1Q8TA

The catalytic subunit of camp-dependent protein kinase (pka) in complex with rho-kinase inhibitor y-27632
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
338
Chain Sequence
b'EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Protein kinase A in complex with Rho-kinase inhibitors Y-27632, Fasudil, and H-1152P: structural basis of selectivity.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q8tA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q8tA02
4HZRA 3L8XA 4DFXE 1BX6A 4QMVA 3LM0A 4E20A 5D11A 2C0OA 3HDMA 4TKSA 2EB3A 4ORKA 1FINA 2QNJA 3OWKA 2WTVA 4TWOA 3PSDA 4NM7A 3ZYAA 5IEXA 5CS6A 2EVAA 3NRMA 3VS3A 1OL6A 1RW8A 4AOJA 4PL5A 4M7IA 5DHJA 4BKJA 2HENA 1QMZA 2UV2A 2XB7A 4YTFA 4JIAA 3V3VA 4O7TA 5HE0A 5M07A 4MNFA 5IH6A 1E1XA 4FF8A 4EJ7A 3CE3A 2PVLA 2YACA 5B2LA 1W0XC 2BROA 4JOAA 3UDBA 2I6LA 3S1HA 3NUAA 3UYTA 4XBRA 4GKHA 3GI3A 3KCKA 4ITIA 4WNKA 2CGVA 3DU8A 3W2SA 5L2SA 2W1EA 3ZLSA 4KBCA 3O7LB 4GMYA 1YI4A 3Q4UA 4QMMA 3EJ1A 4QMTA 1F0QA 4JT3A 2ITZA 2J4ZA 3DKCA 4I0TA 4UV0A 2CDZA 3E63A 2GQRA 4GT4A 3UE4A 4L00A 4EUTA 3QA0A 3LJ0A 4I0SA 3EHAA 3PPJA 4FL1A 4FKPA 4V0GA 4IXPA 2YA9A 4RIXA 4GW8A 3IDPA 3MB7A 5IA2A 4BIEA 4LUDA 4YC6A 2VX1A 4XLVA 4E4MA 3QD3A 4CTBA 2X6EA 4I6FA 4X6RA 5IQAA 3BHYA 1FMKA 3R7IA 4OTIA 3HV7A 1WFCA 2WTKB 1SVGA 4WHZA 1P2AA 4USDA 3MPTA 4HGSA 3PXKA 3ZSIA 2XBJA 3I1AA 1PXPA 2OZAB 4DEBA 5C01A 3UODA 5HO7A 2WMVA 5KZIA 3FEGA 4FZDB 3NAYA 2PPQA 3GGFA 3TV4A 3I6WA 4E93A 5M08A 2Z8CA 2W4JA 5T6KA 3R9HA 4FEXA 3C5UA 4TRLA 3NW5A 5DPVA 3LAUA 3RK9A 3VS5A 4CT1A 5G1XA 4AW0A 3P08A 5BYZA 2F57A 2GSFA 2I0YA 4F9WA 2W7XA 4W4VA 2PK9A 3FZ1A 5EDQA 2X9FA 3OCSA 3ROCA 3ULZA 3D4QA 3D7TB 3R21A 3ULIA 3FKNA 3PJ2A 3QALE 4BDFA 4FV1A 4TYHA 3D5VA 4X7QA 4TYEA 2C5NA 4JQ8A 5I9UA 2QURA 3FC1X 4FG8A 1Q41A 3DB6A 2YM8A 3HRCA 1PXIA 3R00A 3TIYA 1V0BA 4IB5A 3ZEPA 4ZS0A 2JKQA 4A9UA 4MF1A 1Y8YA 2R3HA 2VU3A 4QMPA 2UW7A 4FSYA 4I41A 1JKLA 5CXHA 5IPJA 1XH8A 3UZPA 3K3IA 3MVJA 3I81A 1E1VA 2VUWA 3TXOA 3HRBA 2UZWE 3AT4A 2QU5A 4EBWA 4LOOA 2J2IB 2OK1A 4YJRA 5IA4A 3W33A 4OT5A 4FT0A 1GOLA 3I7CA 4UWBA 2E9PA 2HAKA 2W96B 4F99A 4QTDA 3GU4A 3EQCA 3KMUA 4WA9A 5BNJA 4CKRA 2QO2A 4PP9A 4ZY4A 3ZM4A 3ZUTA 3OD6X 5K3YA 2BAQA 4AN2A 4PV0A 4IWPA 3RPOA 5M09A 5AAFA 3KXMA 3O71A 5ITAA 4BI2A 2XYNA 3F3WA 4O7VA 4I20A 1NY3A 2F2CB 3BWFA 4GVAA 2HK5A 2R7IA 3C4CA 4ACGA 5AUZA 4HVSA 4G2FA 4I93A 3OBGA 4A9TA 3WZDA 2VZ6A 4FV9A 4DT8A 3QTZA 4BDEA 4PPAA 4C4EA 3BV2A 5HHWA 5ETAA 4CV8A 4PMTA 2O2UA 1OECA 4PMPA 4LMNA 5K0KA 5LWMA 1PXJA 1O6KA 4XG7A 3DLSA 2RG6A 5HICA 5DI1A 4U43A 2FB8A 4GU9A 1H1RA 3BYOA 2VTOA 3GC8A 4IZAA 3SX9A 1UNHA 1U46A 5J7HA 5C8MA 5IA3A 4IWOA 4ZJJA 2WMBA 4NKAA 4R7BA 4AF3A 4IMYA 4PTEA 4QYHA 3RP9A 5BUJA 2FSOX 4ACCA 1FVVA 2C0IA 2OI4X 3HMNA 2RL5A 5J7BA 2V5QA 4C7TA 4ZMFA 3TDVA 2WOUA 3ZO3A 2QOFA 2EUFB 4Q5HA 4RLKA 3U51A 4D2SA 2WQOA 2CLQA 2BVAA 5HNBA 4D9UA 5I3OA 2W17A 1LUFA 3U4WA 5J1WA 2DYLA 4FR4A 4XS2A 1ZZ2A 3PTGA 4KSPA 4B8LA 4EJNA 2VO7A 2VTNA 5KCVA 2PTKA 3AGMA 5AP0A 3GENA 3IQ7A 1OKYA 4QYEA 4FV3A 1GZ8A 3NW7A 4G6NA 5DNRA 1H1PA 1WBTA 2XM8A 3TNHA 2WMSA 4BIBA 3Q2MA 4M69A 2QR7A 1SYKA 4FYNA 2UW8A 4M0ZA 4UX9A 5IQIA 4FYOA 4NT4A 3WF9A 4EYJA 4R7HA 3VQHA 2RIOA 4U3ZA 4RSSA 3UBDA 2UZUE 3BYMA 4AACA 4QYYA 4CXAA 1CTPE 3VUDA 5GIPE 4C36A 3OROA 4FVPA 2ZB1A 3QZFA 4HNIA 2B1PA 2XK6A 2XYUA 3VS7A 3VS6A 3K54A 3GC9A 5EW8A 4C3FA 4FKUA 2ZB0A 3CLYA 3KVXA 3PA3A 3QTUA 1ZYCA 4RIWA 4FKQA 4ZP5A 4BCQA 4D2TA 4F1MA 3VC4A 4APPA 2XIZA 4JJRA 4DTBA 4YLKA 4YO4A 2ESMA 2P3GX 3FE3A 4FKVA 3KK9A 4E7WA 2QOCA 5D10A 1OGUA 2C4GA 3A7HA 3LLAA 2CGWA 3MY5A 3TM0A 3V5PA 1NVRA 3F61A 3RPRA 3R83A 3A8XA 1XBCA 3E88A 4AUAA 3BHVA 3PLSA 3I5ZA 4OTFA 2UZNA 4I0RA 4KB8A 2BRHA 4NM5A 4AT3A 4L45A 3TL8A 3VJOA 3RZBA 5M4UA 4FK6A 3OEZA 1ZYDA 4ZOGA 2EU9A 2C1BA 5EW3A 1Q24A 4LRJA 3RCJA 2QU6A 5AR4A 1R0EA 3PE2A 4BZDA 2NNWB 2X0GA 4FKIA 5AR7A 5CNOA 2CGUA 2F7EE 3UZTA 4YHTA 2VRXA 3R30A 3CQEA 4ZJIA 4U79A 2ACXA 4GV1A 4RGJA 3RAIA 1K2PA 3EQHA 4CLJA 1Q8YA 3R28A 1DAWA 4GVJA 4R5SA 3VBXA 3VN9A 4X3FB 4QP8A 3OEFX 1OL2A 3TKIA 3VHEA 2BRNA 3PVBA 3VRZA 5A6OA 3DBFA 4EOSA 1YOMA 4O84A 3F69A 3F3TA 3R9OA 1MP8A 3F3ZA 4EHEA 1KV1A 3JUHA 3MWUA 2WMWA 1QPDA 2W5HA 3MVHA 2W5AA 4GFOA 3ZH8A 1QL6A 3ZUVA 3ZDUA 4DITA 5CAQA 2BMCA 5CI6A 5DOSA 1QPJA 2JFLA 3A60A 2WQEA 4HCUA 4NU1A 4QMNA 4EWQA 1YW2A 4I94A 3HMOA 1A9UA 3MSSA 3AMBA 3ORTA 3OW4A 5C8NA 3HAVA 4QTBA 2Q0NA 4OTRA 3E62A 3MVLA 1YHSA 3FMKA 3QKLA 2UZDA 1GZKA 3HVCA 1KWPA 4J1RA 5BX0A 4H3PA 2X7OA 5HX8A 4AP7A 3BGQA 1XHAA 1YXUA 3UIBA 3A8WA 4FSZA 4DEHA 3KKVA 3FPQA 4F7NA 2BCJA 4FKLA 2WIPA 4KAOA 1FMOE 3ORLA 4KS8A 5KMJA 3ORXA 3OY1A 1YWRA 2PVNA 3DQXA 4G3CA 4NIFA 5AX3A 4F70A 3FHRA 2I7QA 3SAYA 4DGNA 5J9LA 4ZS4A 4OTHA 2X7GA 4RFZA 4GK4A 1P4OA 1M2QA 4C59A 5CNNA 3EZVA 3TNPC 2JBOA 1REJA 3D7ZA 2ETKA 4LFIA 5TOZA 4H1MA 3VF9A 3WZEA 2H8HA 3HECA 4D4YA 3PXYA 4TWPA 3QRUA 1MRUA 3ZDIA 1Y8GA 3L9PA 4E6CA 2RFDA 5TO8A 1YWNA 5EM5A 4C02A 4W8DA 3OY3A 4K6ZA 1S9IA 1Q8WA 4FL3A 3I4BA 2R3NA 3BPRA 5HORA 1IAHA 2C0TA 1GAGA 2O65A 3KCFA 4MQ1A 1YDTE 3A7IA 5CYIA 5I9WA 5LQFA 1GNGA 4EK4A 1PRYA 2P0CA 2WFYA 2R9SA 5E4HA 3RM6A 2X2LA 2C30A 2XMYA 4EHZA 5IG1A 4J53A 2Z7LA 4FT7A 4I6BA 1JNKA 4YJSA 2JDOA 3LFFA 4IX5A 1OKVA 4R6VA 5ETFA 1Z5MA 4IJPA 4LM5A 4WSQA 5J5SA 2JEDA 2XNEA 3M42A 2CKPA 4LUEA 3OW3A 4EHVA 3KULA 4CV9A 5FD2A 2YM5A 1VJYA 2WU6A 3BE9A 5GJGA 4ASEA 4BWXA 3Q6UA 3MESA 4QMOA 3FV8A 3GU5A 2FH9A 4L42A 4RVLA 2GMXA 4N0SA 4YJNA 3F2AA 2QODA 4CFXA 1J1BA 4ACDA 2WTWA 4GT5A 2XIXA 4PDSA 3U55A 1CDKA 2HW6A 4YJTA 3RGFA 2CNVA 3SD0A 3UVRA 5EQPA 2QLQA 4NJ3A 4NSTA 4PPBA 4J96A 4X6QC 2BIKB 3R7YA 1JPAA 1MUOA 1W83A 4M12A 2OIQA 2ZM4A 2AC3A 4R1YA 3O23A 4G16A 3HGKA 3S0OA 1YRPA 5FLFA 4XRLA 3NVKI 1YHVA 3UP7A 2PMIA 4LRKA 4Z9LA 4RVMA 5J95A 4BCGA 2VO3A 3C7QA 4X3JA 4BFMA 5HCYA 3FHIA 5AR8A 3FXZA 3SRVB 5HD7A 3NUXA 1YXTA 2VTIA 4G9RA 4YJVA 4BKZA 1Q8TA 4AFJA 2V55A 4XG3A 5KKRC 2W1ZA 1OM1A 5EDPA 3DK3A 2YZLA 4WG4A 5AV1A 2YABA 4J99A 2R3GA 3RM7A 3V6SA 3ZO2A 3MI9A 5HTIA 2YWVA 2C3KA 5HVJA 4ANMA 3RK7A 4EK8A 3N4TA 2FUMA 2WD1A 3WF7A 4AW2A 3VO3A 3RHKA 1XO2B 3Q52A 3QFVA 3LMGA 2XKCA 4JRVA 3VUMA 5CAVA 3O96A 1ZY4A 3DZOA 2BAJA 4V05A 3U8WA 3IW4A 3MH0A 2C5OA 3W55A 3G0EA 2YCRA 5GJDA 2BZJA 3ODZX 4GSBA 1YI3A 3CTHA 4XNEA 4CFMA 4ZSAA 5IF1A 1PMUA 4DH8A 4F1TA 5B2KA 3O0GA 3OBJA 5GINE 3WYYA 2HW7A 4QRCA 5HGIA 5JZJA 5IQDA 3MW1A 4FTMA 1JQHA 3OP5A 4U44A 4GK2A 1TKIA 2PZYA 3R7EA 2WQMA 3H0YA 3R6XA 3K3JA 4FGBA 5AUWA 3VUKA 3CY3A 3MPMA 3C0HA 4IZ5A 2G1TA 3DK6A 1FGIA 5A54A 1AQ1A 2ZM1A 5CVHA 3DBCA 2PUPA 4IB3A 1OKWA 3NSZA 1Z57A 1LEWA 4IVBA 1M7NA 1ZLTA 2IWIA 4PDPA 2DWBA 4B0GA 5GJFA 3EQPA 3U6IA 2W1DA 1J7LA 4FSQA 1CSNA 2W0JA 3WF6A 2GS6A 1IAJA 4C38A 5KMLA 5FEDA 5T3QA 1OPJA 4RIOA 5D7VA 4K8AA 4F0FA 1H1WA 1U54A 2YIRA 3DJ7A 3EQRA 2ONLC 4CGAA 4Y95A 4IM2A 3ZMMA 2UZOA 4YC3A 1V0OA 1PW2A 4JQEA 4RG0A 1CKIA 5TF9A 2OBJA 3VS4A 4PMMA 1H07A 4Y73A 5LVMA 3LCSA 2YDKA 3EFWA 4G6OA 4BBFA 3HDNA 4EL9A 4XUFA 5TT7A 1VR2A 2GHGA 4HGLA 4O0WA 4QQTA 4ONAA 3L8PA 4WBOA 3UO6A 3FMEA 3W16A 4DG3E 5L8LA 3QLFA 3AC8A 4FZAB 4BDHA 5KMOA 5F94A 4UN0C 2QG7A 4EC9A 4FT9A 3QQUA 5HLNA 1Q61A 4G17A 3IG7A 4WBBB 4FEUA 1OIUA 2VX0A 4U45A 4ITJA 3R2BA 4BHNA 2KULA 4ANQA 3Q9WA 4XP2A 2V7AA 2F7XE 1SZMA 2XRWA 2WHBA 3MA3A 3MA6A 2BRGA 4GUBA 5JRQA 4O7WA 1KE9A 3MFSA 4O27B 4G34A 3FLQA 3MBLA 5BMMA 4X21A 4FT3A 3R8LA 3PSBA 5LMAA 5JGBA 4AN9A 3B2TA 2GNFA 3EN4A 4L67A 5KBRA 5AM6A 2ITPA 1FOTA 3QQGA 1SNXA 3M11A 3P79A 4L9IA 4E5AX 5HIEA 5EYKA 3TKHA 1R39A 1APME 3ZC6A 3P7AA 1BMKA 4DTKA 5CF4A 3FMJA 4EZ5A 3DXQA 5CU2A 3AD5A 2YLFA 3IS5A 4Q9ZA 3QCXA 1XH6A 3DXPA 3PY1A 1MRYA 3U4UA 1MRVA 4TL0A 3DPKA 2OIBA 3I7BA 4DH1A 4FIFA 4V01A 4BZNA 4ANOA 5L2TA 4JVGA 4WO5A 2XK8A 2C5XA 3QAME 4QP7A 5JFXA 2HCKA 2CCHA 2P55A 3CBLA 3WIKA 2CN8A 3QQJA 3RAHA 3QHRA 4YUQA 1H1SA 4ZJVA 2CKQA 3UOHA 4O7NA 4BBEA 3NUPA 5BVDA 4QO9A 4F6WA 4FTTA 1CKPA 2IVUA 4C34A 4F09A 4CCUA 4I22A 5K0XA 5LVLA 4E73A 1HCKA 3GCUA 4L7SA 2WTIA 5AUTA 4OGRA 3NUUA 3V8SA 2BZIB 1F5QA 3DBQA 2Z60A 3THBA 4EOLA 4BR3A 4A9RA 4AOTA 4F6SA 4ZXTA 1OL7A 3ENMA 4XP0A 3UNJA 4RWJA 3MYGA 5CEIA 1PJKA 2BDWA 3KC3A 1KOAA 2JIUA 3HEGA 4BCOA 4O7LA 2VWYA 3RHXA 3FL4A 5CVFA 5M4CA 4MF0A 5JK3A 5HCXA 3PYYA 1ZXEA 4UZHA 3QA8A 4JNWA 5EOBA 4PDYA 4ZY6A 2OWBA 2R3MA 2XEYA 4CFNA 3NX8A 4O6LA 4PTGA 3PFQA 4BTMA 2QCSA 2XEZA 2XBAA 4FSWA 5BQ0A 5A3XA 3BBWA 2ITOA 5D7AA 4BTFA 2BPMA 2YZAA 3FLNC 5IQHA 1IG1A 2QKRA 3D15A 4IDTA 4DGOA 5JZNA 2R7BA 4NJDA 3PPZA 3CY2A 4NK9A 3FMDA 3T9TA 4H05A 2ZAZA 4YZMA 4YR8A 3Q4TA 2ETMA 3HL7A 4BTJA 5HNIX 5LCJA 5HTCA 3UC3A 3PLAE 3O8TA 1Q3WA 5DT0A 1M14A 2V22A 2OXDA 4QTCA 3BU6A 3DKGA 2QOBA 1KE7A 4K2RA 2YM7A 4MTAA 3E8CA 4FKSA 4WSYA 3R7UA 4FA2A 2OSCA 3W10A 3NEWA 4IADA 3QRTA 5IMEA 5EG3A 2CKOA 1OMWA 3F88A 2XNMA 4QTAA 3IGGA 3L1SA 4FSRA 4BL1A 1XKKA 3TCPA 3W1FA 4GFGA 3F7WA 3FXXA 3O51A 4JDIA 1H4LA 2RSVA 4NM3A 3MJ1A 3LFDA 4G3EA 4NTSA 3OFMA 1DM2A 2EXCX 2V7OA 3DXNA 1WAKA 3C13A 3LXKA 4G31A 1U4DA 5CEOA 4MQ2A 5CVGA 4FTQA 2HOGA 3HA8A 2CJMA 3QC9A 3O7LD 2LAVA 2C3JA 2ZJWA 1V0PA 4TYGA 2JKOA 3N4VA 4BDBA 5CAUA 4RJ5A 2R3KA 5FEQA 3SVVA 4AZSA 2PUNA 1FVRA 3HX4A 2YLEA 5I9VA 3MPAA 1J7UA 2JAMA 4DA5A 3MY0A 2XK9A 5A4EA 3WOWA 1UU7A 2WGJA 1YDRE 3RBWA 4AT5A 1JKTA 3LW0A 4AN3A 5C1QB 2W9FB 3G2FA 1UKHA 3L9NA 3DS6A 1H1QA 3OTVA 4W4WA 2G15A 2PMNX 3CQWA 4EWHA 3CR0A 3LFAA 4ZTLA 4K0YA 1VYWA 3HYHA 3QYWA 3U9NA 5EI2A 2UZVA 2XNGA 1ZOEA 3VBYA 1PKDA 3FLWA 5EK7A 3UG2A 2JFMA 4HGTA 5EI6A 4KIPA 3W2RA 5HO8A 5CEPA 3OXIA 3LCDA 1OL1A 5TE0A 5IA5A 3E92A 3PRFA 4DGLC 5FDPA 5KUPA 4AU8A 5M56A 2VGPA 2W05A 5CX9A 4F65A 3HNGA 4YBJA 3NW6A 2VV9A 2PE1A 3IW6A 4KRCA 3COHA 2EXEA 4H58A 4LQMA 4NWMA 3Q6WA 4TTHB 3QC4A 3QUPA 4GK3A 3FYJX 4Y46A 2BDFA 3FZSA 3KQ7A 3NYXA 4M66A 3T3VA 3C4XA 1PXOA 1LEZA 3ZXZA 5CT7A 4NH1A 3ITZA 3LIJA 3LFBA 3P23A 4DH3A 4GEOA 4ZAUA 2VTMA 5DN3A 3Q53A 2PVJA 4FTUA 4M3QA 4UZDA 2FSLX 3BV3A 3SQQA 4F9CA 5A6NA 5DEYA 3SV0A 5J9ZA 3LJ1A 3KB7A 2Z7QA 3RMFA 1GZNA 5HCZA 5HU3A 3DKFA 3AC2A 5CSHA 1JKSA 5FXQA 3HLLA 4OTPA 3DNEA 4TXCA 2V62A 3KK8A 4WG5A 5E8WA 3RTPA 4HVIA 3NUNA 3RPVA 5CEMA 2FSTX 2QHMA 2GCDA 2GTNA 3TZ8A 1L3RE 5FXSA 4UALA 3NVMB 4UY9A 3FMLA 5D41A 5BVWA 4GYIA 4RQKA 3PJ1A 4JDKA 5DRBA 4ZEGA 4R7IA 3UG1A 3QX4A 1OPLA 2XNBA 3E3BX 3PJCA 4XH6A 3RJCA 1WZYA 4EK3A 4ZZNA 1XH4A 1VZOA 5JGAA 3ATSA 1RJBA 2JIVA 2XUUA 3GOPA 4LV8A 5EDRA 3DA6A 4N70A 5LCKA 5LMKA 2SRCA 2C1AA 2JKMA 5J1VA 5F95A 4FV4A 4IANA 4D1XA 1YOLA 4GIHA 5G6VA 5J87A 5H3QA 3NZ0A 3AG9A 3VRYA 3AOXA 1P5EA 4XJ0A 1NVSA 3NNVA 1JAMA 2HY81 2IZSA 2QR8A 2YDIA 4P5QA 4LV5A 5HIDA 3TNQB 5AV0A 5HD4A 2BZKB 1YQJA 2H34A 4YLJA 2ZMDA 3KXHA 5KKRB 2OJ9A 3E93A 4KNBA 4QMSA 1O6LA 3FSFA 5IKWA 3ZUUA 3OHTA 4G1WA 4L8MA 4MCVA 5DA3A 4KABA 3CCNA 3C0IA 2GU8A 5BYYA 5B7VA 5IEVA 4WNPA 3HP2A 3SOCA 4FTIA 5CENA 3OMVA 3BBTB 2X8DA 3F6XA 5AM7A 1F3MC 1DAYA 2XH5A 3OUKA 2UZEA 4F9AA 1STCE 3TV6A 4FGRA 3W32A 3DNDA 2ITNA 4IAYA 4QMXA 3S4QA 5FTGA 4NKSA 3CTQA 4MK0A 3TI1A 4DBXA 4ENXA 4ZIMA 4O21A 2W9ZB 1XQZA 4DLJA 2GDOA 3CD8A 4ZK5A 3ALOA 2E2BA 5HBJA 4BWPA 1QPCA 2O63A 4BI0A 5KX8A 3AQVA 3W2PA 2R3PA 4FTOA 4W8EA 3FKLA 1CKJA 4KA3A 4KIKA 4KRDA 3DFCB 2WQNA 4YURA 4IX3A 4MNEA 5JSMA 1AD5A 3CJFA 2GHLA 5HX6A 3MY1A 4RT7A 2BFXA 5ETCA 3TDWA 4O2ZA 3A7FA 5CF8A 3LE6A 1H00A 4JG7A 2J7TA 3ALNA 2QOQA 3G0FA 3GC0A 4FTJA 5DH3A 4IM0A 4IM3A 1WBNA 3GCPA 4IJ9A 5AP4A 4FKTA 4U5JA 3FYKX 1Q97A 4N6YA 5EM7A 3UIXA 5LJJA 3UOJA 3DGKA 4AW5A 3FXWA 4IAAA 4YJUA 4ACMA 4MXXA 2Y4IC 1WBOA 1I44A 5FG8A 4UWYA 3LLTA 1JSTA 1UNLA 3A99A 4FTKA 4IQ6A 5IU2A 2XM9A 5LVNA 3SC1A 4CYIA 2XNNA 2QHNA 4BZOA 4NL0A 4I4FA 5JMSA 3C51A 3GOKA 4ASDA 4W4XA 1FVTA 2XJ0A 4YU2A 3II5A 3SGCA 4A4LA 4O96A 4ZTQA 1KE6A 4U3YA 4DFUA 3LMHA 4DTAA 3FLYA 3QQFA 2PE2A 4BN1A 5DBXA 4GYGA 4FTNA 4LGDA 1JWHA 5E8YA 3QRIA 1IA8A 3COKA 3KF7A 2VWWA 5DIAA 3KXXA 1XH9A 4RIYB 4U6RA 1KUTA 2GPHA 2J5EA 4AWIA 3LMIA 3E64A 3EN5A 1E9HA 3CGOA 5A46A 4CEGA 4LOPA 4K1BA 3JS2A 2BRMA 3KF4A 5EW9A 2ZV2A 1WMKA 3V8TA 5HVKA 4MKCA 4NEUA 3AD4A 4TNBA 3W8LA 4B4LA 2YIYA 2B9FA 4YJQA 4EH2A 5HTBA 3NPCA 3PIYA 4EQCA 2WTCA 2JDTA 4P2KA 4WUAA 4F7LA 4CFFA 3BLHA 3ZONA 5J5TA 3QX2A 3PJ8A 4PL3A 5HE2A 2HZNA 3R8PA 2UW9A 3ZLXA 4QP3A 4I21A 4A9SA 4MXCA 2RGPA 4ZLZA 4DE4A 5CALA 3O17A 4XLIA 3BYSA 5AR2A 2X2KA 2DUVA 3UMXA 3ROYA 1WBSA 3QYZA 4G6LA 3B8QA 4IDVA 4IW0A 5EYMA 3R8MA 1YKRA 2XJ1A 2YERA 5AJQA 4DFYA 4MXAA 2Y4PA 3UTOA 3HUBA 5DLSA 3QCYA 4DBNA 4ZSGA 3JVSA 5I9XA 1LP4A 1H27A 5CSXA 3UNKA 4X2NA 5IA1A 4HOKA 5IH5A 3DY7A 2GNGA 3ANQA 3BRBA 3WE4A 4EOQA 1KV2A 4C4JA 5GNKA 4I92A 4QYGA 3MN3A 2OICA 2OJIA 2PE0A 3O50A 4W4YA 5HE3A 1KSWA 5BVNA 4EH7A 2PVFA 5E8VA 4BCNA 3LFEA 3PIZA 4PMSA 4B9DA 1W98A 5ANIA 4EC8A 4C4HA 2YJSA 4TPTA 3HV5A 1PHKA 3ZXTA 4AE6A 3DKOA 4XX9A 4CVAA 3U54A 4ZZOA 4FKOA 4RVTA 4XYFA 4Y5QA 2F9GA 2YN8A 3QKKA 2Z2WA 2Y7JA 3AC3A 4MD8E 3LXPA 4QYFA 4O91A 4F9YA 3OWPA 1FGKA 3N9XA 3OOGA 1OL5A 3QTQA 3PUPA 2HIWA 4WG3A 3POOA 3WIGA 2R2PA 4XOYA 4NTTA 3IK3A 4YZCA 3BWJA 4MYGA 3E7OA 4TWCA 3DJ5A 2WNTA 3GBZA 3GC7A 3PE1A 5DVRA 2YWPA 5HBHA 1JVPP 2E9NA 3TUBA 4U9AA 4LI5A 4FNWA 4PNIA 5EHOA 4RVKA 3S00A 1PMNA 5ANOA 4YSMA 2WMRA 3GCVA 3KEXA 3KN6A 4AS0A 4IE9A 2CNUA 3FMMA 5H8EA 1OBGA 3FPMA 4A9YA 2DS1A 3D5UA 5DGZA 4BICA 3PWYA 4ZTSA 3VUIA 3DOGA 2UW3A 4XV3A 2Y8OA 4TYJA 5EFQA 4C2WA 4L52A 4YZDA 4TY1A 3TUCA 4M97A 2VNYA 3SW4A 2GFCA 3L8VA 3FQHA 4JBOA 5K4IA 2CKEA 4UMQA 3Q04A 5DG5A 3S95A 3BGZA 2QOOA 3IKAA 2W1FA 3OF0A 3OS3A 2B0QA 4O0TA 2H96A 5CT0A 1BYGA 2ERKA 3F5PA 3ODYX 3D2IA 4CZTA 4CG8A 1JLUE 3MFTA 2B55A 1YI6A 2X8EA 2Q0BA 3KMMA 4M67A 1H24A 2IW8A 2W4KA 4CRSA 5FGKA 2FVDA 2UVXA 2W1CA 3JYAA 4IHPA 4JIKA 4MEDA 2J0JA 4PQNA 3FZPA 4BC6A 5GZ8A 4WUNA 1J7IA 2ITUA 4PPCA 4FBXA 3LQ8A 1W82A 3RZFA 3EL8A 4NCTA 1PYXA 5HE1A 2HY0A 4AAAA 4IVAA 3T9IA 4ANLA 3IDBA 4Q2AA 4B8MA 4WIHA 3DQWA 1KE5A 5E8SA 3H30A 4BDDA 3D94A 4IFGA 4CMTA 4IX6A 3R1NA 4QMQA 4AXAA 3AT2A 4G3GA 4WNMA 4BTKA 4CKIA 4QMZA 4IAIA 4QMLA 3WZJA 2WU7A 1NA7A 2XKDA 3EN7A 2ITTA 4FODA 2ZOQA 5ANGA 4O2PA 3TJDA 3ZRLA 4I3ZA 4C4FA 2J5FA 3E3PA 3SHEA 2A2AA 5IDNA 4BGHA 1XBBA 5DR2A 3G5DA 4Z7GA 3F2NA 3D0EA 4QP6A 2CNQA 4O1OA 3HV3A 3UYSA 3KN5A 3R22A 3MIYA 4OT6A 4IVDA 5AP6A 3VJNA 4U7ZA 4AGDA 2YAKA 4HPTE 2Y0AA 3LQ5A 2QO9A 5F1ZA 3DV3A 4HCVA 1DI8A 5CAOA 4K9YA 2OZAA 1OI9A 4JAJA 5CQWA 4BCHA 5IH4A 3BEAA 3EQDA 1DI9A 4WOVA 5M51A 4RMZA 4E4NA 5CSVA 5IQBA 3ZRMA 4R8QA 2R64A 3OWLA 4O0VA 5CLPA 4CNHA 3ET7A 4H36A 3BZ3A 1ZYJA 2J90A 2R0UA 5J8IA 5IUHA 3B2WA 4E5BA 3KXNA 3KVWA 3MTFA 3UOLA 4K11A 3QQLA 1PXKA 4MXOA 4EZ7A 2JGZA 5FBOA 3SOAA 4A4OA 3PXRA 5AUVA 2ITVA 4Z16A 5KBQA 3Q32A 4PWNA 3MJ2A 5K4JA 2XIKA 3D7TA 2QO7A 1YXVA 3I5NA 3CIKA 4JBQA 4EONA 5M4IA 4NYEA 2F49A 1XH7A 2G2IA 2RFEA 4V0GB 3WBLA 2PYWA 3R01A 4RIXB 4CG9A 3VVHA 4D5KA 4U81A 3QCSA 1B39A 4FSUA 4JG8A 3HKOA 4GIIA 4TWNA 3R63A 4XG4A 5HI2A 1WVWA 3H3CA 4IFCA 3UZRA 1OVEA 3BHHA 2J50A 3CS9A 3P9JA 2NRUA 5AR5A 5CAPA 4ALWA 1BI7A 4FTAA 4FV5A 3NIEA 3P7CA 3QQHA 4UYAA 4I24A 5EKOA 4DGGA 3ZRKA 3EIDA 2UW4A 4Y5HA 5FTQA 4FIIA 4AX8A 3UVQA 4OTDA 4HYUA 5AFVA 2UW0A 3RNIA 2WELA 3MV5A 3UC4A 2WIHA 2IVTA 2XK3A 4EUUA 4R1VA 4QNYA 3HA6A 4CZUA 3UO5A 4UMTA 4I6HA 3EYHA 4YNEA 4D2VA 2QOKA 4DINA 5AV4A 4GFMA 5IQFA 2VWZA 2B7AA 4FTCA 4ERWA 4O6EA 4IAKA 5JRSA 3PIXA 4XEYA 3V5TA 2EXMA 4C37A 4X0MA 3AXWA 1YOJA 4NFMA 2RF9A 4WRGA 1K3AA 2BKZA 1ZOGA 4ZTNA 3FZRA 1L8TA 5BVFA 4EH5A 3ORIA 3OT3A 3CJGA 2C5YA 5LWNA 2A1AB 2HXLA 1H0WA 3KRLA 3Q9ZA 4PTCA 2BDJA 5L6OA 5BYLA 2BALA 3GT8A 2ZM3A 1M7QA 4BY9E 3ORNA 1Y91A 3R71A 5JGDA 2B52A 3OVVA 5E8TA 4OTQA 2OO8X 5BVKA 3VS1A 3AMYA 3V04A 4YPDA 5FEEA 3MS9A 4EOPA 4UEUA 3R7GA 4D1SA 5AV2A 3G6GA 5JFWA 4BWKA 4JX3A 4O0SA 2X39A 1ZMUA 4O0XA 2E9OA 4CFVA 4E26A 4ANNA 3H4JA 2JLDA 2B53A 4DEAA 3LFQA 3LQ3A 2V0DA 2WB8A 3BU3A 3SKCA 4BDCA 3BQCA 2PVMA 5T68A 3PY3A 1QPEA 3NYNA 4OLIA 4X2FA 1UV5A 3DT1A 3ZS5A 3ORPA 4Y85A 2GS2A 3EQIA 2YM4A 4GG5A 4MX9A 4CMOA 4CT2A 4DG2E 4J98A 3ORMA 4ZZMA 3PJ3A 1CMKE 3QTRA 3QF9A 3I60A 4ANSA 4XG2A 4C33A 5I5ZA 2O8YA 2NPQA 5EI8A 4AG8A 4OBQA 3JR1A 3GQIA 4O7ZA 4XV9A 3ZFMA 3NUSA 1B38A 2WOTA 3G51A 4FKRA 4RIYA 5DE2A 2OF4A 1PF8A 2Y4IB 2WQBA 3CPCA 3FUPA 3GFWA 4JDJA 4M8TA 4E1ZA 4EOIA 1OIQA 2IN6A 3E7VA 4RBLA 2YM6A 4YBKA 3ZTXA 2KTYA 2X4FA 1TQIA 4ZY5A 4N57A 3V5WA 1UWJA 4Q9SA 1Q8ZA 4XG6A 2GNHA 2C69A 4JS8A 4QMWA 4RLLA 2DQ7X 3OCTA 4BKYA 1UA2A 3H9RA 2HXQA 3KFAA 4GL9A 2PU8A 2CPKE 5M57A 4GU6A 5HLPA 2OJJA 5ETIA 2VO6A 2UW5A 5BMSA 3BYUA 3C4ZA 4M13A 1RQQA 5E91A 1YDSE 2I0HA 5AV3A 4DN5A 5AUUA 2R3RA 3SXRA 4ASXA 4O7RA 3C4WA 3QLGA 2G2FA 3W8QA 4DCEA 5BVOA 3EQBA 3KY2A 4RWKA 3DJ6A 5JH6A 3JXWA 3QTSA 3O8UA 2A4LA 4IIRA 5L3AA 1FPUA 3UQGA 1MQBA 2RFNA 3TEIA 3VW6A 5IEYA 4FOBA 5F4NA 4M69B 4S30A 4F7JA 3CPBA 4A06A 1J3HA 3OTUA 2CSNA 4MWHA 1X8BA 3ZSHA 1YXSA 5LXMA 4M84A 5K5XA 2W1IA 4M14A 3C9WA 4F7SA 1H28A 1UVRA 1OZ1A 3PP0A 1WVXA 3DFAA 3KRXA 2W1GA 2BIYA 4Y72A 3R2YA 3LXLA 3VS0A 2PL0A 3AD6A 5EM8A 4RIWB 4Y8DA 3B8RA 3AGLA 2OJGA 2HWPA 1JSUA 3GFEA 2PVYA 2IVVA 1R78A 3GCQA 4FV2A 4YTIA 3SXSA 3NYOA 4X3FA 5AP2A 3TNWA 4AGCA 5D9HA 4FV7A 4D1ZA 1FQ1B 2I40A 4D55A 4G9CA 2YM3A 4Y83A 4LOQA 5EYDA 5I4NA 1R0PA 5AWMA 5M44A 3WILA 1WBVA 5AAGA 4R77A 4TYIA 4UMUA 4FI1A 3FY2A 4UXLA 3NIZA 4GRBA 3KGAA 2C6IA 4EH6A 4FT5A 3FL5A 2VTTA 3W2OA 4CD0A 1URCA 4YJOA 2JBPA 4JDHA 3H0ZA 4QMUA 4QMYA 2HZ4A 3PG1A 3SW7A 1H26A 3GVUA 4B6LA 2VTJA 3ORKA 4HVDA 2O5KA 2PVRA 5E8UA 3NNWA 4KSQA 4KIQA 3UQFA 3FWQA 4DEDA 3SDJA 2PUUA 2PVKA 4RC4A 3EOCA 4ZSLA 4L01A 3ZLYA 3U6HA 3TUDA 3RNYA 3SA0A 4RA4A 2WMUA 3QD4A 5CF6A 2J0LA 5HO6A 3QXOA 1ND4A 3FQEA 5FWKK 5JEBA 3IW5A 2ETRA 4JQ7A 3RAKA 5IZFA 3PZHA 4KIOA 4H3BA 3C0GA 3RWPA 4HYHA 3IO7A 3HRFA 2OGVA 4U42A 4JRNA 4AA0A 4CFWA 4PNKA 3SG8A 2GQGA 2OIDA 2VO0A 1G3NA 3E87A 4IWQA 2VAGA 4YJPA 3E8EA 3CKWA 5L8JA 3R7VA 1SNUA 4BYJA 3FJQE 4BCMA 4OTWA 2PMLX 4QNAA 2PMOX 1J1CA 4BDKA 2R3OA 2JITA 3PXZA 4E4XA 2G2HA 2W5BA 4FIHA 3IECA 3QCQA 4BDGA 4D2PA 5EYCA 2GQSA 1YWVA 4PY1A 5IISA 1V1KA 3IGOA 4FUXA 3RAWA 3MTLA 4YTHA 2OXYA 3UOKA 4LMUA 1A48A 4FEWA 3LJ2A 3FMHA 4IB1A 3RKBA 5AUYA 3LHJA 3P78A 4HVGA 4UBAA 2C47A 3GUBA 2VTQA 2XKEA 2XJ2A 3FY0A 3TNIA 4X2KA 2CMWA 2OJFE 2X4ZA 3IOPA 5E1SA 2WTJA 4RX7A 3ZFYA 4WD5A 4ASZA 4DFNA 3C5IA 1JOWB 3M1SA 3TTJA 3VBQA 2JAVA 4ANBA 3ATTA 4EK6A 5M06A 2BFYA 3HMPA 3KU2A 4TZRA 3MVMA 3FMNA 1U59A 4NIFB 5L6WL 2R0IA 3R0TA 5IUIA 1BLXA 4B99A 2ZV9A 2W1HA 5FP6A 2PWLA 2BTSA 3TTIA 4R78A 2VTSA 1K9AA 4FSMA 3RI1A 4E6AA 3FI2A 4OBOA 2VGOA 3EMGA 5AAEA 2WTDA 4EKLA 2P2HA 3PVUA 2X81A 1Y57A 2GNJA 2F4JA 2HWOA 3ZO4A 3GQLA 3EQGA 3C4FA 2WMTA 3RPYA 1M17A 4UWCA 3D9VA 3ZEWA 2VWUA 4IACA 3TZMA 2ZYBA 4XV2A 5K5NA 4QPSA 3Q4ZA 2OZOA 1UWHA 3F9NA 3HMMA 4RJ6A 5AIRA 5EHLA 4BDJA 4DEIA 4F0GA 4QTEA 5AP3A 3IPHA 3LFSA 3RWQA 3K5UA 3NYVA 2FO0A 4FIEA 3QTIA 5CTPA 3T8OA 4CRLA 4EOMA 5C27A 3ZSGA 3ZFXA 2C68A 1OIYA 3FZOA 4II5A 1RDQE 2I1MA 3KL8A 3KRRA 3QD2B 3ELJA 3ORZA 4NM0A 4XG8A 1HOWA 2WPAA 3SRVA 4OR5A 3QWKA 5HBEA 4YLLA 5M55A 2REIA 5EQYA 4L7FA 4BCIA 3EFJA 4JL9A 1O9UA 2BZHB 1Z9XA 2ZMCA 3KULB 3Q4CA 4GJ3A 4ID7A 3GB2A 4JAIA 2XRUA 2PZPA 2OH4A 2F7ZE 5DT4A 3UIMA 4BRXA 3TZ7A 1H8FA 3OZ6A 1ERKA 4A07A 3PVGA 2QC6A 4J71A 4DGMA 4PUZA 2JD5A 2OW3A 3QKMA 4I6QA 4S2ZA 2W99B 4XMOA 5AUXA 2VN9A 3TV7A 1GZOA 3ZBFA 4BDIA 1T46A 1BL6A 4ZTHA 3EYGA 4RPVA 4AW1A 1U5QA 4ENYA 1PMVA 3BE2A 2GTMA 4J97A 4IAZA 3KXZA 3SG9A 5ANKA 4D0WA 3BELA 5LMKC 3A7JA 3I79A 4G5PA 3BYVA 1OIRA 4IX4A 4Q5EA 3GU7A 3UJGA 5L2WA 4ZMEA 1Q4LA 1P4FA 1XR1A 1IEPA 2CCIA 2OFVA 4LYNA 3BQRA 3NCGA 2YCSA 4FV8A 4FNXA 2AYPA 4KD1A 4QPAA 1ZRZA 4EK5A 2IPXA 3P5KA 2WXVA 2C6LA 2RG5A 4C58A 2C3LA 3EZRA 5FM2A 3DBEA 5E8ZA 3DK7A 3S2PA 5JFSA 3L9MA 4USEA 1ZY5A 4L68A 5CEQA 4BVUA 3LVPA 2IG7A 1Q5KA 4QPMA 5CSWA 1M52A 1VYZA 1ZOHA 4IH8A 3W2QA 5EM6A 4ERKA 5CANA 1LPUA 4FV6A 3DDPA 2XP2A 2VX3A 4MD7E 4BCKA 4MAOA 5H9BA 3K2LA 5E8XA 5KE0A 4C4IA 4EEVA 3FI8A 3EN9A 4CQGA 2W06A 4FV0A 4FNZA 2A19B 4L43A 3IOKA 2YITA 3EQFA 4CQEA 4OAUC 5L4QA 4IZYA 5C4KA 3COMA 3F66A 2IZRA 4O0RA 4M15A 2IW9A 5HESA 4I5MA 5BVEA 5EQEA 4G3FA 1J91A 3CGFA 5DYJA 4CZYB 4O83A 2XK7A 1G5SA 3BIZA 4B7TA 4UMPA 5GIOE 2IJMA 4P7EA 3QBNA 3UVPA 3F2RA 2XA4A 5A14A 5JFVA 4APCA 4ZLOA 1GJOA 3MGYA 4I4EA 4U8ZA 4U0IA 2VD5A 1QCFA 4DCAA 5L6PA 4O7YA 4D0XA 4HNFA 1Y6BA 3NS9A 5CASA 3UP2A 3LCOA 4KKEA 4W9XA 4J95A 5CZIA 3HUCA 2HZIA 3L9LA 2XF0A 4R3RA 4U97A 5JQ5A 4HVHA 3QHWA 3R9RA 4L53A 1KOBA 1U54B 2QOHA 4S32A 3ZZEA 1TVOA 5CU6A 5DRDA 4BCPA 4H3QA 4LG4A 4EQUA 1P14A 2GHMA 4OTGA 2BR1A 4PF4A 4C35A 2JKKA 4C61A 3R1QA 4S34A 4DFLA 4PRJA 3ZU7A 4CLIA 3NGAA 4AFEA 2XCKA 3BEGA 2PVHA 3NCZA 5C4LA 4D58A 4I1ZA 5D12A 2YIWA 4ZTMA 4HCTA 5AP5A 1NXKA 4DG0E 4F4PA 5E92A 5D1JA 3VUTA 4EBVA 3BHTA 4EZ3A 1LR4A 4FKGA 2BRBA 4Z7HA 4WKQA 4XHKB 3VQUA 4QP9A 4FL2A 5I9YA 5AIKA 5ACBC 4C62A 2QOIA 4FG7A 4QT1A 2YAAA 3P7BA 3NNXA 4AQCA 3U6JA 3Q96A 3UNZA 3UPZA 1SVHA 2FA2A 2VTAA 2ZV8A 4O1PA 2RKUA 3W18A 2JIIA 3FSKA 2VWXA 5CXZA 1GIJA 3WYXA 5KO1A 4O0YA 4D28A 2Z7RA 3C1XA 3D2KA 4H1JA 3EWHA 4JLCA 4RJ7A 3UQCA 4OAVB 4IC7A 2YIXA 3QZGA 2GNIA 4L3JA 3FC2A 4I5PA 3V6RA 5DR6A 4O7SA 3VF8A 4MHAA 1MQ4A 3FZTA 4ZTRA 1PYEA 1JBPE 2R5TA 3QUEA 4GG7A 2PUIA 2BHEA 3A62A 3ZCLA 5GZ9A 4ACHA 4DHFA 3OG7A 4FIGA 1REKA 3JVRA 4JBPA 1R1WA 3QGYA 3VW8A 3K5VA 3WI6A 5BPYA 4YTCA 3CC6A 5L2QA 3GXLA 5L2IA 1Q62A 5HQ0A 4IWDA 2YDJA 3EN6A 4XBUA 2QVSE 4XP3A 1ZYLA 3TACA 3VIDA 5HG5A 2CGXA 1OUYA 2Z7SA 2VTHA 1ATPE 5A4CA 1BUHA 3BX5A 4QQCA 3V51A 3QXPA 5F20A 4C4GA 5EOLA 2B9IA 3R73A 3DTCA 1OBDA 2C6EA 3F82A 4LRMA 1Q99A 2YCFA 1B6CB 3ZLWA 4C3PA 4EH9A 2PULA 4GH2A 4XCUA 1Q3DA 2PY3A 3Q5IA 2A27A 3VAPA 5CY3A 3ENHA 2NO3A 3RVGA 2P33A 4GUEA 3DAEA 2FSMX 1BKXA 1Q8UA 4YC8A 3OXTA 3P1AA 2OH0E 4QD6A 4RZVA 4E6QA 4FOCA 3G6HA 5C9CA 3LFNA 4FSTA 2XS0A 2OF2A 3GU6A 3WARA 4CCBA 5DMZA 3OCGA 5HNGA 4YZNA 1ZYSA 4IAFA 4HZSA 4J8MA 2J6MA 1NW1A 4MXYA 3FLZA 3KXGA 3OUNB 4GJ2A 5HOAA 3ERKA 3KREA 3O2MA 4JI9A 3QUDA 4G5JA 5GHVA 3UGCA 3IW8A 5J9YA 4D4VA 4MH7A 4YHJA 3R04A 4E3CA 5C8KA 4RQVA 1WCCA 2O0UA 3CSVA 4HJOA 5FP5A 2Y9QA 5KMMA 2UW6A 2Y6OA 3SXFA 2R3IA 3BLRA 5HEZA 4Z3VA 5BUIA 2IZTA 3ANRA 3REPA 5ICPA 4DLIA 5LVOA 5A4LA 4K77A 5I9ZA 3G90X 3TZ9A 4EH4A 4U41A 3EL7A 3VNTA 1I09A 2BUJA 3KMWA 1HCLA 4IBMA 5KZ0A 5I3RA 2GS7A 2LGCA 3ETAA 3QD0A 4FKJA 3ZBXA 4E6DA 4E8AA 5AA9A 4QP1A 4ARKA 2EB2A 2OXXA 4A7CA 5CU3A 3DAJA 3VWAA 4L3LA 3RPSA 5IQGA 5HG9A 5A4TA 4GS6A 1XWSA 3QGWA 2BHHA 1UNGA 2PHKA 4M0YA 4X2GA 1FBNA 3DCVA 3QL8A 3TG1A 5GZAA 4GCJA 3PZEA 3QZIA 5KMKA 1XBAA 4FG9A 4CKJA 2XKFA 4R3CA 5AP1A 4MXZA 4RFMA 3C4EA 5IA0A 4JR7A 4DH7A 3BI6A 3MFUA 2X1NA 4YMJA 1O6YA 3WZKA 3KRWA 3V8WA 3FDNA 3D14A 1UU8A 2B9HA 1EH4A 2E9UA 4QP4A 1AGWA 5ANEA 3VBWA 3SLSA 3WF8A 4DT9A 2H9VA 1PY5A 4AT4A 5KMIA 2ITXA 4FVRA 2BTRA 4RJ8A 3TWJA 3RCDA 5J79A 3P0MA 1ZAOA 3EH9A 3PRIA 2Y6MA 1M2PA 3QRKA 4ITHA 4J7BA 4NCTC 3QTXA 3ZO1A 4ALUA 4BI1A 3FAAA 2HZ0A 2JDVA 5CU0A 5A9UA 3PA4A 2QLUA 3PSCA 5DEWA 4EOOA 3ACKA 1CM8A 4N4SA 3GU8A 2B9JA 3NUYA 1ZWSA 3CXWA 4FZ7A 4FE2A 1PXNA 2P2IA 1SMHA 5F9EA 3HV4A 4FKWA 2UZLA 2AUHA 4OW8A 4YNOA 3HMIA 4PP7A 2J51A 5IQCA 3P4KA 5HKMA 5HZNA 2WMXA 2XIRA 3A4OX 1UU3A 3H9OA 4QQ5A 5FBNC 5KNJA 3G15A 5FUTA 2CLXA 3MDYA 3ZOSA 3FI3A 4DEGA 5HG7A 3EFKA 3QZHA 4YGAA 5CEKA 3BGPA 3E5AA 4EOJA 5ACKA 4XV1A 3AMAA 4MVFA 5AX9A 4R3PA 2X8IA 5H2UA 4LGGA 4RRVA 3HP5A 2YIQA 4C0TA 1SM2A 4N6ZA 2WTKC 3QQKA 5AMNA 1ZZLA 4BB4A 4O82A 3U9CA 3KRJA 3JY0A 3NR9A 4K33A 5KHWA 3F3UA 1KE8A 1ZMWA 2OU7A 5IDPA 3V5QA 4DAWA 2AC5A 2C6MA 3H10A 3LCTA 3MFRA 3R1SA 3G9LX 2XIYA 1BI8A 3NDMA 4U40A 2XK4A 3ZC5A 2WEIA 4AA5A 4RA5A 4D4RA 1IR3A 4BGQA 4FZ6A 2YHVA 4F64A 4KINA 4AZFA 3MIAA 4KKHA 4ZSJA 1URWA 2C5VA 4FX3A 4AE9A 5IMXA 4S31A 1S9JA 1VEBA 5A4QA 3I0QA 5C26A 3GEQA 4CSVA 3LXNA 4JX7A 4F08A 5CI7A 2VNWA 5FDXA 3LFCA 4M68A 3R8VA 3H9FA 4LL5A 3PG3A 3FI4A 2R3QA 4BCJA 2QD9A 4RWIA 2C6OA 2NP8A 4EH8A 2OG8A 2E9VA 2ZDUA 5ANJA 3CP9A 1TQPA 3JPVA 1NVQA 2JDRA 2YFXA 3W2CA 2C6TA 3TN8A 2WKMA 3DAKA 2GNLA 4FVQA 3EKKA 2WAJA 4GKIA 4DH5A 3ZM9A 4XG9A 5C03A 4RZWA 4BDAA 2P4IA 3Q9YA 5DFPA 4I5CA 2X2MA 2C6KA 3PWDA 4LL0A 4YZBA 3BKBA 5DWRA 5FXRA 5K9IA 2XVDA 2R4BA 4EHGA 4KBKA 3A4PA 3LM5A 4K18A 3CTJA 4O22A 3PVWA 4DF3A 2BILB 3ZZWA 3F5GA 3PPKA 3UIUA 4DEEA 4PL4A 2J0KA 4J52A 2J0MB 4AA4A 3R8UA 4F0IA 4FEVA 4CFUA 4TYHB 1GIHA 4O86A 2VWVA 4L6QA 4TW9A 5EH0A 5I0BA 1YHWA 3F5UA 1IASA 4MBLA 1WBWA 3BU5A 1H0VA 4YO6A 3IW7A 5CWZA 4S33A 1OITA 1GIIA 1UU9A 3DLZA 4D2RA 1BL7A 3NLBA 5FRIA 4I23A 4R5YA 3E8NA 5E1EA 4TT7A 4FTLA 2FYSA 5HIBA 2Q83A 3AC5A 4TNDA 4RC3A 5LOHA 2QOLA 2RFSA 4J8NA 3PP1A 3RALA 4FICA 3TKUA 3VHKA 3BCEA 5LVPA 4UYNA 3VULA 4AZVA 2CN5A 2WEVA 1ZMVA 4H39A 5DR9A 3OT8A 1W8CA 2IZUA 3I6UA 3EFLA 4OUCA 4X2JA 4YPSA 4Z55A 5H8BA 3UO4A 1XJDA 2X7FA 4DFBA 2UUEA 2VTRA 2WMQA 3HV6A 1WBPA 3F3VA 3QTWA 1R3CA 3WZUA 3OCBA 3I0OA 4YP8A 2HELA 3UPXA 1OPKA 2YJRA 2ONLA 4NW5A 4XRJA 4EH3A 4RJ4A 1W7HA 4DFZE 4AZEA 2VTLA 4NFNA 4RX8A 3MH3A 3RINA 3NNUA 2X6DA 2ZVAA 4KIKB 2XNPA 4CTCA 3R1YA 4RFYA 4JR3A 2W4OA 2PZRA 3ACJA 3A7GA 4MNEB 2BKKA 3OWJA 4EYMA 3C50A 5EKNA 3PXFA 3VS2A 3QWJA 3Q9XA 2QI8A 4FIJA 3T3UA 5AEPA 1DS5A 3QU0A 4C2VA 4CMUA 2C6DA 4NZWB 2YCQA 4O0UA 4U80A 5BUEA 2R3LA 3UMWA 4UXQA 5AP7A 5FTOA 4ALVA 2XZSA 1Y6AA 4USFA 5FQDC 4EOKA 3FBVA 5E9EA 4JBVA 2G01A 3POZA 5ANDA 3R8ZA 4GT3A 4F6UA 5CZHA 2WZJA 1IA9A 2XNOA 1JSVA 2JC6A 3LZBA 2UZTA 5B2MA 5HVYA 4KS7A 2IO6A 3Q2JA 4FMQA 5HG8A 2VTPA 4HYSA 4BBMA 4L46A 3AC4A 1A06A 2I0VA 4V04A 1T45A 3DBDA 3O8PA 3CQUA 3L8SA 4ZSEA 3VUHA 4RC2A 4C57A 4MWIA 4OBPA 3Q3BA 2PZ5A 2R3FA 5KMNA 4O38A 3S3IA 4HPUE 4AOIA 1YXXA 2OFUA 3G9NA 3VUGA 5LMBA 4FNYA 2G9XA 2J9MA 2PSQA 4IEBA 3R9DA 4AGUA 4PX6A 3RK5A 1IRKA 3PY0A 4WRSA 2IVSA 3V5JA 2ERZE 4P4CA 4AZWA 3DDQA 3OOMA 4EI4A 2R3JA 4FZFB 5AA8A 1OUKA 1PKGA 2NRYA 1OB3A 3TJCA 4MBIA 4IB0A 4XOZA 3VBVA 3Q60A 1JKKA 4FUYA 4E4LA 3M2WA 3AT3A 4L3PA 2UVYA 4BYIA 5JQ8A 4HW7A 4D9TA 4RJ3A 1G8AA 2UVZA 1M2RA 3PDTA 2B4SB 2H6DA 3D5XA 1OKZA 2WO6A 3JY9A 4LGHA 3R7OA 4P90A 4IC8A 3LKMA 3EB0A 3MH2A 4HYIA 3A2CA 4RWLA 5DT3A 2QKWB 2CHLA 1SVEA 4KKGA 4QOXA 3HZTA 3MH1A 1H08A 2O64A 4F1OA 5JN2A 4E5WA 3TIZA 1YVJA 3GCSA 2EWAA 2OLCA 3D5WA 4UB7A 2ZDTA 4D5HA 1G8SA 3NMUF 4X3FC 4RX5A 3GP0A 4UMRA 5B0XA 5KHXA 3DB8A 4KWPA 4L44A 4BCFA 2Z02A 4BHZA 5M4FA 2X9EA 3CD3A 3ZHPC 3F5XA 3IDCA 2B54A 4MD9E 3FLSA 4QP2A 4C8BA 4G3DA 3D83A 4YSJA 4KUJA 1PMEA 5HU9A 4FTRA 3OXZA 3ID6C 3EKNA 3N51A 1GY3A 1NT2A 5HLWA 2PZIA 5CSPA 3LOKA 3V5LA 2C3IB 3NWWA 4QQJA 2QONA 3WE8A 5L8KA 5E7RA 4FSNA 3N4UA 2BAKA 3QRJA 2IW6A 4FK3A 2YISA 3R9NA 4KBAA 5IUGA 4D4SA 3COIA 4IZ7A 3WF5A 1H25A 4NW6A 4DC2A 2I0EA 3AC1A 3NAXA 1TQMA 3DTWA 2XCHA 3CKXA 4YZ9A 5EHYA 4BF2A 4HGEA 4A4XA 4IVCA 4W9WA 4EQMA 4AGWA 4D2WA 5LARA 2J0IA 5H8GA 2HYYA 2ZV7A 3V01A 2GFSA 2ITWA 3DZQA 4WT6A 4CYJA 2JDSA 5AR3A 4P5ZA 3F7ZA 4TN6A 1RE8A 3KA0A 3BHUA 2VWBA 3TT0A 1U5RA 1WVYA 4O81A 5AADA 2ITYA 5M53A 1PXLA 3CEKA 3IONA 2A0CX 4JXFA 4F9BA 5JKGA 4BGGA 2FGIA 3LPBA 3MB6A 2QG5A 3R02A 4MBJA 2WMAA 5TKDA 4BIDA 4WNOA 5FM3A 3FKOA 4EKKA 4FEQA 1XH5A 4C3RA 4FC0A 5E90A 5CF5A 3FQSA 3OC1A 3BLQA 4YHFA 4ZLYA 2YEXA 1H01A 3VBTA 4EORA 5TR6A 4I5HA 4NUSA 3E8DA 3LCKA 3Q5ZA 1UKIA 2UZBA 5IQEA 4PDOA 3A61A 1ZARA 5CQUA 4AZTA 1W84A 3U87A 4F63A 3P86A 2OKRA 3PA5A 3HAMA 2VWIA 4DYMA 5JT2A 3GNIB 4RX9A 3PXQA 3G33A 2QQ7A 1PXMA 4JG6A 2O3PA 2ITQA 5CU4A 2F2UA
chains in the Genus database with same CATH superfamily
4HZRA 3L8XA 4DFXE 1BX6A 4QMVA 3LM0A 4E20A 5D11A 2C0OA 3HDMA 4TKSA 2EB3A 4ORKA 1FINA 2QNJA 3OWKA 2WTVA 4TWOA 3PSDA 4NM7A 3ZYAA 5IEXA 5CS6A 2EVAA 3NRMA 3VS3A 1OL6A 1RW8A 4AOJA 4PL5A 4M7IA 5DHJA 4BKJA 2HENA 1QMZA 2UV2A 2XB7A 4YTFA 4JIAA 3V3VA 4O7TA 5HE0A 5M07A 4MNFA 5IH6A 1E1XA 4FF8A 4EJ7A 3CE3A 2PVLA 2YACA 5B2LA 1W0XC 2BROA 3W0PA 4JOAA 3UDBA 2I6LA 3S1HA 3NUAA 3UYTA 4XBRA 4GKHA 3GI3A 3KCKA 4ITIA 4WNKA 2CGVA 3DU8A 3W2SA 5L2SA 2W1EA 3ZLSA 4KBCA 3O7LB 4GMYA 1YI4A 3Q4UA 4QMMA 3EJ1A 4QMTA 1F0QA 4JT3A 2ITZA 2J4ZA 3DKCA 4I0TA 4UV0A 2CDZA 3E63A 2GQRA 4GT4A 3UE4A 4L00A 4EUTA 3QA0A 3LJ0A 4I0SA 3EHAA 3PPJA 4FL1A 4FKPA 4V0GA 4IXPA 2YA9A 4RIXA 4GW8A 3IDPA 3MB7A 5IA2A 4BIEA 4LUDA 4YC6A 2VX1A 4XLVA 4E4MA 3QD3A 4CTBA 2X6EA 4I6FA 4X6RA 5IQAA 3BHYA 1FMKA 3R7IA 4OTIA 3HV7A 1WFCA 2WTKB 1SVGA 4WHZA 1P2AA 4USDA 3MPTA 4HGSA 3PXKA 3ZSIA 2XBJA 3I1AA 1PXPA 2OZAB 4DEBA 5C01A 3UODA 5HO7A 2WMVA 5KZIA 3FEGA 4FZDB 1G8JA 3NAYA 2PPQA 3GGFA 3TV4A 3I6WA 4E93A 5M08A 2Z8CA 2W4JA 5T6KA 3R9HA 4FEXA 3C5UA 4TRLA 3NW5A 5DPVA 3LAUA 3RK9A 3VS5A 4CT1A 5G1XA 3ML1A 4AW0A 3P08A 5BYZA 2F57A 2GSFA 2I0YA 4F9WA 2W7XA 4W4VA 2PK9A 3FZ1A 5EDQA 2X9FA 3OCSA 3ROCA 3ULZA 3D4QA 3D7TB 3R21A 3ULIA 3FKNA 3PJ2A 3QALE 4BDFA 3W0SA 4FV1A 4TYHA 3D5VA 4X7QA 4TYEA 2C5NA 4JQ8A 5I9UA 2QURA 3FC1X 4FG8A 1Q41A 3DB6A 2YM8A 3HRCA 1PXIA 3R00A 3TIYA 1V0BA 4IB5A 3ZEPA 4ZS0A 2JKQA 4A9UA 4MF1A 1Y8YA 2R3HA 2VU3A 4QMPA 2UW7A 4FSYA 4I41A 1JKLA 5CXHA 5IPJA 1XH8A 3UZPA 3K3IA 3MVJA 3I81A 1E1VA 2VUWA 3TXOA 3HRBA 2UZWE 3AT4A 2QU5A 4EBWA 4LOOA 2J2IB 2OK1A 4YJRA 5IA4A 3W33A 4OT5A 4FT0A 1GOLA 3I7CA 4UWBA 2E9PA 2HAKA 2W96B 4F99A 4QTDA 3GU4A 3EQCA 3KMUA 4WA9A 5BNJA 4CKRA 2QO2A 4PP9A 4ZY4A 3ZM4A 3ZUTA 3OD6X 5K3YA 2BAQA 4AN2A 4PV0A 4IWPA 3RPOA 5M09A 5AAFA 3KXMA 3O71A 5ITAA 4BI2A 2XYNA 3F3WA 4O7VA 4I20A 1NY3A 2F2CB 3BWFA 4GVAA 2HK5A 2R7IA 3C4CA 4ACGA 5AUZA 4HVSA 4G2FA 4I93A 3OBGA 4A9TA 3WZDA 2VZ6A 4FV9A 4DT8A 3QTZA 4BDEA 4PPAA 4C4EA 3BV2A 5HHWA 5ETAA 4CV8A 4PMTA 2O2UA 1OECA 4PMPA 4LMNA 5K0KA 5LWMA 1PXJA 1O6KA 4XG7A 3DLSA 2RG6A 5HICA 5DI1A 4U43A 2FB8A 4GU9A 1H1RA 4BJJB 3BYOA 2VTOA 3GC8A 4IZAA 3SX9A 1UNHA 1U46A 5J7HA 5C8MA 5IA3A 4IWOA 4ZJJA 2WMBA 4NKAA 4R7BA 4AF3A 4IMYA 4PTEA 4QYHA 3RP9A 5BUJA 2FSOX 4ACCA 1FVVA 2C0IA 2OI4X 3HMNA 2RL5A 5J7BA 2V5QA 4C7TA 4ZMFA 3TDVA 2WOUA 3ZO3A 2QOFA 2EUFB 4Q5HA 4RLKA 3U51A 4D2SA 2WQOA 2CLQA 2BVAA 5HNBA 4D9UA 5I3OA 2W17A 1LUFA 3U4WA 5J1WA 2DYLA 4FR4A 4XS2A 1ZZ2A 3PTGA 4KSPA 4B8LA 4EJNA 2VO7A 2VTNA 5KCVA 2PTKA 3AGMA 5AP0A 3GENA 3IQ7A 1OKYA 4QYEA 4FV3A 1GZ8A 3NW7A 4G6NA 5DNRA 1H1PA 1WBTA 2XM8A 3TNHA 2WMSA 4BIBA 3Q2MA 4M69A 2QR7A 1SYKA 4FYNA 2UW8A 4M0ZA 4UX9A 5IQIA 4FYOA 4NT4A 3WF9A 4EYJA 4R7HA 3VQHA 2RIOA 4U3ZA 4RSSA 3UBDA 2UZUE 3BYMA 4AACA 4QYYA 4CXAA 1CTPE 2IF8A 3VUDA 5GIPE 4C36A 3OROA 4FVPA 2ZB1A 3QZFA 4HNIA 2B1PA 2XK6A 2XYUA 3VS7A 3VS6A 3K54A 3GC9A 5EW8A 1W2CA 4C3FA 4FKUA 2ZB0A 3CLYA 3KVXA 3PA3A 3QTUA 1ZYCA 4RIWA 4FKQA 4ZP5A 4BCQA 4D2TA 4F1MA 3VC4A 4APPA 2XIZA 4JJRA 4DTBA 4YLKA 4YO4A 2ESMA 2P3GX 3FE3A 4FKVA 3KK9A 4E7WA 2QOCA 5D10A 1OGUA 2C4GA 3A7HA 3LLAA 2CGWA 3MY5A 3TM0A 3V5PA 1NVRA 3F61A 3RPRA 3R83A 3A8XA 1XBCA 3E88A 4AUAA 2AEGA 3BHVA 3PLSA 3I5ZA 4OTFA 2UZNA 4I0RA 4KB8A 2BRHA 4NM5A 4AT3A 4L45A 3TL8A 3VJOA 3RZBA 5M4UA 4FK6A 3OEZA 1ZYDA 4ZOGA 2EU9A 2C1BA 5EW3A 4FJVA 1Q24A 4LRJA 3RCJA 2QU6A 5AR4A 1R0EA 3PE2A 4BZDA 2NNWB 2X0GA 4FKIA 5AR7A 5CNOA 2CGUA 2F7EE 3UZTA 4YHTA 2VRXA 3R30A 3CQEA 4ZJIA 4U79A 2ACXA 4GV1A 4RGJA 3RAIA 1K2PA 3EQHA 4CLJA 1Q8YA 3R28A 1DAWA 4GVJA 4R5SA 3VBXA 3VN9A 4X3FB 4QP8A 3OEFX 1OL2A 3TKIA 3VHEA 2BRNA 3PVBA 3VRZA 5A6OA 3DBFA 4EOSA 1YOMA 4O84A 3F69A 3F3TA 3R9OA 1MP8A 3F3ZA 4EHEA 1KV1A 3JUHA 3MWUA 2WMWA 1QPDA 2W5HA 3MVHA 2W5AA 4GFOA 3ZH8A 1QL6A 3ZUVA 3ZDUA 4DITA 5CAQA 2BMCA 5CI6A 5DOSA 1QPJA 2JFLA 3A60A 2WQEA 4HCUA 4NU1A 4QMNA 4EWQA 1YW2A 4I94A 3HMOA 1A9UA 3MSSA 3AMBA 3ORTA 3OW4A 5C8NA 3HAVA 4QTBA 2Q0NA 4OTRA 3E62A 3MVLA 1YHSA 3FMKA 3QKLA 2UZDA 1GZKA 3HVCA 1KWPA 4J1RA 5BX0A 4H3PA 2X7OA 5HX8A 4AP7A 3BGQA 1XHAA 1YXUA 3UIBA 3A8WA 4FSZA 4DEHA 3KKVA 3FPQA 4F7NA 2BCJA 4FKLA 2WIPA 4KAOA 1FMOE 3ORLA 4KS8A 5KMJA 3ORXA 3OY1A 1YWRA 2PVNA 3DQXA 4G3CA 4NIFA 5AX3A 4F70A 3FHRA 2I7QA 3SAYA 4DGNA 5J9LA 4ZS4A 4OTHA 4AXCA 2X7GA 4RFZA 4GK4A 1P4OA 1M2QA 4C59A 5CNNA 3EZVA 3TNPC 2JBOA 1REJA 3D7ZA 2ETKA 4LFIA 5TOZA 4H1MA 3VF9A 3WZEA 2H8HA 3HECA 4D4YA 3PXYA 4TWPA 3QRUA 1MRUA 3ZDIA 1Y8GA 3L9PA 2XANA 4E6CA 2RFDA 5TO8A 1YWNA 5EM5A 4C02A 4W8DA 3OY3A 4K6ZA 1S9IA 1Q8WA 4FL3A 3I4BA 2R3NA 3BPRA 5HORA 1IAHA 2C0TA 1GAGA 2O65A 3KCFA 4MQ1A 1YDTE 3A7IA 5CYIA 5I9WA 5LQFA 1GNGA 4EK4A 1PRYA 2P0CA 2WFYA 2R9SA 5E4HA 3RM6A 2X2LA 2C30A 2XMYA 4EHZA 5IG1A 4J53A 2Z7LA 4FT7A 4I6BA 1JNKA 4YJSA 2JDOA 3LFFA 4IX5A 1OKVA 4R6VA 5ETFA 1Z5MA 4IJPA 4LM5A 4WSQA 5J5SA 2JEDA 2XNEA 3M42A 2CKPA 4LUEA 3OW3A 4EHVA 3KULA 4CV9A 5FD2A 2YM5A 1VJYA 2WU6A 3BE9A 5GJGA 4ASEA 4BWXA 3Q6UA 3MESA 4QMOA 3FV8A 3GU5A 2FH9A 4L42A 4RVLA 2GMXA 4N0SA 4YJNA 3F2AA 2QODA 4CFXA 1J1BA 4ACDA 2WTWA 4GT5A 2XIXA 4PDSA 3U55A 1CDKA 2HW6A 4YJTA 3RGFA 2CNVA 3SD0A 3UVRA 5EQPA 2QLQA 4NJ3A 4NSTA 4PPBA 4J96A 4X6QC 2BIKB 3R7YA 1JPAA 1MUOA 1W83A 4M12A 2OIQA 2ZM4A 2AC3A 4R1YA 3O23A 4G16A 3HGKA 3S0OA 1YRPA 5FLFA 4XRLA 3NVKI 1YHVA 3UP7A 2PMIA 4LRKA 4Z9LA 4RVMA 5J95A 4BCGA 2VO3A 3C7QA 4X3JA 4BFMA 5HCYA 3FHIA 5AR8A 3FXZA 3SRVB 5HD7A 3NUXA 1YXTA 2VTIA 4G9RA 4YJVA 4BKZA 1Q8TA 3UDTA 4AFJA 2V55A 4XG3A 5KKRC 2W1ZA 1OM1A 5EDPA 3DK3A 2YZLA 4WG4A 5AV1A 2YABA 4J99A 2R3GA 3RM7A 3V6SA 3ZO2A 3MI9A 5HTIA 2YWVA 2C3KA 5HVJA 4ANMA 3RK7A 4EK8A 3N4TA 2FUMA 2WD1A 3WF7A 4AW2A 3VO3A 3RHKA 1XO2B 3Q52A 3QFVA 3LMGA 2XKCA 4JRVA 3VUMA 5CAVA 3O96A 1ZY4A 3DZOA 2BAJA 4V05A 3U8WA 3IW4A 3MH0A 2C5OA 3W55A 3G0EA 2YCRA 5GJDA 2BZJA 3ODZX 4GSBA 1YI3A 3CTHA 4XNEA 4CFMA 4ZSAA 5IF1A 1PMUA 4DH8A 4F1TA 5B2KA 3O0GA 3OBJA 5GINE 3WYYA 2HW7A 4QRCA 5HGIA 5JZJA 5IQDA 3MW1A 4FTMA 1JQHA 3OP5A 4U44A 4GK2A 1TKIA 2PZYA 3R7EA 2WQMA 3H0YA 3R6XA 3K3JA 4FGBA 5AUWA 3VUKA 3CY3A 3MPMA 3C0HA 3BLAA 4IZ5A 2G1TA 3DK6A 1FGIA 5A54A 1AQ1A 2ZM1A 5CVHA 3DBCA 2PUPA 4IB3A 1OKWA 3NSZA 1Z57A 1LEWA 4IVBA 1M7NA 1ZLTA 2IWIA 4PDPA 2DWBA 4B0GA 5GJFA 3EQPA 3U6IA 2W1DA 1J7LA 4FSQA 1CSNA 2W0JA 3WF6A 2GS6A 1IAJA 4C38A 5KMLA 5FEDA 5T3QA 1OPJA 4RIOA 5D7VA 4K8AA 4F0FA 1H1WA 1U54A 2YIRA 3DJ7A 3EQRA 2ONLC 4CGAA 4Y95A 4IM2A 2IEWA 3ZMMA 2UZOA 4YC3A 1V0OA 1PW2A 4JQEA 4RG0A 1CKIA 5TF9A 2OBJA 3VS4A 4PMMA 1H07A 4Y73A 5LVMA 3LCSA 2YDKA 3EFWA 4G6OA 4BBFA 3HDNA 4EL9A 4XUFA 5TT7A 1VR2A 2GHGA 4HGLA 4O0WA 4QQTA 4ONAA 3L8PA 4WBOA 3UO6A 3FMEA 3W16A 4DG3E 5L8LA 3QLFA 3AC8A 4FZAB 4BDHA 5KMOA 5F94A 4UN0C 2QG7A 4EC9A 4FT9A 2XAOA 3QQUA 5HLNA 1Q61A 4G17A 3IG7A 4WBBB 4FEUA 1OIUA 2VX0A 4U45A 4ITJA 3R2BA 4AXFA 4BHNA 2KULA 4ANQA 3Q9WA 4XP2A 2V7AA 2F7XE 1SZMA 2XRWA 2WHBA 3MA3A 3MA6A 2BRGA 4GUBA 5JRQA 4O7WA 1KE9A 3MFSA 4O27B 4G34A 3FLQA 3MBLA 5BMMA 4X21A 4FT3A 3R8LA 3PSBA 5LMAA 5JGBA 4AN9A 3B2TA 2GNFA 3EN4A 4L67A 5KBRA 5AM6A 2ITPA 1FOTA 3QQGA 4AQKA 1SNXA 3M11A 3P79A 4L9IA 4E5AX 5HIEA 5EYKA 3TKHA 1R39A 1APME 3ZC6A 3P7AA 1BMKA 4DTKA 5CF4A 3FMJA 4EZ5A 3DXQA 5CU2A 3AD5A 2YLFA 3IS5A 4Q9ZA 3QCXA 1XH6A 3DXPA 3PY1A 1MRYA 3U4UA 1MRVA 4TL0A 3DPKA 2OIBA 3I7BA 4DH1A 4FIFA 4V01A 3KIOC 4BZNA 4ANOA 5L2TA 4JVGA 4WO5A 2XK8A 2C5XA 3QAME 4QP7A 5JFXA 2HCKA 2CCHA 2P55A 3CBLA 3WIKA 2CN8A 3QQJA 3RAHA 3QHRA 4YUQA 1H1SA 4ZJVA 2CKQA 3UOHA 4O7NA 4BBEA 3NUPA 3O5AA 3PFYA 5BVDA 4QO9A 4F6WA 4FTTA 1CKPA 2IVUA 4C34A 4F09A 4CCUA 4I22A 5K0XA 5LVLA 4E73A 1HCKA 3GCUA 4L7SA 2WTIA 5AUTA 4OGRA 3NUUA 3V8SA 2BZIB 1F5QA 3DBQA 2Z60A 3THBA 4EOLA 4BR3A 4A9RA 4AOTA 4F6SA 4ZXTA 1OL7A 3ENMA 4XP0A 3UNJA 4RWJA 3MYGA 5CEIA 1PJKA 2BDWA 3KC3A 1KOAA 2JIUA 3HEGA 4BCOA 4O7LA 2VWYA 3RHXA 3FL4A 5CVFA 5M4CA 4MF0A 5JK3A 5HCXA 3PYYA 1ZXEA 4UZHA 3QA8A 4JNWA 5EOBA 4PDYA 4ZY6A 2OWBA 2R3MA 2XEYA 4CFNA 3NX8A 4O6LA 4PTGA 3PFQA 4BTMA 2QCSA 2XEZA 2XBAA 4FSWA 5BQ0A 5A3XA 3BBWA 2ITOA 5D7AA 4BTFA 2BPMA 2YZAA 3FLNC 5IQHA 1IG1A 2QKRA 3D15A 4IDTA 4DGOA 5JZNA 2R7BA 4NJDA 3PPZA 3CY2A 4NK9A 3FMDA 3T9TA 4H05A 2ZAZA 4YZMA 4YR8A 3Q4TA 2ETMA 3HL7A 4BTJA 5HNIX 5LCJA 5HTCA 3UC3A 3PLAE 3O8TA 1Q3WA 5DT0A 1M14A 2V22A 3W0OA 2OXDA 4QTCA 3BU6A 3DKGA 2QOBA 1KE7A 4K2RA 2YM7A 4MTAA 3E8CA 4FKSA 4WSYA 3R7UA 4FA2A 2OSCA 3W10A 3NEWA 4IADA 3QRTA 5IMEA 5EG3A 2CKOA 2NYAA 1OMWA 3F88A 2XNMA 4QTAA 3IGGA 3L1SA 4FSRA 4BL1A 1XKKA 3TCPA 3W1FA 4GFGA 3F7WA 3FXXA 3O51A 4JDIA 1H4LA 2RSVA 4NM3A 3MJ1A 3LFDA 4G3EA 4NTSA 3OFMA 1DM2A 2EXCX 2V7OA 3DXNA 1WAKA 3C13A 3LXKA 4G31A 1U4DA 5CEOA 4MQ2A 5CVGA 4FTQA 2HOGA 3HA8A 2CJMA 3QC9A 3O7LD 2LAVA 2C3JA 2ZJWA 1V0PA 4TYGA 2JKOA 3N4VA 4BDBA 5CAUA 4RJ5A 2R3KA 5FEQA 3SVVA 4AZSA 2PUNA 1FVRA 3HX4A 2YLEA 5I9VA 3MPAA 1J7UA 2JAMA 4DA5A 3MY0A 2XK9A 5A4EA 3WOWA 4O4BB 1UU7A 2WGJA 1YDRE 3RBWA 4AT5A 1JKTA 3LW0A 4AN3A 5C1QB 2W9FB 3G2FA 1UKHA 3L9NA 3DS6A 1H1QA 3OTVA 4W4WA 2G15A 2PMNX 3CQWA 4EWHA 3CR0A 3LFAA 4ZTLA 4K0YA 1VYWA 3HYHA 3QYWA 3U9NA 5EI2A 2UZVA 2XNGA 1ZOEA 3VBYA 1PKDA 3FLWA 5EK7A 3UG2A 2JFMA 4HGTA 5EI6A 4KIPA 3W2RA 5HO8A 5CEPA 3OXIA 3LCDA 1OL1A 5TE0A 5IA5A 3E92A 3PRFA 4DGLC 5FDPA 5KUPA 4AU8A 5M56A 2VGPA 2W05A 5CX9A 4F65A 3HNGA 4YBJA 3NW6A 2VV9A 2PE1A 3IW6A 4KRCA 3COHA 2EXEA 4H58A 4LQMA 4NWMA 3Q6WA 4O4EA 3QC4A 3QUPA 4TTHB 4GK3A 3FYJX 4Y46A 2BDFA 3FZSA 3KQ7A 3NYXA 4M66A 3T3VA 3C4XA 1PXOA 1LEZA 3ZXZA 5CT7A 4NH1A 3ITZA 3LIJA 3LFBA 3P23A 4DH3A 4GEOA 4ZAUA 2VTMA 5DN3A 3Q53A 2PVJA 4FTUA 4M3QA 4UZDA 2FSLX 3BV3A 3SQQA 4F9CA 5A6NA 3UDZA 5DEYA 3SV0A 5J9ZA 3LJ1A 3KB7A 2Z7QA 3RMFA 1GZNA 5HCZA 5HU3A 3DKFA 3AC2A 5CSHA 1JKSA 5FXQA 3HLLA 4OTPA 3DNEA 4TXCA 2V62A 3KK8A 4WG5A 5E8WA 3RTPA 4HVIA 3NUNA 3RPVA 5CEMA 2FSTX 2QHMA 2GCDA 2GTNA 3TZ8A 1L3RE 5FXSA 4UALA 3NVMB 4UY9A 3FMLA 5D41A 5BVWA 4GYIA 4RQKA 3PJ1A 4JDKA 5DRBA 4ZEGA 4R7IA 3UG1A 3QX4A 1OPLA 2XNBA 3E3BX 3PJCA 4XH6A 3RJCA 1WZYA 4EK3A 4ZZNA 1XH4A 1VZOA 5JGAA 3ATSA 1RJBA 2JIVA 2XUUA 3GOPA 4LV8A 5EDRA 3DA6A 4N70A 1W2FA 5LCKA 5LMKA 2SRCA 2C1AA 2JKMA 5J1VA 5F95A 4FV4A 4IANA 4D1XA 1YOLA 4GIHA 5G6VA 5J87A 5H3QA 3NZ0A 3AG9A 3VRYA 3AOXA 1P5EA 4XJ0A 1NVSA 3NNVA 1JAMA 2HY81 2IZSA 2QR8A 2YDIA 4P5QA 4LV5A 5HIDA 3TNQB 5AV0A 5HD4A 2BZKB 1YQJA 2H34A 4YLJA 2ZMDA 3KXHA 5KKRB 2OJ9A 3E93A 4KNBA 4QMSA 1O6LA 3FSFA 5IKWA 3ZUUA 3OHTA 4G1WA 4L8MA 4MCVA 5DA3A 4KABA 3CCNA 3C0IA 2GU8A 5BYYA 5B7VA 5IEVA 4WNPA 3HP2A 3SOCA 4FTIA 5CENA 3OMVA 3BBTB 2X8DA 3F6XA 5AM7A 1F3MC 1DAYA 2XH5A 3OUKA 2UZEA 4F9AA 1STCE 3TV6A 4FGRA 3W32A 3DNDA 2ITNA 4IAYA 4QMXA 3S4QA 5FTGA 4NKSA 3CTQA 4MK0A 3TI1A 3NFFB 4DBXA 4ENXA 4ZIMA 4O21A 2W9ZB 1XQZA 4DLJA 2GDOA 3CD8A 4ZK5A 3ALOA 2E2BA 5HBJA 4BWPA 1QPCA 2O63A 4BI0A 5KX8A 3AQVA 3W2PA 2R3PA 4FTOA 4W8EA 3FKLA 1CKJA 4KA3A 4KIKA 4KRDA 3DFCB 2WQNA 4YURA 4IX3A 4MNEA 5JSMA 1AD5A 4MUQA 3CJFA 2GHLA 5HX6A 3MY1A 4RT7A 2BFXA 5ETCA 3TDWA 4O2ZA 3A7FA 5CF8A 3LE6A 1H00A 4JG7A 4QDVA 2J7TA 3ALNA 4DDIA 2QOQA 3G0FA 3GC0A 4FTJA 5DH3A 4IM0A 4IM3A 1WBNA 3GCPA 4IJ9A 5AP4A 4FKTA 4U5JA 3FYKX 1Q97A 4N6YA 5EM7A 3UIXA 5LJJA 3UOJA 3DGKA 4AW5A 3FXWA 4IAAA 4YJUA 4ACMA 4MXXA 2Y4IC 1WBOA 1I44A 5FG8A 4UWYA 3LLTA 1JSTA 1UNLA 3A99A 4FTKA 4IQ6A 5IU2A 2XM9A 5LVNA 3SC1A 4CYIA 2XNNA 2QHNA 4BZOA 4NL0A 4I4FA 5JMSA 3C51A 4LDTA 3GOKA 4ASDA 4W4XA 1FVTA 2XJ0A 4YU2A 3II5A 3SGCA 4A4LA 4O96A 4ZTQA 1KE6A 4U3YA 4DFUA 3LMHA 4DTAA 3FLYA 3QQFA 2PE2A 4BN1A 5DBXA 4GYGA 4FTNA 4LGDA 1JWHA 5E8YA 3QRIA 1IA8A 3COKA 3KF7A 2VWWA 5DIAA 3KXXA 1XH9A 2X0QA 4RIYB 4U6RA 1KUTA 2GPHA 2J5EA 4AWIA 3LMIA 3E64A 3EN5A 1E9HA 3CGOA 5A46A 4CEGA 4LOPA 4K1BA 3JS2A 2BRMA 3KF4A 5EW9A 2ZV2A 1WMKA 3V8TA 5HVKA 4MKCA 4NEUA 3AD4A 4TNBA 3W8LA 4B4LA 2YIYA 2B9FA 4YJQA 4EH2A 5HTBA 3NPCA 3PIYA 4EQCA 2WTCA 2JDTA 4P2KA 4WUAA 4F7LA 4CFFA 3BLHA 3ZONA 5J5TA 3QX2A 3PJ8A 4PL3A 5HE2A 2HZNA 3R8PA 3W0MA 2UW9A 3ZLXA 4QP3A 4I21A 4A9SA 4MXCA 2RGPA 4ZLZA 4DE4A 5CALA 3O17A 4XLIA 3BYSA 5AR2A 2X2KA 2DUVA 3UMXA 3ROYA 1WBSA 3QYZA 4G6LA 3B8QA 4IDVA 4IW0A 5EYMA 3R8MA 1YKRA 2XJ1A 2YERA 5AJQA 4DFYA 4MXAA 2Y4PA 3UTOA 3HUBA 5DLSA 3QCYA 4DBNA 4ZSGA 3JVSA 5I9XA 1LP4A 1H27A 5CSXA 3UNKA 4X2NA 5IA1A 4HOKA 5IH5A 3DY7A 4AXEA 2GNGA 3ANQA 3BRBA 3WE4A 4EOQA 1KV2A 4C4JA 5GNKA 3BL9A 4I92A 4QYGA 3MN3A 2OICA 2OJIA 2PE0A 3O50A 4W4YA 5HE3A 1KSWA 5BVNA 4EH7A 2PVFA 5E8VA 4BCNA 3LFEA 3PIZA 4PMSA 4B9DA 1W98A 5ANIA 4EC8A 4C4HA 2YJSA 4TPTA 3HV5A 1PHKA 3ZXTA 4AE6A 3DKOA 4XX9A 4CVAA 3U54A 4ZZOA 4FKOA 4RVTA 4XYFA 4Y5QA 2F9GA 2YN8A 3QKKA 3UDSA 2Z2WA 2Y7JA 3AC3A 4MD8E 3LXPA 4QYFA 4O91A 4F9YA 3OWPA 1FGKA 3N9XA 3OOGA 1OL5A 3QTQA 3PUPA 2HIWA 4WG3A 3POOA 3WIGA 2R2PA 4XOYA 2AQXA 4NTTA 3IK3A 4YZCA 3BWJA 4MYGA 3E7OA 4TWCA 3DJ5A 2WNTA 3GBZA 3GC7A 3PE1A 5DVRA 2YWPA 5HBHA 1JVPP 2E9NA 3TUBA 4U9AA 4LI5A 4FNWA 4PNIA 5EHOA 4RVKA 3S00A 1PMNA 5ANOA 4YSMA 2WMRA 3GCVA 3KEXA 3KN6A 4AS0A 4IE9A 2CNUA 3FMMA 5H8EA 1OBGA 3FPMA 4A9YA 2DS1A 3D5UA 5DGZA 4BICA 3PWYA 4ZTSA 3VUIA 3DOGA 2UW3A 4XV3A 2Y8OA 4TYJA 5EFQA 4C2WA 4L52A 4YZDA 4TY1A 3TUCA 4M97A 2VNYA 3SW4A 2GFCA 3L8VA 3FQHA 4JBOA 5K4IA 2CKEA 4UMQA 3Q04A 4I6LA 1ST0A 5DG5A 3S95A 3BGZA 2QOOA 3IKAA 2W1FA 3OF0A 3OS3A 2B0QA 4O0TA 2H96A 5CT0A 1BYGA 2ERKA 3F5PA 3ODYX 3D2IA 4CZTA 4CG8A 1JLUE 3MFTA 2B55A 1YI6A 2X8EA 2Q0BA 3KMMA 4M67A 1H24A 2IW8A 2W4KA 4CRSA 5FGKA 2FVDA 2UVXA 2W1CA 3JYAA 4IHPA 4JIKA 4MEDA 2J0JA 4PQNA 3FZPA 4BC6A 5GZ8A 4WUNA 1J7IA 2ITUA 4PPCA 4FBXA 3LQ8A 1W82A 3RZFA 3EL8A 4NCTA 1PYXA 5HE1A 2HY0A 4AAAA 4IVAA 3T9IA 4ANLA 3IDBA 4Q2AA 4B8MA 4WIHA 3DQWA 1KE5A 5E8SA 3H30A 4BDDA 3D94A 4IFGA 4CMTA 4IX6A 3R1NA 4QMQA 4AXAA 3P5JC 3AT2A 4G3GA 4WNMA 4BTKA 4CKIA 4QMZA 4IAIA 4QMLA 3WZJA 2WU7A 1NA7A 2XKDA 3EN7A 2ITTA 4FODA 2ZOQA 5ANGA 4O2PA 3TJDA 3ZRLA 3BL7A 4I3ZA 4C4FA 2J5FA 3E3PA 3SHEA 2A2AA 5IDNA 4BGHA 1XBBA 5DR2A 3G5DA 4Z7GA 3F2NA 3D0EA 4QP6A 2CNQA