1Q8TA

The catalytic subunit of camp-dependent protein kinase (pka) in complex with rho-kinase inhibitor y-27632
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Protein kinase A in complex with Rho-kinase inhibitors Y-27632, Fasudil, and H-1152P: structural basis of selectivity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q8tA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q8tA02
3AC1A 4KNBA 4U45A 2C3LA 4AA4A 4IB3A 3PZEA 1JNKA 4BYJA 4B4LA 1PW2A 5TR6A 3KA0A 4PL5A 5DNRA 2IVSA 4Q2AA 3AC8A 3LFSA 1M2RA 5CSHA 5EKOA 4OTDA 5CAOA 2WMXA 4RX9A 5KKRC 2I0EA 3PVGA 3EQPA 3H30A 4M68A 4HVIA 4YJRA 3IK3A 4K6ZA 4BIDA 5BNJA 2Q0NA 3OS3A 2BKZA 2V0DA 4ZTHA 2EXMA 2ZM1A 4B9DA 3EFKA 2AUHA 2QKRA 1LPUA 2EXCX 2Z7SA 4C2WA 4XCUA 3W33A 3K3JA 2RG5A 5KUPA 2F9GA 4IWDA 4Y83A 4BKZA 1A48A 5DEYA 2ZV7A 2XRWA 2BDFA 3I81A 3R28A 3VULA 4ORKA 1V0PA 4Z55A 3FXWA 5LMKC 4UMPA 2GS7A 4IB0A 4AACA 4ZY4A 4ANBA 5AMNA 1YDRE 1HOWA 4ZSJA 3GB2A 4ZTSA 3AT2A 1NY3A 3DDPA 4FUXA 5CT0A 5IU2A 3MA3A 5M08A 3OWLA 3TV7A 4LMNA 5A9UA 1YKRA 5HTBA 3TCPA 3K5VA 4CFUA 4N0SA 2XYUA 3CCNA 3VBWA 3NIEA 3LOKA 3VBYA 2YIYA 2R3JA 4FTLA 1BLXA 5I9WA 4RC2A 1SVEA 5J1VA 3I6UA 3WF5A 3MB7A 4JIAA 4TWPA 2UW5A 4L43A 4MNEB 3PE2A 5HX8A 1GZ8A 3UG2A 2NRUA 3VS2A 4EOKA 4O82A 4DTKA 3FZRA 5DR9A 2B4SB 4X3FA 3ZSGA 4QMNA 5I3RA 4D58A 2B0QA 4BDIA 2XK7A 3RVGA 4HVGA 4DCEA 5JGAA 4F7SA 3EJ1A 4YJNA 3ZBFA 1E1XA 5AP7A 5HO7A 4OAVB 1GAGA 4A9TA 3NNXA 4L44A 4XRLA 4JBPA 1XBBA 5AR5A 3RAWA 4FVPA 5JN2A 3PJ3A 4X2GA 3V8WA 3P5KA 2XKEA 4I93A 2IZTA 2UZUE 4BKJA 4NWMA 3RJCA 3QCYA 1CKPA 4NJDA 3W18A 4ANOA 3G6HA 2GFCA 4PPBA 4UBAA 5AR7A 4D2WA 1JWHA 1VJYA 4G1WA 1PY5A 3BU3A 4LGDA 4M66A 2HWOA 3HUCA 2F7EE 5HTIA 4EK4A 3PIXA 5CEKA 3C5IA 3Q2JA 3CTHA 4XH6A 2PL0A 3MB6A 5FWKK 4W9XA 2OXDA 2VRXA 4I5PA 4FTNA 3V04A 4EOPA 3THBA 3CQEA 3SXSA 2RFEA 4RWIA 4F0IA 4GW8A 4FVQA 4B8LA 2B9IA 4ZIMA 3V5WA 3W2PA 4FV0A 4CYJA 3TIYA 4K2RA 4EUUA 2Y9QA 4P2KA 1YI3A 2PVNA 4EOQA 4O7YA 3R1QA 2PVLA 5J95A 5CS6A 4OLIA 2QOKA 3HP5A 3M11A 3N4VA 4FICA 4E73A 2RSVA 3AC3A 2ITZA 5AUXA 5JRSA 4BI0A 4L6QA 3FMDA 3AT3A 4XG9A 2DQ7X 1NVSA 4NYEA 3LJ2A 3ORKA 4HPUE 1YI4A 4FL3A 4MF1A 2BALA 4UMUA 1ZY5A 1T45A 3F3TA 4GYIA 3WZDA 5A6NA 3PVBA 1H1QA 5FXRA 3KREA 3JY9A 4MNEA 3DFCB 1XQZA 4ITJA 5A6OA 2X7FA 2PE0A 3PE1A 3RNIA 2VN9A 5HE1A 3KCKA 5J9LA 3G15A 2VV9A 2CKPA 2XNEA 4YPDA 3LXKA 3P1AA 3F69A 3D83A 3RALA 3MY1A 2P3GX 4MH7A 3ORTA 1KSWA 2OG8A 3IKAA 3DBCA 3FLWA 3HL7A 4O0RA 5IA2A 2W96B 3PXKA 5BUIA 3UOHA 4A06A 2B9FA 5JEBA 3OXZA 2ZMCA 3BE2A 3QUDA 2O65A 3TEIA 4C2VA 5E4HA 4OTHA 2UW8A 4RVMA 3CPBA 2G2IA 2YIWA 4UN0C 1OL5A 3GU4A 3CGFA 4BICA 4O7TA 3LFAA 2QURA 3VBVA 2W9ZB 4PUZA 2QOIA 4XMOA 2PWLA 3E92A 4U43A 2E2BA 3QBNA 2XKFA 4DT8A 3UGCA 3EYHA 2OIDA 2FH9A 3UIMA 5DA3A 4ANMA 3NW5A 2R3LA 2QOOA 2Z2WA 3NSZA 4PDSA 2OIQA 2NPQA 4BR3A 5CEPA 2R3NA 2IVUA 3IW6A 4FTJA 4CNHA 5EYKA 3TUCA 4PPCA 5GHVA 3F6XA 3OP5A 5LOHA 3PXZA 3CQUA 4BDDA 4EKLA 1F3MC 3RPRA 4O2PA 2GMXA 3CLYA 3BKBA 3M42A 2ZJWA 3G0FA 2WB8A 4PWNA 2CNQA 1VR2A 4GJ2A 2W1GA 4U97A 4QMQA 5CU6A 4YNOA 2C4GA 3PLAE 3NCZA 3FUPA 5K0KA 3RPVA 3BGQA 4IVDA 4RJ4A 4XOZA 4IAYA 1GZKA 3L9LA 5EFQA 3COMA 3E8CA 3R01A 2BRHA 2XZSA 4M8TA 3QHWA 4O6LA 4XBUA 5KCVA 3UO4A 5CSPA 3VUGA 4MQ2A 1JKTA 1XJDA 2WOTA 1FVRA 1UU9A 3IG7A 3RGFA 2JAMA 3TT0A 2H8HA 4DGNA 3FEGA 4L45A 3RAKA 3QLGA 4O91A 2ERZE 3QKMA 3R7IA 2ZB1A 4XV3A 3R7VA 2OFVA 3EL8A 3E64A 3E88A 4FL2A 5D7AA 3R8MA 5BVFA 3VBTA 3VVHA 5DRDA 3QYWA 3FXZA 5BYZA 4BCKA 5D7VA 2ZV9A 4CRSA 2I6LA 2WD1A 4ACDA 1FBNA 4FEWA 5FDXA 4FYNA 2UW9A 4P90A 3A2CA 3LCOA 5I0BA 2AC5A 3HA6A 4J1RA 3CY3A 4LL5A 4Y5QA 5H8GA 2Y4PA 5I4NA 5K4JA 2OZAB 4GT4A 4FK6A 3BV2A 1YQJA 5C8NA 3ZFMA 4EJ7A 2VZ6A 5E8YA 3TI1A 4JG6A 3BYMA 3VS3A 3PSCA 5EM7A 4F6UA 3R2YA 2WQMA 4XEYA 5TT7A 2XEZA 4KS8A 4CMUA 5I9VA 2OF4A 3ULZA 5HIEA 3CD3A 5CEQA 2C0IA 2IJMA 3EH9A 3EN7A 2JDRA 3MS9A 1ERKA 1P14A 4RVLA 5AR2A 1S9JA 5IEYA 2XM9A 3AG9A 3LAUA 2I7QA 4G2FA 3AMYA 5IMEA 2VWYA 4NW6A 3QQGA 3D2IA 4U40A 3G5DA 3RCJA 5B7VA 4BTKA 1PYEA 2W1ZA 3Q3BA 2EVAA 5D1JA 3TV4A 1U5QA 1J1CA 4F1MA 5EQEA 5EQYA 5BMSA 5D9HA 3QUPA 3RPYA 3A7HA 2BCJA 4O2ZA 5KHXA 5TO8A 3NLBA 2BRBA 2C5NA 2YLFA 3VS6A 3DBEA 2GNFA 4LV5A 5HBHA 3C0GA 1M7NA 3F5PA 4IH8A 4JT3A 5IQFA 4AGCA 4D4YA 3Q4UA 5KMMA 4DBNA 4W8DA 5GIOE 1KE8A 2UVYA 4WG5A 2F7ZE 3QTUA 3QZGA 3GC9A 4R5SA 4PL3A 3CJFA 3W2RA 3UVQA 5F95A 1H0WA 3EFJA 4BC6A 3GT8A 4M69A 4IX5A 1F0QA 3OCSA 4GV1A 4HOKA 3OBJA 4V0GB 3R0TA 2WZJA 4FNXA 3HECA 3F2RA 2QODA 5AP5A 4OBPA 3CEKA 5CSVA 2CGXA 4MX9A 3FI8A 2PUUA 3LM0A 4MF0A 4I92A 4R7IA 5F20A 2HY0A 4YHTA 2GNJA 2IG7A 2RIOA 4UWBA 4UWCA 2E9OA 4ASXA 2UZDA 4FYOA 3PIYA 4ASEA 4AT3A 1PMEA 3NUSA 4EHGA 3FLYA 4FOCA 3DKFA 4WKQA 3D7ZA 1OIRA 3LM5A 4WIHA 2R7BA 1OECA 4ZAUA 2VWZA 3HX4A 3MH0A 1H1PA 4GVAA 5HNGA 4RA5A 3QQJA 4O6EA 4RQVA 4BCIA 4BWKA 5BUJA 3EQHA 5DI1A 2Q83A 4DC2A 3NWWA 3G9NA 1JVPP 4I6BA 1OIUA 2CGUA 4U7ZA 3KXHA 3TDWA 2GHLA 5FEDA 3D5VA 2WQBA 1OL1A 1YXTA 1J3HA 2W4OA 5ETAA 3CTJA 2UW6A 4IANA 4UXQA 4BB4A 5D11A 2CMWA 3P7CA 3LFFA 4HGSA 5CI7A 4B8MA 4KKHA 5DBXA 5AFVA 4JAIA 5ANEA 2ITQA 4PMSA 4L3JA 4O0UA 3BYSA 2BDJA 2RKUA 2QR8A 2FA2A 4LUDA 4FK3A 4CFNA 3DJ6A 3TV6A 4J99A 4BCJA 2DUVA 3V5LA 4AZFA 2QD9A 4NH1A 1O9UA 3FL5A 2PMOX 3Q5IA 4C4HA 5M56A 2J0KA 3ELJA 3PXRA 3H9RA 1P4OA 2E9UA 3UIBA 4QYEA 4V01A 4DFXE 2QOHA 5EW3A 4RBLA 2OGVA 4IVBA 3FQEA 5L6PA 4KS7A 4KABA 3D9VA 3KULA 5ANOA 2J51A 1A06A 4FV1A 2PZRA 2YHVA 5L6WL 2VU3A 5ACKA 5T68A 3VS0A 3SXFA 1PKGA 3DXPA 3I0OA 4ZP5A 3DQXA 1JSVA 1SNUA 3ULIA 4NT4A 4WNMA 5EYDA 3C4EA 4XG7A 2H6DA 4XV1A 2CKEA 3ANRA 5LVPA 4U3YA 3P0MA 1ZYCA 3T9IA 3WF8A 3A8WA 2JFMA 2QLUA 4RG0A 3BHHA 1ZMVA 2XVDA 3BLHA 3QYZA 4U0IA 4FZAB 3UOLA 3WE8A 3LCDA 2IO6A 2ESMA 5EDRA 3E8NA 2R5TA 2W06A 3F66A 3NYOA 1UU8A 5CTPA 3EQCA 1ZOGA 5E91A 4AP7A 4EWHA 5IQCA 1JKLA 3EN9A 5LVMA 2OJJA 3O17A 1UVRA 4IACA 3ZM4A 4FOBA 3UOJA 4ZZNA 1YI6A 5EYMA 3F5UA 1FMKA 4FKVA 4EYJA 3CS9A 3P4KA 4IMYA 5HLWA 2OH0E 1FINA 1PXLA 4RLLA 5BVKA 5CEMA 2Y4IB 3NIZA 2UZTA 5CT7A 3ZCLA 4BHNA 3WYYA 2W05A 4NM7A 3WYXA 4J95A 4FNYA 4FTIA 1MQBA 4AAAA 2QI8A 3OXIA 5JQ5A 5GZ9A 2BIKB 1WAKA 4TYJA 4O7ZA 1V0BA 3OHTA 4I23A 4KIPA 3BHUA 3VBQA 1GJOA 4MNFA 3DCVA 2QU5A 5L2IA 2WFYA 1UA2A 2VO0A 3ZLWA 4I21A 4WHZA 4BCQA 3V5QA 3DT1A 5AR4A 3ORPA 2P4IA 1YDTE 2CCIA 4G5PA 3HUBA 5EDPA 4QP6A 1UV5A 1URCA 4YURA 3TTIA 4R77A 2J50A 1BL7A 2HZNA 3OOMA 4QMTA 4WBOA 5ANDA 4M7IA 4D2PA 4F63A 3R7YA 2R3MA 4JDKA 1KV2A 2YEXA 3LXNA 4I20A 3V8SA 4O0TA 3LCKA 5IEVA 3AGMA 3TNHA 3NX8A 3PVUA 4K33A 2UZOA 1OL7A 5BUEA 4B99A 1XWSA 3TNIA 5HCZA 3TTJA 3ZU7A 2LGCA 2VTMA 3AOXA 4ZZMA 4EK5A 5I5ZA 4EBVA 5DYJA 5JRQA 2HYYA 3RBWA 2VGPA 2XNNA 4QTBA 3UDBA 2PMLX 4QMPA 5HHWA 4TNDA 4UMTA 3U9NA 1RW8A 3QQKA 5KBRA 3EHAA 5LVOA 4RJ7A 3ZO1A 5IDPA 3MIYA 3RZFA 4ZLYA 3M1SA 3S3IA 3BHVA 2PZYA 3GCQA 3ZFYA 4PF4A 5BVNA 2VWWA 3KF4A 3HAVA 1H0VA 3G6GA 5CVGA 3ZLXA 5AIKA 4X6QC 1BMKA 2R3KA 4IJPA 5DRBA 1JKKA 3A7IA 4Y46A 5J7HA 4X2KA 4AW2A 3FSFA 4GEOA 2HY81 2C3KA 5CQWA 2PMNX 5GJDA 2JAVA 3FI4A 4UZHA 3EQGA 1M2QA 4GT3A 4MBJA 5HD7A 3WIGA 4GK3A 1LEWA 4RIYB 3FKLA 3G0EA 5E8ZA 3C5UA 3K2LA 2WXVA 4RIXA 2XA4A 4TYHA 3UTOA 4DTBA 2JBOA 3CTQA 5CU3A 5IG1A 1O6YA 1SZMA 1YRPA 1OUKA 4JR3A 4TZRA 5IKWA 3HNGA 3C7QA 2XKDA 4PNKA 4X3JA 4PDPA 4B0GA 4AUAA 3QXOA 2F7XE 3IPHA 5HG5A 3MW1A 1ZXEA 1YXXA 2PVHA 2QOFA 2ZDTA 4JVGA 4S30A 4UXLA 2GU8A 4AE9A 3HYHA 3VS5A 2PMIA 4EWQA 3VW8A 4E4NA 2O0UA 2XCKA 3NW7A 2UUEA 2BTSA 3QL8A 3JY0A 2FO0A 4ZSAA 2B9HA 4QMXA 5ACBC 2WMRA 3R8LA 3NNUA 3R2BA 5L2QA 4FTQA 4GK4A 4Q5EA 3WILA 4EK8A 3IDBA 4G3EA 1WVYA 4LMUA 4YBKA 2ZYBA 4QNAA 4AF3A 4BDGA 3FPMA 4MBLA 4ZS0A 3DBQA 2ZDUA 3MVHA 5M4FA 4GK2A 4FSUA 5IQBA 4KBKA 2QOLA 3TACA 3ZTXA 2GTMA 4BCHA 4BIBA 5HNIX 3U6IA 1UU3A 3Q6WA 4YZNA 5CSXA 3ROCA 4PP7A 2YFXA 2CN8A 3ZBXA 4RWJA 3PPZA 1DAWA 5AP0A 4D5KA 2UW3A 4HJOA 3SLSA 3SW4A 4EH4A 2BIYA 3FE3A 3HEGA 2WTIA 2PVYA 3QGWA 5JFSA 5M51A 2BRMA 2YAKA 3PJ2A 4RRVA 4YJSA 4FA2A 5IF1A 1QPJA 4FNWA 4FTKA 2ZAZA 4P5ZA 4DFYA 4O83A 3ZLSA 3R00A 3JYAA 2JDVA 2WIHA 1LP4A 1ZYJA 3QCXA 4WD5A 3SXRA 4BGHA 1WBVA 5CAPA 3BGPA 3PXFA 4NCTC 3IW7A 4HW7A 4IQ6A 3F3VA 3ORMA 4PTEA 1Q99A 3EFWA 4H3PA 4AN3A 4U9AA 3CJGA 3I60A 1H24A 2VX0A 3VUMA 3WE4A 3PJ1A 4ZEGA 5LWMA 1PYXA 3ZEWA 1ZYDA 5E8XA 4NKSA 3SVVA 4PTCA 3O8TA 3W55A 4FV4A 4C7TA 4HZSA 3I0QA 3ZC6A 1OIYA 3DZQA 5JZNA 5K4IA 4OAUC 1OMWA 4PMMA 4JBQA 4ZJIA 3UZPA 4L53A 3Q96A 4X2JA 4O7WA 4DFUA 1IRKA 2VTTA 3GXLA 3IW4A 2A1AB 2JDTA 3DQWA 5HNBA 3JS2A 3ZDIA 4F6SA 3ATTA 2ZV8A 1TKIA 3GC0A 1H1SA 1SVGA 4GH2A 1OKZA 2XEYA 3LPBA 3WI6A 5IH6A 2QOCA 4LQMA 3UP7A 3QFVA 1ZMUA 4PMTA 4YHFA 3FY2A 5AEPA 1Y6AA 2F2UA 4WNPA 4AGDA 2IN6A 1PXIA 3ZSHA 1R78A 3Q4ZA 5EHOA 1CMKE 5CF8A 4PTGA 4QO9A 5IEXA 3D15A 3QTRA 2HW7A 4QMLA 2H96A 5AUWA 3OW3A 4RT7A 1TQPA 3NAXA 3EQRA 4YTFA 3PP1A 1MP8A 1REKA 3UC3A 2O64A 4DFNA 2R3QA 4XP3A 4J71A 3UQGA 4DN5A 4CQEA 2P33A 2ONLC 3CIKA 2IVVA 5AWMA 1XKKA 4H58A 4BCNA 2Y6OA 4ASZA 3EKNA 4JG8A 1H26A 4AX8A 2XB7A 4GKIA 2VTPA 5LMBA 3Q9YA 1B6CB 3A4OX 1TVOA 3QD2B 2CNVA 4F7JA 4BBFA 2YZLA 2WQEA 3T8OA 4IAAA 4AS0A 4ANLA 4YJQA 1W82A 1WVXA 4IVAA 1WBOA 2GNHA 3B8QA 3A60A 4LGGA 5G6VA 3NVMB 5HO6A 5AM7A 2CHLA 4FIJA 4HNFA 3C4XA 2VWBA 4DH7A 3VO3A 1XH8A 2JEDA 2W1CA 3FLQA 2VUWA 1QMZA 3F5GA 4FKQA 4D2TA 3MPAA 4HCVA 2V62A 4IWOA 4NSTA 4BBEA 3C51A 3F9NA 3OFMA 3DDQA 3E5AA 2A19B 2W1DA 4J8NA 4EH6A 3BWJA 4EUTA 4BHZA 3GC7A 2OXXA 5AX9A 3QD3A 4H36A 3SV0A 4C0TA 1NT2A 3S4QA 5GIPE 4H1MA 1RJBA 3B8RA 4IC7A 4K9YA 2CN5A 2WMUA 4MWIA 1UU7A 2LAVA 1Z9XA 4HPTE 3GC8A 4QOXA 2OKRA 3QTQA 3RK9A 3FYJX 3SOAA 3KU2A 4YJOA 4RIWB 4S32A 1YVJA 1FPUA 2EB3A 2J4ZA 3BQRA 3DBDA 4IAFA 4IX6A 5ANJA 3F61A 3R7GA 4AZEA 3C4WA 3LJ1A 2W5BA 4I22A 4JL9A 4BL1A 1Y57A 3OVVA 3R22A 3TN8A 3EQBA 4IM2A 4DG3E 3RWQA 4CT1A 2A4LA 5DHJA 3O96A 4QTDA 3QHRA 4BI1A 3Q4TA 3W32A 3GENA 5EI2A 2BTRA 1OPJA 3MA6A 4I3ZA 4RLKA 5IPJA 4TY1A 1WBWA 5IA3A 2R3FA 4YJVA 4KKGA 3BV3A 3QD0A 3EQDA 4ZJJA 4G3GA 4FKJA 1YWNA 2VTAA 4IZ7A 4TWNA 2J0MB 4MXXA 2JITA 3E62A 1U4DA 1H28A 4RVKA 4O84A 3BU6A 3DB6A 3H3CA 2PUNA 3TNPC 3P23A 5LMKA 1K9AA 5FP5A 2XNOA 3HMOA 1W7HA 2BKKA 2PU8A 1Q8TA 4GIHA 4X0MA 3Q52A 1YHWA 4D1XA 3IDPA 4KIOA 5BVWA 3KQ7A 3PSDA 2XNGA 4KRCA 5K0XA 1P4FA 2CCHA 5TE0A 3CBLA 2I0VA 5M53A 5FLFA 4W4YA 4EHEA 3KB7A 2OH4A 2VTSA 3Q2MA 4FKUA 4FZFB 3ACKA 2ITWA 5KHWA 5AV2A 3KXNA 5EI6A 4M14A 5EI8A 4OTQA 2P2IA 4C35A 5ANIA 2HXQA 4JX3A 5LVNA 4BDKA 3JXWA 1CKJA 5HI2A 3FJQE 5HE3A 4G3FA 3A61A 2WTCA 2G2HA 2JLDA 4RZVA 3RTPA 4IB1A 4F1TA 4PL4A 4E3CA 2IPXA 2DYLA 4QYYA 5DMZA 2C6OA 4CKIA 3V6SA 4KD1A 2GSFA 1Y6BA 3H9OA 4BIEA 2C1AA 2J5EA 4DEIA 2E9VA 2GNLA 5J9ZA 3IW5A 4OTRA 3SQQA 4AG8A 3FZ1A 4IFCA 3FMKA 4L42A 5CNOA 2JIIA 3VUTA 3EQIA 2C3JA 3I79A 4KIKB 3FC2A 4P5QA 4QMWA 3FXXA 4LGHA 3FI2A 4G6NA 5B2MA 3PTGA 3KKVA 4BWXA 5I3OA 2UZLA 5D41A 4F0FA 3EOCA 5T6KA 4JJRA 3QTIA 4YNEA 4D5HA 2C6LA 5HBJA 4BDJA 5H9BA 1OVEA 3NUPA 4EOLA 4QTEA 4Z3VA 3CGOA 5C01A 3MJ1A 4YLJA 3R1YA 4U79A 3FV8A 4MXCA 5B2KA 4CQGA 3QKLA 1IAJA 3F2NA 4A4OA 2QO2A 4MTAA 2GCDA 2A0CX 3S2PA 4D0XA 1UNLA 4FF8A 2XM8A 4RJ6A 2VTNA 1ZY4A 3NRMA 3SX9A 3R9OA 5CXHA 3B2TA 4YTCA 4OTGA 4ZMFA 4C33A 1YWRA 4IAZA 3U4UA 3OUKA 2Z60A 4XV9A 1DI9A 4EOMA 3UNKA 3F2AA 4LV8A 4A07A 2A2AA 1PKDA 3KXMA 4CSVA 3LMIA 2CSNA 3FZOA 4CFFA 3ZC5A 3SA0A 4JRNA 2F49A 2RFDA 4HVDA 4FKSA 3MTFA 5AUVA 4QMSA 1Q62A 1OKYA 1M52A 3BLQA 4IM3A 3RKBA 2GQGA 4JLCA 2CLXA 2BILB 1K3AA 2OICA 4YSJA 2A27A 3R9HA 5BMMA 3D5XA 4TL0A 4ID7A 2HELA 3MPMA 3MJ2A 3QUEA 4FV2A 4TYIA 3FHIA 4FSTA 4XUFA 5DH3A 4QQTA 4C3PA 3DTCA 3PRIA 4RWKA 3VF8A 3WF9A 3KY2A 4E6CA 4AZWA 3VHKA 2X8EA 3GU6A 3TKIA 3V51A 1YHSA 3RAIA 2ZMDA 3HMPA 5KZIA 3VF9A 3NEWA 4KIKA 2GNIA 2XS0A 3DZOA 3IOPA 4M0YA 1CM8A 1SM2A 3IDCA 3MFRA 3TUDA 4YGAA 2WEIA 5CZIA 3T9TA 1CDKA 3KMUA 2ZVAA 4D2SA 4OBQA 4ZZOA 4EKKA 3OY1A 2HIWA 3QXPA 4ITHA 3ZM9A 1CSNA 3DFAA 1XH9A 4C61A 5L8KA 4O7LA 4AZVA 4TRLA 5K9IA 4YJPA 3ZS5A 5FXSA 3HGKA 4BDEA 5M07A 4EH5A 4FTRA 5AV3A 3O51A 2Z7LA 4QP9A 1FOTA 2ITXA 1QPCA 4APCA 4C59A 4O27B 3GFWA 2PVKA 3ODYX 4CT2A 4ZMEA 3ACJA 4RSSA 3I4BA 4M13A 4IE9A 4XG3A 5EHLA 2YACA 4USDA 3V5PA 4EZ3A 4XP0A 3Q5ZA 5EK7A 3TKUA 3BRBA 3F3WA 3R73A 1HCKA 1UWJA 2ETRA 1BI8A 3R1NA 2UZWE 2R3HA 5KMNA 5L2TA 5A54A 5B2LA 3NPCA 4JBVA 3NYNA 1OITA 2GFSA 1AQ1A 4YTHA 4C37A 2P2HA 4F9AA 2F2CB 2WTVA 4I24A 4R3CA 4ANNA 5CI6A 4DEDA 3PLSA 2FB8A 2XK9A 3CE3A 5JT2A 1Y91A 3MIAA 3R83A 4S34A 2BFYA 4YC6A 3HDNA 5EG3A 5M09A 1ATPE 2ITPA 3ZZEA 4FKWA 2E9PA 2QG7A 1YWVA 1Q8YA 3C13A 3EYGA 4NIFB 3DV3A 2W1IA 5CU4A 4XG6A 3S0OA 4MEDA 4KAOA 2HW6A 2ITUA 4EORA 2VO6A 3N51A 3V5JA 3DK7A 3NUAA 3VNTA 2YWPA 1Q61A 3MFSA 3NYVA 4F9BA 4O81A 4HGTA 4O7VA 4BTMA 2DS1A 2J9MA 1J7UA 4XLIA 3GI3A 3QQUA 4IJ9A 3UG1A 1Q8UA 4WT6A 4CFMA 4L7FA 2QNJA 4C8BA 5IH5A 4IHPA 2WMVA 3CQWA 1JSTA 3MFTA 4A9YA 1RE8A 2ITYA 3RNYA 1WFCA 5ETFA 4DFLA 3EZVA 4XLVA 5JK3A 2O5KA 3O2MA 4PNIA 3W2CA 4GFGA 2WEVA 4QRCA 2PZ5A 3GCSA 3Q32A 4BGQA 5LQFA 4Y95A 4E6DA 4Q5HA 5A4CA 3VAPA 1ZZ2A 4FG8A 4L68A 2AYPA 4YJTA 5CAQA 4RFYA 4E7WA 3DBFA 1M7QA 4P4CA 3VN9A 5HG9A 2QR7A 1YW2A 1FGIA 3H9FA 3EN6A 2R0IA 3D7TB 4Q9SA 5A46A 5IUHA 3E8EA 3ENMA 3WF6A 2CKOA 1KE5A 1FMOE 2XJ2A 3EQFA 3E93A 5IZFA 3N4TA 3LXLA 4D1ZA 3HAMA 3OUNB 1KE6A 2HCKA 3HMIA 1QCFA 3GVUA 4RFMA 1JBPE 1OL2A 1BI7A 3FMHA 2P55A 3PIZA 3C4FA 3IQ7A 4S2ZA 3QF9A 5HEZA 4M15A 3BELA 3GU8A 4E1ZA 2OZAA 2W1FA 3NUUA 4F70A 3OC1A 3KRJA 4U5JA 4Y8DA 4IW0A 5EQPA 3FHRA 5ITAA 4FKIA 2QO9A 3UMXA 5E8VA 2OSCA 4CZTA 4A4LA 4KINA 4IAKA 4IADA 4QMOA 5CEOA 1WBTA 2C6TA 2W5HA 3ALNA 3HRCA 4O0YA 3WBLA 4AT4A 4AZTA 4EOOA 4ONAA 4BKYA 4DGMA 3FQSA 4BI2A 1OI9A 2ERKA 4YLKA 3ORIA 2Z7QA 5KX8A 4NIFA 4ZTRA 3REPA 4JDIA 4R8QA 4NKAA 5E92A 4DFZE 5CENA 1VYZA 3FZSA 3NYXA 4G5JA 3AT4A 4R3RA 4FV3A 4U8ZA 1H08A 3S00A 4FGBA 1U54B 4ACMA 2XNPA 4J53A 4CVAA 3V6RA 4PX6A 4C4JA 4O0SA 4D2RA 4IVCA 3WARA 1S9IA 4GS6A 3LFEA 4FTAA 4O1OA 4BRXA 3P7BA 3HRBA 1SNXA 4XJ0A 4MWHA 1NXKA 3LMGA 3DPKA 3DKCA 4F9CA 1UNGA 3DGKA 4YC8A 5GJGA 5AADA 2VD5A 3HA8A 5DG5A 3L8VA 3R7OA 4ZTLA 1MRYA 2WTKC 3ODZX 3IOKA 2WNTA 4QMMA 5FG8A 5K5NA 4RX5A 3UNZA 1IA9A 1Q5KA 2WMTA 4C4EA 4EQCA 4ITIA 2CKQA 2BAKA 4RGJA 4GCJA 1RDQE 1ZOHA 2WPAA 4EI4A 2XNBA 4I4EA 3KC3A 3V5TA 4IIRA 2OK1A 3E87A 4V0GA 4LRMA 4DINA 5LARA 4DYMA 4OTIA 3FWQA 3PG3A 5CNNA 4WG3A 5TKDA 5L2SA 4GMYA 2GTNA 1ZOEA 2OFUA 5BYLA 2OJFE 3DLZA 5M4IA 4FSMA 4OTPA 2YIRA 1W0XC 4PY1A 5BPYA 1GIJA 2XYNA 5AP1A 4U42A 3PA3A 4C3FA 4X6RA 3O71A 2EB2A 2ITVA 3VUIA 2W17A 4QMZA 4U80A 3SD0A 4BDAA 2PYWA 4CG9A 2UW0A 2ITTA 4CLJA 1KWPA 4O96A 3QTXA 5CF5A 1TQMA 2PVFA 5LCJA 1KE7A 3BI6A 3OCGA 4HYIA 3VWAA 2EXEA 1PHKA 4AT5A 3W10A 3ZH8A 5AIRA 1MQ4A 2KULA 3PXQA 1UWHA 1ZYLA 4AN2A 4S31A 3K54A 4QQ5A 2OJGA 3KXGA 3U9CA 5ICPA 3EZRA 3AGLA 4TWOA 5IH4A 3L8SA 4AZSA 4CTCA 4H3QA 4DH1A 2PVRA 5CF6A 4YZDA 3OT3A 4JQ8A 3VS4A 1KUTA 5L8LA 2ITNA 2WU6A 5E1EA 2Z8CA 3QCSA 4BDHA 4YPSA 5HIDA 4D4RA 4R7HA 3ITZA 3R9DA 2F57A 2F4JA 3A7FA 1Q3WA 3DK3A 4FVRA 3VJOA 3AMAA 3ZEPA 4YZBA 2WMSA 3BHTA 3OEFX 4UALA 3QX4A 3UBDA 3DXQA 4KUJA 1W8CA 2JFLA 3FYKX 4ZXTA 4FKTA 5FEQA 3E3BX 3AD4A 2O8YA 3IS5A 3OMVA 4KKEA 5E9EA 3GP0A 2FVDA 3PPKA 4FZ7A 2UZEA 4O38A 4ZSLA 4B6LA 3PJCA 3PA4A 4FTOA 4DEAA 5L8JA 1JKSA 4MD9E 5E8WA 3KXZA 4BCMA 4BZDA 1JQHA 2XIZA 4ERKA 3DKGA 1U59A 3FZTA 5AX3A 4L46A 3FKOA 3T3VA 3V3VA 3V8TA 3I7BA 3NNVA 4A9SA 4F9WA 2C69A 4MQ1A 5HZNA 4FEVA 4ZS4A 5JQ8A 5IMXA 4RX7A 3I5ZA 1YOMA 1ZRZA 4V05A 2X7GA 4JDHA 4HNIA 3L9NA 4XV2A 4M12A 2YDJA 2XP2A 3CPCA 4C62A 2VX1A 5E8UA 4ZLOA 2YM5A 2JDOA 2OWBA 4GG7A 1R3CA 3R8UA 3RWPA 2YWVA 4M0ZA 4M3QA 2BZKB 3I7CA 1Z57A 2GPHA 2RFNA 2X6DA 2HK5A 4FIGA 2VO3A 3VQHA 4EOIA 3NZ0A 4UWYA 4MAOA 2QKWB 3DK6A 4J52A 4JDJA 4BCOA 3QTZA 4FT3A 5ETIA 2YERA 5AR8A 4YO4A 1U46A 2C5YA 2XK4A 5BQ0A 1VZOA 1IAHA 3LQ5A 3R8VA 3C50A 5KO1A 4FEUA 4UX9A 4D0WA 4F08A 1MRVA 4J97A 4OT5A 2AC3A 2B52A 2W7XA 4W9WA 5C4KA 1UNHA 3KFAA 4Z9LA 3MY0A 4DTAA 4FR4A 2JBPA 4QP7A 2YM4A 3KMWA 3ZUTA 4CMTA 1X8BA 2W1HA 3AXWA 4O86A 4RZWA 5HOAA 3GCVA 3UZTA 3RM6A 2B9JA 4G3CA 4QYFA 4ZSEA 2YCFA 2R64A 1Q8ZA 3ET7A 1XBCA 2RF9A 4S33A 4K77A 4EK3A 1PMNA 3FBVA 2C5XA 3NUYA 1R0PA 3TJCA 5CZHA 5F4NA 3OWJA 2HZIA 4F0GA 2XK6A 4FSYA 2YDKA 3LQ3A 4D2VA 2VTRA 3A7JA 3PWDA 4DEEA 2H34A 3LLTA 3W2SA 4AN9A 4APPA 4F9YA 2XIRA 5FDPA 5ETCA 5EM6A 3R30A 1XH6A 2BZHB 3ZZWA 4O7NA 4EC9A 1ZYSA 5HBEA 5AP2A 4BN1A 1HCLA 4O0WA 3D14A 4Y85A 4ZTQA 1BKXA 5IA4A 3RINA 5CAVA 4ZSGA 2FYSA 2X6EA 4FUYA 3NGAA 4LG4A 5AV4A 2HZ0A 4QTCA 3QCQA 4OBOA 4L67A 5FEEA 3I5NA 2REIA 4AFJA 5J5SA 1W84A 2BDWA 4GT5A 3D94A 5EDQA 5K3YA 3HV3A 3QQFA 4FSWA 3LKMA 3UODA 1PMVA 5HGIA 1JAMA 2HZ4A 3KN6A 2YLEA 2CLQA 4ZY5A 5HVKA 3UQFA 2EUFB 2WHBA 2UVZA 2XIYA 1E9HA 4GG5A 4XNEA 3SHEA 3NUXA 3F5XA 4NK9A 4RIOA 1L3RE 1STCE 4CGAA 3PZHA 4QNYA 3WF7A 4F7LA 3U6JA 3QAME 4KSQA 5KBQA 4IZAA 4K11A 2O63A 4BCFA 5HLPA 1YHVA 4CZUA 1V1KA 3R8ZA 3A62A 5DFPA 1XR1A 1BUHA 3HV4A 3ZXTA 1NVQA 4RIYA 5DT0A 3ATSA 3HMMA 1FGKA 5AP6A 4PDOA 2PTKA 3SOCA 4G31A 4EQUA 5B0XA 1YOJA 1H27A 5TF9A 5A3XA 2QQ7A 4D1SA 1CTPE 2B54A 4NCTA 3UOKA 5D10A 5KMLA 2VNWA 2C3IB 4K1BA 2XCHA 4MXYA 5IDNA 4CLIA 3VUHA 2OJIA 3R71A 3LXPA 2QO7A 3FMJA 3LCTA 3Q6UA 2J6MA 2WKMA 3KRLA 4OR5A 2FSLX 4E8AA 4TXCA 2Q0BA 3GQIA 4YJUA 4WG4A 4XG2A 2QLQA 3EWHA 3WZUA 3BX5A 2UW4A 4G34A 5J79A 4FIEA 4EOJA 3OT8A 4YBJA 3T3UA 2C6IA 4RC4A 3RK7A 4UYAA 2SRCA 3P08A 3FMNA 2W1EA 3LJ0A 3COKA 5CU0A 5JMSA 1W83A 5GZ8A 4BVUA 3D5WA 3KMMA 5E90A 4RJ5A 3WZJA 3NNWA 4OTWA 4NEUA 2VNYA 5EW8A 5A14A 4EL9A 3LCSA 4BGGA 5E7RA 4FZ6A 4AU8A 4FT5A 4IBMA 3BGZA 4FIIA 3LE6A 5HICA 5FRIA 3FZPA 5C03A 2BRNA 4FG9A 3GCPA 3E8DA 3GUBA 3ID6C 4I5MA 4UMQA 1WBNA 1RQQA 2HENA 3UIXA 4X2FA 3OWPA 3EL7A 3UYTA 4ASDA 4CCUA 5KMOA 3W1FA 4YUQA 2C6KA 2C68A 3F7ZA 2J0JA 2VGOA 1ND4A 2V5QA 2PK9A 4MXOA 4GSBA 4QPAA 4FKGA 4LOPA 2IWIA 1E1VA 1H07A 4JIKA 4YZCA 1URWA 4CZYB 4U41A 3EIDA 2VO7A 2ONLA 3F82A 2VX3A 3MVLA 4U81A 3MH1A 4IAIA 2UVXA 3F3ZA 3HP2A 5DOSA 2WTWA 4JNWA 5IA0A 3P9JA 4F09A 2ETKA 4DCAA 3RPSA 3WZKA 2X8IA 5TOZA 2JD5A 4N4SA 1CKIA 3DU8A 5FXQA 1YXSA 4TT7A 1SYKA 2WMQA 4I5CA 4O7SA 5L4QA 1FVVA 5FUTA 3IGGA 4G6LA 3U55A 3OEZA 4JAJA 2V55A 5CXZA 2C30A 2X39A 4IXPA 1IA8A 4UYNA 4L9IA 4IC8A 4YC3A 2UV2A 2GQRA 1H8FA 1Q8WA 2NNWB 1GZNA 2X7OA 1B38A 4CG8A 3D2KA 2W5AA 3A99A 1PXMA 3QQHA 4DE4A 2GHGA 3R1SA 1WMKA 4UY9A 4G17A 4GKHA 2NO3A 4FTUA 3PUPA 3W2QA 3TXOA 3R9NA 3LFBA 3UMWA 1SVHA 4R5YA 4MYGA 4UV0A 1FVTA 1V0OA 3FSKA 4FTMA 4MK0A 4XRJA 4USEA 4J98A 2C0TA 2PY3A 3MY5A 4JOAA 5HG8A 3L9PA 2IW9A 4TNBA 4FBXA 1XH5A 4JQEA 4L3PA 1H25A 4BWPA 4EJNA 3PSBA 2VTHA 3GOPA 4FNZA 2YCSA 3GOKA 3II5A 5AUUA 1H1WA 5AUZA 3AC4A 5FD2A 2BAJA 4IX4A 4TYEA 2IW8A 4IB5A 5A4TA 3F7WA 3HRFA 4MXZA 5HU3A 4K0YA 3VUKA 5H3QA 3PG1A 4MHAA 2H9VA 4QQJA 3E3PA 4QYHA 3MH3A 5LMAA 3ZMMA 1GNGA 2J7TA 4KBAA 1BYGA 2OBJA 3L9MA 4RQKA 4YSMA 4U6RA 3G2FA 3LW0A 4JX7A 1FQ1B 2UW7A 2PE1A 2BHHA 2X0GA 3ZSIA 1WBSA 3ZHPC 3NW6A 2I1MA 2XBAA 2UZNA 4L01A 2PZIA 3BYVA 4FIHA 4R3PA 5EYCA 3EKKA 5AAFA 2XK8A 4FV8A 5CAUA 4FSZA 4E4MA 3QA0A 3V01A 5HD4A 4CMOA 2NRYA 5EOLA 5IQHA 2WMWA 3OROA 3R63A 4GL9A 3Q53A 5I9UA 4FL1A 2PZPA 5KMIA 2XIKA 3NAYA 2J0IA 4ALWA 3EN5A 4X3FC 4F7NA 4PV0A 4F1OA 3MGYA 5FP6A 3GCUA 4JS8A 2VTJA 2WGJA 5L6OA 2BMCA 3LFCA 3LIJA 2VTIA 3MVJA 4D4SA 3JVRA 3TNWA 3I1AA 2YDIA 5A4QA 4BYIA 3H0YA 5IUGA 2J90A 3W16A 3OWKA 2BPMA 4F4PA 3P7AA 2PHKA 4XHKB 3UQCA 2VAGA 3ZLYA 3GGFA 1Q41A 3GNIB 4O21A 4D28A 2YIQA 4JI9A 2X8DA 3UJGA 1ZMWA 4RIWA 1BL6A 3O7LB 5FTOA 4X7QA 3UP2A 1I09A 2JC6A 3C1XA 4IFGA 2QG5A 3L8XA 4X21A 4J96A 4FX3A 4YZMA 2Y8OA 1ZZLA 1R1WA 3ZO3A 2C47A 4O1PA 5DWRA 4USFA 2VTQA 4E5AX 3BPRA 3UO5A 3RP9A 1IR3A 3NS9A 5J1WA 4QP4A 4R1YA 4PMPA 3Q04A 4I0TA 3KK8A 4ZJVA 2JIVA 5FM2A 4L00A 3W8LA 4W8EA 5HORA 4H1JA 4RX8A 4DFBA 1ZAOA 3F88A 3NDMA 1P5EA 3P86A 3QGYA 3R21A 4FKOA 1YXVA 4HZRA 4JXFA 5DGZA 5H8BA 3TL8A 5CWZA 5HU9A 5AUTA 5JFWA 5FM3A 5M55A 3OBGA 3KXXA 3VRYA 3BE9A 2PE2A 3ZO2A 4BDCA 2G2FA 4AA5A 5BX0A 3QTWA 3Q9XA 3BIZA 3GU7A 5DPVA 5AV1A 3VHEA 4FTTA 5HE2A 4EHVA 1Q24A 4Q9ZA 1J7LA 4DT9A 4JQ7A 5JH6A 3WOWA 4PP9A 1XBAA 4XG4A 3VQUA 4YHJA 4CCBA 3S1HA 4QT1A 3TZMA 4XOYA 4G9CA 4WNKA 5HG7A 5EOBA 3UZRA 3E63A 3OY3A 3KK9A 4U3ZA 1XH7A 4ZOGA 3UNJA 3TG1A 2RFSA 1Z5MA 4QP8A 4C36A 4PRJA 2HXLA 3MFUA 3SG9A 2C6MA 4XYFA 3RZBA 2IVTA 5ANGA 3GBZA 3FMEA 1ZWSA 4QPMA 3QRKA 2WU7A 3KGAA 2IZRA 3L8PA 4H3BA 1U5RA 5HQ0A 4YP8A 4F99A 4R78A 4R7BA 4DGLC 2WO6A 2YCRA 5J7BA 3VJNA 2WMAA 3A7GA 5FQDC 3N4UA 3D0EA 3DA6A 3HV7A 3TZ7A 3ZYAA 1IEPA 2VWXA 2R0UA 4LOOA 1DI8A 3VS7A 3CP9A 3ZFXA 4NW5A 4FEXA 4EC8A 1JSUA 4NM3A 4XBRA 1L8TA 4IZYA 3ORXA 2X81A 3C0HA 4F6WA 2B53A 3TDVA 4DEBA 3HV6A 4FKPA 4CD0A 3PWYA 4HYSA 5FBNC 4E20A 3ERKA 2CJMA 2ZM3A 3FY0A 2YA9A 1YDSE 3QX2A 3ORLA 4G9RA 5CVFA 3QRUA 4OGRA 1KV1A 3TKHA 4I0SA 1LR4A 2Z7RA 4IX3A 3VRZA 5GZAA 1A9UA 4Z7GA 2YJRA 3IONA 3DB8A 4RC3A 5E8SA 4ENXA 3DOGA 3KVWA 3AMBA 2Y7JA 3R04A 4ACCA 5KMKA 3G90X 3I6WA 2E9NA 3VW6A 4W4WA 3R7UA 4WBBB 2CNUA 4EZ5A 3PP0A 3LMHA 3SGCA 3KRRA 3QD4A 1AD5A 4J8MA 2XH5A 4E4XA 5HLNA 2BZJA 3KCFA 3QU0A 3QWJA 4CYIA 5LWNA 5EHYA 5AAEA 4QP2A 4YO6A 4C4FA 3ZDUA 2XIXA 5G1XA 4D4VA 4F64A 5GINE 4UZDA 2X9EA 3AD6A 5CU2A 5DIAA 5C27A 4KB8A 4RJ3A 3DAEA 2FSOX 4FV5A 5FTQA 4EH7A 5JGBA 3LFDA 3UVRA 3OCTA 3BEAA 4HGEA 3NCGA 1Q97A 4G3DA 3W8QA 5AR3A 3HLLA 3ZUVA 5M4UA 2R3GA 3COHA 5KNJA 3E7OA 3ZRKA 3VIDA 1TQIA 5DT3A 2JGZA 3QTSA 3WIKA 3PYYA 3Q9WA 1WVWA 4RA4A 1B39A 3OTUA 3FPQA 4I6QA 3DNDA 3QZIA 4EHZA 2JKQA 3C4CA 5IISA 4Z16A 3O8PA 4M69B 2I40A 4ANQA 3QLFA 4A4XA 2I0YA 2FSMX 4FV7A 4RPVA 4AW0A 1OB3A 2WTDA 4NTSA 4XS2A 5AV0A 3ZXZA 4ALUA 3DTWA 1XH4A 2X1NA 2YABA 4IEBA 4NUSA 4QYGA 2Z02A 3VBXA 4TTHB 2CPKE 5GJFA 3AC2A 4Y72A 3IW8A 2Y6MA 3KEXA 1R39A 2OF2A 4IWQA 4PQNA 4ZLZA 2PUPA 2R9SA 2WMBA 3LFQA 4I0RA 4K18A 3OZ6A 2BZIB 2QHNA 4AW5A 2FGIA 2OI4X 3KRXA 4XG8A 2V22A 3POZA 4JR7A 1OBGA 4WSQA 3R9RA 1OL6A 3RHKA 2PVJA 3KF7A 5BVEA 1DM2A 3IGOA 4QP3A 4IZ5A 1OM1A 3C4ZA 1F5QA 2W4JA 3BWFA 1J91A 4I41A 3SRVB 3CSVA 1M14A 1PXPA 5M06A 4XX9A 3JPVA 3COIA 3CKXA 3L1SA 2XJ1A 4LUEA 4YR8A 1GIHA 4GUBA 5HE0A 5C4LA 3QC4A 3AQVA 3C9WA 1XHAA 3KL8A 4O7RA 4CFXA 3R02A 4MCVA 3RM7A 2JKOA 4C4GA 5HESA 4UB7A 5J9YA 4YMJA 2EU9A 3CY2A 3QRIA 1OGUA 1P2AA 1O6KA 4GFOA 5DT4A 2WTKB 4KRDA 3QZFA 3ANQA 4B7TA 3OD6X 2GS6A 2KTYA 4E6AA 3TJDA 3DS6A 4DEHA 4EOSA 4EBWA 1H4LA 2RGPA 3PXYA 5BVOA 3UO6A 4CKRA 2FUMA 3CXWA 5JFVA 2OJ9A 1REJA 5IA1A 4E26A 5HTCA 5FTGA 3U87A 4QD6A 3SAYA 3KULB 2WOUA 1GIIA 2GNGA 3AC5A 3FAAA 3GEQA 3N9XA 4AQCA 4NU1A 5GNKA 4G6OA 2XKCA 3OF0A 3BU5A 3NR9A 5AA9A 2YCQA 4WRSA 5FBOA 3UPXA 5IQAA 2JIUA 2C0OA 4FG7A 4FT0A 3FMMA 3DJ5A 4D55A 4ANSA 3TWJA 2G1TA 2BVAA 4TWCA 5IQGA 2BHEA 4HVHA 1QL6A 5C1QB 4L7SA 1IASA 2O3PA 3QZHA 4C57A 3OOGA 2B7AA 2BAQA 4NM0A 4U44A 3A4PA 2R3PA 3D4QA 4EH2A 2CGVA 2WQOA 5IA5A 3MH2A 3FI3A 3UPZA 2WIPA 2JKKA 3NVKI 4JG7A 3CC6A 4TN6A 5AM6A 1OKVA 1Y8YA 3ZUUA 2VWVA 3BYUA 5T3QA 5KE0A 4C4IA 2ITOA 2WELA 2QCSA 4DLIA 4BCPA 4CEGA 3H0ZA 2X2KA 3IO7A 3DY7A 2J0LA 4L52A 4GU9A 4WRGA 4OW8A 5EM5A 3KN5A 4CV8A 5K5XA 2PULA 4I6HA 4DLJA 4FEQA 4P7EA 3EB0A 1VEBA 4NJ3A 3SRVA 4DGGA 4FT7A 5EM8A 2IW6A 3HKOA 3LLAA 5D12A 3PDTA 4AOJA 4TYGA 4WUNA 1PRYA 4Y73A 2G15A 4PPAA 3EFLA 5CANA 4GIIA 2B55A 4R6VA 1NA7A 5DR6A 5HO8A 3AD5A 4W4XA 3BCEA 4OUCA 1WBPA 3ZONA 4LRJA 3D7TA 4HCUA 4DHFA 4DAWA 4RFZA 1IG1A 1VYWA 3MN3A 4DEGA 3O0GA 3SKCA 1GY3A 1DAYA 3BYOA 1PXKA 2GHMA 2R3RA 3H10A 4O0XA 1SMHA 3KRWA 3HZTA 2YM7A 3BQCA 2VWUA 3POOA 4QTAA 4ACGA 5KMJA 2W4KA 4AE6A 4LL0A 4QMYA 4EYMA 3Q4CA 1MRUA 3FLZA 4RMZA 4FSQA 3TIZA 3A8XA 4DG2E 4EQMA 3MWUA 5CYIA 5JFXA 4N6ZA 3QC9A 4I94A 1J7IA 3QA8A 2UZVA 4I6FA 4MBIA 4CKJA 3P78A 4WNOA 2NP8A 3LQ8A 2ZB0A 2W0JA 4K8AA 4E5WA 3G9LX 5M57A 3GU5A 5EW9A 2C5OA 2J2IB 4L8MA 1YXUA 5AP4A 5LXMA 5LCKA 5DEWA 1GOLA 4O22A 4ACHA 2Y0AA 3BEGA 3VS1A 5E8TA 1PXNA 1R0EA 5HVYA 3RK5A 4EH8A 5KZ0A 5JKGA 1U54A 4MKCA 3FMLA 4RJ8A 2HOGA 3R8PA 3K5UA 1OKWA 3RMFA 1BX6A 1H01A 2X2MA 2YJSA 3G51A 4ALVA 4BTFA 2XMYA 2V7OA 4A7CA 1MUOA 4KA3A 4FTCA 3O7LD 4FIFA 2OO8X 4AW1A 4G16A 4TW9A 1JLUE 2ZOQA 1ZARA 3MPTA 5CLPA 5HKMA 3HMNA 2XRUA 2PSQA 3MTLA 4O0VA 1G8SA 4FZDB 4HCTA 5CY3A 2OXYA 3TUBA 3RCDA 4DH3A 4KIQA 2YN8A 4ZY6A 5C8KA 1PF8A 2VWIA 4GJ3A 4JRVA 2V7AA 5DN3A 3CKWA 4RIXB 4ZTMA 4TYHB 1M2PA 2JDSA 4BDFA 1H00A 3ZOSA 4FODA 3BHYA 3PY3A 4EH9A 5CALA 5FGKA 5J87A 3OXTA 3QKKA 5DVRA 4BDBA 5EKNA 3EMGA 3CR0A 4WA9A 4BTJA 4E93A 4RVTA 2OZOA 2XNMA 2X2LA 3DLSA 3PVWA 4EONA 3UIUA 4KBCA 2WTJA 4FT9A 2BFXA 4OTFA 4NFNA 4CRLA 4FE2A 3FLNC 2VTLA 2G9XA 4LFIA 4RWLA 3MV5A 3VC4A 4HYUA 3PJ8A 1OBDA 2YIXA 2HWPA 3SDJA 5JSMA 3EN4A 4ZK5A 5CF4A 3R7EA 3PY0A 4KSPA 5EH0A 2OIBA 1DS5A 4WSYA 3DAJA 5DLSA 4C38A 2XJ0A 3O8UA 5CVHA 2VTOA 2UZBA 4BF2A 3RPOA 4UEUA 4NM5A 5C8MA 2C1BA 4AFEA 3UE4A 2YM8A 1ZLTA 2BR1A 3MVMA 2XBJA 2CGWA 2Y4IC 4DITA 4FI1A 1G8AA 4E6QA 4ENYA 5M44A 4C02A 3QWKA 1OUYA 2HAKA 4TKSA 5J8IA 2IZSA 2BUJA 2DWBA 4YTIA 5H8EA 5F9EA 5I9ZA 3G33A 4MD7E 1WCCA 3PRFA 5A4LA 3MESA 4M97A 3KVXA 4F65A 5CQUA 5F1ZA 2C5VA 4N57A 3BBTB 2YM6A 2ZV2A 4CFWA 3ALOA 4EH3A 1M17A 1UKIA 3E7VA 3DKOA 2W99B 4CV9A 4CFVA 1LUFA 4C58A 2RL5A 1WZYA 4AGUA 3FL4A 3SG8A 3H4JA 2QVSE 3PPJA 4FSRA 5IQDA 4GFMA 2XUUA 3ZO4A 3BLRA 2R2PA 4FKLA 4QPSA 5LJJA 4GUEA 4J7BA 3RHXA 4E4LA 4L3LA 3SC1A 1Y8GA 4BFMA 2C6EA 4M84A 4A9UA 3B2WA 4ERWA 4GU6A 4HVSA 4EEVA 1PXJA 3U51A 5JGDA 2QONA 3P79A 5CX9A 2ACXA 3GQLA 3O23A 3JVSA 4EK6A 3SW7A 4YLLA 3MYGA 3WZEA 1PMUA 3DNEA 3TNQB 3DAKA 3HV5A 1UKHA 4D9TA 1PJKA 5BYYA 1Q4LA 2QU6A 1OIQA 3FQHA 4UMRA 5I9YA 3BBWA 4JBOA 3FLSA 4I1ZA 2YZAA 4OT6A 1AGWA 3MI9A 3UC4A 4CTBA 4FV9A 4GVJA 3S95A 5CASA 2YAAA 4BZOA 2PPQA 1KE9A 4A9RA 5IUIA 2XF0A 5CSWA 2R7IA 2B1PA 2JKMA 3U6HA 3PFQA 2QOBA 1H1RA 4XP2A 3TM0A 5M4CA 3FC1X 4HGLA 3ENHA 3TZ8A 4Z7HA 3FDNA 1G5SA 3QQLA 4BY9E 4R1VA 2O2UA 2OW3A 4AGWA 3JR1A 4FSNA 3ZRLA 1PXOA 2QHMA 2X4FA 4IDTA 4DH5A 1W98A 4DH8A 5AA8A 3MSSA 1K2PA 2I0HA 4YZ9A 3ROYA 3UVPA 2XK3A 4ARKA 1T46A 3UYSA 4FV6A 2FSTX 5C26A 3HDMA 2YM3A 4AOIA 4YU2A 4Y5HA 1OPKA 5JZJA 4NFMA 4C3RA 4DG0E 2X9FA 5DR2A 4LI5A 3QALE 4IWPA 5LVLA 3NUNA 5AUYA 5AP3A 1OPLA 1G3NA 1QPDA 1J1BA 4I4FA 5CEIA 3RAHA 3K3IA 4BZNA 3DJ7A 3ZRMA 3RI1A 2OLCA 1LEZA 2WQNA 2BRGA 4IM0A 4H39A 4ZTNA 2BROA 4C34A 3TZ9A 3HVCA 3O50A 3W2OA 5HIBA 3U8WA 1YOLA 3U54A 1JOWB 2GS2A 5HCYA 3U4WA 1Q3DA 4MVFA 1XO2B 2C6DA 4NL0A 3QRJA 5DE2A 2J5FA 4GYGA 3M2WA 4LOQA 3DXNA 5HCXA 4I5HA 4LYNA 3R6XA 4DA5A 5J5TA 5ANKA 5A4EA 4LRKA 2W9FB 3OTVA 3ORNA 3Q60A 4QMUA 3OG7A 4QP1A 2ETMA 2OU7A 4FKRA 4WO5A 1EH4A 4BBMA 2QC6A 4QMVA 4WOVA 4V04A 1JPAA 3LVPA 2EWAA 3IECA 3LZBA 4EZ7A 3NMUF 1KOAA 3FKNA 2PUIA 2GDOA 1OZ1A 5H2UA 4HYHA 3QRTA 5AJQA 4W4VA 4AA0A 5IQIA 3MBLA 1I44A 2WAJA 4QQCA 5HX6A 5KKRB 4DBXA 1O6LA 4NTTA 3MDYA 4NZWB 4AXAA 2YITA 3LHJA 4CXAA 5I9XA 1NW1A 4E5BA 4BCGA 4MD8E 1APME 3ETAA 3BZ3A 4PDYA 4AWIA 3ORZA 3PY1A 2PVMA 3VUDA 4DF3A 2QOQA 1GZOA 4KWPA 4FMQA 4MXAA 3OW4A 4N6YA 4AOTA 5L2WA 2G01A 3LFNA 4WUAA 4N70A 3C0IA 4DGOA 4II5A 5F94A 4X2NA 5HVJA 4FGRA 3D5UA 5E1SA 5C9CA 4H05A 3F3UA 4GRBA 2CDZA 2ZM4A 2IZUA 4IDVA 2RG6A 3CD8A 2X4ZA 2YISA 4TPTA 1NVRA 2GQSA 3GFEA 4LM5A 2P0CA 2R3OA 4FC0A 4X3FB 5AAGA 4D9UA 3OCBA 5L3AA 5BVDA 1KOBA 3JUHA 1QPEA 2R4BA 3PA5A 3Q9ZA 5IQEA 4M67A 2R3IA
chains in the Genus database with same CATH superfamily
3AC1A 4KNBA 4U45A 2C3LA 4AA4A 4IB3A 3PZEA 1JNKA 4BYJA 4B4LA 1PW2A 5TR6A 3KA0A 4PL5A 5DNRA 2IVSA 4Q2AA 3AC8A 3LFSA 1M2RA 5CSHA 5EKOA 4OTDA 5CAOA 2WMXA 4RX9A 5KKRC 2I0EA 3PVGA 3EQPA 3H30A 1TZDA 4M68A 4HVIA 4YJRA 3IK3A 3BLAA 4K6ZA 4BIDA 5BNJA 2Q0NA 3OS3A 3PFYA 2BKZA 2V0DA 4ZTHA 2EXMA 2ZM1A 4B9DA 3EFKA 2AUHA 2QKRA 1LPUA 2EXCX 2Z7SA 4C2WA 4XCUA 3W33A 3K3JA 2RG5A 5KUPA 2F9GA 4IWDA 4Y83A 4BKZA 1A48A 5DEYA 2ZV7A 2XRWA 2BDFA 3I81A 3R28A 3VULA 4ORKA 1V0PA 4Z55A 3FXWA 5LMKC 4UMPA 2GS7A 4IB0A 4AACA 4ZY4A 4ANBA 5AMNA 1YDRE 1HOWA 4ZSJA 3GB2A 4ZTSA 3AT2A 1NY3A 3DDPA 4FUXA 5CT0A 5IU2A 3MA3A 5M08A 3OWLA 3TV7A 4LMNA 5A9UA 1YKRA 5HTBA 3TCPA 3K5VA 4CFUA 4N0SA 2XYUA 3CCNA 3VBWA 3NIEA 3LOKA 3VBYA 2YIYA 2R3JA 4FTLA 1BLXA 5I9WA 4RC2A 1SVEA 5J1VA 3I6UA 3WF5A 3MB7A 4JIAA 4TWPA 2UW5A 4L43A 4MNEB 3PE2A 5HX8A 1GZ8A 3UDTA 3UG2A 2NRUA 3VS2A 4EOKA 4O82A 4DTKA 3FZRA 5DR9A 2B4SB 4X3FA 3ZSGA 4QMNA 5I3RA 4D58A 2B0QA 4BDIA 2XK7A 3RVGA 4HVGA 4DCEA 5JGAA 4F7SA 3EJ1A 4YJNA 3ZBFA 1E1XA 5AP7A 5HO7A 4OAVB 1GAGA 4A9TA 3NNXA 4L44A 4XRLA 4JBPA 1XBBA 5AR5A 3RAWA 4FVPA 5JN2A 3PJ3A 4X2GA 3V8WA 3P5KA 2XKEA 4I93A 2IZTA 2UZUE 4BKJA 4NWMA 3RJCA 3QCYA 1CKPA 4NJDA 3W18A 4ANOA 3G6HA 2GFCA 4PPBA 4UBAA 5AR7A 4D2WA 1JWHA 1VJYA 4G1WA 1PY5A 3BU3A 4LGDA 4M66A 2HWOA 3HUCA 2F7EE 5HTIA 4EK4A 3PIXA 5CEKA 3C5IA 3Q2JA 3CTHA 2X0QA 2PL0A 4XH6A 3MB6A 5FWKK 4W9XA 3W0SA 2OXDA 2VRXA 4I5PA 4FTNA 3V04A 4EOPA 3THBA 3CQEA 3SXSA 2RFEA 4RWIA 4F0IA 4GW8A 4FVQA 4B8LA 2B9IA 4ZIMA 3V5WA 3W2PA 4FV0A 4CYJA 3TIYA 4K2RA 4EUUA 2Y9QA 4P2KA 1YI3A 2PVNA 4EOQA 4O7YA 3R1QA 2PVLA 5J95A 5CS6A 4OLIA 2QOKA 3HP5A 3M11A 3N4VA 4FICA 4E73A 2RSVA 3AC3A 2ITZA 5AUXA 5JRSA 4BI0A 4L6QA 3FMDA 3AT3A 4XG9A 2DQ7X 1NVSA 4NYEA 3LJ2A 3ORKA 4HPUE 1YI4A 4FL3A 4MF1A 2BALA 4UMUA 1ZY5A 1T45A 3F3TA 4GYIA 3WZDA 5A6NA 3PVBA 1H1QA 5FXRA 3KREA 3JY9A 4MNEA 3DFCB 1XQZA 4ITJA 5A6OA 2X7FA 2PE0A 3PE1A 3RNIA 2VN9A 5HE1A 3KCKA 5J9LA 3G15A 2VV9A 2CKPA 2XNEA 4YPDA 3LXKA 3P1AA 3F69A 3D83A 3RALA 3MY1A 2P3GX 4MH7A 3ORTA 1KSWA 2OG8A 3IKAA 3DBCA 3FLWA 3HL7A 2XARA 4O0RA 5IA2A 2W96B 3PXKA 5BUIA 3UOHA 4A06A 2B9FA 5JEBA 1ST0A 3OXZA 2ZMCA 3BE2A 3QUDA 2O65A 3TEIA 4C2VA 5E4HA 4OTHA 2UW8A 4RVMA 3CPBA 2G2IA 2YIWA 4UN0C 1OL5A 3GU4A 3CGFA 4BICA 4O7TA 3LFAA 2QURA 3VBVA 2W9ZB 4PUZA 2QOIA 4XMOA 2PWLA 3E92A 4U43A 2E2BA 3QBNA 2XKFA 4DT8A 3UGCA 3EYHA 2OIDA 2FH9A 3UIMA 5DA3A 4ANMA 3NW5A 2R3LA 2QOOA 2Z2WA 3NSZA 4PDSA 2OIQA 2NPQA 4BR3A 5CEPA 2R3NA 2IVUA 3IW6A 4FTJA 4CNHA 5EYKA 3TUCA 4PPCA 5GHVA 3F6XA 3OP5A 2X0PA 3PXZA 3CQUA 5LOHA 4BDDA 4EKLA 1F3MC 3RPRA 4O2PA 2GMXA 3CLYA 3BKBA 3M42A 2ZJWA 3G0FA 2WB8A 4PWNA 2CNQA 1VR2A 4GJ2A 2W1GA 4U97A 4QMQA 5CU6A 4YNOA 2C4GA 3PLAE 3NCZA 3FUPA 5K0KA 3RPVA 3BGQA 4IVDA 4RJ4A 4XOZA 4IAYA 3W0RA 1GZKA 1TFFA 3L9LA 5EFQA 3COMA 3E8CA 3R01A 2BRHA 2XZSA 4M8TA 3QHWA 4O6LA 4XBUA 5KCVA 3UO4A 5CSPA 3VUGA 4MQ2A 1JKTA 1XJDA 2WOTA 1FVRA 1UU9A 3IG7A 3RGFA 2JAMA 3TT0A 2H8HA 4DGNA 3FEGA 4L45A 3RAKA 3QLGA 4O91A 2ERZE 3QKMA 3R7IA 2ZB1A 4XV3A 3R7VA 2OFVA 3EL8A 3E64A 3E88A 4FL2A 5D7AA 3R8MA 5BVFA 3VBTA 3VVHA 5DRDA 3QYWA 3FXZA 5BYZA 4BCKA 5D7VA 2ZV9A 4CRSA 2I6LA 2WD1A 4ACDA 1FBNA 4FEWA 5FDXA 4FYNA 2UW9A 4P90A 3A2CA 3LCOA 5I0BA 2AC5A 3HA6A 4J1RA 3CY3A 4LL5A 4Y5QA 5H8GA 2Y4PA 5I4NA 5K4JA 2OZAB 4GT4A 4FK6A 3BV2A 1YQJA 5C8NA 3ZFMA 4EJ7A 2VZ6A 5E8YA 3TI1A 4JG6A 3BYMA 3VS3A 3PSCA 5EM7A 4F6UA 3R2YA 2WQMA 4XEYA 5TT7A 2XEZA 4KS8A 4CMUA 5I9VA 2OF4A 3ULZA 5HIEA 3CD3A 5CEQA 2C0IA 2IJMA 3EH9A 3EN7A 2JDRA 3MS9A 1ERKA 1P14A 4RVLA 5AR2A 1S9JA 5IEYA 4DHJA 2XM9A 3AG9A 3LAUA 2I7QA 4G2FA 3AMYA 5IMEA 2VWYA 4NW6A 3QQGA 3D2IA 4U40A 3G5DA 3RCJA 5B7VA 4BTKA 1PYEA 2W1ZA 3Q3BA 2EVAA 5D1JA 3TV4A 1U5QA 1J1CA 4F1MA 5EQEA 5EQYA 5BMSA 5D9HA 3QUPA 3RPYA 3A7HA 2BCJA 4O2ZA 5KHXA 5TO8A 3NLBA 2BRBA 2C5NA 2YLFA 3VS6A 3DBEA 2GNFA 4LV5A 5HBHA 3C0GA 1M7NA 3F5PA 4IH8A 4JT3A 5IQFA 4AGCA 4D4YA 3Q4UA 5KMMA 4DBNA 4W8DA 5GIOE 1KE8A 2UVYA 4WG5A 2F7ZE 3QTUA 3QZGA 3GC9A 4R5SA 4PL3A 3CJFA 3W2RA 3UVQA 5F95A 1H0WA 3EFJA 4BC6A 3GT8A 4M69A 4IX5A 1F0QA 3OCSA 4GV1A 4HOKA 3OBJA 4V0GB 3R0TA 2WZJA 4FNXA 3HECA 3F2RA 2QODA 5AP5A 4OBPA 3CEKA 5CSVA 2CGXA 4MX9A 3FI8A 2PUUA 3LM0A 4MF0A 4I92A 4R7IA 5F20A 2HY0A 4YHTA 2GNJA 2IG7A 2RIOA 4UWBA 4UWCA 2E9OA 4ASXA 2UZDA 4FYOA 3PIYA 4ASEA 4AT3A 1PMEA 3NUSA 4EHGA 3FLYA 4FOCA 3DKFA 4WKQA 3D7ZA 1OIRA 3LM5A 4WIHA 2R7BA 1OECA 4ZAUA 2VWZA 3HX4A 3MH0A 1H1PA 4GVAA 5HNGA 4RA5A 3QQJA 4O6EA 4RQVA 4BCIA 4BWKA 5BUJA 3EQHA 5DI1A 2Q83A 4DC2A 3NWWA 3G9NA 1JVPP 4I6BA 1OIUA 2CGUA 4U7ZA 3KXHA 3TDWA 2GHLA 5FEDA 3D5VA 2WQBA 1OL1A 1YXTA 1J3HA 2W4OA 5ETAA 3CTJA 2UW6A 4IANA 4UXQA 4BB4A 5D11A 2CMWA 3P7CA 3LFFA 4HGSA 5CI7A 4B8MA 4KKHA 5DBXA 5AFVA 4JAIA 5ANEA 2ITQA 4PMSA 4L3JA 4O0UA 3BYSA 2BDJA 2RKUA 2QR8A 2FA2A 4LUDA 4FK3A 4CFNA 3DJ6A 3TV6A 4J99A 4BCJA 2DUVA 3V5LA 4AZFA 2QD9A 4NH1A 1O9UA 3FL5A 2PMOX 3Q5IA 4C4HA 5M56A 2J0KA 3ELJA 3PXRA 3H9RA 1P4OA 2E9UA 3UIBA 4QYEA 4V01A 4DFXE 2QOHA 5EW3A 4RBLA 2OGVA 4IVBA 3FQEA 5L6PA 4KS7A 4KABA 3D9VA 2XAOA 3KULA 5ANOA 2J51A 1A06A 4FV1A 2PZRA 2YHVA 5L6WL 2VU3A 5ACKA 5T68A 3VS0A 3SXFA 1PKGA 3DXPA 3I0OA 4ZP5A 3DQXA 1JSVA 1SNUA 3ULIA 4NT4A 4WNMA 4DHZA 5EYDA 3C4EA 4XG7A 2H6DA 4XV1A 2CKEA 3ANRA 5LVPA 4U3YA 3P0MA 1ZYCA 3T9IA 3WF8A 3A8WA 2JFMA 2QLUA 4RG0A 3BHHA 1ZMVA 2XVDA 3BLHA 3QYZA 4U0IA 4FZAB 3UOLA 3WE8A 3LCDA 2IO6A 2ESMA 5EDRA 3E8NA 2R5TA 2W06A 3F66A 3NYOA 1UU8A 5CTPA 3EQCA 1ZOGA 5E91A 4AP7A 4EWHA 1G8KA 1JKLA 3EN9A 5LVMA 5IQCA 2OJJA 3O17A 1UVRA 4IACA 3ZM4A 4FOBA 3UOJA 4ZZNA 1YI6A 5EYMA 3F5UA 3AKLA 1FMKA 4FKVA 4EYJA 3CS9A 3P4KA 4IMYA 5HLWA 2OH0E 1FINA 1PXLA 4RLLA 5BVKA 5CEMA 2Y4IB 3NIZA 2UZTA 5CT7A 3ZCLA 4BHNA 3WYYA 2W05A 4NM7A 3WYXA 4J95A 4FNYA 4FTIA 1MQBA 4AAAA 2XALA 2QI8A 3OXIA 5JQ5A 5GZ9A 2BIKB 1WAKA 4TYJA 4O7ZA 1V0BA 3OHTA 4I23A 4KIPA 3BHUA 3VBQA 1GJOA 4MNFA 3DCVA 2QU5A 5L2IA 2WFYA 1UA2A 2VO0A 3ZLWA 4I21A 4WHZA 4BCQA 3V5QA 3DT1A 5AR4A 3ORPA 2P4IA 1YDTE 2CCIA 4G5PA 3HUBA 5EDPA 4QP6A 1UV5A 1URCA 4YURA 3TTIA 4R77A 2J50A 1BL7A 2HZNA 3OOMA 4QMTA 4WBOA 5ANDA 4M7IA 4D2PA 4F63A 3R7YA 2R3MA 4JDKA 1KV2A 2YEXA 3LXNA 4I20A 3V8SA 4O0TA 3LCKA 5IEVA 3AGMA 3TNHA 3NX8A 3PVUA 4K33A 2UZOA 1OL7A 5BUEA 4B99A 1XWSA 3TNIA 5HCZA 3UDZA 3TTJA 3ZU7A 2LGCA 2VTMA 3AOXA 4ZZMA 4EK5A 5I5ZA 4EBVA 5DYJA 5JRQA 2HYYA 3RBWA 2VGPA 2XNNA 4QTBA 3UDBA 2PMLX 4QMPA 5HHWA 4TNDA 4UMTA 3U9NA 1RW8A 3QQKA 5KBRA 3EHAA 5LVOA 4RJ7A 3ZO1A 5IDPA 3MIYA 3RZFA 4ZLYA 3M1SA 3S3IA 3BHVA 2PZYA 3GCQA 3ZFYA 4PF4A 5BVNA 2VWWA 3KF4A 3HAVA 1H0VA 3G6GA 5CVGA 3ZLXA 5AIKA 4X6QC 1BMKA 2R3KA 4IJPA 5DRBA 1JKKA 3A7IA 4Y46A 5J7HA 4X2KA 4AW2A 3FSFA 4GEOA 2HY81 2C3KA 5CQWA 2PMNX 5GJDA 2JAVA 3FI4A 4UZHA 3EQGA 1M2QA 4GT3A 4MBJA 5HD7A 3WIGA 4GK3A 1LEWA 4RIYB 3FKLA 2AEGA 3G0EA 5E8ZA 3C5UA 3K2LA 2WXVA 4RIXA 2XA4A 4TYHA 3UTOA 4DTBA 2JBOA 3CTQA 5CU3A 5IG1A 1O6YA 1SZMA 1YRPA 1OUKA 4JR3A 4TZRA 5IKWA 3HNGA 3C7QA 2XKDA 4PNKA 4X3JA 4PDPA 4B0GA 4AUAA 3QXOA 2F7XE 3IPHA 5HG5A 3MW1A 1ZXEA 1YXXA 2PVHA 2QOFA 2ZDTA 4JVGA 4S30A 4UXLA 2GU8A 4AE9A 3HYHA 3VS5A 2PMIA 4EWQA 3VW8A 4E4NA 2O0UA 2XCKA 3NW7A 2UUEA 2BTSA 3QL8A 3JY0A 2FO0A 4ZSAA 2B9HA 4QMXA 5ACBC 2WMRA 3R8LA 3NNUA 3R2BA 4O4FA 5L2QA 4FTQA 4GK4A 4Q5EA 3WILA 4EK8A 3IDBA 4G3EA 1WVYA 4LMUA 4YBKA 2ZYBA 4QNAA 4AF3A 4BDGA 3FPMA 4MBLA 4ZS0A 3DBQA 2ZDUA 3MVHA 5M4FA 4GK2A 4FSUA 5IQBA 4KBKA 2QOLA 3TACA 3ZTXA 2GTMA 4BCHA 4BIBA 5HNIX 3U6IA 1UU3A 3Q6WA 4YZNA 5CSXA 3ROCA 4PP7A 2YFXA 2CN8A 3ZBXA 4RWJA 3PPZA 1DAWA 5AP0A 4D5KA 2UW3A 4HJOA 3SLSA 3SW4A 4EH4A 2BIYA 3FE3A 3HEGA 2WTIA 2PVYA 3QGWA 5JFSA 5M51A 2BRMA 2YAKA 3PJ2A 4RRVA 4YJSA 4FA2A 5IF1A 1QPJA 4FNWA 4FTKA 2ZAZA 4P5ZA 4DFYA 4O83A 3ZLSA 3R00A 3JYAA 2JDVA 2WIHA 1LP4A 1ZYJA 3QCXA 4WD5A 3SXRA 4BGHA 1WBVA 5CAPA 3BGPA 3PXFA 4NCTC 3IW7A 4HW7A 4IQ6A 3F3VA 3ORMA 4PTEA 1Q99A 3EFWA 4H3PA 4AN3A 4U9AA 3CJGA 3I60A 1H24A 2VX0A 3VUMA 3WE4A 3PJ1A 4ZEGA 5LWMA 1PYXA 3ZEWA 1ZYDA 5E8XA 4NKSA 3SVVA 4PTCA 3O8TA 3W55A 4FV4A 4C7TA 4HZSA 3I0QA 3ZC6A 1OIYA 3DZQA 5JZNA 5K4IA 4OAUC 1OMWA 4PMMA 4AQKA 4JBQA 4ZJIA 3UZPA 4L53A 3Q96A 4X2JA 4O7WA 4DFUA 1IRKA 2VTTA 3GXLA 3IW4A 2A1AB 2JDTA 3DQWA 5HNBA 3JS2A 3ZDIA 4F6SA 3ATTA 2ZV8A 1TKIA 3GC0A 1H1SA 1SVGA 4GH2A 1OKZA 2XEYA 3LPBA 3WI6A 5IH6A 2QOCA 4LQMA 3UP7A 3QFVA 1ZMUA 4PMTA 4YHFA 3FY2A 5AEPA 1Y6AA 2F2UA 4WNPA 4AGDA 2IN6A 1PXIA 3ZSHA 1R78A 3Q4ZA 1XMLA 5EHOA 1CMKE 5CF8A 4F78A 4PTGA 1G8JA 4QO9A 5IEXA 3D15A 3QTRA 2HW7A 4QMLA 2H96A 5AUWA 3OW3A 4RT7A 1TQPA 3NAXA 3EQRA 4YTFA 3PP1A 1MP8A 1REKA 3UC3A 2O64A 4DFNA 2R3QA 4XP3A 4J71A 3UQGA 4DN5A 4CQEA 2P33A 2ONLC 3CIKA 2IVVA 5AWMA 1XKKA 4H58A 4BCNA 2Y6OA 4ASZA 3EKNA 4JG8A 1H26A 4AX8A 2XB7A 4GKIA 2VTPA 5LMBA 3Q9YA 1B6CB 3A4OX 1TVOA 3QD2B 2CNVA 4F7JA 4BBFA 2YZLA 2WQEA 3T8OA 4IAAA 4AS0A 4ANLA 4YJQA 1W82A 1WVXA 4IVAA 1WBOA 2GNHA 3B8QA 3A60A 4LGGA 5G6VA 3NVMB 5HO6A 5AM7A 4BJJB 2CHLA 4FIJA 4HNFA 3C4XA 2VWBA 4DH7A 3VO3A 1XH8A 2JEDA 2W1CA 3FLQA 2VUWA 1QMZA 3F5GA 4FKQA 4D2TA 3MPAA 4HCVA 2V62A 4IWOA 4NSTA 4BBEA 3C51A 3F9NA 3OFMA 3DDQA 3E5AA 2A19B 2W1DA 4J8NA 4EH6A 3BWJA 4EUTA 4BHZA 4LDTA 3GC7A 2OXXA 5AX9A 3QD3A 4H36A 3SV0A 4C0TA 1NT2A 3S4QA 5GIPE 4H1MA 1RJBA 3B8RA 4IC7A 4K9YA 2CN5A 2WMUA 4MWIA 1UU7A 2LAVA 1Z9XA 4HPTE 3GC8A 4QOXA 2OKRA 3QTQA 3RK9A 2NYAA 3FYJX 3SOAA 3KU2A 4YJOA 4RIWB 4S32A 1YVJA 1FPUA 2EB3A 2J4ZA 3BQRA 3DBDA 4IAFA 4IX6A 5ANJA 3F61A 3R7GA 4AZEA 2ZFYA 3C4WA 3LJ1A 2W5BA 4I22A 4JL9A 4BL1A 1Y57A 3OVVA 4DHIB 3R22A 3TN8A 3EQBA 4IM2A 4DG3E 3RWQA 4CT1A 2A4LA 5DHJA 3O96A 4QTDA 3BL9A 3QHRA 4BI1A 3Q4TA 3W32A 3GENA 5EI2A 2BTRA 1OPJA 3NFGB 3MA6A 4I3ZA 4RLKA 5IPJA 4TY1A 1WBWA 5IA3A 2R3FA 4YJVA 1ST4A 4KKGA 3BV3A 3QD0A 3EQDA 4ZJJA 4G3GA 4FKJA 1YWNA 2VTAA 4IZ7A 4TWNA 2J0MB 4MXXA 2JITA 3E62A 1U4DA 1H28A 4RVKA 4O84A 3BU6A 3DB6A 3H3CA 2PUNA 3TNPC 3P23A 5LMKA 1K9AA 5FP5A 2XNOA 3HMOA 1W7HA 2BKKA 2PU8A 1Q8TA 4GIHA 4X0MA 3Q52A 1YHWA 4D1XA 3IDPA 4KIOA 5BVWA 3KQ7A 3PSDA 2XNGA 4KRCA 5K0XA 1P4FA 2CCHA 5TE0A 3CBLA 2I0VA 5M53A 5FLFA 4W4YA 4EHEA 3KB7A 2OH4A 2VTSA 3Q2MA 4FKUA 4FZFB 3ACKA 2ITWA 5KHWA 5AV2A 3KXNA 5EI6A 4M14A 5EI8A 4OTQA 2P2IA 4C35A 5ANIA 2HXQA 4JX3A 5LVNA 4BDKA 3JXWA 1CKJA 5HI2A 3FJQE 5HE3A 4G3FA 3A61A 2WTCA 2G2HA 2JLDA 4RZVA 3RTPA 4IB1A 4F1TA 4PL4A 4E3CA 2IPXA 2DYLA 4QYYA 5DMZA 2C6OA 4CKIA 3V6SA 4KD1A 2GSFA 1Y6BA 3H9OA 4BIEA 2C1AA 2J5EA 4DEIA 2E9VA 2GNLA 5J9ZA 3IW5A 4OTRA 3SQQA 4AG8A 3FZ1A 4IFCA 3FMKA 4L42A 5CNOA 2JIIA 3VUTA 3EQIA 2C3JA 3I79A 4KIKB 3FC2A 4P5QA 4QMWA 3FXXA 4LGHA 3FI2A 4G6NA 5B2MA 3PTGA 3KKVA 4BWXA 5I3OA 2UZLA 5D41A 4F0FA 3EOCA 5T6KA 4JJRA 3QTIA 4YNEA 4D5HA 2C6LA 5HBJA 4BDJA 5H9BA 1OVEA 3NUPA 4EOLA 4QTEA 4Z3VA 3VONA 3CGOA 5C01A 3MJ1A 4YLJA 3R1YA 4U79A 3FV8A 4MXCA 5B2KA 4CQGA 3QKLA 1IAJA 3F2NA 4A4OA 2QO2A 4MTAA 2GCDA 2A0CX 3S2PA 4D0XA 1UNLA 4FF8A 2XM8A 4RJ6A 2VTNA 1ZY4A 3NRMA 4O4CA 3R9OA 5CXHA 3SX9A 3B2TA 4YTCA 4OTGA 4ZMFA 4C33A 1YWRA 4IAZA 3U4UA 3OUKA 2Z60A 4DDIA 4XV9A 1DI9A 4EOMA 3UNKA 3F2AA 4LV8A 4A07A 2A2AA 1PKDA 3KXMA 4CSVA 3LMIA 2CSNA 3FZOA 4CFFA 3ZC5A 3SA0A 4JRNA 4LV7A 2F49A 2RFDA 4HVDA 4FKSA 3MTFA 5AUVA 4QMSA 1Q62A 1OKYA 1M52A 3BLQA 4IM3A 3RKBA 2GQGA 4JLCA 2CLXA 2BILB 1K3AA 2OICA 4YSJA 2A27A 3R9HA 5BMMA 3D5XA 4TL0A 4ID7A 2HELA 3MPMA 3MJ2A 3QUEA 4FV2A 4TYIA 3FHIA 4FSTA 4XUFA 5DH3A 4QQTA 4C3PA 3DTCA 3PRIA 4RWKA 3VF8A 3WF9A 3KY2A 4E6CA 4AZWA 3VHKA 2X8EA 3GU6A 3TKIA 3V51A 1YHSA 3RAIA 2ZMDA 3HMPA 5KZIA 3VF9A 3NEWA 4KIKA 2GNIA 2XS0A 3DZOA 2AQXA 3IOPA 4M0YA 1CM8A 1SM2A 3IDCA 3MFRA 4QEBA 3TUDA 4YGAA 2WEIA 5CZIA 3T9TA 1CDKA 3KMUA 2ZVAA 4D2SA 4OBQA 4ZZOA 4EKKA 3OY1A 2HIWA 3QXPA 4ITHA 3ZM9A 1CSNA 3DFAA 1XH9A 4C61A 5L8KA 4O7LA 4AZVA 4TRLA 5K9IA 4YJPA 3ZS5A 5FXSA 3HGKA 4BDEA 5M07A 4EH5A 4FTRA 5AV3A 3O51A 2Z7LA 4QP9A 1FOTA 2ITXA 1QPCA 4APCA 4C59A 4O27B 3GFWA 2PVKA 3ODYX 4CT2A 4ZMEA 3ACJA 4RSSA 3I4BA 4M13A 4IE9A 4XG3A 5EHLA 2YACA 4USDA 3V5PA 4EZ3A 4XP0A 3Q5ZA 5EK7A 3TKUA 3BRBA 3F3WA 3R73A 1HCKA 1UWJA 2ETRA 1BI8A 3R1NA 2UZWE 2R3HA 5KMNA 5L2TA 5A54A 5B2LA 3NPCA 4JBVA 3NYNA 1OITA 2GFSA 1AQ1A 4YTHA 4C37A 2P2HA 4F9AA 2F2CB 2WTVA 4I24A 4R3CA 4ANNA 5CI6A 4DEDA 3PLSA 2FB8A 2XK9A 3CE3A 5JT2A 1Y91A 3MIAA 3R83A 4S34A 2BFYA 4YC6A 3HDNA 5EG3A 5M09A 1ATPE 2ITPA 3ZZEA 4FKWA 2E9PA 4QDEA 2QG7A 1YWVA 1Q8YA 3C13A 3EYGA 4NIFB 3DV3A 2W1IA 5CU4A 4XG6A 3S0OA 4MEDA 4KAOA 2HW6A 2ITUA 4EORA 2VO6A 3N51A 3V5JA 3DK7A 3NUAA 3VNTA 2YWPA 1Q61A 3MFSA 3NYVA 4F9BA 4O81A 4HGTA 4O7VA 4BTMA 2DS1A 2J9MA 1J7UA 4XLIA 3GI3A 3QQUA 4IJ9A 3UG1A 1Q8UA 3W0PA 4WT6A 4CFMA 4L7FA 2QNJA 4C8BA 5IH5A 4IHPA 2WMVA 3CQWA 1JSTA 3MFTA 4A9YA 1RE8A 2ITYA 3RNYA 1WFCA 5ETFA 4DFLA 3EZVA 4XLVA 5JK3A 2O5KA 3O2MA 4PNIA 3W2CA 4GFGA 2WEVA 4QRCA 2PZ5A 3GCSA 3Q32A 4BGQA 5LQFA 4Y95A 4E6DA 4Q5HA 5A4CA 3VAPA 1ZZ2A 4FG8A 4L68A 2AYPA 4YJTA 5CAQA 4RFYA 4E7WA 3DBFA 1M7QA 4P4CA 3VN9A 5HG9A 2QR7A 1YW2A 1FGIA 3H9FA 3EN6A 2R0IA 3D7TB 4Q9SA 5A46A 5IUHA 3E8EA 3ENMA 3WF6A 2CKOA 1KE5A 1FMOE 2XJ2A 3EQFA 3E93A 5IZFA 3N4TA 3LXLA 4D1ZA 3HAMA 3OUNB 1KE6A 2HCKA 3HMIA 1QCFA 3GVUA 4RFMA 1JBPE 1OL2A 1BI7A 3FMHA 2P55A 3PIZA 3C4FA 3IQ7A 4S2ZA 3QF9A 5HEZA 4M15A 3BELA 3GU8A 4E1ZA 2OZAA 2W1FA 3NUUA 4F70A 3OC1A 3KRJA 4U5JA 4Y8DA 4IW0A 5EQPA 3FHRA 5ITAA 4FKIA 2QO9A 3UMXA 5E8VA 2OSCA 4CZTA 1OGYA 4A4LA 4KINA 4IAKA 4IADA 4QMOA 5CEOA 1WBTA 2C6TA 2W5HA 3ALNA 3HRCA 4O0YA 3WBLA 4AT4A 4AZTA 4EOOA 4ONAA 4BKYA 4DGMA 3FQSA 4BI2A 1OI9A 2ERKA 4YLKA 3ORIA 2Z7QA 5KX8A 4NIFA 4ZTRA 3REPA 4JDIA 4R8QA 4NKAA 5E92A 4DFZE 5CENA 1VYZA 3FZSA 3NYXA 4G5JA 3AT4A 4R3RA 4FV3A 4U8ZA 1H08A 4O4BB 3S00A 4FGBA 3KIOC 1U54B 4ACMA 2XNPA 4J53A 4CVAA 3V6RA 4PX6A 4C4JA 4O0SA 4D2RA 4IVCA 3WARA 1S9IA 4GS6A 3LFEA 4FTAA 4O1OA 4BRXA 3P7BA 3HRBA 1SNXA 4XJ0A 4MWHA 1NXKA 3LMGA 3DPKA 3DKCA 4F9CA 1UNGA 3DGKA 4YC8A 5GJGA 5AADA 2VD5A 3HA8A 5DG5A 3L8VA 3R7OA 4ZTLA 1MRYA