVA 3KVWA 5IPJA 2W4JA 3QCYA 2C69A 5AMNA 5EOLA 1YKRA 3QHWA 1YHSA 4W8EA 3R01A 1YDSE 4XNEA 3NYNA 4FL3A 2EXCX 2YCQA 2GS6A 3TCPA 4RWJA 1KWPA 2W7XA 3ZSGA 3NNUA 2W17A 2A1AB 4O91A 5AIKA 4MVFA 3GFWA 3KB7A 2OJIA 4JQ8A 4U81A 3QQUA 2VAGA 4XEYA 3V5PA 3LFCA 3TZ7A 4DTKA 4QOXA 3OW3A 1QL6A 4XG3A 5E8UA 4L3LA 4E4XA 5HTIA 3D7ZA 4UXLA 3MDYA 4QYGA 4F09A 3KY2A 5ANIA 4DFXE 3AMYA 3W8LA 1OITA 4CG9A 3P9JA 3AC5A 1PMVA 2O65A 2W1IA 4O21A 1GZNA 2XNOA 5HOAA 5IH6A 2PL0A 3I60A 3Q9WA 5HCXA 4S34A 3A7JA 5HO6A 3OWLA 1APME 3ZRMA 4J97A 2BRHA 4HCTA 2UZWE 3UVQA 4UYNA 1ZYCA 3OD6X 5LWNA 1IA8A 3CXWA 4DEGA 5M07A 3F3WA 3ULZA 4QTAA 3P86A 3UMXA 5JFWA 2PZ5A 5HE2A 5IMEA 4FL2A 3U4WA 4FA2A 5LMBA 3EN9A 2FSLX 2NP8A 3KXZA 5BVFA 5J79A 4D28A 2C5XA 5AAEA 4FG7A 4I20A 2PVRA 5CALA 1NVRA 3A61A 5F94A 3F2AA 3HNGA 2DUVA 2WMUA 3PXKA 5CNOA 5IEVA 3COKA 3OEZA 3EN5A 2V7AA 3EKNA 2YIQA 2GNLA 2R3HA 2VTIA 4DT8A 3DQXA 4BYIA 3OY3A 4I93A 2GQRA 3WYXA 3VS6A 4Y85A 3IW4A 3UODA 5CEPA 4YJOA 5FTGA 3KRRA 3FI8A 1OKVA 3F3UA 4EUUA 2X2KA 4G6LA 2XEZA 3RM7A 3WARA 3RNIA 4KBAA 2JKOA 2WFYA 3EN6A 1I09A 4HZRA 4C4IA 3PA4A 2GFSA 4FKWA 4CV8A 3O8PA 2QNJA 4ZK5A 3DNEA 3W2OA 4NUSA 2XF0A 3PFQA 1YOLA 1ZAOA 2QOIA 3CTHA 5EQPA 3Q2JA 5TR6A 3W32A 2C1AA 5FGKA 4TPTA 4YC8A 4ERWA 2E9PA 4FV0A 1ZARA 4MCVA 4RC3A 4QMZA 4OUCA 4XV1A 1YI6A 1PXOA 3ZFYA 3PSDA 4OAUC 3C0IA 1JKSA 3FYKX 5CU2A 5A4TA 3WBLA 1FVVA 3GEQA 4JLCA 5ACKA 4ERKA 5EQYA 4DEHA 2CGXA 3EQFA 2YM7A 1GY3A 2RFNA 4ZY5A 2VZ6A 3D2IA 5E4HA 1OIRA 1MRYA 4BTFA 5M4CA 4QT1A 2EB2A 4JDKA 3HMOA 4K8AA 4YZBA 4ZJJA 2A19B 3QTQA 5HE0A 4PMSA 3TIYA 4RSSA 2F2CB 3L9LA 3VBTA 3LQ8A 4AX8A 1KUTA 4A9RA 5C8NA 4F6WA 4CFUA 4AF3A 4KAOA 5HU9A 4I3ZA 1OIQA 2X2LA 3UJGA 4S32A 4FSYA 3CKXA 3ZXZA 2BTSA 3QZHA 1YXTA 2PZYA 3UZPA 4BWPA 4DTBA 5FEEA 2YM5A 1KOBA 2W1HA 2ETMA 4RX7A 4YUQA 1A48A 5M56A 1PKGA 3HA6A 5DA3A 3HMMA 4G3DA 2BHHA 4QP8A 3ORKA 1H24A 3D4QA 3A8XA 4IZ5A 4KIPA 4OTQA 2QQ7A 3BCEA 4QMYA 5AAFA 4O38A 3RM6A 4C3RA 1URWA 2YABA 2I6LA 3BZ3A 4DHFA 3DBQA 2Z8CA 4JAJA 5K9IA 3C7QA 5LVOA 5E1EA 3CTJA 4IIRA 2PPQA 4FI1A 2UZEA 3I4BA 2QO9A 3WE8A 4QMVA 1H25A 4D2WA 4NFNA 3VJOA 2XA4A 3UNKA 3W2SA 1KE6A 4UZHA 5LWMA 3TUBA 4KUJA 5BPYA 1ZOGA 2NRUA 4LYNA 1REJA 3HZTA 1DAYA 3BEAA 3GC0A 3OUKA 5FXQA 4RIWA 1IAHA 5HLNA 2ZJWA 3QKMA 4IAYA 3SVVA 5IQBA 2WGJA 3MW1A 1AGWA 1JKKA 3RINA 3R1NA 3PXFA 4DBNA 3TV7A 3OHTA 4M0ZA 2A0CX 3BLRA 3FMNA 4QYYA 4EOQA 5BMSA 2BZJA 3BYSA 3JUHA 4L68A 5FEDA 3R9NA 3VHKA 4O7YA 3PVGA 3VS5A 3B2TA 3DBCA 4H3QA 3KREA 3WZDA 2C6MA 4KRDA 3THBA 5LVMA 3AC4A 3B2WA 4FKLA 3SOCA 2G9XA 3UOHA 4YC6A 1CKJA 4L00A 3NSZA 4FNZA 4FTRA 1PRYA 5ITAA 3CLYA 4M69A 3W1FA 4C59A 3ET7A 4RMZA 2GHLA 4TWNA 5HIBA 3U8WA 3U55A 5EW3A 4CFWA 4BZOA 3ATSA 2OH4A 4YLJA 4EOSA 1YXXA 3MH0A 3TKIA 3R1QA 4IC7A 4RIYB 1J7LA 4UYAA 1OIUA 4FG9A 1PXJA 3BI6A 1WBTA 4NCTC 4V05A 5H8GA 5E1SA 1U54B 3F66A 5BYZA 4CMOA 2XM9A 4IWPA 1IASA 4QTCA 3AD6A 4WUNA 4YJRA 3V5QA 5AV4A 4AE9A 5CXZA 1UKIA 4L42A 1I44A 2FSOX 5KHXA 1FGIA 2QOLA 4EJNA 1CTPE 4ZJVA 3ZRKA 4OTHA 1YDTE 3CC6A 2XBJA 3LM5A 3FMEA 4FTMA 5HCZA 5L4QA 3SG9A 5CU0A 1Z57A 5CSVA 3PP1A 1OECA 3PY1A 5E8ZA 1BI8A 3FHIA 4ZJIA 4ANBA 4LL5A 3F3ZA 2Z7LA 4MBLA 3LLTA 3WYYA 5A6NA 4GYIA 4QMTA 4BWXA 2XCHA 1QPCA 4F0GA 2AUHA 5M53A 5DHJA 4EZ7A 5JEBA 2ETKA 1LP4A 4R7HA 3R8MA 3KRJA 4I92A 1V0BA 2LAVA 2VTQA 1Q62A 5CU3A 5A6OA 2XH5A 1YVJA 1J3HA 4EI4A 3PLSA 3SC1A 3HV6A 5BNJA 2R3OA 2BDWA 2G01A 4KINA 4LOOA 4DH5A 5CT7A 4L44A 4WKQA 3LCOA 4BF2A 3R21A 4BKYA 4MXOA 3R7OA 2BRMA 4PWNA 2XK7A 4U8ZA 3HV7A 2CCHA 4MKCA 4LUEA 3TNWA 3ENMA 1SYKA 4XLVA 2OZAA 4C62A 2PVMA 3OXIA 2PK9A 4L9IA 2WTJA 4F70A 4U42A 4M14A 4RA5A 3OROA 3O2MA 2W1EA 5DH3A 3W2CA 1Y6BA 4M12A 5CY3A 5M57A 4FK3A 3BEGA 4J98A 4ANQA 4O2ZA 4RWKA 2OSCA 5IQEA 3QC4A 2HY81 2YWPA 3G0FA 1WVXA 3SOAA 3A4PA 3BV2A 5AUXA 4BICA 4J71A 3LMIA 3EH9A 4H39A 1K2PA 1DS5A 2XK9A 3A7HA 2WU6A 3PY3A 2B9JA 3IGGA 3PJCA 4QP1A 3T9IA 3LXLA 4BCPA 2OK1A 5IQDA 1U4DA 2W5HA 2XIZA 3QQLA 2X7GA 2R7BA 5AAGA 3PVWA 1OI9A 5D7AA 4AZFA 4N70A 2BVAA 3QYWA 2O8YA 4OW8A 5LMAA 2I0EA 2QKRA 4BYJA 3R28A 1H1WA 1M2PA 3N9XA 4CYIA 4BIBA 4BTKA 3KEXA 4ZZOA 3FXXA 5BYYA 5CASA 3DBFA 1OB3A 3O96A 3FZSA 4RJ3A 4K1BA 5JQ8A 2GNIA 2GPHA 3KXGA 1V1KA 3D15A 3NYOA 4FIJA 5DN3A 3UVPA 4AOTA 3A4OX 1NXKA 2BKKA 5AR2A 4CKJA 4FTKA 2IZUA 4QP7A 5E8SA 1U46A 4C57A 3V5JA 5F9EA 2BDJA 1GNGA 2GHMA 1M14A 3LVPA 4QD6A 1R39A 5C4KA 1JPAA 4FYOA 3PJ2A 4OBPA 4FIFA 4Y8DA 3ZBFA 4R78A 3MA3A 3RNYA 1UNHA 4A4XA 4PPCA 3O50A 4U3ZA 5CU4A 4MNEA 3FPQA 1G8AA 4CZUA 3LW0A 3AC2A 4X6RA 3EQRA 2OF4A 4Z3VA 4PMPA 4ACGA 2R3LA 3PIXA 4GCJA 5T68A 2PVHA 5M08A 3VUTA 1PYXA 1UKHA 3U87A 5KZ0A 5IDPA 2XNPA 1ATPE 5AADA 5BVEA 4RVMA 2OBJA 2GMXA 4O86A 3R02A 3NUXA 4TYHA 5GIOE 2QONA 5I9WA 3EQCA 4MTAA 4IVBA 3GCPA 2VD5A 2UZNA 2RFDA 1ZXEA 3PZEA 3KC3A 2VWXA 1PXKA 4E5WA 3V04A 4IAZA 4V0GB 3TNQB 2ONLC 2IVUA 4RGJA 2CKPA 1XH4A 1IG1A 2WTCA 4ENYA 5HX8A 4GW8A 5ETAA 3BWJA 3MYGA 2PE0A 2WD1A 2YJRA 3PJ1A 2ZOQA 2ZM3A 4JAIA 3GC7A 3BWFA 3NZ0A 1BL7A 4TYGA 3CIKA 4HVHA 4FKOA 1HOWA 2XIRA 4PP9A 4XG6A 4DGGA 4RJ8A 4F7JA 2WTKC 4ORKA 3KRLA 3Q60A 4ID7A 5LVNA 3EQHA 3R8PA 3QQHA 4DEEA 3D2KA 2KULA 4KD1A 3SXSA 4A7CA 1TVOA 2G15A 1P2AA 4BCNA 1G8SA 3LFDA 5EW8A 3UE4A 5B0XA 2V0DA 1XH7A 1PXPA 3FI2A 4FT7A 3KQ7A 2YHVA 4U97A 2OXYA 2BCJA 4W4YA 3VBXA 1UVRA 4B9DA 5EYDA 2ITYA 1OUYA 4GG5A 2XKEA 3HP5A 4QRCA 2O5KA 3FV8A 3CTQA 1JNKA 2HZ0A 2HIWA 2ZV9A 3WZUA 4RRVA 4QMWA 4RIXA 3Q9YA 4NEUA 5C27A 3RHXA 3VC4A 4FODA 4AZWA 4AN3A 4EYMA 2YLEA 3RVGA 3C13A 5IA5A 2Y7JA 4TY1A 3VF8A 1OIYA 2CN8A 4ITHA 5AP4A 4QQ5A 5AP2A 3VVHA 2EXEA 4BI2A 3O0GA 2ZV8A 3QXPA 4HOKA 3P23A 1GJOA 2AC5A 4C7TA 2H6DA 1XO2B 2BIKB 4J95A 1SMHA 2GS7A 2VWBA 3DK3A 3IOKA 4QP6A 3FLQA 5JSMA 2XKCA 4ITJA 4TYIA 4ZTRA 4C4GA 4RVKA 5HCYA 3K5UA 2LGCA 4OT5A 3COMA 3RZFA 1GIIA 3VUKA 4GVAA 4EH9A 4IZAA 4BDFA 1OL7A 2QLUA 3Q4TA 4IAAA 3U6HA 3FLYA 3PTGA 4IWOA 2BKZA 3FXWA 4OBQA 5F4NA 1PYEA 2FO0A 2XIYA 4EBWA 1CM8A 1PMNA 4X2JA 3G15A 5HO8A 1R0PA 5EKNA 3IO7A 3PA5A 4E8AA 3DTCA 3Q4CA 2J5FA 4NW6A 3MSSA 4YP8A 5A54A 4QMSA 5LARA 3TI1A 2QHMA 3DV3A 3EFLA 3NUYA 4KIKA 4L46A 4M84A 4HW7A 4RBLA 4TNDA 4AACA 4BDKA 3BBTB 5IG1A 1XQZA 4E26A 4EH6A 3E8CA 1TQPA 4Z7HA 3E8DA 5ETFA 2PWLA 4KBCA 4QTBA 1JSVA 4MH7A 4YJSA 4U40A 2YZAA 5LMKA 3U6JA 3NIZA 3VS4A 3MB7A 4RWIA 5KKRB 1PXMA 4O0UA 5AR8A 2J0JA 4BBEA 3O51A 2OJ9A 5A4QA 4CFNA 1O6YA 2CKQA 4IH8A 3NVMB 2RFSA 4JDJA 3KXHA 4DYMA 4IJ9A 4H1JA 3AT3A 3BU3A 2P3GX 3BBWA 3DKGA 3PRFA 5HE1A 4EK6A 4M15A 3RK9A 2ZV7A 3RWQA 3LKMA 3OVVA 3UG2A 4JQEA 4F9YA 2HW6A 2OICA 4MHAA 4PL5A 2F2UA 2H34A 2RG6A 5EOBA 5AUWA 3R83A 4NJ3A 4O1OA 2FGIA 4EC8A 4YNOA 3IECA 4BKJA 2BFYA 4EOLA 4ANSA 3OWKA 4F9BA 2VTMA 4GH2A 4K18A 5LQFA 5JFVA 3UP7A 4Q5EA 2PMOX 5CXHA 1XH9A 4FR4A 5J87A 5AIRA 5I4NA 2XNNA 3P4KA 4BTMA 4CFMA 4D0WA 1O6KA 4C3FA 5EM7A 4EOKA 5EM6A 3ERKA 3Q5IA 4D1SA 5IA1A 4D4VA 2JKMA 4DFLA 2R2PA 3NGAA 5FP5A 4Y5HA 2QOQA 5KUPA 3QWKA 1M7NA 1H07A 4JBVA 4DEAA 4RFZA 3HMNA 4MBJA 2V55A 2OIDA 5AM6A 4ALWA 5FM3A 4AW5A 3QUPA 5L6PA 4BI0A 4BBFA 2WMBA 3OY1A 4R3PA 4YSMA 1GIHA 2JBOA 3KXMA 2Y9QA 3ZXTA 5KE0A 4GJ2A 4C8BA 1CKIA 3DXPA 5A3XA 2BIYA 3JYAA 3FHRA 1SVGA 5FXRA 2R3FA 3CR0A 3KU2A 2KTYA 5HEZA 3ZU7A 4HGEA 3NUUA 1Y6AA 3F69A 4CRSA 3W2RA 4JRVA 4XOYA 3CQUA 3PXZA 4BC6A 2O63A 2GS2A 2VTNA 4I23A 4YURA 1YOMA 1NA7A 1KE9A 3LXKA 4V04A 3SAYA 2UVXA 1P14A 2P4IA 4RZWA 5EK7A 3BLHA 3W18A 3AXWA 1IRKA 4I5HA 1IEPA 2JD5A 3SQQA 1QPEA 3LXNA 4WSQA 4EK5A 4AE6A 3R63A 3QUEA 3BV3A 4KIKB 4U80A 3VUIA 2OF2A 4P5QA 4AGCA 4ASDA 4IWQA 2WTWA 3AGMA 5CSHA 5AP0A 2BDFA 2QOHA 2Z7RA 3FKNA 3Q53A 4RG0A 4F9AA 3BYUA 3EWHA 4CT2A 3IGOA 1M52A 2CDZA 2GU8A 4G2FA 4J53A 4FKTA 3BKBA 4I94A 3TEIA 3EFJA 2E9VA 5A4LA 4CT1A 5IH5A 4ARKA 4QO9A 3IPHA 5E90A 1ZWSA 3KXNA 5GZ9A 5EI6A 3UNZA 1FVTA 3ID6C 4DA5A 2ZVAA 2C3IB 2R7IA 4QYFA 1F5QA 5EHYA 4O6EA 5EI8A 3QX4A 2CKEA 3KGAA 4GK3A 1PY5A 4GYGA 3I0OA 4WBBB 5GJFA 1WBNA 5IKWA 3TJCA 3DQWA 5DR6A 4FV5A 4E1ZA 4ZTQA 4GU6A 4E4NA 4J1RA 1JLUE 5GJGA 2GNJA 4FSRA 5CAUA 2OI4X 3F88A 4M8TA 4G31A 4O83A 3NAXA 3ORXA 3BYMA 1JOWB 4GUBA 4EL9A 3BPRA 3Q9XA 2XRWA 5JZJA 3ZZEA 3ZM4A 1VYZA 2Y0AA 4I4FA 4N57A 5BMMA 1XH5A 3H0ZA 3Q3BA 1MRUA 2VO7A 2C4GA 3RJCA 3VBVA 3C50A 4JS8A 4LGGA 4NFMA 3WZJA 2UV2A 4F7NA 3VJNA 3CQEA 5K0KA 4EYJA 1H8FA 4ZOGA 4O81A 3F5UA 2DS1A 3C4EA 3PWDA 5CEIA 2R5TA 4XG9A 5M4FA 5I9XA 1ZY5A 3ACJA 3L8PA 3NIEA 4KWPA 4Z55A 5LCJA 3QQJA 3AQVA 2QC6A 5FM2A 3V3VA 4AW2A 1GZKA 3W2QA 4BDBA 3UG1A 1NT2A 2UZTA 3MN3A 4J96A 3ZDUA 1PMEA 4CYJA 5EQEA 4KABA 3T8OA 3TNPC 5M44A 2PVLA 3HV4A 4ASEA 2HCKA 1L8TA 2QD9A 4RVTA 3E5AA 3FC1X 3OC1A 3G6HA 3FPMA 3P79A 3ZS5A 1M17A 4CKIA 5H3QA 2W5BA 1PXLA 4M0YA 4CTBA 5EHOA 5CAVA 3KN5A 3V8WA 4E20A 3I6WA 4JVGA 3HAVA 4EH2A 3H30A 3OXTA 4M3QA 4FF8A 4XHKB 4DG3E 3Q6WA 4UZDA 5HQ0A 5K5XA 1L3RE 4FTIA 2HY0A 1J1CA 4C4JA 3F7ZA 3SRVB 4WOVA 3HDMA 3NCZA 2OXXA 3GCVA 5CVHA 5AR3A 1H1SA 4XG7A 3CJFA 4KBKA 3LCDA 4V0GA 3R7VA 1B6CB 1Q8YA 4BHZA 3IW6A 3O8TA 4AA4A 3D5XA 4GMYA 3TTIA 2B52A 3MFSA 4O0YA 3ZC6A 5HZNA 2XNGA 2C47A 1Y8YA 3IW7A 2PE1A 4FSMA 1ZMUA 3COHA 3QTSA 3VW8A 5M09A 2OZOA 3I6UA 5DT4A 4A06A 4D5HA 3IK3A 3FL4A 5HVKA 3GU7A 5GHVA 1ND4A 2W4OA 5CQUA 5AP3A 2GSFA 4BDCA 4FKRA 3VW6A 3SRVA 4ASXA 4BN1A 3NCGA 4B99A 4DCEA 2C0OA 2YFXA 4FT9A 4FZAB 3DBDA 3FMKA 4U45A 5E8VA 3TT0A 5FBNC 3VF9A 4RX5A 4UN0C 4MQ2A 3ZO2A 3GFEA 4LOPA 2OG8A 3ZC5A 2VWWA 4XG8A 5IQGA 2UW3A 3M42A 4GSBA 1ZOEA 5JKGA 4HVDA 4RT7A 3V51A 5BVDA 1XBBA 2ITOA 3FY0A 4KSPA 3CKWA 5B2KA 3BU6A 4XRLA 4QQTA 4TKSA 5I3OA 4XBUA 4HCUA 4D9UA 4IZ7A 4BHNA 5A9UA 3DFCB 3KRXA 4GT5A 4RLLA 4G6OA 4AAAA 4BDHA 5AEPA 4B8LA 3OTVA 4CVAA 4PTEA 1GZ8A 2XK6A 1BMKA 2Y8OA 1S9IA 4EOMA 2CNVA 1JKTA 3DB8A 4WUAA 3R8ZA 4GK4A 1R1WA 5HBJA 1TQIA 5J95A 3TV6A 3C4FA 2UZUE 2P2IA 2W1FA 4E6CA 4OR5A 5IF1A 4BBMA 1JSUA 4DFZE 5ICPA 2WMQA 3PLAE 2VN9A 2BRBA 3DJ6A 5HHWA 2IN6A 2W06A 2C3KA 2JKKA 2EWAA 1H27A 1T45A 4PDOA 3CP9A 3KK8A 5HI2A 1Z9XA 2UVZA 2UZOA 3LFEA 4CNHA 1SVEA 2QKWB 3UO4A 5BVOA 2BAKA 4GIIA 2EXMA 4YZMA 4YHFA 5EDRA 4LUDA 4FIEA 1BUHA 1MRVA 2B55A 3G5DA 4FNWA 1WAKA 2YCSA 3HGKA 3CY3A 2RL5A 1WMKA 2OZAB 3FLSA 3ODZX 4FVQA 4GS6A 4JQ7A 3DCVA 3NDMA 2ITTA 4O0TA 3DGKA 4O7ZA 3TNHA 1P5EA 2GNHA 4YJPA 4IJPA 2JITA 4I5CA 4E73A 2P2HA 2OW3A 4EH3A 5JFXA 4FOCA 3AC8A 3Q32A 2G2FA 4N6ZA 2R3KA 3WIKA 4FE2A 1RDQE 5CENA 3HECA 3TV4A 3UIBA 3QTUA 2OJJA 2WZJA 4L52A 3P78A 3S95A 5DR9A 1QPDA 3E7VA 3G33A 3KXXA 4CLIA 4WG3A 3OTUA 2PTKA 2QG5A 3R7GA 3G9LX 4H3PA 2WTVA 2C6KA 3SV0A 3CEKA 3VBYA 4IMYA 5L8LA 4DTAA 3PE1A 3HKOA 4X3JA 1Q4LA 2VX3A 3FJQE 4FVPA 4AGWA 2PVFA 2UW8A 3D5UA 2A27A 3FBVA 1DI9A 3F5XA 3GUBA 4TZRA 5KMIA 2ZM4A 3HDNA 3UIXA 5AV3A 4G34A 4XCUA 4QMXA 1R0EA 1U59A 3MH1A 5L6OA 2YIXA 4Y5QA 3FZ1A 4EH5A 1BKXA 4LRJA 2DYLA 1MQ4A 4YJQA 3UO6A 2AYPA 3BHHA 2YACA 3A8WA 3GP0A 4NM7A 3BYVA 2I1MA 4QPMA 1GOLA 2OIBA 1ERKA 2YERA 3QTIA 3VULA 4I6FA 2UZDA 3ITZA 4FKIA 3HUBA 4E5BA 4R5SA 2PVJA 3HEGA 4RIYA 4R7IA 3W8QA 4BDAA 5A4EA 5GZ8A 4PP7A 2YEXA 4JL9A 4D58A 3P7CA 4I1ZA 3PA3A 2I0VA 3KMUA 4ZTHA 5IZFA 4DFNA 4FKPA 5JZNA 1YDRE 3OFMA 3TKHA 4C0TA 5AUTA 3OMVA 3II5A 2WMAA 4M69B 4Z16A 4USFA 4W9XA 3RP9A 5B2MA 4WNOA 3MFTA 4KRCA 1PMUA 3V5WA 4DE4A 2GCDA 4AT4A 5IQAA 1WFCA 1P4FA 3DAKA 4W4VA 2PVYA 4F6SA 3K3IA 2WQEA 3F3VA 5E8WA 4PNIA 1V0OA 4OT6A 3MPMA 1G3NA 4IDTA 4KA3A 4Q5HA 2OH0E 3E8EA 2QU5A 3ZO4A 1WBOA 3FUPA 3GVUA 2XZSA 4ZS0A 4RX8A 3KF4A 3RKBA 2VTLA 4I22A 5I9VA 5IUGA 2C6DA 4E6QA 5KMKA 1Q3DA 4R7BA 2RSVA 1PHKA 4R1VA 3QD0A 2J0MB 3HRFA 2YM3A 3QGYA 3ORIA 2NO3A 4JBPA 5HO7A 2XMYA 2QCSA 2VX0A 3DAEA 4G16A 1YXVA 4G5JA 4YO4A 4JG8A 2QOFA 4IM2A 2YJSA 5FXSA 2IW9A 2R3IA 2YIYA 4NTTA 4P5ZA 4MD8E 1YI3A 5CF6A 4EOOA 2ZM1A 4M66A 3DB6A 1Q8ZA 2VWYA 2PUNA 4ANLA 2W9ZB 5KKRC 4O7NA 1QMZA 2GNGA 1M2RA 5I9ZA 5L2TA 3OZ6A 3CY2A 2QOBA 2OFVA 4D0XA 2A2AA 4IW0A 4BGGA 1UA2A 2ZAZA 2ONLA 5BX0A 3GCQA 5HNBA 5TF9A 4FSUA 3UC3A 5G1XA 4XG2A 3F2RA 2WTKB 5CWZA 3POOA 3WI6A 4PF4A 1OMWA 2XCKA 3R7YA 2Q83A 4ZSEA 4QMMA 2GFCA 3VWAA 4BI1A 2BUJA 3E7OA 5DIAA 5AP7A 4ZSJA 2ZMDA 5DMZA 5FDPA 4ACCA 3E3PA 3SHEA 1JKLA 2W05A 3A60A 4AOIA 2VO6A 4U41A 3R22A 5CI7A 2RIOA 3U9NA 5AUYA 2BR1A 3IONA 3ZUTA 3HLLA 3D9VA 5M06A 3LFNA 2ITWA 3HA8A 4G9RA 5HU3A 3GOPA 4BCHA 3T9TA 1H08A 5GNKA 2WPAA 1GZOA 5F95A 4DH7A 2VTPA 3LIJA 3RK5A 2WELA 3AT4A 4F0FA 4CTCA 4AGUA 4IB3A 3QLFA 2C0IA 1OPJA 3POZA 2WMTA 3EMGA 2O2UA 3MB6A 2VWUA 4O22A 3O17A 3RPRA 4BGQA 5LVLA 3R8LA 2JC6A 4BCJA 3V5LA 1YWRA 2WHBA 1Y91A 3ANRA 4G3EA 5HESA 4I41A 3MI9A 4RIXB 4U43A 4B8MA 4IB0A 3TXOA 2JDRA 4DG0E 1UU7A 2JFMA 4YZDA 3VNTA 4G17A 1OM1A 1STCE 2WIHA 5M55A 1E1XA 3RCDA 4DEBA 4TWPA 2Z7SA 3UVRA 1W82A 4FV4A 5FD2A 3TUCA 2B7AA 3C4WA 4FMQA 4FKVA 2OLCA 2JDTA 2YAKA 3ULIA 1VR2A 2WMSA 3ZUVA 5LXMA 4MWIA 4O2PA 4QYHA 2HYYA 2O0UA 2B54A 3FZPA 4CCUA 3VBWA 5I5ZA 4XV9A 2WQOA 5LVPA 1CKPA 1M7QA 4ZLOA 2QOOA 5CI6A 4KKEA 4XUFA 1BI7A 3BELA 3WILA 4LGDA 3V6SA 4D4RA 4EH7A 4WO5A 3OP5A 4L8MA 5KBRA 3QZFA 4YR8A 5IA0A 4FV8A 4PNKA 3EYHA 3BQRA 4FK6A 4A4LA 1S9JA 3TDVA 3O71A 2B9HA 3EB0A 4HZSA 3U51A 4CKRA 3E62A 4X2GA 5JRQA 4JI9A 3NX8A 4NCTA 2W1ZA 3I5NA 4X3FC 3NW6A 2CJMA 2ZMCA 3G6GA 3OUNB 4G3FA 4NM5A 3PVBA 4AT3A 3C5IA 4FSZA 4K33A 1DAWA 2PULA 2X81A 4EK8A 4NYEA 2EU9A 1ZY4A 2ZDTA 3F82A 3OXZA 3EHAA 4DGNA 5HG8A 4ZSAA 5DGZA 4Y83A 4X2NA 3CD8A 5IEXA 3ZONA 4TYHB 5DBXA 3PPZA 4W9WA 2UVYA 5EHLA 4QP4A 4C2WA 3PVUA 1OL6A 4FV6A 4H58A 4BVUA 4JBOA 5J8IA 3QRIA 4FTAA 3ELJA 5DLSA 4IVDA 2IG7A 4MNEB 4BDEA 4NWMA 2C5YA 3C51A 4U3YA 5KX8A 1ZYJA 5HVJA 3PUPA 3R7EA 4DG2E 4FT0A 5EFQA 4C58A 5EYMA 1WZYA 4BCIA 4DCAA 1SVHA 4ZTMA 4O7WA 3H3CA 4XRJA 1ZZ2A 2PYWA 3FMDA 3OWJA 1AD5A 2BZHB 2HAKA 4WNMA 4RVLA 4EK3A 3MTFA 4Z9LA 3MA6A 4ZSGA 3VHEA 3VS0A 5D41A 1PJKA 2QG7A 2WMXA 3JVSA 4DGLC 2C0TA 4CRLA 3FZOA 2PVKA 4O0SA 4C38A 1XBCA 3I1AA 2WOTA 5EKOA 3UQGA 2PUIA 3LE6A 1RJBA 3RPSA 4YMJA 5J9LA 4QTEA 2RKUA 3FQSA 2X4FA 4ZY6A 2YN8A 3C0HA 4HPTE 5DNRA 4MWHA 4K2RA 4W4XA 4DEIA 5KBQA 2XRUA 3L8SA 2QURA 4HGTA 2B9FA 3GBZA 3DU8A 3PDTA 4D1XA 2Z7QA 4FUYA 4D1ZA 4FTTA 4APCA 4F64A 2UUEA 5KMOA 3SLSA 5J1WA 3RCJA 4MF1A 4YTHA 3R2BA 3BE9A 2AC3A 3DDQA 3LJ2A 3PE2A 5H8BA 3KK9A 4CMTA 4L6QA 5I9UA 4MXAA 4F1MA 4HCVA 3KCFA 3BLQA 3OWPA 3TIZA 3R0TA 4ZY4A 4NK9A 2XNEA 2EUFB 2PMNX 3GU5A 5JGAA 5M51A 3VS7A 3TZMA 4CQEA 5AV2A 4OTWA 2J5EA 1FVRA 4HYHA 3UP2A 4D2SA 2R0IA 4Z7GA 2CGUA 4FZDB 4USEA 3KL8A 3QD2B 1KV2A 5C1QB 4CMUA 3NVKI 4G5PA 4G3CA 3EN7A 5CS6A 4A07A 2DQ7X 4ASZA 1J7UA 2HXLA 3H10A 4BB4A 2XK4A 1LEZA 4ZIMA 3ZRLA 4BWKA 3MVHA 3P1AA 3PG3A 5FQDC 2QR8A 3D5WA 4DFYA 1VZOA 3A7IA 1K9AA 4PDPA 5CSWA 4NSTA 3MVJA 5BUIA 4O7SA 4EONA 2G2HA 3E92A 3RGFA 2XJ2A 2XIKA 1GIJA 1KV1A 3L9PA 4L45A 4A9TA 4AG8A 3ZM9A 3VUDA 2JLDA 2UZBA 4FX3A 4C02A 4MXZA 3EFWA 4AP7A 5HNGA 4BR3A 3QUDA 3SGCA 4BL1A 3S1HA 3KMWA 4I0RA 2F49A 4CFFA 3DJ5A 3F7WA 4I5PA 3TN8A 1NVQA 3B8RA 3JY9A 1R78A 3ZDIA 4EHVA 3C9WA 1FBNA 4RC4A 1U54A 4PUZA 4QTDA 4CZYB 4JX7A 5DEYA 1OBDA 3U54A 3JPVA 1XBAA 3Q96A 2CLQA 4NZWB 3RPVA 1Q99A 2ETRA 3DOGA 4MK0A 4PV0A 3C0GA 4EOIA 1SZMA 2F4JA 4ANOA 3FAAA 3ZUUA 2R3QA 3BGPA 4JJRA 4DN5A 1UNLA 3DKCA 3TTJA 4OAVB 4FEQA 4WG5A 3F9NA 1HCLA 3R9HA 3H4JA 3QQKA 4TWOA 4M67A 5E8XA 4ALUA 5HG9A 4LGHA 2IO6A 5E8TA 2CNQA 4O7RA 1H4LA 4EH8A 3KCKA 4I0TA 5BUEA 2JEDA 3O7LB 2R0UA 5AP6A 2Y4PA 2XKFA 4O7VA 2R4BA 4BZDA 2HOGA 3LQ5A 5CANA 2YM6A 3LFQA 4IAIA 4JIKA 1FINA 2GHGA 4IX3A 4EHGA 5K0XA 2V22A 3E93A 3IDPA 2C68A 5TO8A 4RIWB 3DAJA 1UU3A 2ZYBA 1T46A 5CAOA 3R2YA 2VRXA 5L8KA 4XH6A 4F1TA 2BPMA 2PMIA 5AR4A 5AX9A 4HYUA 5IA3A 5K5NA 2ZB1A 5FLFA 5D11A 4JIAA 4YGAA 3UGCA 1SM2A 2HK5A 3IW5A 4YHJA 2JIVA 5LJJA 3QCXA 1WBSA 5DRDA 3W55A 5ANJA 5C26A 2CN5A 4O84A 3GQLA 1ZZLA 2ITUA 4L67A 3P7AA 5DG5A 3WF8A 3IDBA 4IB5A 2W5AA 4GG7A 5DRBA 3VUHA 4BIDA 4NM3A 4FL1A 1IR3A 3UOJA 3MV5A 1H0VA 3GNIB 4IFCA 4J99A 4AXAA 4RA4A 4J52A 2J9MA 2HWOA 3HYHA 2XB7A 4D9TA 4AUAA 4YTFA 3N4VA 5D10A 4RWLA 5FUTA 2WTDA 4D4SA 5IISA 5IDNA 4ONAA 2YAAA 1OZ1A 4FV7A 4TTHB 5C9CA 2FUMA 4IADA 2E2BA 1B39A 2BAJA 2Z2WA 5I0BA 5AA9A 3T3VA 5ETIA 1KOAA 1UV5A 4L43A 4DF3A 2Y4IC 4XOZA 3RK7A 4F7SA 4YO6A 1FPUA 4D2PA 5C03A 2IWIA 2V7OA 3HMPA 2C30A 3NEWA 1WBVA 3H0YA 3REPA 1WCCA 4KS7A 5CEMA 3UYSA 2FYSA 5E92A 2P55A 4UWBA 1KE8A 4F0IA 4L53A 3OCTA 4HJOA 2JDVA 3MPTA 1NW1A 4UWYA 4O82A 5HG7A 5FWKK 3RI1A 4QQJA 4I6QA 3MH3A 4JG6A 4ACMA 4WNPA 3L1SA 1Z5MA 3P08A 4FYNA 4MD7E 5DOSA 3H9OA 3LPBA 3T3UA 2W1DA 3UIUA 3UO5A 3NW5A 2VTHA 2B1PA 2BILB 3DXQA 2IZTA 3RALA 4IDVA 4EQMA 3FMMA 4QMOA 4KIOA 1QCFA 3QTRA 3GCSA 3MY1A 4WIHA 1U5QA 5JH6A 3MS9A 3R7IA 4C4EA 2F7XE 3MY0A 5IQHA 2FH9A 4U44A 5KMNA 5FRIA 3P0MA 4FZ6A 1Y8GA 4LV8A 3VUGA 3MTLA 4ZSLA 4F08A 4UMQA 1VEBA 3FC2A 3QF9A 3QFVA 4RLKA 3Q52A 3OOMA 3NLBA 4TL0A 5HBHA 4F63A 4K77A 4ZTNA 3LFFA 4YZ9A 3DPKA 2O3PA 3FXZA 3WOWA 5CYIA 3PRIA 3NR9A 5FG8A 5HD7A 1U5RA 2J2IB 2PZIA 1NVSA 2VV9A 2I0YA 4QQCA 3ZLWA 4XS2A 2A4LA 3OT3A 4IHPA 4GIHA 1W7HA 1BLXA 1H00A 4F9CA 5M4IA 3RAIA 4BDGA 3PZHA 3QZGA 4EEVA 4IC8A 3K5VA 3IOPA 3QX2A 4GL9A 4IAFA 3LJ1A 4OTRA 5CF8A 1YXUA 5EG3A 3M1SA 3N51A 5HKMA 1JQHA 2VWZA 4DLJA 2IZSA 3F6XA 3FYJX 4PY1A 2YCFA 3ATTA 2E9NA 1YHVA 4LQMA 3WE4A 4FVRA 4RX9A 3TZ8A 3GGFA 3CCNA 3E3BX 4NH1A 4KNBA 3TKUA 4H05A 1FQ1B 3FL5A 4MYGA 5BUJA 2VGPA 3AGLA 1LPUA 1REKA 4Q9ZA 4D5KA 3R1SA 1CDKA 5IQFA 4GK2A 2PHKA 3ALOA 2BHEA 2FSMX 3CPBA 2UW9A 3PJ8A 4QNAA 4RJ7A 2BFXA 4PQNA 4FIIA 3A7FA 3LAUA 5TKDA 3TNIA 3O7LD 3LXPA 3EQIA 2SRCA 4FTJA 3WIGA 4UMUA 3KVXA 4WD5A 4XV3A 2XUUA 3ZHPC 4EKKA 4ZZNA 3JY0A 4UWCA 4NJDA 4UEUA 4DH8A 2YA9A 1EH4A 2ZV2A 5ACBC 4XLIA 1BL6A 2OGVA 1J1BA 5CVGA 1ZOHA 3R9OA 2C6TA 4YJTA 4YNEA 4YTIA 3DT1A 3LCSA 1DM2A 5D7VA 3DKFA 4ITIA 4D2VA 4K0YA 3DZOA 2PY3A 4F99A 4GFMA 2Y4IB 4U0IA 3TG1A 2VX1A 5A46A 2XJ0A 3PWYA 2V62A 4EWHA 1XKKA 2VTSA 2BROA 3MFRA 4IWDA 3R9DA 3WF6A 1ZMWA 2IZRA 2XK3A 5AP1A 2HW7A 2YM4A 3GENA 4JT3A 5HLWA 5HIDA 2ITQA 5JGDA 4AFEA 1W83A 3N4TA 4BRXA 4FGBA 3LHJA 3MBLA 3QD4A 4MNFA 2EVAA 2X6DA 4PMMA 4XJ0A 3V8SA 4CEGA 4CQGA 3SG8A 1Q3WA 2PSQA 2QR7A 1PW2A 2P0CA 4AW0A 5C8KA 2CGVA 2IPXA 4XG4A 1A9UA 4FICA 2WOUA 5FEQA 3UZTA 4AOJA 2PE2A 3MFUA 4I24A 4E93A 3R00A 4R6VA 4LRMA 4QMNA 2VWVA 4IBMA 5GZAA 3ZMMA 3LFAA 5IU2A 2VTRA 3OBJA 4Q2AA 1TQMA 3QBNA 2OJFE 2VO3A 5D1JA 4DH1A 5LMKC 3RHKA 5HTBA 4ACHA 3DZQA 2X9EA 4JG7A 5DWRA 4AWIA 3KF7A 4YJVA 4NIFA 2QO7A 3QA0A 1ZYSA 5ANKA 2RG5A 1XH8A 4J8NA 2G2IA 2H9VA 4DT9A 3UNJA 4TYEA 4PPBA 3ZCLA 3QQFA 2X7FA 4PL4A 4E6DA 3ZTXA 5GINE 3MPAA 5J9ZA 4BIEA 5L2SA 2ITVA 3RTPA 2BRGA 4X2FA 2GTNA 4MAOA 4P7EA 4PL3A 2VTJA 5HNIX 4XP2A 5DE2A 1B38A 3QCQA 4K9YA 4FV9A 2YIRA 4IM0A 2X7OA 3V8TA 3FE3A 3ZLXA 1PKDA 2UZLA 3FSFA 5AV1A 2PUPA 3JR1A 3QA8A 1OKZA 3Q5ZA 1YRPA 4YJUA 4WRGA 2IW8A 3TWJA 4F1OA 4Y46A 3KRWA 3NPCA 3IDCA 4RJ4A 4IANA 2J0KA 5ANDA 3LMGA 2CCIA 4UMTA 4OTPA 3VQUA 3ZSHA 4ACDA 4MQ1A 2J50A 5IEYA 5HVYA 4OTIA 1W8CA 3EQGA 2ITZA 3DJ7A 2H96A 2HZNA 1Q41A 4LMUA 2HWPA 4GFOA 4Y73A 4DH3A 4F7LA 3SD0A 4YPSA 4R5YA 4FC0A 4BDIA 4BCGA 5B2LA 3BYOA 3NS9A 4AA5A 2ZDUA 3MIAA 3I5ZA 2C5VA 2UW0A 3A62A 3ZEPA 3EFKA 4GJ3A 3VO3A 5E91A 2CSNA 3EL7A 2VTAA 3ORTA 4OGRA 4HVIA 4YU2A 3S00A 4A9YA 4FV1A
chains in the Genus database with same CATH superfamily
5DI1A 5KMMA 3KFAA 3RPYA 3DBEA 3R8UA 4X0MA 3MVMA 2PUUA 4GU9A 3ROCA 1JSTA 4IX4A 5CQWA 5CX9A 2WQBA 2Y6MA 2JDSA 3F61A 4TNBA 3BGZA 3D14A 3QKKA 2BTRA 1WVWA 1LEWA 5TOZA 3NMUF 2WXVA 4QNYA 3L9MA 5CVFA 4MF0A 5GIPE 4F6UA 5CU6A 4O0VA 4UBAA 3K54A 3PXRA 3P7BA 4FNYA 3QTZA 4XP3A 3R9RA 2RFEA 3QRTA 5ETCA 4IB1A 2XNBA 5G6VA 2WO6A 4O96A 3VRZA 4ALVA 3OT8A 3MWUA 3HX4A 3AOXA 1H1QA 3BGQA 5IH4A 2Y6OA 5EM8A 4FTLA 4KS8A 2HXQA 1YOJA 3HV3A 3FI3A 4EJ7A 4JNWA 4DC2A 2W99B 4D4YA 5JN2A 3QWJA 3LLAA 2XNMA 3Q9ZA 1XJDA 2X9FA 1VYWA 5B7VA 3ZLSA 4C4HA 2I40A 1M2QA 3QTXA 4U79A 3D7TA 3CGOA 2VGOA 4N6YA 1FOTA 3JVRA 1CSNA 3V6RA 2ITNA 4LRKA 5D12A 4FSQA 5EYKA 4IACA 3PP0A 4BGHA 4ZLZA 4GFGA 4PMTA 4IM3A 1XWSA 3DTWA 5K3YA 3TZ9A 4QMQA 1H28A 3FY2A 3EOCA 1ZYLA 4M97A 1URCA 3EJ1A 4JRNA 2ZB0A 3FI4A 4MXCA 3CJGA 4N0SA 5EM5A 1SNUA 5IMXA 3MJ2A 5BYLA 2OFUA 1IA9A 4HGLA 3COIA 3I79A 3M2WA 4IAKA 5DR2A 1BX6A 4B4LA 2ESMA 3GQIA 2F7EE 2W1CA 2OJGA 3LCKA 3OCGA 4AS0A 1O6LA 3OG7A 2XAOA 3S0OA 3L8XA 2WQNA 2FA2A 3HRBA 2O64A 4GT3A 4OBOA 4EHEA 4IEBA 2Q0BA 2PU8A 2WMVA 4O0WA 1UU8A 4YPDA 3C4ZA 3CBLA 3ZOSA 4OTFA 4PDSA 4R77A 4UB7A 5EI2A 3RZBA 5C8MA 2E9UA 2R3JA 4YHTA 1F3MC 3GB2A 4L3JA 4IVAA 4AT5A 4YSJA 3EQBA 1Q8UA 2GTMA 4HYSA 5AV0A 3HUCA 2R3NA 3ZO3A 4EHZA 4ANNA 3SW7A 3CE3A 3A99A 1YQJA 4RC2A 3G2FA 4RPVA 4DINA 3ZZWA 4BCOA 1OPKA 3ZSIA 4UX9A 3BQCA 4FIGA 4PTGA 5J9YA 3UPXA 2X39A 3LQ3A 3GT8A 4S31A 3NUAA 2J6MA 2OXDA 1FMKA 3EKKA 4IX5A 5A4CA 3AMBA 3FZRA 3NW7A 3NUSA 5AWMA 3EYGA 5FTOA 4G1WA 2IJMA 2XJ1A 1YW2A 4AA0A 1QPJA 3CPCA 4LG4A 5TT7A 2JGZA 3AT2A 3TJDA 1P4OA 4R8QA 4NU1A 5IA2A 2V5QA 1JWHA 3JXWA 4O1PA 4DGOA 3FLNC 5CEQA 3DDPA 3SDJA 3ZO1A 4FKQA 4BFMA 3W33A 3TDWA 3MESA 3QRJA 2BMCA 3NUPA 3QYZA 4MBIA 1XR1A 3FKOA 3C1XA 4RIOA 2VTTA 4AZSA 5KZIA 3CD3A 4XV2A 2R3GA 4YZNA 4H36A 3F5PA 3R73A 4BCMA 3BIZA 3OCSA 4NTSA 2J0LA 3BHUA 4A9SA 4GUEA 3FMJA 4FTOA 4HNFA 2YM8A 3PPKA 1GAGA 3E87A 3OEFX 2B53A 2F9GA 3TM0A 3NWWA 1IAJA 2BZIB 3VUMA 4E7WA 5HORA 3ZYAA 2DWBA 2GQGA 3LZBA 4B0GA 4WA9A 2J4ZA 5AJQA 3QRUA 2W96B 4S33A 2IVSA 4ZTLA 5GJDA 3UDBA 4NT4A 2CHLA 2F7ZE 3F3TA 5DT3A 5HTCA 4AXCA 4RFMA 2FSTX 3HVCA 3E8NA 2X6EA 2CKOA 2VO0A 3G51A 5L6WL 2XS0A 2R9SA 4FSWA 3DLZA 3DFAA 3R04A 1H0WA 2QLQA 4TXCA 2JBPA 4CD0A 5AR5A 5JFSA 2C5NA 4BCQA 4DFUA 3DLSA 2Z60A 2CLXA 4I0SA 4EBVA 4FSTA 4WT6A 3RWPA 1H1PA 3QAME 3DY7A 3UIMA 4C35A 4UMRA 4NL0A 2XKDA 3BHTA 4JXFA 3RAHA 5L2WA 3LFBA 4I6BA 5HD4A 4BY9E 4KSQA 3OOGA 4W8DA 1H1RA 3PXYA 4LL0A 2FB8A 5TE0A 2XK8A 1OL5A 4D2RA 4UALA 4L3PA 1OL2A 3UZRA 3DK7A 3NUNA 5CSPA 1R3CA 1XHAA 3D5VA 3NAYA 3BU5A 1JBPE 5FTQA 4AFJA 2C6EA 3RAWA 3QC9A 3EL8A 3IW8A 1XH6A 3G90X 4MD9E 4QP2A 3DK6A 4FTQA 4QMPA 5AR7A 4EC9A 3FEGA 5KO1A 4X3FB 4P2KA 4C37A 4HVSA 4PX6A 3UOKA 1OVEA 3EIDA 3Q6UA 2X8EA 3KULB 4FG8A 4DHJA 5HG5A 3Q4UA 4L7FA 2W0JA 4U9AA 4E4LA 4JR7A 2J7TA 4UV0A 4ZMFA 3V01A 5K4IA 4FV2A 5IUHA 2GDOA 5IUIA 2XVDA 3QRKA 4DGMA 5HX6A 3MY5A 1TKIA 2C5OA 4J7BA 4C34A 2I0HA 3NRMA 2ERKA 4IQ6A 3QKLA 4I6HA 3ANQA 5KCVA 3R30A 4R1YA 1OBGA 4YLKA 5HGIA 4HVGA 4I21A 4AN2A 4O0XA 3ORMA 3I7CA 4QPAA 3WF9A 4YC3A 4EWQA 4ENXA 4LI5A 5J5SA 1FGKA 2PZRA 4MXYA 1K3AA 4WRSA 1OUKA 4RJ5A 5AFVA 2QU6A 1WBPA 3QGWA 3OBGA 4PDYA 4CFVA 5L2QA 5J1VA 1PXIA 1MUOA 1OL1A 1Q8TA 4DLIA 1ZRZA 4S2ZA 5EDPA 3RBWA 2B4SB 1Q61A 4E5AX 5EW9A 2PMLX 4JR3A 2NNWB 3LCTA 5JMSA 5DEWA 3PPJA 4II5A 2PVNA 4TYJA 3VBQA 5J5TA 4P90A 3QTWA 4LOQA 2Q0NA 5CEOA 5E8YA 4FT5A 2CNUA 2J90A 2VU3A 1YI4A 3CQWA 4IXPA 3ORNA 4UXQA 5ANEA 2HZIA 5H8EA 2VNYA 4V01A 3FQEA 5H9BA 3UMWA 3P5JC 3AMAA 3E63A 3TL8A 2XYUA 3QD3A 5T6KA 3ZFMA 4UMPA 2XEYA 5CAPA 2QOCA 3IKAA 2IVVA 3E88A 2YZLA 4JBQA 3KULA 1OKYA 3PIYA 4ZTSA 5JGBA 5DYJA 4TRLA 2IW6A 2QODA 4X3FA 5KHWA 4KKHA 3GOKA 4AGDA 3MGYA 5A14A 5IQCA 2WEIA 2A98A 4M13A 4Y72A 4YTCA 3QALE 5AX3A 5AUVA 2R3RA 1UU9A 4N4SA 4LMNA 3AC1A 4ZEGA 1KE7A 3F2NA 4PRJA 1JVPP 2WIPA 4QMUA 3NNXA 4FEVA 3DA6A 4RQVA 4GKIA 4MX9A 4BKZA 5D9HA 2WMRA 4WSYA 4DBXA 3C4XA 1J91A 2JIIA 3L9NA 2FVDA 4EZ3A 4YLLA 1ZMVA 4AW1A 2R64A 3BE2A 5IA4A 2B9IA 3QZIA 1KE5A 3GU8A 4GEOA 3RMFA 3KN6A 3PYYA 4LV5A 4P4CA 4YBJA 3SA0A 5L2IA 2XM8A 3DKOA 5HBEA 4C2VA 3I81A 2RF9A 3L8VA 3QL8A 4XMOA 4D2TA 3QQGA 5I3RA 2WMWA 5C4LA 1UWHA 3O8UA 4IX6A 4U6RA 2I7QA 1OPLA 4FSNA 3HAMA 3PIZA 3W0MA 1G5SA 2XP2A 4XX9A 4C3PA 2UW5A 2H8HA 2UW4A 3KA0A 2JAMA 4C4FA 4U7ZA 4QMLA 4FZ7A 4TN6A 4WBOA 4AU8A 3AD5A 1WBWA 3E64A 4A4OA 2PZPA 3W2PA 3NNWA 5AM7A 4WNKA 4A9UA 4KIQA 4XYFA 3U4UA 3NYVA 3JS2A 4X2KA 3MH2A 4AN9A 3A7GA 3W10A 4NKSA 3TACA 4EKLA 3EZRA 3PG1A 3HP2A 2W9FB 1H01A 3I7BA 3VIDA 3MJ1A 4PPAA 3P5KA 4ZZMA 3Q2MA 2QOKA 4GRBA 4EQUA 4EZ5A 3R8VA 2EB3A 3ZBXA 3LM0A 4CGAA 4IE9A 1OGUA 1OKWA 4O7TA 3PSCA 4MXXA 3K3JA 3UYTA 4FKJA 2BALA 4FTUA 5CSXA 4CFXA 4ZMEA 3OW4A 4GV1A 1LUFA 1ZLTA 4Q9SA 4QP9A 5AP5A 3IQ7A 5L3AA 3DS6A 2JKQA 3ENHA 3UQCA 2OKRA 3HV5A 4FRFA 2Z02A 3CSVA 3CGFA 3I0QA 2QHNA 4L01A 4EUTA 5H2UA 2XBAA 4OTGA 3GC9A 4IZYA 2YWVA 4BDDA 4USDA 4LM5A 4WG4A 2BZKB 5AA8A 4F78A 2ACXA 5HIEA 4ZLYA 3U9CA 2C6IA 4CXAA 1XMMA 3W16A 3GU6A 1W0XC 4S30A 5AUUA 4GKHA 5HLPA 4H1MA 2WTIA 4RQKA 3B8QA 1AQ1A 4E3CA 3LMHA 2VWIA 4MEDA 2GQSA 4X6QC 4G9CA 3WF5A 3ORZA 4I4EA 4JX3A 2UZVA 3RAKA 5IQIA 3NYXA 3S2PA 4LFIA 3S3IA 5JQ5A 3VS3A 2HZ4A 3ODYX 3GCUA 1SNXA 4FKSA 3VN9A 2R3MA 3FSKA 2CMWA 1Q97A 4XBRA 3VS2A 1YHWA 2ERZE 2JDOA 3H9FA 1V0PA 2OU7A 3EZVA 3FDNA 4FUXA 4YZCA 3UC4A 1PF8A 2BAQA 3Q04A 5E9EA 3BX5A 4K11A 4RFYA 5T3QA 3N4UA 4F4PA 5ANOA 2UW6A 4HGSA 4O0RA 4BJJB 5KMLA 3FMLA 1RE8A 2C3JA 2J51A 4O6LA 4DAWA 2CPKE 4YBKA 2YCRA 2X8DA 5C01A 3C5UA 4E6AA 5CNNA 4ZXTA 4EOPA 4HYIA 1W2CA 3SW4A 4NKAA 2VTOA 4EH4A 3QLGA 4JDHA 3S4QA 4C61A 5CAQA 4NM0A 4BZNA 5CF4A 4CLJA 5L8JA 2JAVA 4TT7A 3IS5A 4X7QA 4FIHA 3MVLA 5ANGA 3SXRA 4Y95A 3UPZA 5AUZA 3O23A 3ZEWA 4EQCA 2XYNA 4FTCA 4FEWA 1W98A 4DEDA 2IVTA 4B7TA 3VS1A 3QXOA 4ZS4A 2C3LA 3MIYA 5BQ0A 3Q4ZA 3D7TB 2REIA 1PXNA 2YIWA 3FLZA 3FMHA 5CZIA 3G0EA 1NY3A 5DPVA 4ZAUA 1Q8WA 2X8IA 4K6ZA 3AC3A 3QHRA 2UW7A 2VNWA 2JIUA 2YLFA 2QI8A 4W4WA 5LCKA 3VAPA 3H9RA 4AZTA 5HICA 2R3PA 3RPOA 2OIQA 5DVRA 4EK4A 3WZKA 1CMKE 3FQHA 4AXEA 4DDGA 3HMIA 3HRCA 2C6OA 3LOKA 3OF0A 4O4FA 3U6IA 2ZFYA 5M09A 5CTPA 5CEKA 1W84A 1RQQA 5KNJA 3FZTA 2WQMA 1KSWA 3R1YA 3AG9A 4FKUA 4F65A 1ZYDA 2J0IA 3SKCA 2XARA 1MQBA 1YXSA 5FDXA 2HELA 3LFSA 4FNXA 3SX9A 4CG8A 4R3CA 5KMJA 3BHVA 4OLIA 5CZHA 2NPQA 1RW8A 2WB8A 3KKVA 4O7LA 3F5GA 3QU0A 4IVCA 5EDQA 5EYCA 2C1BA 2C6LA 3QCSA 4BCKA 2OWBA 2QO2A 2RGPA 3ETAA 5E7RA 5EH0A 3TDVA 4XP0A 3ZH8A 4CV9A 2NRYA 3BRBA 1MP8A 4QPSA 2AEGA 4FGRA 2X0PA 2WKMA 2XIXA 2YDIA 4GT4A 2W1GA 1X8BA 4GVJA 1J7IA 4HPUE 5BVNA 3K2LA 1E1VA 5F1ZA 3V5TA 4B6LA 1Q24A 2F57A 2QVSE 5FBOA 1YWVA 5JRSA 2ITPA 4CSVA 2ITXA 4CCBA 1E9HA 4C36A 3FLWA 4FT3A 3UBDA 1WVYA 4PTCA 1UNGA 3G9NA 3KIOC 4QP3A 3M11A 4R3RA 2YISA 4M7IA 5DFPA 4AQCA 1Q5KA 4TWCA 2X1NA 1FMOE 4TW9A 2WAJA 1VJYA 1JAMA 1Y57A 3EN4A 4C33A 4FV3A 4M68A 4X21A 5J7HA 5K4JA 3GXLA 4J8MA 3UQFA 3HL7A 4F9WA 3TUDA 3ZLYA 4EORA 4ZP5A 5BVKA 5JT2A 5F20A 1BYGA 4HNIA 2OO8X 5J7BA 1A06A 2W4KA 3PJ3A 4KB8A 4YJNA 4FOBA 3OS3A 3ALNA 3EQDA 1F0QA 1H26A 4FEUA 3PY0A 3ORLA 4WHZA 4EOJA 2VUWA 4G6NA 3LJ0A 3D0EA 2BRNA 4CZTA 4BDJA 3NNVA 3UOLA 4FKGA 4RJ6A 3WF7A 2HENA 5M4UA 1O9UA 4DITA 4L7SA 2WU7A 3AD4A 4RZVA 3FWQA 4FTNA 2YDKA 4KKGA 2X4ZA 2GNFA 3DNDA 1UWJA 3BHYA 2YITA 4AZEA 4QDEA 4I5MA 3ZFXA 4E4MA 3R6XA 4NW5A 4BCFA 4QYEA 2WEVA 4U5JA 4D55A 4FBXA 5LOHA 3UDZA 2CGWA 3CS9A 5I9YA 2X0GA 2JFLA 4JDIA 3PXQA 3BLAA 4ANMA 4OTDA 4FZFB 2G1TA 4NIFB 3R7UA 3ACKA 4JOAA 5BVWA 3EQPA 3GC8A 2P33A 3ORPA 3GI3A 4UY9A 1HCKA 2YDJA 5CLPA 4O27B 1TFFA 4DFBA 3ROYA 1DI8A 4BTJA 2XALA 3OCBA 2WNTA 1YWNA 4H3BA 5JK3A 5FP6A 3WZEA 2E9OA 3D94A 2X2MA 3IG7A 3SXFA 2XANA 3VQHA 3PSBA 5HE3A 5DT0A 1LR4A 3FKLA 3BL7A 2B0QA 4APPA 3R71A 5CT0A 3VRYA 3D83A 3A2CA 4G3GA 3C4CA 3DXNA 5CF5A 4FEXA 3UTOA 3GU4A 4IFGA 3KMMA 4AZVA 3KVWA 5IPJA 2W4JA 3QCYA 2C69A 5AMNA 5EOLA 1YKRA 3QHWA 1YHSA 4W8EA 3R01A 1YDSE 4XNEA 3NYNA 4FL3A 2EXCX 2YCQA 2GS6A 3TCPA 4RWJA 1KWPA 2W7XA 3ZSGA 3NNUA 2W17A 2A1AB 4O91A 5AIKA 4MVFA 3GFWA 3KB7A 2OJIA 4JQ8A 4U81A 3QQUA 2VAGA 4XEYA 3V5PA 3LFCA 3TZ7A 4DTKA 4QOXA 3OW3A 1QL6A 4XG3A 5E8UA 4L3LA 4E4XA 5HTIA 3D7ZA 4UXLA 3MDYA 4QYGA 4F09A 3KY2A 5ANIA 4DFXE 3AMYA 3W8LA 1OITA 4CG9A 3P9JA 3AC5A 1PMVA 2O65A 2W1IA 4O21A 1GZNA 2XNOA 5HOAA 5IH6A 2PL0A 3I60A 3ML1A 3Q9WA 5HCXA 4S34A 3A7JA 5HO6A 3OWLA 1APME 3ZRMA 4J97A 2BRHA 4HCTA 2UZWE 3UVQA 4UYNA 1ZYCA 3OD6X 5LWNA 1IA8A 3CXWA 4DEGA 5M07A 3F3WA 3ULZA 4QTAA 3P86A 3UMXA 5JFWA 2PZ5A 5HE2A 5IMEA 4FL2A 3U4WA 4FA2A 5LMBA 3EN9A 2FSLX 2NP8A 3KXZA 5BVFA 5J79A 4D28A 2C5XA 5AAEA 4FG7A 4I20A 2PVRA 5CALA 1NVRA 3A61A 5F94A 3F2AA 3HNGA 2DUVA 2WMUA 3PXKA 5CNOA 5IEVA 3COKA 3OEZA 3EN5A 2V7AA 3EKNA 2YIQA 2GNLA 2R3HA 2VTIA 4DT8A 3DQXA 4BYIA 3OY3A 4I93A 2GQRA 3WYXA 3VS6A 4Y85A 3IW4A 3UODA 5CEPA 4YJOA 5FTGA 3KRRA 3FI8A 1OKVA 3F3UA 4EUUA 2X2KA 4G6LA 2XEZA 3RM7A 3WARA 3RNIA 4KBAA 2JKOA 2WFYA 3EN6A 1I09A 4HZRA 4C4IA 3PA4A 2GFSA 4FKWA 4CV8A 3O8PA 2QNJA 4ZK5A 3DNEA 3W2OA 4NUSA 2XF0A 3PFQA 1YOLA 1ZAOA 2QOIA 3CTHA 5EQPA 3Q2JA 5TR6A 3W32A 2C1AA 5FGKA 4TPTA 4YC8A 4ERWA 2E9PA 4FV0A 1ZARA 4MCVA 4RC3A 4QMZA 4OUCA 4XV1A 1YI6A 1PXOA 3ZFYA 3PSDA 4OAUC 3C0IA 1JKSA 3FYKX 5CU2A 5A4TA 3WBLA 1FVVA 3GEQA 4JLCA 5ACKA 4ERKA 5EQYA 4DEHA 2CGXA 3EQFA 2YM7A 1GY3A 2RFNA 4ZY5A 2VZ6A 3D2IA 5E4HA 1OIRA 1MRYA 4BTFA 5M4CA 4QT1A 2EB2A 4JDKA 3HMOA 4K8AA 4YZBA 4ZJJA 2A19B 3QTQA 5HE0A 4PMSA 3TIYA 4RSSA 2F2CB 3L9LA 3VBTA 3LQ8A 4AX8A 1KUTA 4A9RA 5C8NA 4F6WA 4CFUA 4AF3A 4KAOA 5HU9A 4I3ZA 1OIQA 2X2LA 3UJGA 4S32A 4FSYA 3CKXA 3ZXZA 2BTSA 3QZHA 1YXTA 2PZYA 3UZPA 4BWPA 4DTBA 5FEEA 2YM5A 1KOBA 4DDIA 2W1HA 2ETMA 4RX7A 4YUQA 1A48A 5M56A 1PKGA 3HA6A 5DA3A 3HMMA 4G3DA 2BHHA 4QP8A 3ORKA 1H24A 3D4QA 3A8XA 4IZ5A 4KIPA 4OTQA 2QQ7A 3BCEA 4QMYA 5AAFA 4O38A 3RM6A 4C3RA 1URWA 2YABA 2I6LA 3BZ3A 4DHFA 3DBQA 2Z8CA 4JAJA 5K9IA 3C7QA 5LVOA 5E1EA 3CTJA 4IIRA 2PPQA 4FI1A 2UZEA 3I4BA 2QO9A 3WE8A 4QMVA 1H25A 4D2WA 4NFNA 3VJOA 2XA4A 3UNKA 3W2SA 1KE6A 4UZHA 5LWMA 3TUBA 4KUJA 5BPYA 1ZOGA 2NRUA 4LYNA 1REJA 3HZTA 1DAYA 3BEAA 3GC0A 3OUKA 5FXQA 4RIWA 1IAHA 5HLNA 2ZJWA 3QKMA 4IAYA 3SVVA 5IQBA 2WGJA 3MW1A 1AGWA 1JKKA 3RINA 3R1NA 3PXFA 4DBNA 3TV7A 3OHTA 4M0ZA 2A0CX 3BLRA 3FMNA 4QYYA 4EOQA 5BMSA 2BZJA 3BYSA 3JUHA 4L68A 5FEDA 3R9NA 3VHKA 4O7YA 3PVGA 3VS5A 3B2TA 3DBCA 4H3QA 3KREA 3WZDA 2C6MA 4KRDA 3THBA 5LVMA 3AC4A 3B2WA 4FKLA 3SOCA 2G9XA 3UOHA 4YC6A 1CKJA 4L00A 3NSZA 4FNZA 4FTRA 1PRYA 5ITAA 3CLYA 4M69A 3W1FA 4C59A 3ET7A 4RMZA 2GHLA 4TWNA 5HIBA 3U8WA 3U55A 5EW3A 4CFWA 4BZOA 3ATSA 2OH4A 4YLJA 4EOSA 1YXXA 3MH0A 3TKIA 3R1QA 4IC7A 4RIYB 1J7LA 4UYAA 1OIUA 4FG9A 1PXJA 3BI6A 1WBTA 4NCTC 4V05A 5H8GA 5E1SA 1U54B 3F66A 5BYZA 4CMOA 2XM9A 4IWPA 1IASA 4QTCA 3AD6A 4WUNA 4YJRA 3V5QA 5AV4A 4AE9A 5CXZA 1UKIA 4L42A 1I44A 3PUFC 2FSOX 5KHXA 1FGIA 2QOLA 4EJNA 1CTPE 4ZJVA 3ZRKA 4OTHA 1YDTE 3CC6A 2XBJA 3LM5A 3FMEA 4FTMA 5HCZA 5L4QA 3SG9A 5CU0A 1Z57A 5CSVA 3PP1A 1OECA 3PY1A 5E8ZA 1BI8A 3FHIA 4ZJIA 4ANBA 4LL5A 3F3ZA 2Z7LA 4MBLA 3LLTA 3WYYA 5A6NA 4GYIA 4QMTA 4BWXA 2XCHA 1QPCA 4F0GA 2AUHA 5M53A 5DHJA 4EZ7A 5JEBA 2ETKA 1LP4A 4R7HA 3R8MA 3KRJA 4I92A 1V0BA 2LAVA 2VTQA 1Q62A 5CU3A 5A6OA 2XH5A 1YVJA 1J3HA 4EI4A 3PLSA 3SC1A 3HV6A 5BNJA 2R3OA 2BDWA 2G01A 4KINA 4LOOA 4DH5A 5CT7A 4L44A 4WKQA 3LCOA 4BF2A 3R21A 4BKYA 4MXOA 3R7OA 2BRMA 4PWNA 2XK7A 4U8ZA 3HV7A 2CCHA 4MKCA 4LUEA 3TNWA 3ENMA 1SYKA 4XLVA 2OZAA 4C62A 2PVMA 3OXIA 2PK9A 4L9IA 2WTJA 4F70A 4U42A 4M14A 4RA5A 3OROA 3O2MA 3UDTA 2W1EA 5DH3A 3W2CA 1Y6BA 4M12A 5CY3A 5M57A 4FK3A 3BEGA 4J98A 4ANQA 4O2ZA 4RWKA 2OSCA 5IQEA 3QC4A 2HY81 2YWPA 3G0FA 1WVXA 3SOAA 3A4PA 3BV2A 5AUXA 4BICA 4J71A 3LMIA 3EH9A 4H39A 1K2PA 1DS5A 2XK9A 3A7HA 2WU6A 3PY3A 2B9JA 3IGGA 3PJCA 4QP1A 3T9IA 3LXLA 4BCPA 2OK1A 5IQDA 1U4DA 2W5HA 2XIZA 3QQLA 2X7GA 2R7BA 5AAGA 3PVWA 1OI9A 5D7AA 4AZFA 4N70A 2BVAA 3QYWA 2O8YA 4OW8A 5LMAA 2I0EA 2QKRA 4BYJA 3R28A 1H1WA 1M2PA 3N9XA 4CYIA 4BIBA 4BTKA 3KEXA 4ZZOA 3FXXA 5BYYA 5CASA 3DBFA 1OB3A 3O96A 3FZSA 4RJ3A 4K1BA 5JQ8A 2GNIA 2GPHA 3KXGA 1V1KA 3D15A 3NYOA 4FIJA 5DN3A 3UVPA 4AOTA 3A4OX 1NXKA 2BKKA 5AR2A 4CKJA 4FTKA 2IZUA 4QP7A 5E8SA 1U46A 4C57A 3V5JA 5F9EA 2BDJA 1GNGA 2GHMA 1M14A 3LVPA 4QD6A 1R39A 5C4KA 1JPAA 4FYOA 3PJ2A 4OBPA 4FIFA 4Y8DA 3ZBFA 4R78A 3MA3A 3RNYA 1UNHA 4A4XA 4PPCA 3O50A 4U3ZA 5CU4A 4MNEA 3FPQA 1G8AA 4CZUA 3LW0A 3AC2A 4X6RA 3EQRA 2OF4A 4Z3VA 4PMPA 4ACGA 2R3LA 3PIXA 4GCJA 5T68A 2PVHA 5M08A 3VUTA 1PYXA 1UKHA 3U87A 5KZ0A 5IDPA 2XNPA 1ATPE 5AADA 5BVEA 4RVMA 2OBJA 2GMXA 4O86A 3R02A 3NUXA 4TYHA 5GIOE 2QONA 5I9WA 3EQCA 4MTAA 4IVBA 3GCPA 2VD5A 2UZNA 2RFDA 1ZXEA 3PZEA 3KC3A 2VWXA 1PXKA 1TZDA 4E5WA 3V04A 4IAZA 4V0GB 3TNQB 2ONLC 2IVUA 4RGJA 2CKPA 1XH4A 1IG1A 2WTCA 4ENYA 5HX8A 4GW8A 5ETAA 4QDVA 3BWJA 3MYGA 2PE0A 2WD1A 2YJRA 3PJ1A 2ZOQA 2ZM3A 4JAIA 3GC7A 3BWFA 3NZ0A 1BL7A 4TYGA 3CIKA 4HVHA 4FKOA 1HOWA 2XIRA 4PP9A 4XG6A 4DGGA 4RJ8A 4F7JA 2WTKC 4ORKA 3KRLA 3Q60A 4ID7A 5LVNA 3EQHA 3R8PA 3QQHA 4DEEA 3D2KA 2KULA 4KD1A 3SXSA 4A7CA 1TVOA 2G15A 1P2AA 4BCNA 1G8SA 3LFDA 5EW8A 3AKLA 3UE4A 5B0XA 2V0DA 3NFFB 1XH7A 1PXPA 3FI2A 4FT7A 3KQ7A 2YHVA 4U97A 2OXYA 2BCJA 4W4YA 3VBXA 1UVRA 4B9DA 5EYDA 2ITYA 1OUYA 4GG5A 2XKEA 3HP5A 4QRCA 2O5KA 3FV8A 3CTQA 1JNKA 2HZ0A 2HIWA 2ZV9A 3WZUA 4RRVA 4QMWA 4RIXA 3Q9YA 4NEUA 5C27A 3RHXA 3VC4A 4FODA 4AZWA 4AN3A 4EYMA 2YLEA 3RVGA 1OGYA 3C13A 5IA5A 2Y7JA 4TY1A 3VF8A 1OIYA 2CN8A 4ITHA 5AP4A 4QQ5A 5AP2A 3VVHA 2EXEA 4BI2A 3O0GA 2ZV8A 3QXPA 4HOKA 3P23A 1GJOA 2AC5A 4C7TA 2H6DA 1XO2B 2BIKB 4J95A 1SMHA 2GS7A 2VWBA 3DK3A 3IOKA 4QP6A 3FLQA 5JSMA 2XKCA 4ITJA 4TYIA 4ZTRA 3AKJA 4C4GA 4RVKA 5HCYA 3K5UA 2LGCA 4OT5A 3COMA 3RZFA 1GIIA 3VUKA 4GVAA 4EH9A 3NFGB 4IZAA 4BDFA 1OL7A 2QLUA 3Q4TA 4IAAA 3U6HA 3FLYA 3PTGA 4IWOA 2BKZA 3FXWA 4OBQA 5F4NA 1PYEA 2FO0A 2XIYA 4EBWA