1Q8TA

The catalytic subunit of camp-dependent protein kinase (pka) in complex with rho-kinase inhibitor y-27632
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Protein kinase A in complex with Rho-kinase inhibitors Y-27632, Fasudil, and H-1152P: structural basis of selectivity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q8tA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q8tA02
4HVIA 3GC8A 5EM7A 2XK4A 4A9UA 2YJSA 3BIZA 2PULA 4O1PA 4NTSA 3G51A 3H3CA 4FI1A 1JNKA 1PHKA 4P2KA 3SLSA 3V5QA 2OF2A 3GVUA 2X4ZA 1PF8A 3OWLA 3FJQE 4O0YA 3PE2A 4RC3A 4N70A 1YQJA 3ZFYA 1ZOEA 3DJ5A 3SC1A 3P08A 5GZ9A 3W2CA 5CENA 4FX3A 4CD0A 2QR8A 1ZYCA 4D2VA 5C01A 4EK6A 4F9BA 4PP7A 5DYJA 3R1SA 5EK7A 4QOXA 1GIIA 4DEBA 1XHAA 4MD9E 3HGKA 4YSMA 1PXLA 3GUBA 4YNEA 3E92A 5AR4A 3UP7A 2ITXA 5KBRA 4FKTA 4RQKA 1V0BA 4Y46A 5AR5A 4BGGA 3R2YA 3QGYA 4AZFA 4LYNA 4JRNA 3G0EA 5HGIA 4OTDA 1RJBA 4FT0A 2O0UA 4XLIA 3C50A 4E4NA 3OXIA 1Y8GA 1Z9XA 4YO4A 4QQ5A 5CU4A 3RM7A 1ZZ2A 4EQMA 4O7WA 1JSUA 5BYZA 3TNQB 3DV3A 4Y73A 4IWQA 3MSSA 5EW9A 4O21A 3U9NA 4QTEA 3OW4A 4AGWA 2Z02A 3DU8A 1J1CA 3OY1A 1Q62A 2Y4IB 4WG3A 5LWNA 3S0OA 1YW2A 4D1ZA 3BEAA 2JKMA 4FTKA 4HZSA 4FC0A 5JZNA 5IA2A 4PMPA 3OP5A 3OCGA 2WGJA 4EH5A 2GNLA 3MVHA 3C4CA 3UNJA 4HW7A 2PVHA 4HGEA 3CY3A 2C6OA 3FZOA 4R8QA 4V01A 1BL6A 1O6YA 4IAYA 5EKOA 3T3VA 4A7CA 2ZOQA 3DJ7A 4O1OA 2CNUA 1YOJA 3MTLA 2BRNA 5CU6A 4C36A 4DEAA 2CKPA 3ATTA 1OL1A 2GS7A 3COMA 1YXTA 3AD4A 2EB3A 1ZYJA 3R6XA 4KA3A 5E8TA 4D58A 5LVOA 4EC9A 1OGUA 2ETRA 4GJ2A 3GP0A 3KF7A 4KRDA 2V62A 3KCFA 1ZMUA 5I9ZA 3D7ZA 3H30A 4IQ6A 4FEUA 2ITZA 4KSQA 3N9XA 4YC8A 2XKCA 4XYFA 3LFSA 1YDSE 4FTQA 3NIEA 2QHMA 5AV1A 2UZDA 5HTCA 2X7FA 5I9VA 4BWXA 4FF8A 2WXVA 4IC8A 3ZEWA 4PTEA 3RNIA 1PW2A 4N57A 2EXEA 3GI3A 3TM0A 4O6LA 3KRJA 5DWRA 4M69A 3R8LA 3OTUA 2PE0A 4UMQA 2W1GA 4MWIA 3SKCA 4C4IA 5DEWA 1ZZLA 2WMTA 4WG4A 4DLIA 4RLLA 4FZAB 4PV0A 3ORNA 2YN8A 1SZMA 3EMGA 4YP8A 5FEEA 5K9IA 5EI8A 4ASZA 1YXXA 5M06A 3HUCA 2FH9A 3MY0A 5TO8A 2EU9A 1OKYA 4J53A 5M53A 4IXPA 5CLPA 2HXLA 3OCSA 3HA8A 4TPTA 2HAKA 2WU6A 4BWKA 4DITA 4ZTRA 4WRSA 3QHRA 3PRIA 4RJ8A 3OCBA 1BUHA 3BU3A 3TV7A 2QC6A 2WQOA 3JVSA 3VWAA 2PPQA 2WZJA 5AM7A 3UG1A 5K4IA 4CFUA 3P0MA 4R7HA 5CAVA 4EOSA 5IF1A 1U54B 4NZWB 3FMDA 3ZSIA 3E64A 1GAGA 3DK6A 3E3BX 5CTPA 4EZ5A 1ZOHA 2QOQA 5K5XA 2JBPA 5E8VA 4ZTQA 2VWBA 3E93A 5H8GA 4YR8A 3F66A 4QMMA 3PXRA 4YLLA 2ITUA 2IZUA 2QKWB 3LCSA 4ANSA 3FLZA 4QP4A 4RX5A 1KE8A 3MB6A 3HDNA 3RI1A 4FZDB 3V01A 4XG2A 5AWMA 3DK3A 2CGXA 3UOJA 2UZNA 4QMNA 3IW8A 3K3JA 2VTIA 2WTKC 4PDYA 1PMEA 1DAYA 1IAHA 5M55A 5ANJA 2GS6A 5AP4A 5M09A 4V05A 4QQJA 4H58A 5B2LA 2BFYA 4U6RA 4ASXA 3GCSA 5EQEA 3DB6A 2ITQA 4Y72A 3UO5A 5IQCA 4ACCA 3I6WA 4F6SA 2CSNA 4PMMA 4YZCA 2CHLA 3NYOA 4JX7A 1BI7A 3FXZA 5EM5A 5C27A 2YJRA 5M4CA 3QWKA 4NFMA 3UIBA 3FSKA 5HLWA 4FIGA 4RJ6A 2GHMA 4IWPA 5EYMA 4KNBA 3O7LD 3GXLA 1MP8A 3NYXA 3VW8A 1OI9A 2CMWA 2X39A 4FL3A 4D2SA 4EOJA 2BZKB 3VBVA 4QP6A 4ITIA 3A99A 4O0VA 3F88A 2WPAA 3FMKA 5HZNA 2PE1A 4O7ZA 3QWJA 4EH7A 1O6LA 2F7EE 4YLKA 3L8XA 4JQ8A 1GZKA 2OXXA 3BYSA 3DBEA 4EK3A 3QX2A 5ETAA 1CM8A 1OBGA 3AC5A 4JT3A 5GINE 2RF9A 3QFVA 5I9UA 4C4EA 3TTIA 1XH8A 3BLHA 4QMXA 4L00A 5D9HA 3TDWA 3QTSA 5GJFA 1XKKA 2YZAA 3OBJA 4DG2E 1NW1A 2RG6A 3ZFMA 3UIUA 2XBAA 4F9YA 1YOMA 2VO3A 4M12A 3RHXA 2OH0E 2WO6A 3P9JA 4Q5HA 5CU2A 1NY3A 3UOLA 4CRLA 3HRBA 2R0IA 5AP5A 2PUNA 4GFOA 4IM2A 3V3VA 4QP2A 4AW5A 2VTAA 1YRPA 3WYXA 2V22A 5CEOA 5JGAA 3HL7A 3EFLA 3LM0A 3T3UA 3BYMA 3RPVA 4O7TA 2HWPA 3SXRA 3EJ1A 2FSOX 1U54A 3MFUA 3RTPA 4RSSA 1RQQA 3UC4A 3VBXA 1J7UA 2B0QA 4D28A 3MB7A 3NRMA 2I0YA 2QR7A 2G01A 5FTOA 5C8NA 3WF8A 2ITNA 2W17A 2XCHA 4XG9A 4IWDA 3NYVA 3KXMA 5F94A 2PVFA 5DFPA 4J95A 3WF5A 3MPAA 3UTOA 5AX3A 4G16A 5HNIX 2Z7SA 4XOZA 3P5KA 5HQ0A 2C1AA 2Y4PA 5C1QB 3LZBA 4IB5A 4BY9E 3NW6A 2ZM3A 3AC2A 4L01A 1U5QA 4A4LA 4KD1A 1Q24A 1WVYA 3WILA 3ORIA 5CSXA 3VS7A 3QCQA 3WF6A 1G8SA 4U8ZA 2FSMX 4RWKA 3BYVA 3M2WA 4NCTA 5CF5A 4F7NA 3TTJA 4C0TA 4USEA 4OR5A 5LVPA 4HCTA 3PPKA 4GCJA 2PUUA 4DFUA 1STCE 2B53A 2XZSA 2ITVA 3F3VA 4WSQA 3JVRA 5ANGA 3TZ9A 5KKRB 1RE8A 3PUPA 3E8EA 2PZPA 4XG7A 1YHSA 4LI5A 3VUHA 1H27A 4KIQA 4RWJA 3LQ3A 4EZ3A 4BB4A 2R3IA 4G5JA 4K77A 2W0JA 2RFSA 1Y6AA 3TUBA 2J51A 2QU5A 2QD9A 4DTBA 2VD5A 4U80A 4C3FA 4AN2A 1PXJA 3UE4A 4UWYA 1PKGA 4FSZA 4E4MA 5ANIA 3DCVA 3GGFA 3OWJA 3AD5A 4AP7A 5IISA 3QZHA 2JFLA 5IKWA 2XJ1A 4KINA 4O96A 4JAJA 4LUDA 4RWLA 1H01A 4BRXA 4KBKA 5GNKA 1XO2B 4EH8A 5KO1A 4CNHA 4BN1A 3WE8A 4AOIA 5AEPA 3U55A 4JG8A 3ZM9A 2IVVA 2ACXA 4RFZA 4DFXE 4NL0A 2B1PA 4DGOA 4E6DA 2XIRA 1B39A 3ZZWA 4V0GB 4AT3A 4FIJA 2NP8A 3C4XA 3FLYA 3SOCA 3SRVB 5FP5A 1WBOA 2GSFA 5FXRA 3DS6A 2KTYA 4G3FA 2CDZA 1OPLA 4NW6A 4WNKA 3TNIA 5A4LA 1UU3A 1AGWA 5TF9A 3OS3A 3TACA 3RWPA 4PY1A 3BYUA 2UW3A 3IW7A 1NVRA 4YJSA 4AA4A 4D2PA 4I93A 3UQCA 4BCQA 4LQMA 4N0SA 3NW5A 1CDKA 3BU6A 2NPQA 3ROCA 4F1OA 2ITYA 5AP1A 3H9RA 3I1AA 4EOOA 2E2BA 4J8MA 4JX3A 1YWRA 4GT4A 5TOZA 2YFXA 1WBNA 4F65A 3FUPA 3VBWA 4L68A 3D14A 3EN5A 2P55A 2QO9A 4ASEA 4CQEA 3NAXA 5KMKA 3BRBA 3SG9A 3SAYA 3NIZA 2RFNA 4FV6A 4ZJVA 4TWOA 2A2AA 5FM2A 3CTQA 5EQYA 5E8WA 1K2PA 2YAKA 5KZIA 3CEKA 4E6CA 4RLKA 4A9YA 1H00A 5D7VA 3EIDA 4BR3A 4GT3A 4QPAA 3CJFA 4ZMEA 4EOMA 3HUBA 2WMWA 5ITAA 1FQ1B 3R0TA 4H36A 4BI2A 4FV3A 1M7NA 4U43A 4BIDA 4R1YA 3R9OA 4NUSA 4AF3A 1R0EA 5IQFA 2ONLC 4UV0A 1L8TA 3ORXA 4PPBA 4DC2A 5I0BA 5L2SA 4DF3A 3Q9YA 2CGVA 4QP1A 4C4FA 1UVRA 4NM0A 3PLAE 4FR4A 2G9XA 3IK3A 4LMNA 2YA9A 3V5PA 4CFNA 2VX3A 1O6KA 2XP2A 4UWBA 2YDIA 1YDTE 3ZDIA 1Q8WA 2X8DA 2GQSA 1YHWA 3QTIA 4I5PA 3HX4A 2CJMA 4R6VA 1AQ1A 4NH1A 5ANEA 2UZTA 2PTKA 1WBVA 3LXPA 3MI9A 4RA4A 2HY0A 2WIHA 3BGQA 3DBFA 4YSJA 2PVRA 1QPDA 2QO7A 2JGZA 3QYWA 2OJGA 2GMXA 1OITA 4DEIA 3RGFA 4FEWA 2H6DA 3EHAA 4AT5A 4M0YA 5KNJA 2WMRA 4D1SA 5IA1A 4Q9ZA 4G6NA 2X9EA 4FVRA 3A7JA 3UC3A 4JL9A 4M67A 2W4OA 2W05A 3DKOA 3PP1A 4QYYA 3ZH8A 4I94A 1UA2A 3NYNA 4TYIA 4BVUA 4L7SA 4HYSA 4NT4A 3EKKA 4DINA 5T6KA 3UPZA 4FV8A 3MFTA 4FICA 4V0GA 3ZM4A 5E1SA 1LP4A 3LXNA 3GCVA 3SRVA 3VRYA 4AGDA 3D0EA 3A61A 4FEXA 3I79A 4ZY5A 5DNRA 4FKRA 4BZOA 1BLXA 1Q99A 2XK6A 2ERZE 3L9NA 3MPTA 4RFYA 4YBJA 4O7RA 3CD8A 5CALA 3F5UA 3QU0A 2QLQA 5I9XA 3D2IA 3F5XA 3ZSHA 2J9MA 2GCDA 2BAJA 3HECA 5DR6A 4BI1A 5FBNC 2OH4A 1QPJA 4XMOA 5CEKA 5AP2A 5IQAA 2XK3A 3WZDA 3A7FA 1YXUA 3OEZA 4FG9A 4B4LA 4M8TA 3LLTA 4QP9A 4DH7A 5BVDA 5EQPA 3MY1A 2XCKA 2WTWA 2X2MA 3OVVA 3LXLA 2H8HA 4RVMA 1KOAA 1M14A 3JXWA 1EH4A 3QQHA 1H4LA 4QQTA 3DLZA 5IA0A 2Y8OA 3L8SA 4S30A 2A27A 3FY2A 4AFEA 3MH1A 4KKHA 5B2KA 3UQGA 2C68A 3E5AA 4V04A 2J2IB 2BUJA 1ZY5A 4EOPA 4CXAA 4M84A 3V5LA 4BDFA 4JIAA 3W33A 3CBLA 3EN6A 2PK9A 2UZWE 5C9CA 3R8MA 5A9UA 4GIIA 5EKNA 5ICPA 3KXGA 2ZJWA 3OT8A 2XRUA 4M15A 1JVPP 5LOHA 4RT7A 4JOAA 3MFSA 4PL3A 4QMUA 3NUSA 3HAMA 3UP2A 2DYLA 3BV3A 3EOCA 4K2RA 3QA0A 4W8EA 2BDFA 3CKXA 5ETIA 3SVVA 1WVXA 2WTKB 4FKWA 3UVPA 1NXKA 2RG5A 1M7QA 2VTMA 5AAEA 4C38A 5HBJA 3FZ1A 4KIKB 4NCTC 1H1PA 5ACKA 2RKUA 3TKUA 3HZTA 2BIYA 4QMZA 4JJRA 3PRFA 3PY0A 4XP3A 3RINA 4D4VA 4DH1A 3H9FA 3WARA 4BKJA 3R1YA 2XKDA 3F3ZA 4X2KA 5EM8A 1UNHA 1YI3A 1FINA 3AT3A 2AC3A 3A8WA 3NNWA 4QMVA 3RPYA 4F09A 3R8PA 2CKOA 2JITA 3V5WA 3A2CA 3F3WA 5IA3A 1BYGA 2WTCA 1BL7A 3VC4A 3QD4A 4W9XA 3QKMA 3Q6UA 3VN9A 4BTFA 3FDNA 5E91A 5HOAA 5BVWA 1IA8A 3W55A 1Q97A 4XHKB 3GU7A 4XV1A 2C6EA 4YJOA 5TT7A 5HLNA 1ATPE 4AS0A 3PWDA 2UZOA 5H3QA 4O6EA 4RC4A 3R21A 4BWPA 4F7LA 3ZMMA 2XYUA 4PWNA 5AUVA 3DKCA 2XVDA 3QTXA 3I5ZA 3CPBA 1NVQA 4FV9A 2UW5A 3BBTB 2X8EA 3WOWA 4PNKA 3DQWA 2X1NA 1CKPA 3DKFA 2JDSA 2Z7QA 3LJ0A 3BE2A 4GVJA 4E6QA 5HU9A 1H8FA 4BC6A 3WI6A 4B99A 4BTJA 4MKCA 4E93A 1U5RA 2JDOA 3HYHA 1KE7A 3JR1A 5LVNA 2IZTA 3VO3A 3ZFXA 4FKGA 3P4KA 4YPSA 3U51A 2GFCA 3ORKA 4FTIA 3PZEA 5HBEA 3HV6A 5HICA 3ZRLA 1ZYLA 2P0CA 3WZEA 5D10A 4O38A 1PMUA 4FSRA 4G2FA 3RPRA 5KMMA 4GUBA 4Y5HA 2I7QA 2PMLX 3PLSA 4OLIA 3D5VA 4L52A 5AV4A 4ANOA 3HMPA 4KB8A 3S95A 2HK5A 4BZDA 5KZ0A 3DA6A 3DNDA 4U79A 3QRJA 4YJRA 4UMTA 4YJPA 5CX9A 4O83A 2FO0A 3NR9A 2FSTX 3O8TA 3R71A 1F3MC 3KK8A 4BBMA 3FLSA 4WSYA 1TKIA 2VWXA 2WTIA 3KVWA 5KHXA 4CVAA 1WMKA 4NFNA 3CXWA 5GJDA 3TNHA 4C57A 2VO0A 3NUXA 4KWPA 4ZZMA 2R3MA 5IEYA 5J1WA 3KMWA 4B8MA 4EC8A 1Y6BA 4HGTA 4L43A 1LUFA 3I0QA 4DH5A 5HCXA 1KUTA 2JIUA 4KIKA 5E7RA 4FTTA 3KQ7A 3KXNA 5L2WA 2PVJA 2FVDA 3LVPA 3VS5A 4CFVA 3R7EA 1OB3A 4K1BA 3BLRA 2QOLA 1Q8UA 3GQIA 4G3CA 4F9CA 4FKOA 1B6CB 1FMOE 4O82A 3WZJA 5CWZA 1G3NA 5JK3A 4WA9A 3TZMA 2O8YA 2OGVA 2VWIA 4JVGA 1H1WA 3MY5A 4K18A 2JIIA 4M7IA 3Q2MA 4BGQA 3ACKA 4IX6A 3DPKA 5C26A 4II5A 2RIOA 5M4IA 4L46A 3GBZA 2CN5A 4QTAA 3PXFA 3EZVA 4E5WA 4RFMA 5J9ZA 3BZ3A 4JLCA 4I23A 4YHJA 5CAOA 5KX8A 1OBDA 3SXSA 1P4OA 3R04A 3P79A 4X6RA 1SVEA 1OKZA 4QP8A 2WMXA 3W2QA 3WZUA 4N4SA 4BHNA 3B2TA 4X3FC 5FUTA 2UW9A 3R7VA 5IQDA 4LFIA 3BYOA 4GUEA 4FGBA 2W99B 3PJ1A 4MXZA 3GCUA 4DA5A 4MD8E 5ANDA 2CCHA 1K3AA 4RX7A 2ZV8A 4F7JA 4OBOA 4NK9A 4EOKA 1DAWA 4JR3A 2UW6A 4DN5A 5JFWA 5L2QA 5EW8A 4IWOA 4CT1A 2F4JA 4YGAA 4U3YA 4Y83A 4GW8A 4IAAA 3Q4ZA 1UNGA 1BKXA 4O0XA 5AA9A 2OJJA 3MTFA 4EH3A 3BQCA 3PVBA 4EORA 4KABA 2A19B 4C4JA 3UPXA 2C6MA 3EQDA 3QQUA 3W8QA 4O0SA 5M08A 4D0XA 3OY3A 2R3PA 3QD0A 4I21A 3BE9A 3U8WA 3ZLYA 2UZBA 3PDTA 4I0RA 4BDEA 3QRKA 4B9DA 4C2WA 1FVTA 2WELA 2W1FA 2W9ZB 3NPCA 2RSVA 2WMUA 3GB2A 3EL7A 4TWPA 3QLGA 4WUNA 2PVLA 2PU8A 3S2PA 2I0EA 2Y0AA 2YCQA 2FGIA 1UU8A 2I6LA 4IIRA 4JBVA 3DAKA 4MNEA 4U0IA 4UZDA 3NEWA 4YZNA 5LVLA 1OPKA 5HCZA 2O64A 3W8LA 3R8VA 2NO3A 2QOOA 2EVAA 4F08A 1U46A 4ANLA 3W2RA 3CIKA 2VWUA 3GENA 4YTHA 3S3IA 4TWCA 1JQHA 4CMTA 1YI4A 3P86A 3IGOA 5AV0A 5L8LA 4ANBA 3R30A 3BHTA 4GK2A 4M97A 2XS0A 3KRWA 4IZ5A 1GY3A 4GG7A 1UWHA 2R9SA 2W1EA 3NX8A 4LGGA 3UIMA 3FQSA 2PUIA 2HYYA 1Q4LA 5J7BA 4JG7A 2EWAA 3ZHPC 1SYKA 2C47A 4ZTSA 2OSCA 1FMKA 5J79A 3AD6A 3KN5A 4OUCA 1YXVA 4IX5A 5AFVA 1Y57A 5CZIA 1WAKA 2ZVAA 5G6VA 4J99A 5IA5A 4O7LA 3MPMA 1W84A 3UOHA 4FZFB 4Z7HA 2ERKA 5EDRA 5BVKA 2BDJA 2XMYA 4PL4A 2F49A 4TZRA 3PXYA 3TXOA 3FKOA 3NCZA 4WNMA 1YWNA 4FKPA 4AW1A 4J8NA 4O7NA 4RMZA 5CXHA 3TNWA 3ENMA 4FV5A 4AUAA 3B8RA 2W06A 3QA8A 4YURA 4L3JA 4HVHA 2BALA 4FKUA 3RBWA 4AZWA 3BHHA 1IR3A 3HP5A 3T9TA 4DGGA 5CF6A 1QL6A 5CU0A 3HV4A 1HCLA 3IKAA 2IZSA 4XEYA 4EQCA 3BHYA 5AR2A 1LPUA 1IAJA 3TUCA 1FOTA 3FXXA 2WMQA 4FNYA 4FTCA 3R00A 1IRKA 3DQXA 4K0YA 3ZYAA 1PMNA 4G6LA 5GJGA 4DBXA 4O27B 3BELA 3LHJA 5AMNA 3F5PA 4U41A 3DXQA 2WTJA 2BRGA 1OKWA 4ZSEA 4ZY4A 2WFYA 4ZXTA 4CCUA 4I6HA 4KBCA 4LRJA 5BQ0A 3DTCA 1GIJA 4ZTHA 2J0MB 4EHZA 3QLFA 5CAQA 1G8AA 1W98A 2BRMA 2F57A 4GVAA 4XS2A 2WTDA 4ZZNA 3R28A 1RW8A 3EQCA 2OJFE 5JFXA 3O8UA 2CPKE 2XEZA 2YDJA 3A4PA 3OXZA 2UUEA 2GNHA 3F7ZA 4D9UA 3HKOA 4ACHA 4UMRA 2QHNA 4ANMA 2WQMA 3C4FA 4PPAA 2ITTA 3MN3A 4FTUA 3P7AA 2HWOA 3OT3A 5CY3A 5DRDA 1BMKA 2YM7A 4DH8A 3QCYA 3U6IA 3QZGA 5CSWA 4M14A 3QKLA 2JAVA 4CV9A 5AUWA 3VIDA 1M17A 2I1MA 4U44A 4UXLA 2YDKA 2XKFA 3ALOA 2XBJA 5DVRA 4RWIA 4EHVA 3CQWA 2ITWA 3REPA 2G1TA 4PL5A 3NS9A 4CKJA 4TYJA 2NRUA 5L4QA 3I5NA 1OL2A 5KMIA 4BDAA 5FBOA 3LFCA 3LFBA 3U6JA 2IWIA 2ZYBA 4DEHA 4FSNA 1REKA 3KXHA 4ZSGA 2CN8A 5BMMA 4YC3A 2P4IA 3A7HA 2JBOA 2QOIA 3KKVA 3D94A 5AR8A 4ENXA 4FG7A 5IH5A 4QMYA 5DEYA 3SV0A 3MFRA 5JT2A 4BIBA 4B0GA 1NT2A 5AM6A 5HIDA 2H9VA 3SXFA 1A9UA 3ELJA 4CMOA 4F6WA 2R3GA 3E7OA 2ONLA 4X6QC 4CEGA 3IW5A 5EH0A 4FKLA 4C34A 3G6HA 2OU7A 5FTGA 3KGAA 5AV3A 5AP6A 2VUWA 4FOBA 5DRBA 4XCUA 3RKBA 3Q9WA 2J0KA 2I0HA 4PDSA 4QMWA 2R5TA 4JDHA 4RA5A 3EKNA 4I4FA 2QU6A 4DEGA 3ZO2A 3I81A 4FIHA 4P90A 2CLQA 1FVRA 5BPYA 5KHWA 5L2IA 3FQHA 2C5VA 2BTRA 1HCKA 1M52A 1R78A 4C62A 3BCEA 2YCRA 5K0KA 3QF9A 5A4CA 3FI2A 4CCBA 5BNJA 4QYFA 3CY2A 3FL4A 2WIPA 4X2NA 3NUUA 2YIQA 3IPHA 3FXWA 3EYHA 3LFNA 4R7IA 4EK4A 1E9HA 3E63A 3QCXA 1OIRA 2JKQA 3AQVA 2J4ZA 3LPBA 4BDGA 1W83A 4ACDA 5A6NA 4FV2A 3I0OA 4LL5A 4CKIA 4BYIA 5T68A 4GYIA 3Q32A 4WBOA 4J1RA 3SX9A 4FUXA 4XOYA 4EJNA 1UKHA 4I41A 5E8ZA 2XK7A 3ZOSA 2GDOA 4YTCA 5L2TA 4Q2AA 3QKKA 3ZC5A 3EQPA 3ZSGA 5CSVA 4TRLA 4EH6A 3HNGA 2C5YA 4MHAA 3LJ1A 3PJ2A 4NW5A 3SDJA 2ZAZA 4E4LA 3ID6C 4ALWA 4O84A 3QXPA 2C0OA 3VUKA 1R1WA 3TUDA 2VV9A 3TDVA 5J7HA 4IDTA 3CC6A 5AP0A 3TNPC 2J5FA 3CE3A 3L8VA 2UZLA 4YNOA 3OOMA 3CKWA 3VUMA 4FVQA 2YCFA 3FHRA 4DEEA 4C61A 2PYWA 1Y8YA 1Z5MA 2GTNA 4JNWA 2YLEA 4U40A 3L9MA 3MYGA 4AFJA 3C4ZA 4QMSA 3RPOA 4FV7A 3ZRMA 4U42A 2E9VA 2PWLA 3PZHA 4HNFA 4LRKA 4XX9A 4ACMA 4C7TA 1TQPA 4DHFA 4GK4A 4GEOA 2VU3A 2YISA 3MW1A 2HW6A 3ODZX 4QMOA 1PXPA 2J7TA 4MBLA 4X2JA 5HIBA 5J87A 3V8WA 4FEVA 3KB7A 3TL8A 4AZVA 3SGCA 1H07A 3R9HA 3TZ8A 4HYIA 3V6SA 5H9BA 4FGRA 2RFDA 4BCPA 5B0XA 3NNVA 4GU9A 2VTQA 1ZXEA 4O0TA 2PL0A 2IO6A 3QRTA 4UY9A 5F9EA 3UYTA 4EWHA 3DAJA 4RIWB 3Q9ZA 2HCKA 3Q4CA 2XB7A 5JQ8A 3PG3A 2UZVA 3FZPA 2WMVA 1ZRZA 4HZRA 4GKIA 1VZOA 1R3CA 2ZDUA 5AUUA 4CGAA 3CJGA 4Y95A 2O2UA 5DI1A 2R3HA 2PSQA 3RM6A 2QQ7A 4D2TA 5HORA 3NAYA 3JYAA 1WVWA 4AZSA 3CR0A 3EB0A 4F99A 4IB3A 5AV2A 2VWYA 4J96A 3EFWA 1Q5KA 3HAVA 5A3XA 2YIXA 2QOBA 4FKVA 3OBGA 5HTIA 2C1BA 5TKDA 2YZLA 2A4LA 2Z7RA 4QD6A 1V0PA 2WAJA 1T46A 1DS5A 5K3YA 5AA8A 5ANOA 4DBNA 3F69A 3PIYA 4IX3A 4KS7A 5DG5A 4FTNA 2H34A 3BWFA 4QO9A 4NJDA 4MNFA 4W4WA 4JDJA 4IADA 4CLJA 5JSMA 3COIA 5HO8A 4BKZA 4DGLC 2XK8A 3VUDA 4BCFA 4G3EA 4MXCA 1H1SA 3BLQA 2XM8A 5HVYA 4AG8A 3OW3A 3ACJA 2YIYA 3RCDA 2G15A 3K3IA 4IB0A 1VYZA 3V5TA 4DGNA 5LCKA 5IQIA 3QYZA 3FI4A 5CF8A 2C5XA 3NUAA 4ZSLA 4I20A 2WMSA 3VS0A 4EZ7A 4TNDA 4PF4A 3DAEA 2V55A 4ZK5A 3FHIA 3OUKA 4X3FB 3O50A 2B9IA 2C69A 5HO6A 3F3TA 3G9LX 3ORLA 3UVQA 4FL2A 1KE5A 4PMSA 3VW6A 3FQEA 3NCGA 4APCA 3N4UA 4YTFA 5I3OA 3TWJA 3S1HA 4XV9A 4K8AA 3ZC6A 3SOAA 3H0ZA 1FGKA 2UVXA 5DT4A 3PA3A 2Y6MA 4AXAA 5AUTA 4R3RA 3MS9A 2E9NA 2VWWA 3FMEA 3E8NA 4FK6A 4L3PA 3QTWA 4RZVA 3RPSA 4CYJA 2W1HA 3R9NA 5FM3A 3HV5A 2W7XA 2FB8A 3DY7A 1NA7A 3GU4A 4H3BA 4JQEA 4MF1A 5DR9A 4D4SA 3DBCA 4O2ZA 2FSLX 3L9PA 5BVFA 1MRUA 2HIWA 5DMZA 4OAVB 2EXCX 4FV0A 2C0IA 3FY0A 3LIJA 4EL9A 5AUYA 5HHWA 3PVWA 4K6ZA 4O0UA 4IZ7A 2GTMA 4AN9A 4A4XA 3DZOA 2BR1A 3ANRA 1A06A 2ETMA 4TYHB 5DHJA 2OZAB 4TNBA 5HU3A 4I92A 4WKQA 2O65A 3BU5A 3H10A 4O81A 3RNYA 4BDKA 3RALA 4Z16A 2BIKB 3FMMA 4RIWA 3P7CA 1GZNA 5HNGA 3ZLSA 1E1XA 4A06A 1KSWA 4MXOA 2BAKA 5AP7A 3VJNA 4JBQA 3HMOA 3FZTA 3O96A 4CQGA 4I6BA 4EKKA 2B9FA 2BILB 4GU6A 4HOKA 4X21A 4ZEGA 1TQMA 4WD5A 3WIGA 4TT7A 4AE6A 2XA4A 3HV7A 3D83A 5DT3A 1MRVA 4BICA 4D5KA 5JRQA 3FL5A 4IFCA 4IMYA 3DBDA 4YHFA 5JKGA 4YMJA 3WBLA 2OZOA 3OHTA 4FTLA 2REIA 3R9DA 3D4QA 4PDOA 3TKHA 4GMYA 1DI9A 3V04A 4XG3A 3MIYA 5KMNA 4UXQA 1H25A 3F3UA 4AW0A 1YKRA 1OUKA 5CZHA 4E6AA 3D7TA 4BDDA 5D41A 4QYHA 3KC3A 2IVSA 3BQRA 4U97A 4E1ZA 3DBQA 3UMXA 1GNGA 3ULIA 3F6XA 5BMSA 2XJ2A 3UZTA 2C6IA 5A54A 2BHEA 3A8XA 1J7IA 5L6OA 3IONA 4OAUC 3NMUF 4JBPA 2KULA 2E9PA 1V0OA 4UWCA 2QG7A 3QZIA 5LJJA 4KKGA 5F20A 2ZV9A 4EBVA 4ZS0A 3LMHA 2YM8A 4FIEA 3E87A 4C2VA 3C9WA 2YM6A 2CCIA 4CT2A 3EFJA 4DLJA 4F0FA 2C6LA 2P3GX 2F2CB 3OFMA 3OWKA 3LM5A 3VBTA 1KE6A 4X3FA 3AC1A 5ETFA 5CEQA 3K5UA 1FVVA 3R63A 3AT2A 4EI4A 3UDBA 2ZB0A 2X0GA 4EH9A 4F9AA 5EHOA 4JR7A 5CI7A 3QCSA 2YWPA 1S9IA 3PVUA 4TW9A 3ZDUA 4DTKA 3DKGA 4YPDA 3FMLA 4E8AA 4BF2A 5AAGA 2BHHA 2ITPA 2X2LA 3POZA 3TCPA 1REJA 1GJOA 4TL0A 2QOCA 2J0JA 2YWVA 4ZTNA 4FTMA 3ZEPA 1T45A 3P78A 4YJUA 3CP9A 5EYKA 3TJCA 4O86A 1W8CA 4FNZA 4QRCA 3QUPA 1IG1A 3O0GA 4OTRA 3V6RA 4EOIA 5IQEA 2QG5A 1UWJA 4I5CA 3KF4A 5CASA 3EFKA 4KKEA 4Z3VA 4TYHA 2QOFA 4WBBB 2OZAA 1H26A 2CLXA 2R7BA 3QRUA 4FUYA 4GYGA 4MTAA 3W2PA 5HLPA 2W1CA 5KUPA 4MX9A 4QT1A 5EW3A 3Q4UA 3B8QA 3CCNA 3F7WA 3KA0A 5J1VA 3WYYA 2WNTA 5IQGA 3JUHA 3HRCA 2BMCA 1VR2A 4EQUA 3R7IA 1B38A 1FPUA 5CAUA 5A14A 3E8CA 4RQVA 2PHKA 4IJPA 4QPSA 4RC2A 3II5A 4CFFA 4IVDA 4ZSJA 4OTWA 4EH4A 1W82A 1V1KA 3E62A 4ARKA 4AQCA 3U4WA 3CD3A 3AGLA 4P4CA 1SNUA 4IAKA 5I9YA 5LXMA 2HW7A 4HCVA 1OUYA 3EN7A 4W4YA 3ATSA 2ZB1A 1PXOA 4BTMA 2A1AB 2C5NA 5CVGA 4IX4A 4EOQA 2BPMA 2PE2A 5KE0A 4DFYA 3IG7A 4EHEA 4EK8A 4LV8A 4TYGA 3FAAA 1H24A 1VJYA 2JEDA 1CKIA 3P7BA 4OTFA 3FI8A 5AUZA 3HV3A 3AC3A 5CF4A 5L3AA 3U6HA 1ND4A 4FKSA 4P7EA 2C3IB 4EK5A 2GPHA 5BUIA 1M2RA 3VUIA 5JMSA 4HYUA 1FBNA 4GKHA 3JS2A 1JKSA 1ZLTA 4LOQA 3QX4A 5BVEA 3C4EA 3DDQA 1MQ4A 2IPXA 3OZ6A 4W4VA 5EHYA 3DFAA 3UZRA 2C6DA 1YI6A 4YJQA 3IDCA 4B8LA 2SRCA 3RHKA 3FEGA 5KMJA 3KVXA 4ZP5A 5FP6A 4FA2A 3COHA 5FLFA 4DFZE 3QTZA 3KY2A 3R01A 2A0CX 1BI8A 4R3CA 4ALVA 1YHVA 5AJQA 3BGPA 5IUGA 5LMBA 4CFMA 4QNAA 3LE6A 2VO7A 1WZYA 5D7AA 4L67A 3S00A 2WD1A 3NSZA 2PY3A 4RJ7A 4O7VA 3PSCA 5TR6A 3W1FA 5AIKA 2O63A 4ZLZA 4CTBA 4I1ZA 4R78A 3E8DA 2Y7JA 3NZ0A 5BUEA 5HX8A 4ORKA 2C0TA 5IQHA 2PZYA 3Q9XA 4AGUA 4XV3A 3AT4A 3EQRA 3OWPA 1CSNA 2X7OA 3NNXA 4F4PA 2BROA 4WIHA 2UW7A 4DCAA 5IEXA 1I09A 5FWKK 2VTJA 5HX6A 4I4EA 2IJMA 2G2FA 2W4JA 4C8BA 2R3LA 3FE3A 3QL8A 2RFEA 5CSHA 3TJDA 5BUJA 4FTOA 4KBAA 3PFQA 3QUEA 5M4UA 3MJ1A 3KMMA 3I7CA 4UBAA 2GU8A 3RVGA 2UW4A 2VN9A 3PPJA 3RP9A 1HOWA 1RDQE 5C4LA 3ZXTA 3BPRA 3FPMA 3SQQA 4ANNA 3PXZA 5L6WL 2VWVA 3PE1A 4H3QA 4I6QA 4CYIA 3VF9A 3MA6A 4YZBA 1GIHA 1Y91A 4YLJA 3V5JA 3LJ2A 2X2KA 5B2MA 5GIPE 3U9CA 5HCYA 2FYSA 4NM5A 4K11A 4L45A 2BCJA 1S9JA 3BV2A 5BYLA 1XBAA 3T8OA 3TT0A 4MVFA 4TXCA 3AMYA 3LW0A 4BGHA 4F6UA 4UMPA 1QPCA 3NDMA 3PVGA 5IUHA 4AZEA 5M4FA 1PMVA 4MNEB 4IAFA 1VYWA 2H96A 3DT1A 4AW2A 4FYOA 4F63A 4BDHA 4J52A 4C59A 4J7BA 4X2FA 3ZO4A 1AD5A 2FA2A 1WBSA 5AUXA 5H2UA 3S4QA 3UO6A 1E1VA 2DS1A 1SVHA 1ZYDA 2XIXA 3A7GA 4QYEA 5L8JA 4CZUA 2XNBA 3TEIA 2AYPA 5HI2A 2WOTA 4ERKA 4NU1A 4C33A 4FYNA 3UZPA 4IM0A 3Q53A 2P2IA 1TQIA 3MH2A 4RJ4A 3FMHA 4YZ9A 2JKKA 2OI4X 3AOXA 2W5BA 1Q8TA 3EQFA 4GV1A 4A9RA 3ERKA 3OEFX 2R7IA 3FKNA 5H8EA 3CQUA 3LOKA 3R7OA 3RK5A 4MK0A 4FKQA 4LGHA 1QCFA 5I9WA 4U5JA 2C3LA 4DG0E 2VX1A 1H1RA 4NIFB 3C0IA 3UJGA 3E88A 2JDRA 5AR3A 4ERWA 5I4NA 2VRXA 3C4WA 4P5ZA 5KMOA 4DGMA 1Z57A 3LFFA 2Z7LA 2JC6A 4JAIA 2C6TA 4NTTA 4ONAA 4R5YA 4ITJA 1PYEA 3OCTA 3QC9A 4IFGA 4B7TA 5KKRC 4AT4A 3L1SA 4G3GA 3FYKX 2R3FA 2B7AA 3TG1A 4MQ2A 4ZLYA 2XRWA 3EWHA 5JFSA 4ZAUA 3LCKA 4LGDA 4YJNA 3ORZA 3KXZA 2XNMA 3DDPA 4Z7GA 3QQFA 5B7VA 4NKSA 2GHLA 2VNYA 1NVSA 3VF8A 3MH0A 3UIXA 4IM3A 4Q9SA 2OJIA 3VBQA 2BZHB 2QNJA 3PSBA 4L44A 5CXZA 5AIRA 4IAIA 3THBA 2CNVA 1JSTA 2OICA 2RL5A 2YM5A 3EH9A 4JRVA 4FODA 1M2PA 3NWWA 4BI0A 4BDBA 4AU8A 3EN4A 5E1EA 5LWMA 4KIOA 4UMUA 3MVMA 1DI8A 1R0PA 2WU7A 5EG3A 4Z55A 4GJ3A 4P5QA 5CS6A 2ITOA 4F7SA 5K5NA 5M56A 4IDVA 1X8BA 4AN3A 2WMBA 4KSPA 4AOTA 2YIRA 2Q0NA 3ZLXA 3O8PA 4FKIA 4FT5A 2QVSE 1Q61A 4PMTA 5FD2A 1Q8ZA 3QD3A 5E9EA 4IW0A 3Q52A 3PJ8A 1PXKA 4Z9LA 2I40A 4IZYA 3OMVA 1OMWA 5AADA 1GZ8A 2JFMA 3G0FA 3MH3A 4GH2A 4UYNA 4NWMA 3FBVA 1JKLA 2HY81 1XH5A 3O71A 3PP0A 5HG5A 3A60A 4GL9A 2WQEA 2VTPA 4OBQA 2BKZA 4EEVA 4FEQA 1ZMWA 4LOOA 1QMZA 2WEVA 3FLWA 4WUAA 1XR1A 3DNEA 5EDQA 2GS2A 5HKMA 5DLSA 3VNTA 4D55A 2XH5A 4FMQA 5JGBA 3G15A 2WTVA 2X6EA 3MBLA 2OBJA 4ASDA 5FTQA 3PWYA 5DOSA 4FV1A 4OTGA 4U9AA 4RVLA 3UBDA 3BKBA 4XH6A 1YDRE 1OECA 3TN8A 3UNKA 4L3LA 4H05A 4S2ZA 2R3JA 3UVRA 5JGDA 2DWBA 5HVKA 4LUEA 2J0LA 4L6QA 3QQGA 2OFUA 3N51A 4PTGA 4M68A 3DB8A 4C35A 2F7ZE 2VO6A 3CSVA 3PG1A 3IW4A 3HRFA 4S33A 3ORMA 4RIYA 5FXQA 4UX9A 4J98A 2OIBA 3R8UA 2YM4A 3LQ8A 4NIFA 4DEDA 2IVUA 2GNJA 1SMHA 3C5UA 4PQNA 4RVKA 4ZOGA 3AGMA 4DT8A 3UOKA 5HVJA 3PA4A 3M42A 1YXSA 2WB8A 3AXWA 4AZTA 5CQUA 4UEUA 4NYEA 4UYAA 4BYJA 5GZ8A 4WOVA 4E3CA 4EYJA 2VTLA 3SW7A 3POOA 4C3RA 2CGUA 5L6PA 3RAHA 4WNOA 3RK7A 2Q0BA 3CTHA 4K33A 2R4BA 4YJVA 1OPJA 2P2HA 4OT5A 3LQ5A 4AACA 4FOCA 4U45A 2BZJA 1LEWA 2UZEA 4GT5A 2Q83A 3N4TA 3HVCA 4DT9A 2ZM4A 1MUOA 4TN6A 3DJ6A 3MJ2A 3QAME 3QD2B 4G9RA 4AA5A 3R7UA 3CLYA 5BYYA 1ZARA 3VQHA 3LXKA 2XF0A 2B52A 5E90A 1OM1A 4FSTA 3LFAA 3CTJA 4DE4A 4QNYA 3TV4A 4YHTA 4BZNA 4PX6A 3QTQA 2DQ7X 2VWZA 4G17A 5CQWA 3OXTA 3I7BA 3VHKA 5CSPA 3MA3A 2VTNA 4C4HA 2O3PA 4UALA 5C8MA 2OO8X 2VAGA 3C7QA 4GRBA 3BGZA 5E8UA 3ZBXA 4X2GA 1O9UA 4R7BA 3ZCLA 5J5SA 2ZM1A 1SVGA 2XIZA 5AX9A 2EUFB 4WO5A 4O7SA 2V5QA 2X9FA 2OW3A 2PMNX 3PY1A 4RIXB 3PTGA 5FGKA 2B9JA 3G5DA 1PY5A 4EYMA 4O0WA 4IJ9A 2YABA 2QODA 4MQ1A 4UZHA 2XIYA 4M3QA 4WG5A 3W32A 3MVLA 2C30A 3GU5A 3HLLA 4MXXA 2ZV7A 4BBFA 3ZLWA 2CKQA 1CTPE 3E3PA 4HVSA 4ZY6A 5M57A 1KWPA 4D4RA 1P5EA 3AMAA 3MIAA 1J91A 4HGLA 4E4XA 1M2QA 3GC7A 3HDMA 2X7GA 4CFXA 4D1XA 3ITZA 4MYGA 3UG2A 3IECA 3R7GA 4BTKA 4PPCA 2BRHA 3M11A 2YHVA 3DXPA 3CGFA 3DLSA 3W2SA 5CEPA 4QPMA 1LEZA 5KMLA 2OFVA 3KRXA 2YLFA 2XNOA 4I24A 3ZONA 1U59A 3RJCA 3ZTXA 4XG6A 3DK7A 4E5AX 3IOKA 5I3RA 3K5VA 2QKRA 4ENYA 2X4FA 3VVHA 3ZO1A 4ZMFA 1JOWB 1U4DA 4XLVA 4S34A 4IACA 4LM5A 3FLNC 3IQ7A 3TIZA 2GNIA 3BBWA 4EUTA 5FDPA 4ZIMA 3BHUA 3QALE 1H28A 3KRLA 5DR2A 5CT0A 5FEQA 4BCJA 3FC1X 5HO7A 4FK3A 1Q8YA 4HPUE 3NVKI 4ACGA 4N6ZA 4U7ZA 4OTPA 2PZIA 3RAKA 3LFEA 3H9OA 1XH6A 4XG8A 3C5IA 3LMIA 4GK3A 2O5KA 3FPQA 3W18A 4BCMA 2WHBA 5D12A 2BZIB 1Q3DA 3A62A 2Y9QA 1YOLA 4ZSAA 4IB1A 4LV5A 3R2BA 3EN9A 2CKEA 4J71A 2BKKA 1R39A 4IE9A 4TY1A 1IASA 3ZUTA 3ROYA 3LAUA 2GFSA 4R3PA 5DN3A 3D5UA 2EB2A 4GFMA 1P14A 2B4SB 4WT6A 5CNNA 3DOGA 5TE0A 3VRZA 3QBNA 3VS4A 1MQBA 3Q4TA 2IW6A 4OTIA 4QQCA 4ANQA 4H39A 4BDIA 3Q2JA 2GHGA 1JAMA 4EOLA 2HENA 2QURA 2W96B 3EL8A 4FTAA 5AAFA 4F64A 1P4FA 1TVOA 1Q3WA 4YZDA 3UO4A 4Y8DA 4CTCA 2OK1A 1YVJA 5LCJA 4O0RA 2BFXA 3PY3A 3D5XA 4JI9A 5CANA 4RRVA 3ZZEA 2ZMDA 2PVNA 5A46A 3SHEA 4ZS4A 1XH9A 3VAPA 4G34A 4PUZA 4GIHA 3WF7A 4TTHB 2VNWA 1GZOA 1Q41A 2YCSA 3A7IA 2C3JA 2PZ5A 5ETCA 4AOJA 3QQJA 4RIXA 5CAPA 4IH8A 3ZRKA 2W4KA 3FC2A 4E73A 1JKTA 5IDPA 2JKOA 2YIWA 5IA4A 2VTSA 3O23A 2C4GA 5J9LA 1YWVA 3L8PA 3FV8A 4ZJIA 5IDNA 4IANA 3BI6A 3PJCA 5HE1A 3SD0A 4D9TA 5JFVA 1WBPA 4OTQA 3EQBA 1H0VA 4IZAA 4RJ3A 5CT7A 4YO6A 5D11A 2GNGA 3HMNA 3QTRA 4CZYB 4QMQA 3HMMA 4JG6A 5DIAA 4QMPA 3RMFA 3C13A 2YAAA 5CYIA 4FTJA 4H3PA 2PZRA 3K2LA 3IS5A 3RAIA 3GFEA 5IG1A 1JSVA 2GQRA 4RVTA 4Q5EA 5DPVA 4YZMA 5F4NA 4X7QA 4XBRA 1OVEA 2B54A 3GU8A 4O91A 1UU9A 2XIKA 5EDPA 3R7YA 3NUYA 4XUFA 4PP9A 2BVAA 1FGIA 4BFMA 4APPA 3GNIB 1PXNA 2HOGA 3LFDA 3TKIA 4XNEA 4B6LA 3FLQA 1KOBA 2F9GA 5E8YA 4EWQA 1OIYA 3R02A 2J6MA 3H0YA 4S32A 3ODYX 5D1JA 3IOPA 5CI6A 5ANKA 3CPCA 3NUNA 1A48A 4NSTA 3D7TB 4YUQA 3P23A 4OW8A 5F95A 5HE3A 3G9NA 2B55A 4CV8A 2AUHA 2AC5A 5DA3A 2OLCA 3LCTA 3SA0A 3DZQA 4GSBA 4R77A 3C51A 4BL1A 5GHVA 5HG7A 4FT7A 3ZXZA 4ZLOA 4R5SA 2Z60A 4D4YA 2ZV2A 4GS6A 3OC1A 3KMUA 2CNQA 5C4KA 4D0WA 2WKMA 3ANQA 4H1MA 3R1NA 4C4GA 2FUMA 3COKA 3DGKA 2UV2A 2WQBA 4JDIA 5CVFA 3D15A 2X6DA 1PYXA 3KULB 4F9WA 4E5BA 3MGYA 3SW4A 2GQGA 4FL1A 2PUPA 5E4HA 3NGAA 2WQNA 4BCNA 1WCCA 1PXIA 4AAAA 4JS8A 4BBEA 3F2NA 4F1TA 5A4QA 5LQFA 5IPJA 2E9OA 1PRYA 4WRGA 4D5HA 3BEGA 4IHPA 2HZIA 4QP7A 5AR7A 4IVCA 3BHVA 3UMWA 4BHZA 5DGZA 5GIOE 1JWHA 3I60A 5BVOA 3T9IA 2ETKA 4FV4A 4U3ZA 5KCVA 5E8SA 3LCDA 3QXOA 4CSVA 4XV2A 4HVDA 3R83A 3GOKA 2R0UA 4L8MA 4USFA 5LMAA 3KXXA 4E20A 3QQKA 1SNXA 2OJ9A 5J5TA 4JQ7A 4FTRA 4L42A 3AC8A 3EQHA 3IGGA 4MAOA 3PXKA 3GU6A 3HA6A 4I5HA 4XRLA 3ZS5A 4DG3E 4NKAA 4NEUA 1H1QA 4L7FA 4WHZA 5IUIA 4DYMA 3AMBA 5EHLA 4DH3A 2R3RA 1W7HA 3MV5A 4JXFA 1J1BA 4O7YA 3MESA 3PJ3A 4ITHA 3EQIA 4E26A 3WIKA 2YEXA 2OXDA 4CKRA 2VZ6A 3ORTA 4HNIA 5IMXA 2V7AA 3OROA 3V8SA 3R9RA 2R3KA 5CNOA 1XQZA 4MXYA 3C0GA 4XG4A 2YERA 4IVAA 4F0GA 3IDPA 3QQLA 2VTHA 3RCJA 4FZ7A 4GG5A 2W9FB 5EI2A 4E7WA 4X0MA 3UGCA 5I5ZA 5HG9A 3LMGA 1WBTA 4EH2A 4FBXA 1WBWA 4O2PA 2VTOA 4M13A 4RX8A 1CMKE 2ESMA 3Q5IA 4MD7E 4MF0A 3KN6A 3UYSA 4MWHA 3F2RA 4G5PA 2J0IA 4MCVA 1H08A 3GC0A 3JY0A 3V8TA 3VS1A 5AP3A 5LMKA 4MBJA 3PA5A 5J9YA 5HBHA 4QTDA 3O2MA 4G1WA 4U81A 2I0VA 5HE2A 4CRSA 3AC4A 4BCHA 3G33A 4FNWA 2X81A 2UW0A 1OIUA 2HELA 2BDWA 4IAZA 4LRMA 4RX9A 5E92A 3M1SA 1APME 5JH6A 1QPEA 3LFQA 5CU3A 1JKKA 3CGOA 5T3QA 4CG9A 2UVZA 2Y4IC 2BTSA 3KU2A 3GOPA 3R1QA 1I44A 4YJTA 5CEMA 3FSFA 4PTCA 4I0TA 3FWQA 5JZJA 2X8IA 4G31A 3QUDA 3SG8A 3VS2A 2VTRA 1OL7A 1L3RE 1LR4A 4RG0A 3TZ7A 2VGOA 3RAWA 2Z8CA 3KULA 4FZ6A 4JIKA 1JPAA 5DH3A 3KEXA 3PXQA 4MXAA 2QOKA 3FKLA 3IW6A 5M44A 5HESA 3VULA 2WMAA 3FYJX 1CKJA 3ALNA 4EUUA 4R1VA 3QHWA 3IDBA 1JBPE 3WE4A 3W16A 2QLUA 3DXNA 4FT3A 4HCUA 4LG4A 1KV1A 2XNNA 5A4EA 3U54A 3HP2A 1ZWSA 3BX5A 3NW7A 4XRJA 2JLDA 3B2WA 4LMUA 1H0WA 2W5AA 2V0DA 5A6OA 3QC4A 3QRIA 4KUJA 2JDTA 3QZFA 4N6YA 5EFQA 3VQUA 4F0IA 5IH4A 2J5EA 4FNXA 2W1IA 3IO7A 4LL0A 5ACBC 3F9NA 4CZTA 5J95A 1URWA 4FKJA 2C3KA 2XEYA 2XUUA 4OGRA 3F2AA 4DAWA 3ENHA 1GOLA 3KK9A 4DFBA 1PJKA 3OF0A 2B9HA 2PVMA 4IC7A 2C6KA 4BCGA 2XNGA 2WEIA 1F0QA 4C58A 5J8IA 3FZSA 1WFCA 2R3NA 3RWQA 2J90A 4PRJA 2QONA 4EKLA 4G3DA 3ETAA 2G2HA 3FI3A 5JQ5A 3G2FA 3VUGA 4GFGA 3I4BA 4Y85A 2ZMCA 2UZUE 1ZYSA 4KAOA 4A9SA 4BDJA 1SM2A 4OTHA 3GEQA 4L53A 5FEDA 2YACA 4YTIA 3RK9A 1J3HA 4QTCA 5FXSA 1W0XC 2GNFA 1PXMA 3O7LB 2W5HA 4BKYA 3ZBFA 3ZO3A 4UN0C 3F82A 5IZFA 4EBWA 3MWUA 5BX0A 1ERKA 2VX0A 1DM2A 4CMUA 2J50A 4OT6A 2WOUA 2HZNA 3TIYA 3GCPA 3I6UA 4FVPA 3HEGA 4HYHA 1K9AA 4DFLA 4YBKA 1P2AA 4OBPA 3KCKA 3KL8A 4D2RA 5IMEA 3F61A 1XJDA 2V7OA 2VTTA 3Q96A 4FE2A 2UVYA 3G6GA 3LLAA 4O22A 2IG7A 4AX8A 2IVTA 3PYYA 2IZRA 1ZOGA 5EOLA 3LKMA 2JIVA 2QI8A 3D2KA 1UKIA 2CGWA 2OG8A 3PIZA 4FSYA 2HZ0A 1XH4A 4K9YA 3KREA 4ID7A 3RZBA 3VUTA 4USDA 5LARA 2G2IA 5JN2A 3Q04A 3VBYA 4AWIA 4YU2A 1XWSA 4JDKA 4FSMA 5F1ZA 3TI1A 1IA9A 2LGCA 4KS8A 4BCIA 3GCQA 3QTUA 2P33A 4MBIA 2R64A 3OD6X 5E8XA 4J97A 4NM3A 4MEDA 2IW9A 2XNPA 1ZY4A 4AGCA 4HVGA 4H1JA 1URCA 2PVYA 4ZTMA 2JD5A 3U4UA 4NM7A 3OUNB 4A9TA 4IEBA 5IQBA 3W10A 4CLIA 1KV2A 3VS6A 4EONA 4HPTE 5JEBA 3OG7A 4QP3A 4M0ZA 4CFWA 5BVNA 4BCKA 4I22A 5G1XA 4IBMA 4WNPA 3R22A 5HG8A 3MDYA 5FRIA 2YITA 3GT8A 1J7LA 2BRBA 2XM9A 1VEBA 3A4OX 5A4TA 1PKDA 5EI6A 4QMTA 2IN6A 4AE9A 3NVMB 4JBOA 4TWNA 5M51A 4TYEA 2F2UA 2W1DA 4G9CA 3GFWA 2PVKA 4I5MA 3UQFA 3RZFA 4NJ3A 4C3PA 2NNWB 4ZZOA 5CVHA 3FMNA 3G90X 5LVMA 1MRYA 5IU2A 1OZ1A 2ZDTA 4RBLA 2Y6OA 4D2WA 3DTWA 3JY9A 3EYGA 4FT9A 4RJ5A 3L9LA 4RGJA 2E9UA 4EHGA 4FSQA 4S31A 4FSWA 1XBBA 5IH6A 3EZRA 3HMIA 4HJOA 2RGPA 3F5GA 3E7VA 2LAVA 4ALUA 1OKVA 3NNUA 5HNBA 4BCOA 5HTBA 2DUVA 3R8ZA 4X3JA 2OWBA 2QOHA 5DE2A 3VS3A 5K0XA 4I0SA 3N4VA 2HZ4A 3NUPA 2R3QA 5FQDC 5HE0A 1OL5A 3JPVA 1JLUE 4Y5QA 1UU7A 2XK9A 5HEZA 4FIFA 3W2OA 4CG8A 2OKRA 3C0HA 3U87A 3V51A 1ZAOA 4IVBA 4KIPA 4W8DA 4FG8A 5EOBA 3QGWA 2R3OA 2XKEA 5DBXA 5LMKC 3DFCB 4QTBA 4RIOA 5K4JA 3FZRA 2QCSA 4FSUA 2XNEA 3UODA 5IEVA 3ORPA 2HXQA 2OIQA 3PIXA 4ZTLA 4RIYB 5GZAA 4A07A 3AG9A 3MVJA 1UNLA 4G6OA 2R2PA 4I3ZA 5FG8A 3KFAA 4QYGA 2QO2A 2OIDA 2JAMA 4F70A 3P1AA 3ZUUA 4XP2A 4BIEA 1XBCA 3BWJA 2Z2WA 4ZJJA 2EXMA 4QMLA 3K54A 4BDCA 3PPZA 4RZWA 3TV6A 3PSDA 3H4JA 1F5QA 5L8KA 2OF4A 3GC9A 4A4OA 3FMJA 4L9IA 3Q6WA 5EM6A 5EYCA 4M66A 5FDXA 4C02A 4C37A 4YC6A 4TKSA 4DTAA 1G5SA 2PMIA 2W1ZA 1BX6A 1OIQA 4PNIA 3EQGA 4HGSA 3O51A 5HIEA 3ULZA 4UB7A 1KE9A 2NRYA 2XJ0A 4PDPA 3D9VA 2IW8A 4DCEA 4W9WA 2C5OA 3NLBA 2BAQA 2UW8A 3Q60A 1XH7A 3C1XA 5EYDA 5H8BA 3CQEA 3LCOA 3VHEA 3WZKA 3ZU7A 2VGPA 3ET7A 3KRRA 5JRSA 4EJ7A 5HD4A 4AA0A 1OL6A 4FIIA 3GQLA 3OTVA 5DT0A 3R73A 5C03A 3ZUVA 4I6FA 2PMOX 3UNZA 3Q3BA 2XYNA 3WF9A 5CEIA 4XP0A 4XJ0A 2OXYA 3O17A 4MH7A 1ZMVA 5M07A 4KRCA 2JDVA 3D5WA 4DFNA 4RPVA 3CS9A 3OOGA 1UV5A 5KBQA 3VJOA 2F7XE 4W4XA 4LOPA 5HD7A 4XBUA 2YM3A 3Q5ZA 1IEPA 4M69B 5C8KA 4F1MA
chains in the Genus database with same CATH superfamily
4HVIA 3GC8A 5EM7A 2XK4A 4A9UA 2YJSA 3BIZA 2PULA 4O1PA 4NTSA 3G51A 3H3CA 4FI1A 1JNKA 1PHKA 4P2KA 3SLSA 3V5QA 2OF2A 3GVUA 2X4ZA 1PF8A 3OWLA 3FJQE 4O0YA 3PE2A 4RC3A 4N70A 1YQJA 3ZFYA 1ZOEA 3DJ5A 3SC1A 3P08A 5GZ9A 3W2CA 5CENA 4FX3A 4CD0A 1ST0A 2QR8A 1ZYCA 4D2VA 5C01A 4EK6A 4F9BA 4PP7A 5DYJA 3R1SA 5EK7A 4QOXA 1GIIA 4DEBA 1XHAA 4MD9E 3HGKA 4YSMA 1PXLA 3GUBA 4YNEA 3E92A 5AR4A 3UP7A 2ITXA 5KBRA 4FKTA 4RQKA 1V0BA 4Y46A 5AR5A 4BGGA 3R2YA 3QGYA 4AZFA 4LYNA 4JRNA 3G0EA 5HGIA 4OTDA 1RJBA 4FT0A 2O0UA 4XLIA 3C50A 4E4NA 3OXIA 1Y8GA 1Z9XA 4YO4A 4QQ5A 5CU4A 3RM7A 1ZZ2A 4EQMA 4O7WA 1JSUA 5BYZA 3TNQB 3DV3A 4Y73A 4IWQA 3MSSA 5EW9A 4O21A 3U9NA 4QTEA 3OW4A 4AGWA 2Z02A 3DU8A 1J1CA 3OY1A 1Q62A 2Y4IB 4WG3A 5LWNA 3S0OA 1YW2A 4D1ZA 3BEAA 2JKMA 4FTKA 4HZSA 4FC0A 5JZNA 5IA2A 4PMPA 3OP5A 3OCGA 2WGJA 4EH5A 2GNLA 3MVHA 3C4CA 3UNJA 4HW7A 2PVHA 4HGEA 3CY3A 2C6OA 3FZOA 4R8QA 4V01A 1BL6A 1O6YA 4IAYA 5EKOA 3T3VA 4A7CA 2ZOQA 3DJ7A 4O1OA 2CNUA 1YOJA 3MTLA 2BRNA 5CU6A 4C36A 4DEAA 2CKPA 3ATTA 1OL1A 2GS7A 3COMA 1YXTA 3AD4A 2EB3A 1ZYJA 3R6XA 4KA3A 5E8TA 4D58A 5LVOA 4EC9A 1OGUA 2ETRA 4GJ2A 3GP0A 3KF7A 4KRDA 2V62A 3KCFA 1ZMUA 5I9ZA 3D7ZA 3H30A 4IQ6A 4FEUA 2ITZA 4KSQA 3N9XA 4YC8A 2XKCA 4XYFA 3LFSA 1YDSE 4FTQA 3NIEA 2QHMA 5AV1A 2UZDA 5HTCA 2X7FA 5I9VA 4BWXA 4FF8A 2WXVA 4IC8A 3ZEWA 4PTEA 3RNIA 1PW2A 4N57A 2EXEA 3GI3A 3TM0A 4O6LA 3KRJA 5DWRA 3NFFB 4M69A 3R8LA 3OTUA 2PE0A 4UMQA 2W1GA 4MWIA 3SKCA 4C4IA 5DEWA 1ZZLA 2WMTA 4WG4A 4DLIA 4RLLA 4FZAB 4PV0A 3ORNA 2YN8A 1SZMA 3EMGA 2IEWA 5FEEA 4YP8A 5K9IA 5EI8A 4ASZA 1YXXA 5M06A 3HUCA 2FH9A 3MY0A 5TO8A 2EU9A 1OKYA 4J53A 5M53A 4IXPA 5CLPA 2HXLA 3OCSA 3HA8A 4TPTA 2HAKA 2WU6A 4BWKA 4DITA 4ZTRA 4WRSA 3QHRA 3PRIA 4RJ8A 3OCBA 1BUHA 3BU3A 3TV7A 2QC6A 2WQOA 3JVSA 3VWAA 2PPQA 2WZJA 5AM7A 3UG1A 5K4IA 4CFUA 3P0MA 4R7HA 5CAVA 4EOSA 5IF1A 1U54B 4NZWB 3FMDA 3ZSIA 3E64A 1GAGA 3DK6A 3E3BX 5CTPA 4EZ5A 1ZOHA 2QOQA 5K5XA 2JBPA 5E8VA 4ZTQA 2VWBA 3E93A 5H8GA 4YR8A 3F66A 4QMMA 3PXRA 4YLLA 2ITUA 2IZUA 2QKWB 3LCSA 4ANSA 3FLZA 4QP4A 4RX5A 1KE8A 3MB6A 3HDNA 3RI1A 4FZDB 3V01A 4XG2A 5AWMA 3W0NA 4BJJB 3DK3A 2CGXA 3UOJA 2UZNA 4QMNA 3IW8A 3K3JA 2VTIA 2WTKC 4PDYA 1PMEA 1DAYA 1IAHA 5M55A 5ANJA 2GS6A 5AP4A 5M09A 4V05A 4QQJA 4H58A 5B2LA 2BFYA 4U6RA 4ASXA 3GCSA 5EQEA 3DB6A 2ITQA 4Y72A 3UO5A 5IQCA 4ACCA 3I6WA 4F6SA 2CSNA 4PMMA 4YZCA 2CHLA 3NYOA 4JX7A 1BI7A 3FXZA 4QDEA 5EM5A 5C27A 2YJRA 5M4CA 3QWKA 4NFMA 3UIBA 3FSKA 5HLWA 4FIGA 3BLAA 4RJ6A 2GHMA 4IWPA 5EYMA 4KNBA 3O7LD 3GXLA 1MP8A 3NYXA 3VW8A 1OI9A 2CMWA 2X39A 4FL3A 4D2SA 4EOJA 2BZKB 3VBVA 4QP6A 4ITIA 3A99A 4O0VA 3F88A 2WPAA 3FMKA 5HZNA 2PE1A 4O7ZA 3QWJA 4EH7A 1O6LA 2F7EE 4YLKA 3L8XA 4JQ8A 1GZKA 2OXXA 3UDSA 3BYSA 3DBEA 4JMQA 3W0QA 4EK3A 3QX2A 5ETAA 1CM8A 1OBGA 3AC5A 4JT3A 5GINE 2RF9A 3QFVA 5I9UA 4C4EA 3TTIA 1XH8A 3BLHA 4QMXA 4L00A 5D9HA 3TDWA 3QTSA 5GJFA 1XKKA 2YZAA 3OBJA 4DG2E 1NW1A 2RG6A 3ZFMA 3UIUA 2XBAA 4F9YA 1YOMA 2VO3A 4M12A 4O4EA 3RHXA 2OH0E 2WO6A 3P9JA 4Q5HA 5CU2A 1NY3A 3UOLA 4CRLA 3HRBA 2R0IA 5AP5A 2PUNA 4GFOA 4IM2A 3V3VA 4QP2A 4AW5A 2VTAA 1YRPA 3WYXA 2V22A 5CEOA 5JGAA 3HL7A 3EFLA 3LM0A 3T3UA 3BYMA 3RPVA 4O7TA 2HWPA 3SXRA 3EJ1A 2FSOX 1U54A 3MFUA 3RTPA 4O4CA 1RQQA 4RSSA 3UC4A 3VBXA 1J7UA 2B0QA 4D28A 3MB7A 3NRMA 2I0YA 2QR7A 2G01A 5FTOA 5C8NA 3WF8A 2ITNA 2W17A 2XCHA 4XG9A 4IWDA 3NYVA 3KXMA 5F94A 2PVFA 5DFPA 4J95A 3WF5A 3MPAA 3UTOA 5AX3A 4G16A 5HNIX 2Z7SA 4XOZA 3P5KA 5HQ0A 2C1AA 2Y4PA 5C1QB 4BJJA 2IF8A 3LZBA 4IB5A 4BY9E 3NW6A 2ZM3A 3AC2A 4L01A 1U5QA 4A4LA 4KD1A 1Q24A 1WVYA 3WILA 3ORIA 5CSXA 3VS7A 3QCQA 3WF6A 1G8SA 4U8ZA 2FSMX 4RWKA 3BYVA 3M2WA 4NCTA 5CF5A 4F7NA 3TTJA 4C0TA 4USEA 4OR5A 5LVPA 4HCTA 3PPKA 4GCJA 2PUUA 4DFUA 1STCE 2B53A 2XZSA 2ITVA 3F3VA 4WSQA 3JVRA 5ANGA 3TZ9A 5KKRB 1RE8A 3PUPA 3E8EA 4DHIB 2PZPA 4XG7A 1YHSA 4LI5A 3VUHA 1H27A 4KIQA 4RWJA 3LQ3A 4EZ3A 4BB4A 2R3IA 4G5JA 4K77A 2W0JA 2RFSA 1Y6AA 3TUBA 2J51A 2QU5A 2QD9A 4DTBA 2VD5A 4U80A 2XARA 4LV7A 4C3FA 4AN2A 1PXJA 3UE4A 4UWYA 1PKGA 4FSZA 4E4MA 5ANIA 2XALA 3DCVA 3GGFA 3OWJA 3AD5A 4AP7A 5IISA 3QZHA 2JFLA 5IKWA 2XJ1A 4KINA 4O96A 4JAJA 4LUDA 4RWLA 1H01A 4BRXA 4KBKA 5GNKA 1XO2B 4EH8A 5KO1A 4CNHA 4BN1A 3WE8A 4AOIA 5AEPA 3U55A 4JG8A 3ZM9A 2IVVA 2ACXA 4RFZA 4DFXE 4NL0A 2B1PA 4DGOA 4E6DA 2XIRA 1B39A 3ZZWA 4V0GB 4AT3A 4FIJA 2NP8A 3C4XA 3FLYA 3SOCA 3SRVB 5FP5A 1WBOA 2GSFA 5FXRA 3DS6A 2KTYA 4G3FA 2CDZA 1OPLA 4NW6A 4WNKA 3TNIA 5A4LA 1UU3A 1AGWA 5TF9A 3OS3A 3TACA 3RWPA 4PY1A 3BYUA 2UW3A 3IW7A 1NVRA 4YJSA 4AA4A 4D2PA 4I93A 3UQCA 4BCQA 4LQMA 4N0SA 3VONA 3NW5A 1CDKA 3BU6A 2NPQA 3ROCA 4F1OA 2ITYA 5AP1A 3H9RA 3I1AA 4EOOA 2E2BA 4J8MA 4JX3A 1YWRA 4GT4A 5TOZA 2YFXA 1WBNA 4F65A 3FUPA 3VBWA 4L68A 3D14A 3EN5A 2P55A 2QO9A 4ASEA 4CQEA 3NAXA 5KMKA 3BRBA 3SG9A 3SAYA 3NIZA 2RFNA 4FV6A 3W0PA 4ZJVA 4TWOA 2A2AA 5FM2A 3CTQA 5EQYA 5E8WA 1K2PA 2YAKA 5KZIA 3CEKA 4E6CA 4RLKA 4A9YA 1H00A 5D7VA 3EIDA 4BR3A 4GT3A 4QPAA 3CJFA 4ZMEA 4EOMA 3HUBA 2WMWA 5ITAA 1FQ1B 3R0TA 4H36A 4BI2A 4FV3A 1M7NA 4U43A 4BIDA 4R1YA 3R9OA 4NUSA 4AF3A 1R0EA 5IQFA 2ONLC 4UV0A 1L8TA 3ORXA 4PPBA 4DC2A 5I0BA 5L2SA 4DF3A 3Q9YA 2CGVA 4QP1A 4C4FA 1UVRA 4NM0A 3PLAE 4FR4A 2G9XA 3IK3A 4LMNA 2YA9A 3V5PA 4CFNA 2VX3A 1O6KA 2XP2A 4UWBA 2YDIA 1YDTE 3ZDIA 1Q8WA 2X8DA 2GQSA 1YHWA 3QTIA 4I5PA 3HX4A 2CJMA 4R6VA 1AQ1A 4NH1A 5ANEA 2UZTA 2PTKA 1WBVA 3LXPA 3MI9A 4RA4A 2HY0A 2WIHA 3BGQA 3DBFA 4YSJA 2PVRA 1QPDA 2QO7A 2JGZA 3QYWA 2OJGA 2GMXA 1OITA 4DEIA 3RGFA 4FEWA 2H6DA 3EHAA 4AT5A 4M0YA 5KNJA 4AXCA 2WMRA 4D1SA 5IA1A 4Q9ZA 4G6NA 2X9EA 4FVRA 3A7JA 3UC3A 4JL9A 4M67A 2W4OA 2W05A 3DKOA 3PP1A 4QYYA 3ZH8A 4I94A 1UA2A 3NYNA 4TYIA 4BVUA 4L7SA 4HYSA 4NT4A 3EKKA 4DINA 5T6KA 3UPZA 4FV8A 3MFTA 4FICA 4V0GA 3ZM4A 5E1SA 1LP4A 3LXNA 3GCVA 3SRVA 3VRYA 4AGDA 3D0EA 3A61A 4FEXA 3I79A 4ZY5A 5DNRA 4FKRA 4BZOA 1BLXA 1Q99A 2XK6A 2ERZE 3L9NA 3MPTA 4RFYA 4YBJA 4O7RA 3CD8A 5CALA 3F5UA 3QU0A 2QLQA 5I9XA 3D2IA 3F5XA 3ZSHA 2J9MA 2GCDA 2BAJA 3HECA 5DR6A 4BI1A 5FBNC 2OH4A 1QPJA 4XMOA 5CEKA 5AP2A 5IQAA 2XK3A 3WZDA 3A7FA 1YXUA 3OEZA 4FG9A 4B4LA 4M8TA 3LLTA 4QP9A 4DH7A 5BVDA 5EQPA 3MY1A 2XCKA 2WTWA 2X2MA 3OVVA 3LXLA 2H8HA 4RVMA 1KOAA 1M14A 3JXWA 1EH4A 3QQHA 1H4LA 4QQTA 3DLZA 5IA0A 2Y8OA 3L8SA 4S30A 2A27A 3FY2A 4AFEA 3MH1A 4KKHA 5B2KA 3UQGA 2C68A 3E5AA 4V04A 2J2IB 2BUJA 1ZY5A 4EOPA 4CXAA 4M84A 3V5LA 4BDFA 4JIAA 3W33A 3CBLA 3EN6A 2PK9A 2UZWE 5C9CA 3R8MA 5A9UA 4GIIA 5EKNA 5ICPA 3KXGA 4AXFA 2ZJWA 3OT8A 2XRUA 4M15A 1JVPP 5LOHA 4RT7A 4JOAA 3MFSA 4PL3A 4QMUA 3NUSA 3HAMA 3UP2A 2DYLA 3BV3A 3EOCA 4K2RA 3QA0A 4W8EA 2BDFA 3CKXA 5ETIA 3SVVA 1WVXA 2WTKB 4FKWA 3UVPA 1NXKA 2ZFYA 2RG5A 1M7QA 2VTMA 5AAEA 4C38A 5HBJA 3FZ1A 4KIKB 4NCTC 1H1PA 5ACKA 2RKUA 3TKUA 3HZTA 2BIYA 4QMZA 4JJRA 3PRFA 3PY0A 4XP3A 3RINA 4D4VA 4DH1A 3H9FA 3WARA 4BKJA 3R1YA 2XKDA 3F3ZA 4X2KA 5EM8A 1UNHA 1YI3A 1FINA 3AT3A 2AC3A 3A8WA 3NNWA 4QMVA 3RPYA 4F09A 3R8PA 2CKOA 2JITA 3V5WA 3A2CA 3F3WA 5IA3A 1BYGA 2WTCA 1BL7A 3VC4A 3QD4A 4W9XA 3QKMA 3Q6UA 3VN9A 4BTFA 3FDNA 5E91A 5HOAA 5BVWA 1IA8A 3W55A 1Q97A 4XHKB 3GU7A 4XV1A 2C6EA 4YJOA 5TT7A 5HLNA 1ATPE 4AS0A 3PWDA 2UZOA 5H3QA 4O6EA 4RC4A 3R21A 4BWPA 4F7LA 3ZMMA 2XYUA 4PWNA 5AUVA 3DKCA 2XVDA 3QTXA 3I5ZA 3CPBA 1NVQA 4FV9A 2UW5A 3BBTB 2X8EA 3WOWA 4PNKA 3DQWA 2X1NA 1CKPA 3DKFA 2JDSA 2Z7QA 3LJ0A 3BE2A 4GVJA 4E6QA 5HU9A 1H8FA 4BC6A 2AEGA 3WI6A 4B99A 4BTJA 4MKCA 4E93A 1U5RA 2JDOA 3HYHA 1KE7A 3JR1A 5LVNA 2IZTA 3VO3A 3ZFXA 4FKGA 3P4KA 4YPSA 3U51A 2GFCA 3ORKA 4FTIA 3PZEA 5HBEA 3HV6A 5HICA 3ZRLA 1ZYLA 2P0CA 3WZEA 5D10A 4O38A 1PMUA 4FSRA 4G2FA 3RPRA 5KMMA 4GUBA 4Y5HA 2I7QA 2PMLX 3PLSA 4OLIA 3D5VA 4L52A 5AV4A 4ANOA 3HMPA 4KB8A 3S95A 2HK5A 4BZDA 5KZ0A 3DA6A 3DNDA 4U79A 3QRJA 4YJRA 4UMTA 4YJPA 5CX9A 4O83A 2FO0A 3NR9A 2FSTX 3O8TA 3R71A 1F3MC 3KK8A 4BBMA 3FLSA 4WSYA 1TKIA 2VWXA 2WTIA 3KVWA 5KHXA 4CVAA 1WMKA 4NFNA 3CXWA 5GJDA 3TNHA 4C57A 2VO0A 3NUXA 4KWPA 4ZZMA 2R3MA 5IEYA 5J1WA 3KMWA 4B8MA 4EC8A 1Y6BA 4HGTA 4L43A 1LUFA 4FJVA 3I0QA 4DH5A 5HCXA 1KUTA 2JIUA 4KIKA 5E7RA 4FTTA 3KQ7A 3KXNA 5L2WA 2PVJA 2FVDA 3LVPA 3VS5A 4CFVA 3R7EA 1OB3A 4K1BA 3BLRA 2QOLA 1Q8UA 3GQIA 4G3CA 4F9CA 4FKOA 1B6CB 1FMOE 4O82A 3WZJA 5CWZA 3UDTA 1G3NA 5JK3A 4WA9A 3TZMA 2O8YA 2OGVA 2VWIA 4JVGA 1H1WA 3MY5A 4K18A 2JIIA 4M7IA 3Q2MA 4BGQA 3ACKA 4IX6A 1TFFA 3DPKA 5C26A 4II5A 2RIOA 5M4IA 4L46A 3GBZA 2CN5A 4QTAA 3PXFA 3EZVA 4E5WA 4RFMA 5J9ZA 3BZ3A 4JLCA 4I23A 4YHJA 5CAOA 5KX8A 1OBDA 3SXSA 1P4OA 3R04A 3P79A 4O4FA 4X6RA 1SVEA 1OKZA 4QP8A 2WMXA 3W2QA 3WZUA 4N4SA 4BHNA 3B2TA 4X3FC 5FUTA 2UW9A 3R7VA 5IQDA 4LFIA 3BYOA 4GUEA 4FGBA 2W99B 3PJ1A 4MXZA 3GCUA 4DA5A 4MD8E 5ANDA 2CCHA 1K3AA 4RX7A 2ZV8A 4F7JA 4OBOA 4NK9A 4EOKA 1DAWA 4JR3A 2UW6A 4DN5A 5JFWA 5L2QA 5EW8A 4IWOA 4CT1A 2F4JA 4YGAA 4U3YA 4Y83A 4GW8A 4IAAA 3Q4ZA 1UNGA 1BKXA 4O0XA 5AA9A 2OJJA 4FRFA 3MTFA 4EH3A 3BQCA 3PVBA 4EORA 4KABA 2A19B 4C4JA 3UPXA 2C6MA 3EQDA 3QQUA 3W8QA 4O0SA 5M08A 4D0XA 3OY3A 2R3PA 3QD0A 4I21A 3BE9A 3U8WA 3ZLYA 2UZBA 3PDTA 4I0RA 4BDEA 3QRKA 4B9DA 4C2WA 1FVTA 2WELA 3W0OA 2W1FA 2W9ZB 3NPCA 2RSVA 2WMUA 3GB2A 3EL7A 4TWPA 3QLGA 4WUNA 2PVLA 2PU8A 3S2PA 2I0EA 2Y0AA 2YCQA 2FGIA 1UU8A 2I6LA 4IIRA 4JBVA 3DAKA 4MNEA 4U0IA 4UZDA 3NEWA 4YZNA 5LVLA 1OPKA 5HCZA 2O64A 3W8LA 3R8VA 2NO3A 2QOOA 2EVAA 3UDZA 4F08A 1U46A 4ANLA 3W2RA 3CIKA 2VWUA 3GENA 4YTHA 3KIOC 3S3IA 4TWCA 1JQHA 4CMTA 1YI4A 3P86A 3IGOA 5AV0A 5L8LA 4ANBA 3R30A 3BHTA 4GK2A 4M97A 2XS0A 3KRWA 4IZ5A 1GY3A 4GG7A 1UWHA 2R9SA 2W1EA 3NX8A 4LGGA 3UIMA 3FQSA 2PUIA 2HYYA 1Q4LA 5J7BA 4JG7A 2EWAA 3ZHPC 1SYKA 2C47A 4ZTSA 2OSCA 1FMKA 5J79A 3AD6A 3KN5A 4OUCA 1YXVA 4IX5A 5AFVA 1Y57A 5CZIA 1WAKA 2ZVAA 5G6VA 4J99A 5IA5A 4O7LA 3MPMA 1W84A 3UOHA 4FZFB 4Z7HA 2ERKA 5EDRA 5BVKA 2BDJA 2XMYA 4PL4A 2F49A 4TZRA 3PXYA 3TXOA 3FKOA 3NCZA 4WNMA 1YWNA 4FKPA 4AW1A 4J8NA 4O7NA 4RMZA 5CXHA 3TNWA 3ENMA 4FV5A 4AUAA 3B8RA 2W06A 3QA8A 4YURA 4L3JA 4HVHA 2BALA 4FKUA 3RBWA 4AZWA 3BHHA 1IR3A 3HP5A 3T9TA 4DGGA 5CF6A 1QL6A 5CU0A 3HV4A 3NFGB 1HCLA 3IKAA 2IZSA 4XEYA 4EQCA 3BHYA 5AR2A 1LPUA 1IAJA 1TZDA 3TUCA 1FOTA 3FXXA 2WMQA 4FNYA 4FTCA 3R00A 1IRKA 3DQXA 4K0YA 3ZYAA 1PMNA 4G6LA 5GJGA 4DBXA 4O27B 3BELA 3LHJA 5AMNA 3F5PA 4U41A 3DXQA 2WTJA 2BRGA 1OKWA 4ZSEA 4ZY4A 2WFYA 4ZXTA 4CCUA 4I6HA 4KBCA 4LRJA 5BQ0A 3DTCA 1GIJA 4ZTHA 2J0MB 4EHZA 3QLFA 5CAQA 1G8AA 1W98A 2BRMA 2F57A 4GVAA 4XS2A 2WTDA 4ZZNA 3R28A 1RW8A 3EQCA 2OJFE 5JFXA 3O8UA 2CPKE 2XEZA 2YDJA 3A4PA 3OXZA 2UUEA 2GNHA 3F7ZA 4D9UA 3HKOA 4ACHA 4UMRA 2QHNA 4ANMA 2WQMA 3C4FA 4PPAA 2ITTA 3MN3A 4FTUA 3P7AA 2HWOA 3OT3A 5CY3A 5DRDA 1BMKA 2YM7A 4DH8A 3QCYA 3U6IA 3QZGA 5CSWA 4M14A 3QKLA 2JAVA 4CV9A 5AUWA 3VIDA 1M17A 2I1MA 4U44A 4UXLA 2YDKA 2XKFA 3ALOA 2XBJA 5DVRA 4RWIA 4EHVA 3CQWA 2ITWA 3REPA 2G1TA 4PL5A 3NS9A 4CKJA 4TYJA 2NRUA 5L4QA 3I5NA 1OL2A 5KMIA 4BDAA 5FBOA 3LFCA 3LFBA 3U6JA 2IWIA 2ZYBA 4DEHA 4FSNA 1REKA 3KXHA 4ZSGA 2CN8A 5BMMA 4YC3A 2P4IA 3A7HA 2JBOA 2QOIA 3KKVA 3D94A 5AR8A 4ENXA 4FG7A 5IH5A 4QMYA 5DEYA 3SV0A 3MFRA 5JT2A 4BIBA 4B0GA 1NT2A 5AM6A 5HIDA 2H9VA 3SXFA 1A9UA 3ELJA 4CMOA 4F6WA 2R3GA 3E7OA 2ONLA 4X6QC 4CEGA 3IW5A 5EH0A 4FKLA 4C34A 3G6HA 2OU7A 5FTGA 3KGAA 5AV3A 5AP6A 2VUWA 4FOBA 5DRBA 4XCUA 3RKBA 3Q9WA 2J0KA 2I0HA 4PDSA 4QMWA 2R5TA 4JDHA 4RA5A 3EKNA 4I4FA 2QU6A 4DEGA 3ZO2A 3I81A 4FIHA 4P90A 2CLQA 1FVRA 5BPYA 5KHWA 5L2IA 3FQHA 2C5VA 2BTRA 1HCKA 1M52A 1R78A 4C62A 3BCEA 2YCRA 5K0KA 3QF9A 5A4CA 3FI2A 4CCBA 5BNJA 4QYFA 3CY2A 3FL4A 2WIPA 4X2NA 3NUUA 2YIQA 3IPHA 3FXWA 3EYHA 3LFNA 4R7IA 4EK4A 1E9HA 3E63A 3QCXA 1OIRA 2JKQA 3AQVA 2J4ZA 3LPBA 4BDGA 1W83A 4ACDA 5A6NA 4FV2A 3I0OA 4LL5A 4CKIA 4BYIA 5T68A 4GYIA 3Q32A 4WBOA 4J1RA 3SX9A 4FUXA 4XOYA 4EJNA 1UKHA 4I41A 5E8ZA 2XK7A 3ZOSA 2GDOA 4YTCA 5L2TA 4Q2AA 3QKKA 3ZC5A 3EQPA 3ZSGA 5CSVA 4TRLA 4EH6A 3HNGA 2C5YA 4MHAA 3LJ1A 3PJ2A 4NW5A 3SDJA 2ZAZA 4E4LA 3ID6C 4ALWA 4O84A 3QXPA 2C0OA 3VUKA 1R1WA 3TUDA 2VV9A 3TDVA 5J7HA 4IDTA 3CC6A 5AP0A 3TNPC 2J5FA 3CE3A 3L8VA 2UZLA 4YNOA 3OOMA 3CKWA 3VUMA 4FVQA 2YCFA 3FHRA 4DEEA 4C61A 2PYWA 1Y8YA 1Z5MA 2GTNA 4JNWA 2YLEA 4U40A 3L9MA 3MYGA 4AFJA 3C4ZA 4QMSA 3RPOA 4FV7A 3ZRMA 4U42A 2E9VA 2PWLA 3PZHA 4HNFA 4LRKA 4XX9A 4ACMA 4C7TA 1TQPA 4DHFA 4GK4A 4GEOA 2VU3A 2YISA 3MW1A 2HW6A 3ODZX 4QMOA 1PXPA 2J7TA 4MBLA 4X2JA 5HIBA 5J87A 3V8WA 4FEVA 3KB7A 3TL8A 4AZVA 3SGCA 1H07A 3R9HA 3TZ8A 4HYIA 3V6SA 5H9BA 4FGRA 2RFDA 4BCPA 5B0XA 3NNVA 4GU9A 2VTQA 1ZXEA 4O0TA 2PL0A 2IO6A 3QRTA 4UY9A 5F9EA 3UYTA 4EWHA 3DAJA 4RIWB 3Q9ZA 2HCKA 3Q4CA 2XB7A 5JQ8A 3PG3A 2UZVA 3FZPA 1OGYA 2WMVA 1ZRZA 4HZRA 4GKIA 1VZOA 1R3CA 2ZDUA 5AUUA 4CGAA 3CJGA 4Y95A 2O2UA 5DI1A 2R3HA 2PSQA 3RM6A 2QQ7A 4D2TA 5HORA 3NAYA 3JYAA 1WVWA 4AZSA 3CR0A 3EB0A 4F99A 4IB3A 5AV2A 2VWYA 4J96A 3EFWA 1Q5KA 3HAVA 5A3XA 2YIXA 2QOBA 4FKVA 3OBGA 5HTIA 2C1BA 5TKDA 2YZLA 2A4LA 2Z7RA 4QD6A 1V0PA 2WAJA 1T46A 1DS5A 5K3YA 5AA8A 5ANOA 4DBNA 3F69A 3PIYA 4IX3A 4KS7A 5DG5A 4FTNA 2H34A 3BWFA 4QO9A 4NJDA 4MNFA 4W4WA 4JDJA 4IADA 4CLJA 5JSMA 3COIA 5HO8A 4BKZA 4DGLC 2XK8A 3VUDA 4BCFA 4G3EA 4MXCA 1H1SA 3BLQA 2XM8A 5HVYA 4AG8A 3OW3A 3ACJA 2YIYA 3RCDA 2G15A 3K3IA 4IB0A 1VYZA 3V5TA 4DGNA 5LCKA 5IQIA 3QYZA 3FI4A 5CF8A 2C5XA 3NUAA 4ZSLA 4I20A 2WMSA 3VS0A 4EZ7A 4TNDA 4PF4A 3DAEA 2V55A 4ZK5A 3FHIA 3OUKA 4X3FB 3O50A 2B9IA 2C69A 5HO6A 3F3TA 3G9LX 3ORLA 3UVQA 4FL2A 1KE5A 4PMSA 3VW6A 3FQEA 3NCGA 4APCA 3N4UA 4YTFA 5I3OA 3TWJA 3S1HA 4XV9A 4K8AA 3ZC6A 3SOAA 3H0ZA 1FGKA 2UVXA 5DT4A 3PA3A 2Y6MA 4AXAA 5AUTA 4R3RA 3MS9A 2E9NA 2VWWA 3FMEA 3E8NA 4FK6A 4L3PA 3QTWA 4RZVA 3RPSA 4CYJA 2W1HA 3R9NA 5FM3A 3HV5A 2W7XA 2FB8A 3DY7A 1NA7A 3GU4A 4H3BA 4JQEA 4MF1A 5DR9A 4D4SA 3DBCA 4O2ZA 2FSLX 3L9PA 5BVFA 1MRUA 2HIWA 5DMZA 4OAVB 2EXCX 4FV0A 2C0IA 3FY0A 3LIJA 4EL9A 5AUYA 5HHWA 3PVWA 4K6ZA 4O0UA 4IZ7A 2GTMA 4AN9A 4A4XA 3DZOA 2BR1A 3ANRA 1A06A 2ETMA 4TYHB 5DHJA 2OZAB 4TNBA