1Q8TA

The catalytic subunit of camp-dependent protein kinase (pka) in complex with rho-kinase inhibitor y-27632
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Protein kinase A in complex with Rho-kinase inhibitors Y-27632, Fasudil, and H-1152P: structural basis of selectivity.
pubmed doi rcsb
source organism Bos taurus
total genus 110
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q8tA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q8tA02
3ORNA 3VW8A 3QGYA 2UW5A 4V01A 2UZWE 2PMNX 5ICPA 3HA6A 3UJGA 3ZUUA 4L68A 3HDMA 3DFCB 4DCEA 2J0JA 1CMKE 2GU8A 2ITZA 1JNKA 2ZM1A 3FMNA 1M17A 3TKUA 4KSPA 3VS2A 4LMNA 1WZYA 4Y85A 3SGCA 5CNNA 2EXCX 4D2RA 3VUDA 2ITUA 1RDQE 2JIIA 2BCJA 2YM3A 3R63A 3U6HA 1M14A 3MH0A 5ACBC 4DFLA 4AGUA 4DFYA 4FC0A 2OFUA 2WU6A 4L8MA 4JQ7A 4LOQA 2ZMDA 1H1SA 4MXYA 2UW6A 3KCKA 1OMWA 4CCBA 3FC2A 1Q61A 2OO8X 3CJFA 3ACKA 3ENMA 4G16A 4O22A 1PRYA 3ZONA 4XBUA 3FV8A 3GXLA 3EQFA 3SA0A 4MCVA 3VRYA 4AW1A 3I5ZA 4QQCA 4MTAA 2XRWA 3VBWA 4BTMA 5I9ZA 4FTAA 5AR4A 1SVGA 3MB6A 3QRUA 4FT7A 4YTHA 4HVHA 3HP5A 2PUUA 3K3JA 3NUXA 1Q3WA 4GRBA 1Q8ZA 1Z9XA 2PZIA 3QC9A 2VGOA 2WOTA 2QO2A 3DU8A 4HNFA 1H1QA 3HZTA 1PHKA 2QNJA 3IW8A 5EDPA 4DBNA 3CJGA 5EI6A 1P2AA 1HCKA 2RFDA 4RVTA 2GS7A 2GMXA 2EWAA 4YLKA 4EZ5A 2RFNA 4I94A 5J9ZA 4GL9A 3FHRA 5EM7A 2BHEA 2WMTA 4KIQA 4KIPA 2Y9QA 5CU4A 1QL6A 2XNOA 5LCJA 4FVRA 3TIZA 5LMKA 3BHVA 5CXZA 5BVEA 4D5KA 1OPJA 3LLAA 3RVGA 5CF5A 3FKNA 4WOVA 4X3FB 4R3PA 1VR2A 4FT9A 5CSXA 2YZAA 3IKAA 4D28A 3KEXA 5H2UA 3NAYA 4FIGA 2FVDA 3DY7A 5DGZA 4RWJA 2WMWA 4L52A 4WRGA 4EOIA 5M57A 3DQXA 3ORMA 3GOPA 3L8PA 3R1YA 4I23A 5A54A 1SVEA 3GVUA 4M69A 2W5AA 4YC6A 1MUOA 2PULA 4KIKA 5M08A 3WE4A 5AFVA 4QYEA 3IW6A 5HG5A 3UTOA 4BYJA 3M1SA 2JIVA 4N6YA 3R8LA 5I3RA 2GS2A 4K9YA 4KABA 3LCDA 3E7VA 3C4XA 4E93A 5ANJA 3CCNA 4JDIA 4U42A 3D5UA 2YDIA 2PVLA 2IZRA 4FF8A 4UN0C 4Z3VA 5GZAA 1J7UA 2X2LA 4ANQA 3QQKA 1Q41A 3OY3A 5BPYA 4LL0A 3LCTA 4UYAA 4FZDB 3UP2A 4CT2A 3UOJA 3BU3A 4YNEA 3EQDA 5L2IA 2GSFA 5JGDA 2CGVA 1GZOA 5I4NA 1CDKA 3QQJA 4Q5EA 4ZSLA 4GUBA 4JNWA 3H9FA 5ETAA 3UYTA 2OZAB 4ZSAA 5HBHA 2C0IA 4OAVB 5IQGA 2YDJA 3GC9A 1URCA 5F20A 3BEAA 2ETMA 3ET7A 3EJ1A 3OXIA 4D1SA 5C03A 3AMBA 4R77A 3LW0A 3MSSA 2VO7A 5CX9A 1QPJA 3R8VA 4TYGA 4YPDA 2OIDA 4F1TA 1H0VA 4D2SA 3C0HA 2PUPA 4WT6A 1GZKA 2XH5A 2CSNA 1XH9A 3AC3A 3KMWA 3UVRA 3CIKA 4PTCA 2B53A 1YWNA 4I5MA 4IJ9A 4FKTA 2C5YA 4FSTA 2BDWA 3PLSA 3PA5A 4QMVA 3R9NA 2J0MB 4IZ7A 4ZP5A 4EQCA 5IDPA 5AP2A 4YZMA 5D1JA 5AV3A 4YLLA 1J7LA 3U9NA 4UMQA 2C0TA 5M4FA 4F9CA 1A06A 2VNYA 2O3PA 5E8UA 3HV3A 2CDZA 4FKLA 4J97A 4AW2A 2YN8A 2VD5A 2WQBA 2XIKA 4I4FA 1KSWA 4RJ6A 2V7AA 1JKLA 4G6NA 4JBQA 1T45A 2XNMA 4QP9A 3ZRKA 4E6AA 3LVPA 4ZIMA 4E4NA 1XH8A 2BRHA 2ITTA 2XK9A 3QC4A 3AC8A 3RPVA 1IAJA 4R5SA 4OTWA 5L8JA 4CMTA 2PZYA 4MF1A 2EVAA 2OJGA 5LVMA 4A06A 4I93A 4IHPA 1FOTA 2XVDA 3HMPA 4H1JA 4U45A 1BKXA 3C9WA 2FO0A 4C38A 5EHLA 4WSQA 4PNKA 3PLAE 1JSVA 2VTTA 3TEIA 4MBIA 3KXZA 5EYDA 3TIYA 5E1SA 5HIEA 2HK5A 2R64A 4XYFA 2WTCA 3PIXA 5HE2A 4G3FA 3PA4A 2BTSA 2VWXA 2X6DA 4Q9ZA 5JRQA 3VHEA 5ANIA 4H3BA 4CZYB 3U9CA 2BKZA 2E9UA 4B7TA 2PZRA 5D10A 4RIYA 2XNGA 2QU6A 3CPBA 4RIWA 4OLIA 3CEKA 3VAPA 3U4WA 1WBWA 2FH9A 2JDRA 4D2WA 5IH4A 4O7WA 2LGCA 2UZDA 4K6ZA 5AP1A 1W8CA 4E4LA 3VULA 4XG9A 3ZFXA 4C62A 4MNEA 5HNBA 3GC8A 4FTKA 3DCVA 2QD9A 5IA1A 4E26A 3G2FA 3KXHA 3DAJA 3EQGA 4FL2A 4FSUA 4NT4A 3KULB 4MXZA 4BCQA 2C5NA 1WFCA 3BIZA 4F7SA 4O7LA 3G51A 1KE5A 4PTEA 5D7AA 2PE2A 5LVPA 5A4QA 3QAME 2VX1A 2Z7QA 4U79A 3MWUA 5IA4A 4GJ2A 5KE0A 4ZZNA 3V3VA 3O8UA 4MXAA 4U80A 5KBQA 5BVKA 2O64A 3G0FA 1OL1A 2OU7A 2YZLA 4IZ5A 1G8SA 1GOLA 4M3QA 2GHLA 4FKGA 2CN8A 5DFPA 5EKOA 5L8KA 2R3KA 5FBNC 4BCJA 4JOAA 5IQIA 3MH1A 4UMUA 3BHYA 3EQPA 5DRDA 4B0GA 4FEUA 4C36A 2WELA 3L1SA 4IWDA 4MQ2A 2VWUA 2VX3A 4UXLA 3VHKA 5CF6A 4FZFB 2VWIA 4DTKA 3P79A 4PTGA 4QD6A 3PP0A 4NWMA 1WBPA 3O71A 3GNIB 4DEIA 1REJA 3ROYA 4FOCA 3DZQA 4JIAA 5IU2A 4BICA 5EQEA 4FODA 2XKEA 4LMUA 4L7SA 4EJNA 2XA4A 4A9YA 3CP9A 4HPTE 5T3QA 4PP7A 5ETIA 3V6SA 3BWJA 4WNOA 3ORKA 3F5PA 5DNRA 3CTHA 2C6OA 4LGDA 4U7ZA 4IZYA 4DEHA 2B1PA 4FSQA 2OK1A 1GY3A 3NPCA 2YM6A 4CMUA 3EMGA 1U46A 4GG7A 2JIUA 3NRMA 4O86A 2GQSA 1KE8A 5IQAA 3F82A 4F7JA 3A7FA 3NIZA 3KF7A 4IB3A 1U5QA 2VRXA 4I3ZA 3DOGA 3NSZA 3MH2A 4XV2A 4B8MA 1Y91A 4DTBA 2B54A 2VO6A 3GP0A 3P1AA 3PXQA 4NTTA 4RJ3A 3NZ0A 5AAGA 5KMOA 3UQGA 3UNJA 3OFMA 4AZTA 4AZSA 4FOBA 2BRGA 1CKJA 4K1BA 4CLIA 4CZUA 3GCSA 1KE9A 3TNPC 2RG6A 4FEXA 4YTFA 5HOAA 4EK5A 4UYNA 2ZJWA 3QHRA 5CYIA 4BCGA 3BHUA 4GU9A 5BYYA 4AU8A 5AMNA 4QQTA 1H00A 4D9UA 2QKRA 4G9CA 2XJ0A 5EKNA 2CNQA 4ARKA 3N4TA 3NYNA 2W9FB 4JDJA 4Y72A 4D9TA 3HMOA 4NJDA 2OBJA 3UOKA 3VIDA 1JKSA 4JJRA 5IUGA 2QKWB 5IUIA 4MHAA 4AXAA 2BFXA 4MD9E 2B9FA 3ZO1A 2W4OA 5BQ0A 3UZRA 4IVBA 2P33A 4E3CA 1W98A 4PP9A 4O83A 5DOSA 2VTMA 3AMAA 2VNWA 3FUPA 3GU4A 2ZV8A 4TWCA 3MVHA 1E1XA 1UU8A 4FKVA 2GTMA 3BEGA 5AX9A 2YIWA 3BGPA 5JRSA 4CNHA 1FVTA 3HGKA 4NU1A 4YO4A 4RVKA 1P4FA 1WBTA 1ZWSA 4E8AA 5I9YA 3W2CA 3DBFA 3RPSA 4ZTMA 2QOQA 3R8MA 2I6LA 4NSTA 1Q8UA 4ZMFA 4I20A 2J4ZA 4CFNA 4RFYA 4TYEA 2CPKE 2WMUA 4GIIA 4JBVA 4R1VA 5KCVA 5AP4A 2WTWA 3QRTA 1YOJA 3Q4CA 4Y5HA 3MTLA 2JLDA 3Q96A 4RIOA 1WBSA 1U4DA 4MX9A 4L3PA 2QI8A 1FINA 2R2PA 4IH8A 3IGGA 4U97A 4FV2A 4IAZA 2XEYA 5AP0A 4C3PA 5K5NA 3R30A 5FXQA 2CN5A 3LJ0A 2JDVA 3H10A 4R1YA 4W4XA 5AP3A 2PHKA 3WE8A 3ZEPA 2NNWB 3EN7A 4M0YA 3LOKA 4HZRA 1YVJA 2WU7A 5I9VA 2WTIA 1KOAA 2OKRA 2YCRA 1PXOA 1TQMA 4DCAA 2P2IA 3CD3A 3POOA 3BYVA 5JK3A 4GT3A 3G6GA 2UW3A 4UWCA 4OTGA 4CG8A 3CKXA 3FMMA 2BMCA 4IQ6A 2VTIA 3GT8A 3PDTA 4GJ3A 1YOLA 3ALOA 3NNWA 2Y0AA 4NZWB 3R83A 3RK9A 4ZZOA 5BNJA 3H9OA 5CU2A 4IZAA 2F49A 3PXZA 4EL9A 1GNGA 1WVYA 3QQHA 5GJDA 5GZ8A 3QKLA 3LFBA 3QZHA 4RSSA 4TT7A 4EOLA 5JFSA 3FDNA 4QP1A 4TZRA 4BRXA 3ULIA 2VWBA 4IANA 5A3XA 4DF3A 1L3RE 5J87A 1IAHA 5IH6A 5C8NA 4EYJA 4N57A 2E9NA 4QTBA 3LAUA 4EK8A 2V62A 1XO2B 2YM8A 5CU6A 3CE3A 4TNBA 5AIRA 2XKFA 4CYJA 3R7VA 2WMQA 2QVSE 3FMDA 3VUMA 5K0XA 2VTSA 4IX3A 3VO3A 4P4CA 4KSQA 4M7IA 2P3GX 4RMZA 5AR8A 3ZDIA 4F1MA 2J2IB 3F66A 1XWSA 3MVLA 2UZVA 4X2GA 3HLLA 3BYSA 3QKKA 2VWZA 5AAEA 5ITAA 3PPKA 4GFGA 3R9HA 4EK4A 4CG9A 4TY1A 1Q5KA 3MY0A 4QYGA 3D2KA 3PIZA 1UKIA 3OZ6A 3VQHA 5EYKA 4G31A 3FMJA 1PXNA 4BR3A 5EOBA 3WIKA 4GIHA 3SD0A 2YIXA 3LQ5A 3W32A 1ZZLA 4O0VA 1HCLA 4G5PA 5BMSA 1LEZA 2PWLA 3RAKA 2QU5A 2PYWA 3SG8A 1FGKA 5TR6A 3MVJA 3OXZA 3ORPA 4RRVA 5EYMA 3W10A 5C8KA 5LWNA 3SW7A 1A9UA 3PSBA 5FXSA 3SLSA 2R3GA 2F57A 1ZOHA 1URWA 1LEWA 2W1GA 3GU6A 4GEOA 5J7HA 5FTOA 2OG8A 3QZFA 2E2BA 3HV4A 4IB1A 5EQYA 4QO9A 3PY0A 3QQUA 4KAOA 2R3QA 4CFMA 4MXXA 3UGCA 2C4GA 1PXPA 3PJCA 5E92A 3UPXA 2OH4A 4FIHA 3FXZA 4GG5A 5DBXA 3RM7A 3SXSA 3S00A 4RJ8A 1OI9A 3F2NA 1M2RA 1PXLA 5GJFA 4ZEGA 2ITXA 5BYZA 4B4LA 4AZEA 2Z2WA 3NVMB 5EI8A 5C4LA 5EM6A 4AWIA 3RHXA 3RPRA 5AUZA 4FTRA 3QL8A 3MFSA 3EQBA 1QPCA 4M12A 2GNLA 4JT3A 1CM8A 4W4VA 4BZNA 3PXRA 5LARA 2YA9A 1I44A 3ZC6A 4D2VA 3EFLA 4QMZA 2XM8A 3LCKA 5ANEA 3D15A 3Q9ZA 5AR5A 1Q97A 2ZDUA 5HVKA 2FSTX 4AT3A 3MYGA 3LFEA 3Q04A 4Q5HA 3CSVA 2BIKB 3KF4A 3GQIA 3JXWA 3CQEA 3E8NA 3QD0A 2VTJA 2ONLC 3DT1A 3F5XA 5HLPA 1OL5A 1T46A 2JDSA 4BCKA 5L6OA 4FK3A 4EC9A 4LOPA 5EG3A 3R1QA 2R4BA 2PMIA 3LXNA 3QCYA 4TWPA 4F64A 1HOWA 4FV4A 3KK9A 4NIFA 3RINA 4AN2A 5TOZA 4H1MA 5HQ0A 4PDYA 3OBGA 5E1EA 3O23A 4M69B 4C4JA 3NYVA 4KIKB 4L6QA 5IISA 2YIYA 1H24A 3I1AA 2GHMA 4I41A 4DN5A 3O7LD 3R71A 1YHSA 2ITQA 5E9EA 3P4KA 2KULA 1BMKA 2W1HA 1DAWA 2AUHA 2Z60A 4FV5A 4RJ7A 5D7VA 5AP5A 1YKRA 1IEPA 3WF5A 2BTRA 3A7IA 2RIOA 3KU2A 3OOMA 3U6JA 1H1PA 3C5UA 4LOOA 3AD4A 2YFXA 3VBQA 2UZTA 1JQHA 4FZ7A 4QTCA 4QYFA 2QOLA 4ZLYA 5LMBA 3EQHA 4GKHA 2G1TA 4EHZA 2YAAA 2W5BA 5E8SA 4CKRA 1B6CB 2R3LA 4EONA 4F7LA 5M4UA 2A4LA 1UU7A 3HDNA 3PSDA 4PNIA 2OF2A 4AGDA 4AF3A 3PWDA 3HA8A 2PPQA 3EHAA 2C30A 3M42A 3BYMA 3OTVA 4XLVA 3LM5A 3MI9A 4FG8A 4GFOA 4WKQA 2R3JA 5ANGA 4ZS0A 3SRVA 5DLSA 1JSUA 2IJMA 2F9GA 3KRJA 4BY9E 5FLFA 3Q9XA 5H8GA 5A46A 3REPA 3QFVA 2CKQA 3FL5A 3MBLA 4IFCA 4IFGA 3DKOA 4DH5A 4DG0E 1SNUA 2PUIA 3OCSA 3A7GA 3MTFA 5CXHA 3SVVA 4A4XA 4MXCA 3NCZA 1O6KA 1ZZ2A 4ZY5A 2YM7A 2PTKA 4CEGA 1R0PA 4NTSA 3D4QA 4YJPA 3DXPA 2BZHB 4PPCA 4FSWA 3MV5A 3B8RA 3P86A 2IVVA 3OHTA 3BCEA 4HVDA 3DJ5A 3N51A 2R3OA 4IM3A 3GCVA 5FEEA 5FUTA 4RC2A 5DHJA 3GC0A 4FMQA 4BCIA 3SG9A 2GDOA 3TV7A 4FV9A 2BUJA 2XS0A 3O8PA 2IZTA 4O21A 4M68A 1XH5A 4II5A 3V04A 4IM2A 1ND4A 4G6LA 3AC4A 5AUUA 5L2WA 3RPOA 3O50A 4BYIA 2REIA 4QMYA 4EEVA 3PP1A 4M14A 4DC2A 2UZOA 4OTRA 2XMYA 1DS5A 3DBEA 1PW2A 3VS1A 4O0SA 4RIYB 4V0GA 3G90X 5HORA 2UZUE 3VW6A 1H1RA 2YABA 3DKGA 4RIWB 5CSWA 5TF9A 3ZO4A 1YQJA 3FWQA 2H6DA 4Y83A 5A9UA 4L42A 2WMSA 3RCDA 3LQ8A 4BF2A 2XK6A 5EK7A 4MNEB 4D4VA 4QRCA 1UKHA 2OIQA 1YI3A 2V0DA 1PJKA 3MVMA 4QYYA 3RK5A 2FUMA 2F7XE 3ALNA 4FKIA 4NW6A 5CAVA 2CNVA 2PVHA 2ZOQA 5DR2A 3GFWA 4LRJA 3VUGA 1MRVA 1UWHA 3OWJA 4FSRA 4AT4A 2PK9A 2XK3A 4R5YA 4ANNA 2WPAA 4EKKA 4BGQA 3V6RA 4C02A 4XJ0A 4X2NA 4GT4A 2ETKA 3MB7A 3FZ1A 2HZIA 4CV9A 1H1WA 2QODA 4XV9A 4OTIA 2C68A 3TG1A 4M97A 3ZZEA 3C51A 2X81A 3OS3A 4GU6A 4WBOA 5AP7A 1BUHA 3TWJA 3C1XA 4DGNA 3W16A 3BELA 3UDBA 4QTEA 2YJSA 4XG6A 1H25A 2GTNA 3MFUA 4EC8A 3Q2JA 3D5VA 3OUNB 3V5JA 4HYUA 5DRBA 2F7EE 1RJBA 4BDJA 3UG2A 2HELA 2JKQA 4CQGA 3P08A 2IWIA 1OIRA 2YLEA 3AMYA 4QPMA 2CJMA 3FQHA 5C27A 5TT7A 3W2QA 4C61A 4FEWA 4D0WA 3U87A 5JGAA 1NA7A 1STCE 5D11A 5EM8A 3R7IA 5L8LA 4MF0A 2CKPA 3FI8A 3MPTA 4ZAUA 2HIWA 3U8WA 5JFWA 4CYIA 4AE6A 5DEYA 4YNOA 4MWHA 4E7WA 1G8AA 4F9YA 5A4CA 2F7ZE 3UP7A 4DFUA 1JKTA 2W5HA 3IW5A 2ZAZA 1ZYLA 4WUAA 5EDRA 5CEPA 5HX8A 2A27A 5IQFA 3R1SA 4GMYA 2UZEA 2R3PA 5ETCA 1XHAA 3POZA 2VX0A 5HIDA 4S32A 4U5JA 5C9CA 3E3PA 2ONLA 2VTAA 1OM1A 2WD1A 3D0EA 5FP5A 4J52A 3BPRA 5CSHA 3PJ3A 1YHVA 2J0IA 2EB2A 4OTPA 4F0FA 4R3RA 2DS1A 4JQ8A 4AUAA 1JLUE 2CCHA 4EQUA 2GNHA 2HWPA 4K11A 1GAGA 5M44A 4QMNA 3NIEA 2F4JA 1UV5A 5FP6A 4LGGA 4IW0A 4UB7A 3U4UA 4JRNA 5FRIA 3W1FA 3IONA 5D12A 2IG7A 4Y46A 3WZDA 4QYHA 5M53A 5C1QB 2G2FA 2UVYA 3LQ3A 1Y57A 3BV3A 1YXTA 2QOOA 2BAQA 4I92A 4QTDA 4QP3A 4G1WA 2B0QA 4WA9A 3QTIA 3DK6A 4KBAA 2XIYA 5IEXA 1IA9A 2OICA 3FZPA 1ZY4A 5CU3A 4EHEA 1QCFA 3QCSA 3WBLA 3F7ZA 3ORLA 4RJ4A 4I6FA 4ZJIA 2GNJA 4RZWA 3P7BA 5K4JA 2V55A 2C69A 2XIXA 2AYPA 3EZRA 4S30A 3R02A 3BHTA 4RWIA 3V51A 4IXPA 1OL7A 2X9FA 3UODA 5M09A 4D4SA 2W06A 5LXMA 1SM2A 3DNDA 4ANLA 1OKYA 5IMXA 3FMKA 3OEZA 2W1IA 1G3NA 2X8EA 4NFNA 4H3QA 4DLJA 2Y8OA 4YZDA 3UNZA 4GFMA 4AOIA 1OKZA 3E64A 2QHNA 2Z8CA 3L9MA 4OBOA 3E8CA 2XEZA 2XKDA 4OGRA 3FLSA 4YJVA 5DPVA 1NVRA 4FI1A 4P2KA 4JR3A 4B99A 4KS7A 4FSYA 3GFEA 3LLTA 3UE4A 2JC6A 3C4CA 1JAMA 3LMHA 1H28A 1TQPA 2UZLA 4GT5A 4RVMA 5DH3A 3HNGA 3KXGA 4O0TA 4FT3A 4F09A 4HYHA 1B39A 1OZ1A 2W05A 3E88A 4ZOGA 1XR1A 3Q5IA 4H05A 3HV5A 1OIYA 4BB4A 3BLHA 3NYOA 5B2KA 2Q0BA 4BHNA 3QF9A 2J50A 1S9JA 5DWRA 4XV1A 5I9WA 2O5KA 3CY3A 2R0UA 1F0QA 4LRMA 2YWPA 4AA0A 3F3VA 4QTAA 5HZNA 1U54A 2PVRA 3BKBA 4TRLA 2NPQA 5K4IA 3LCOA 1M2QA 2EXEA 5FGKA 3GGFA 2IN6A 3KRXA 4U0IA 2VTLA 4L43A 3HL7A 4EWQA 3PPZA 1O6LA 4DH7A 2P0CA 4KWPA 4RQKA 3LCSA 2H8HA 5KZ0A 1FVVA 5E8WA 4RC3A 4YZCA 4C4EA 2R9SA 2CGUA 5HTBA 3JUHA 3RTPA 4J95A 3L9PA 4Z7GA 4YPSA 4B8LA 2DYLA 2FA2A 2FB8A 5LVLA 1TQIA 4NCTC 3QQFA 3UOHA 3PFQA 5BVFA 2X2MA 3AQVA 3W2PA 2XYNA 4K2RA 2FYSA 2ZYBA 3TTIA 3BBWA 4FIFA 5B7VA 5IQEA 5TE0A 3ZU7A 2UW4A 2XZSA 4BKJA 2X4ZA 3ZDUA 3RM6A 4ALUA 5EH0A 2RFSA 2A0CX 3OCBA 3UC3A 5I9XA 5IEYA 3BLQA 3QU0A 3OD6X 2WQNA 4XLIA 4GK2A 2Y4PA 2NO3A 2W1CA 5LCKA 4QMWA 3OT3A 1TVOA 5I5ZA 3QRKA 2A1AB 3SXFA 1Q8TA 2YDKA 5ACKA 4ITHA 3A60A 3FZRA 3PZHA 4CRSA 1MRUA 2JITA 3HVCA 3QUPA 4PRJA 1PXMA 3NLBA 4DITA 3VF9A 4EOKA 3R28A 4BWKA 4YHTA 1NW1A 4R3CA 3GBZA 2C6DA 1MP8A 3V5TA 3ZO3A 4IVAA 3ATTA 3QLFA 3CQUA 3LE6A 3C5IA 3DZOA 1U5RA 5J5TA 4YP8A 1Q4LA 3NAXA 4U40A 2XNPA 4U3ZA 3HMMA 2OXXA 4YJUA 4BTKA 2C3IB 2JBOA 3T9IA 3EQRA 3EN4A 4YHJA 3DBDA 3EIDA 3L8XA 5E4HA 5DMZA 2PVNA 4V05A 3HKOA 4EZ3A 2JFMA 4HNIA 4O7VA 2JD5A 4L00A 4BIDA 5L6WL 4F99A 2ITVA 2GS6A 5IKWA 3I0QA 2WMVA 3LZBA 4X2JA 3F6XA 3QGWA 4C57A 3P78A 4GSBA 5CEIA 4BN1A 4O0RA 3PG1A 3MIYA 4EH2A 3VQUA 4RFZA 4ACMA 2OJFE 2Y7JA 5HCYA 5AJQA 3F7WA 4S34A 5HHWA 1E1VA 3ODYX 4W8EA 3UMWA 3BI6A 5EM5A 3UG1A 2OSCA 3WF9A 4F4PA 2X6EA 4I22A 4KBCA 3KREA 3NUAA 2C6TA 3W2RA 3FYKX 4GK3A 5IA0A 1KE7A 3C13A 3FYJX 4O7YA 4Z9LA 2BRMA 4XV3A 4QMMA 1J1CA 4U6RA 3O2MA 3DAEA 4I5PA 4D0XA 5BVOA 3RKBA 2A19B 4L45A 2R7IA 4X2FA 1OKWA 3KGAA 5AA8A 1V0BA 1ZY5A 2YJRA 3E87A 3KCFA 4KIOA 4FV1A 5CLPA 4QPSA 3RZBA 4D1ZA 4PPBA 5M4CA 4ZLZA 1F5QA 1UU3A 1Q62A 2QONA 3FHIA 1UWJA 5BX0A 1MQ4A 2HZNA 4Z16A 1BI7A 3F3WA 3PVWA 5CNOA 1MQBA 1QMZA 3FZTA 3VS3A 4XG4A 4O2PA 2VO0A 4ZY4A 3OMVA 2ITOA 2JKOA 1XH6A 5FM2A 4QP8A 1WBVA 3TNWA 5JEBA 2AC3A 5CZHA 4OAUC 5CEMA 4NIFB 4QMQA 2QR8A 4NM3A 4U81A 2H34A 3TZ8A 1L8TA 5HO6A 2VWVA 3KRRA 4I5HA 4BBEA 5HD4A 5LQFA 3DQWA 4TTHB 5AWMA 4C0TA 3QZIA 2XK8A 3D14A 3E5AA 5AUTA 3FI4A 5HCXA 5A14A 2BALA 3I60A 3WZEA 5FWKK 1QPEA 2GFSA 3QRJA 4YJQA 4D55A 3ZLYA 4CFUA 1LP4A 3EKNA 5JH6A 1R78A 4IX6A 4RLKA 2C3LA 3NVKI 4Y73A 1ZMVA 4MXOA 5CEQA 2BROA 4V04A 1PMUA 2IW8A 4KRDA 4EH9A 3KB7A 3ZLXA 5M07A 3WZUA 4C8BA 1WBNA 4GH2A 4IAKA 5DR6A 4RG0A 4ANSA 5EQPA 4K8AA 4A9UA 4BDDA 4FTOA 4IIRA 4LUDA 4TNDA 3ANRA 1NVQA 3PIYA 2W9ZB 3MFRA 3V8WA 4HYIA 3MGYA 4O91A 4X6RA 3R8UA 3TNIA 1K3AA 4F63A 2C6KA 3D2IA 3FPMA 5C8MA 4IX4A 4MD8E 5CVFA 3OCGA 3D7TA 3VBVA 4BZDA 1DAYA 2C5XA 4J8NA 4OBPA 2JDTA 3FSKA 2J6MA 4BCFA 4IVDA 4EH8A 3B2TA 2JKKA 5J5SA 2XNNA 4FSZA 4ERWA 4FTTA 3IO7A 5LVNA 2VU3A 3LXKA 4FKOA 4NM7A 5ANDA 4FNXA 4RIXB 4C7TA 2BZKB 1W83A 3E92A 5AV0A 5IMEA 3R7YA 3ZEWA 3SRVB 2WMRA 4EBWA 3VS0A 3NCGA 4X0MA 3PWYA 4A4OA 3FXWA 4C2VA 1CKPA 1YXVA 4IC8A 3OY1A 4UBAA 3F69A 3EN6A 2XBJA 3A8XA 1BYGA 3RI1A 4FTLA 1K9AA 1WMKA 5CEKA 3QTRA 2WO6A 3VRZA 4LQMA 2PVKA 3QWKA 2QO9A 4A7CA 5E8ZA 1ZYSA 4FKQA 3UZTA 1IA8A 2OJ9A 3PY1A 1OITA 3A61A 4BKZA 2YISA 2X0GA 2BRNA 2Q0NA 3PE2A 4FGBA 2PMLX 4MBLA 1A48A 3U55A 4PMPA 2VZ6A 4TPTA 1ZXEA 4NFMA 3F9NA 4QP2A 4NCTA 4JL9A 5EYCA 4PDOA 3Q6UA 1REKA 5GZ9A 2DWBA 4R8QA 4DEEA 3Q3BA 4NYEA 4R78A 4ALVA 3ZXTA 3LFAA 3RCJA 4D2TA 4ZJJA 3R21A 3DBCA 3HUCA 2C5VA 3CY2A 4JLCA 4XP3A 3UO6A 2ZDTA 3SX9A 2VWYA 3UQCA 3S4QA 2P2HA 1G5SA 3AGLA 4GVJA 4C35A 4IDTA 5JQ5A 3ITZA 3ZH8A 5IQCA 5AUVA 4K77A 4AGCA 2F2CB 1OB3A 5CVGA 2BFYA 3VBXA 3O8TA 5JZJA 4O1PA 4BDKA 2QG5A 4YR8A 4RGJA 3GEQA 3W8LA 3D5WA 4V0GB 4IC7A 3MS9A 3VS5A 2GNFA 3OBJA 4NL0A 2PVYA 2W1FA 3EFKA 5M55A 4IEBA 3D83A 4PWNA 3Q52A 4L53A 4CQEA 4WBBB 4FEVA 3R01A 3MJ1A 4ACGA 5KMJA 3GB2A 3IOPA 3R8PA 5E8XA 4F9AA 3THBA 4CZTA 3FEGA 1YWRA 3Q9YA 4M67A 3PTGA 2QOKA 4ACCA 3F61A 3NDMA 5FEQA 3TKHA 4TXCA 4DLIA 1ZOEA 4UZDA 2CKEA 1JKKA 4EUTA 4BTFA 1KOBA 5AAFA 5AA9A 4EH6A 3P23A 4PL4A 3FXXA 4XOZA 5IF1A 2BIYA 3P0MA 4DGMA 3RGFA 2WTKB 3RAHA 3GCPA 4U9AA 5A6NA 2UVXA 3HRBA 2ZMCA 4JRVA 4RLLA 2XBAA 5H3QA 3TKIA 4CFFA 3Q6WA 1WBOA 3Q4TA 3PUPA 4UXQA 4DGLC 3COIA 2B4SB 4YZNA 1JWHA 4I0TA 3EB0A 2X1NA 3RNYA 4E6QA 5HU9A 3TDVA 2OGVA 2CLXA 4OTQA 3PYYA 4MD7E 4U43A 4EOOA 4YJTA 3UBDA 1M7NA 4DE4A 2G2IA 4G3GA 2Y4IB 3GCUA 1ZYJA 3ORTA 3QXPA 4FTQA 3ZM4A 4HGSA 3VS7A 3COMA 2PL0A 2C0OA 3OG7A 3QTXA 4H39A 4ASZA 1ZOGA 4EH7A 3C4WA 3R6XA 4NM5A 4TYHA 3ZSIA 3DBQA 5E8TA 2WNTA 3COKA 3NNXA 3PVBA 2XP2A 4JI9A 4JS8A 4RFMA 3SOAA 4C4FA 3NNUA 2WGJA 4NM0A 4WG5A 1J3HA 4GS6A 4AFEA 3P5KA 3Q53A 1SNXA 4F6WA 4A07A 1R0EA 2ESMA 2DUVA 3BHHA 3PVUA 1QPDA 3FY0A 4XG2A 4JBPA 5BVWA 3NMUF 4ITIA 4DEAA 1XBCA 3SC1A 4M13A 3IPHA 5J7BA 2VN9A 2QOFA 2X2KA 3H0ZA 1DI9A 3DPKA 3HRCA 4BDEA 3ZYAA 5HTCA 4QQJA 1YHWA 2Z7SA 2W0JA 5CANA 1NT2A 3U54A 2YCQA 4DFNA 2HOGA 4UMTA 5FDPA 3SQQA 4CLJA 2GCDA 5CAOA 5AUWA 3AXWA 5LJJA 4LUEA 3VWAA 1OBGA 4I5CA 5HI2A 3WZKA 5KNJA 1Q99A 4KUJA 1PMVA 3TZ9A 2WTVA 3F5GA 2J5FA 1XJDA 3WOWA 4A9TA 5K9IA 1FBNA 4G3CA 4JX7A 5E7RA 2IW6A 3EN9A 5LVOA 4TWNA 5AM7A 3BZ3A 4UWYA 3KXMA 4KBKA 1VYZA 2WKMA 5JMSA 3EYHA 2NRUA 4LFIA 4YC8A 4IBMA 4UEUA 4RWKA 1YOMA 2PVJA 3WI6A 3QTZA 5IQBA 1ERKA 4YTIA 4BKYA 2QG7A 5EDQA 4LYNA 4BI2A 5FD2A 1R3CA 2WAJA 4DGGA 3QHWA 3R9RA 3MA6A 4L67A 3PE1A 3QQGA 3KXNA 3TJCA 2WZJA 3HEGA 3UIMA 1CKIA 3IW4A 4OTHA 3UOLA 4XBRA 4XX9A 5TKDA 4RA4A 4IB0A 3DB6A 1YRPA 3S95A 4HCUA 3ZRLA 3E62A 4C4GA 5DVRA 2GQRA 3IW7A 3SXRA 3QD3A 2O65A 1Y8GA 2Q83A 4FUXA 1OIUA 2V22A 3AC1A 3KMMA 3T9TA 2XM9A 3O17A 3SOCA 2CKOA 5LMAA 4ZTSA 2OLCA 4QPAA 3JS2A 4RPVA 4UALA 4EQMA 2W1DA 2PU8A 5DE2A 4WNPA 4FZ6A 4P90A 3ZLWA 4PQNA 2J7TA 2JFLA 3FZSA 3H3CA 5E90A 5BUJA 3H0YA 3NX8A 4YLJA 2X8IA 3EZVA 1GIIA 1MRYA 3W8QA 2R5TA 3A99A 3BQRA 3W55A 2ZB1A 3QALE 5JFVA 3PY3A 2HXLA 5AR2A 2B9IA 4A9RA 5M56A 2QCSA 2V5QA 1JSTA 4I24A 5DT0A 2X39A 4FTMA 5J9YA 3GQLA 4Q2AA 5KKRB 3DDQA 1U54B 2V7OA 3NW5A 3Q32A 4YJSA 4O0WA 3V5QA 5L6PA 5CQUA 4DH3A 4QMLA 4BIEA 1OKVA 5FEDA 2HW6A 3VJOA 4A9SA 1XH7A 4L9IA 3TACA 2EXMA 4CMOA 5B2LA 3BX5A 5IUHA 5M06A 4IMYA 3FL4A 4F9WA 3UPZA 4CKJA 2ITYA 3WILA 1I09A 4JAIA 4E20A 3QTUA 4DEBA 3VBYA 2ZV2A 4DHFA 4DFXE 5BUIA 4H36A 2IZSA 3SKCA 3F5UA 2BZJA 3W33A 5KMKA 2QLUA 3CXWA 3FY2A 5IA2A 4W4YA 2WIPA 1PKDA 2YM4A 3OW4A 5K5XA 4O81A 4FL1A 3TI1A 2E9VA 3G9NA 5F4NA 4N70A 4A4LA 2JEDA 4LG4A 5CQWA 1P14A 1TKIA 1UNGA 2CHLA 1KE6A 2OXDA 2YIRA 4L7FA 5EW8A 3KRWA 1UNLA 3MDYA 3BGQA 3PJ1A 4IX5A 2UVZA 3RZFA 5AIKA 1OBDA 1ZYDA 2R3MA 1W7HA 3D9VA 1DM2A 3E63A 1JBPE 4Q9SA 1ZRZA 3UIBA 2ITWA 1FQ1B 2ZV9A 4DEDA 4WNMA 2UZNA 1BI8A 1H08A 2HW7A 3QZGA 1PMNA 1BX6A 4L46A 3SW4A 5HU3A 2YACA 3R2BA 4S33A 4DTAA 3WF6A 4ASEA 4AZVA 2XK7A 3KN6A 1GIHA 2C1AA 3UIXA 4G3EA 4HOKA 4CFVA 2CLQA 3IS5A 4CTCA 3TUDA 5CF8A 4PV0A 1Q8YA 2W1ZA 3L9NA 3MW1A 4JDHA 2O0UA 4YO6A 3TV6A 4C2WA 4ITJA 4G17A 4M8TA 2PZ5A 3TV4A 4J7BA 3DTCA 1JVPP 4FV8A 4C58A 5LWMA 4B6LA 2UV2A 3FE3A 1YXSA 4KS8A 4BDAA 4EH4A 4EOPA 3G9LX 1ZMUA 4LGHA 3UVQA 2A2AA 5AX3A 4G6OA 5HBEA 3PA3A 3OW3A 5CI6A 3MPAA 4BDFA 4I4EA 3NYXA 3NUNA 3B8QA 1OPKA 1EH4A 4HGTA 5L3AA 4RQVA 5CASA 4E73A 5M51A 1GZNA 4X3JA 2XB7A 4FL3A 4BCHA 2UW7A 1BL6A 2ZV7A 3QA0A 5EI2A 4O7ZA 1S9IA 3A8WA 2W99B 4F6UA 4LI5A 5BVDA 1WAKA 3DK7A 4S2ZA 4LRKA 3U6IA 3FZOA 1OUKA 4BCOA 2X7FA 4X21A 3FMHA 4FYNA 3L9LA 4I6HA 4EKLA 1ZARA 3IECA 2I40A 2XKCA 4MYGA 1Z57A 5T68A 3IK3A 4H3PA 5HESA 5C26A 3E7OA 2JDOA 3JPVA 4KB8A 4PPAA 4AFJA 5CSPA 1V0OA 4J71A 3ATSA 2C6IA 4O0XA 5HG9A 4AN3A 2JAVA 4N6ZA 3GENA 4FNWA 5HE1A 4RC4A 5LOHA 2OIBA 4ANBA 4BDHA 3ZLSA 5HGIA 4FKUA 2OI4X 5KZIA 3FI2A 1H4LA 3I79A 3RAIA 3T8OA 5FXRA 3MESA 2FSOX 1NXKA 5J1WA 4I6QA 4NH1A 3JY0A 2XNBA 3NUYA 2J90A 4QMSA 5HEZA 1YDRE 4APCA 3QD2B 2WMXA 3BQCA 3R73A 5CT0A 4C33A 3BBTB 3MJ2A 4XOYA 2IVSA 5EOLA 2G15A 2FSMX 1PF8A 2XNEA 3G6HA 1IASA 3ZRMA 2C3JA 4BVUA 3A4PA 5KMNA 2GNIA 3C0GA 3CD8A 2EU9A 3NNVA 4DH8A 2PMOX 4DYMA 4I1ZA 2YIQA 1AGWA 2ZB0A 2C6LA 5F94A 4UWBA 4WSYA 4AX8A 3PPJA 1RE8A 4CRLA 3F2RA 4F0IA 3F3TA 5CU0A 4XEYA 4MH7A 4DT9A 3TTJA 3V5WA 3HAVA 3F2AA 3QCXA 4FV3A 3TM0A 5CAUA 3HRFA 4ANMA 3FLWA 4GVAA 4UX9A 5C4KA 4UY9A 4HW7A 2C3KA 3L8SA 3ORIA 5I9UA 4BWXA 3TZ7A 3I6UA 4FT5A 3OEFX 4OUCA 4TKSA 3ZTXA 4RX5A 4RX8A 4XRJA 5H9BA 4JBOA 3D7TB 5HE3A 4W9XA 3R7OA 3VS4A 4YTCA 5AP6A 2FSLX 3OT8A 3OF0A 1JOWB 1Y6AA 3ZBFA 3LFFA 4RA5A 4DINA 3HYHA 4AOJA 3I7CA 1R1WA 3I5NA 3O51A 4N0SA 4YZ9A 3CTQA 2R3RA 3LXPA 2VTRA 2HZ0A 3ETAA 5FM3A 3V8SA 4FTIA 4YZBA 4DFZE 3I4BA 1FMKA 4OR5A 4HPUE 4AE9A 3VUIA 5BUEA 3R7UA 3GUBA 1UNHA 3WYXA 4PUZA 3R00A 5AUXA 2BZIB 3COHA 3U51A 4TWOA 5JSMA 3ODZX 2HCKA 4ZTQA 1KV2A 4IVCA 4CXAA 3ENHA 4USFA 3IG7A 2GNGA 4EH5A 4FA2A 4IADA 4R7BA 3KQ7A 1BL7A 1KV1A 3GI3A 3K54A 3QKMA 4AOTA 5EW9A 3MA3A 3E3BX 5I3OA 4ASDA 5ETFA 1SZMA 4USDA 4X6QC 4PDPA 5L2QA 3OTUA 4YHFA 3ZO2A 3ZSGA 4EWHA 5HX6A 2ZM3A 3HMIA 1ATPE 4BBFA 5KO1A 1P5EA 4AS0A 3H4JA 3D5XA 3ZFMA 4D58A 1Z5MA 5JN2A 1APME 2RGPA 4Y8DA 5HG8A 4TL0A 4P7EA 3TNHA 2YCFA 5IA5A 5J95A 4MQ1A 3ZOSA 2YWVA 2W17A 5ANKA 3JYAA 3QUEA 4QOXA 4XG7A 3EFJA 2R3HA 4RX9A 4X3FC 2PVFA 4XMOA 1J7IA 3TN8A 3N9XA 4IJPA 4FV6A 3RJCA 5HO8A 3G0EA 4KKGA 3V01A 3RHKA 4YU2A 5IQDA 3DB8A 4JVGA 3TUCA 3DJ6A 4ZZMA 4C3FA 3P7AA 3PXKA 1GIJA 4M66A 3FLZA 4RT7A 3FPQA 3ZS5A 3DK3A 3BU5A 1F3MC 3R7GA 5T6KA 4EYMA 3I7BA 5IDNA 2WHBA 5L2TA 4IWQA 3UC4A 3K5UA 3KRLA 3LFDA 1JPAA 1FMOE 4WG3A 4C59A 2BVAA 5L4QA 3V5LA 3PG3A 2WMBA 3C4EA 3CGFA 5IQHA 3NUPA 3WARA 4DEGA 2Z7LA 4EJ7A 1OUYA 1YXUA 4IM0A 3KL8A 2OFVA 4XG8A 4ZSJA 4NW5A 4MNFA 4BTJA 2W96B 3LJ2A 4FGRA 3JVRA 4ZMEA 3ZC5A 5HIBA 1SYKA 3EFWA 3LFCA 4FTJA 4BDIA 5KUPA 2WEIA 3QA8A 4FTNA 3NR9A 2J51A 3QD4A 3B2WA 4B9DA 4GKIA 3RBWA 4QMOA 2LAVA 5J9LA 3I6WA 5EW3A 4DGOA 1UVRA 3OROA 4HJOA 3R9OA 3ACJA 2Y6OA 3C4ZA 4EOJA 4D1XA 4IDVA 5CI7A 4D2PA 1LUFA 2BAKA 2RL5A 4BI1A 3DFAA 4UMPA 2CGXA 3FQSA 5HICA 3RAWA 3P7CA 3E8EA 4FKJA 4J8MA 4X7QA 2C5OA 2XIRA 4MEDA 3CLYA 2PE1A 5IG1A 3FKLA 3O7LB 3ZMMA 3SV0A 1WVWA 4C4HA 1H07A 4TYHB 1XH4A 5JFXA 2HY0A 3W18A 4XG3A 5DYJA 5A4EA 4JIKA 4AG8A 3OWKA 4NKAA 3AD5A 4CGAA 4EORA 3QXOA 3HV7A 4L01A 3VBTA 1XQZA 2VTPA 3RPYA 4CSVA 4C3RA 5H8BA 3PXYA 4ANOA 3OWLA 4RBLA 4HZSA 3SHEA 3DLSA 1VEBA 1FVRA 1RW8A 1GJOA 2VTNA 5AV2A 5CT7A 4XUFA 2IZUA 3HX4A 1IR3A 2NRYA 5DIAA 2H96A 4N4SA 5DG5A 1P4OA 3PJ8A 5IPJA 5JQ8A 5KMIA 3GOKA 4M15A 1PXIA 3QRIA 4RZVA 5I0BA 5F95A 5CAPA 1R39A 3O96A 3N4VA 4XP2A 3QBNA 2WFYA 4JG8A 4R7IA 4FE2A 4AT5A 4FYOA 3NS9A 4G3DA 4E5WA 1M7QA 2E9OA 3H9RA 2OW3A 3FLNC 5E8YA 5D9HA 3OCTA 5EHYA 3NGAA 4FIJA 4CT1A 4E4XA 4S31A 4ENXA 3UNKA 1W84A 4FTCA 5L2SA 3NUSA 3EL7A 2UW9A 2YAKA 3IQ7A 3EQCA 3HMNA 3HECA 5CZIA 2O63A 3A62A 3A4OX 5G6VA 3ZHPC 5JKGA 4U8ZA 4K33A 4PDSA 2YITA 5KBRA 4FG9A 3R0TA 3NW6A 2QURA 5AM6A 3IOKA 2QOHA 2CMWA 2R7BA 3MFTA 4BCNA 4ALWA 5CS6A 1LPUA 3K5VA 4JQEA 4CFWA 5JT2A 3ID6C 3R1NA 2IW9A 2GFCA 5EFQA 4F6SA 2PVMA 5KX8A 4XCUA 1XBBA 1M52A 1O6YA 2HWOA 2BDJA 1OL2A 3VF8A 4P5QA 3ZUVA 3KY2A 3LMGA 3C4FA 5HLWA 4G2FA 4YJOA 4XHKB 4NEUA 3FSFA 3WF8A 5A4TA 2EUFB 5M4IA 2UW8A 4ORKA 4ZTLA 3D94A 4FTUA 4ERKA 4O7NA 2I0VA 4NJ3A 5A4LA 3AT2A 3MN3A 3AT4A 4RWLA 4O38A 4ONAA 4PL3A 5DI1A 4EI4A 2YM5A 1OPLA 2YHVA 3K3IA 4HVGA 4NUSA 1VJYA 3UVPA 3EYGA 2GQGA 3BE2A 3FLYA 3KKVA 1YI4A 2I0YA 4BGGA 5FQDC 3TT0A 2B7AA 4ACHA 3UQFA 3SAYA 2C47A 2QC6A 2QQ7A 1Q24A 3II5A 5F9EA 2VGPA 4CFXA 3QCQA 4G5JA 2HXQA 3ORZA 4G34A 3FJQE 5GHVA 3DKCA 4FNZA 3R8ZA 4FUYA 3WYYA 5IH5A 2OH0E 2QOBA 4UMRA 2XK4A 1H0WA 5G1XA 1J91A 3PRFA 3A7HA 3CS9A 2XRUA 2QO7A 3LM0A 3R22A 4BI0A 4ID7A 4E5BA 3CC6A 2WEVA 4FK6A 3UO4A 4WG4A 1W0XC 3QWJA 4R7HA 4E4MA 2P4IA 3S1HA 2ERKA 4HGLA 2O8YA 4CCUA 3JR1A 2RKUA 4Y5QA 4AP7A 3A7JA 4GV1A 4ENYA 3O0GA 4BDCA 3CR0A 3Q60A 3T3UA 4R6VA 2WQOA 2C6MA 5DT4A 5HNIX 5CWZA 1PXKA 2X7GA 4FIEA 3TL8A 4O84A 3VUKA 5K0KA 4J53A 3NW7A 1ZLTA 4H58A 4FVPA 5FTQA 4Z7HA 1GZ8A 3FLQA 2ZM4A 4FBXA 2OZOA 2WXVA 3QYWA 3QLGA 4UZHA 3MPMA 4FX3A 1Q3DA 4X3FA 5FBOA 3BRBA 5HVYA 4XRLA 1YXXA 4AW5A 3ORXA 1YDSE 1OECA 2JBPA 1V1KA 5J79A 3AC2A 2X8DA 4C4IA 4I21A 3R9DA 5AEPA 3OVVA 3WZJA 3HAMA 2BR1A 2GPHA 3E8DA 4FG7A 2SRCA 4HYSA 5CSVA 4MBJA 2X4FA 4U44A 2PE0A 4AA4A 4QMUA 2WOUA 3ZZWA 3QX4A 4D4RA 2W7XA 3FI3A 4ZSGA 1DI8A 4ZK5A 3Q2MA 5CALA 3H30A 4TYJA 1H8FA 3LFQA 2H9VA 4F70A 2W1EA 3Q4UA 4J99A 4QQ5A 4BFMA 4F08A 5JZNA 2OXYA 2G2HA 4DBXA 2XUUA 4ZTHA 3F88A 4HVIA 3KA0A 3K2LA 3CQWA 3LKMA 4JX3A 3W2OA 3WF7A 2J9MA 2PSQA 2XJ1A 4CD0A 1W82A 3RP9A 2I7QA 4WNKA 1IG1A 2DQ7X 3KK8A 2JKMA 4GYGA 4BZOA 2J0LA 4EZ7A 5J1VA 4O2ZA 5BYLA 5D41A 3VS6A 4HGEA 2OZAA 3KC3A 4M0ZA 4AAAA 4EK6A 4CKIA 4L3LA 2I1MA 3BYUA 3EWHA 3GU7A 4YGAA 5E8VA 2VTQA 4EUUA 5CY3A 3AG9A 3OWPA 1VZOA 4WUNA 4OW8A 4BWPA 3G5DA 4HCTA 3QTSA 2VUWA 4FVQA 3MH3A 5HG7A 3C0IA 4BCMA 1OGUA 2BPMA 4APPA 4F9BA 3VJNA 4LM5A 1NVSA 5KHWA 3ZBXA 2ZVAA 4Y95A 4O1OA 3TZMA 5HD7A 4E6CA 3Q9WA 4YBKA 4FNYA 3RWQA 4BDBA 4EOMA 4PMTA 5JGBA 4X2KA 3OC1A 3ZCLA 4IAFA 2YERA 4O82A 2GHGA 3IDCA 2B9JA 4J98A 3EL8A 4AZWA 4YSJA 2QR7A 4YC3A 2FGIA 3I0OA 4ZJVA 3DV3A 2O2UA 3M11A 2PZPA 2XCKA 5IA3A 5FTGA 3M2WA 2BRBA 3KVWA 2WQEA 4RVLA 4U3YA 3TXOA 4M84A 5CTPA 3EQIA 2NP8A 3W2SA 2B9HA 4LV5A 1Y8YA 3CKWA 4E1ZA 5HBJA 4FZAB 4IAAA 4LL5A 2JGZA 5DA3A 2HENA 4QNYA 1O9UA 5EHOA 4XP0A 3HV6A 4JR7A 3DDPA 2RF9A 2OF4A 2OWBA 4NK9A 3HP2A 2IO6A 3ERKA 3GU5A 3OUKA 5KHXA 3S0OA 4FSNA 2BILB 4K18A 5AUYA 4ZXTA 3AGMA 2HYYA 3PRIA 4DG3E 1PYEA 4KA3A 4PMMA 4PMSA 3N4UA 5CF4A 3FMLA 4DAWA 1YI6A 2R3NA 3QQLA 4O7RA 3JY9A 3GU8A 3TJDA 4OT5A 2R0IA 5CENA 3TUBA 3TNQB 3VN9A 2YCSA 4AACA 4ZLOA 5F1ZA 2BDFA 4W8DA 5AR3A 5HVJA 3F3UA 4ZSEA 4IWPA 1X8BA 2BAJA 4F65A 2WQMA 3OXTA 2ITPA 3Q5ZA 5B2MA 5AV4A 4UV0A 2X7OA 5KMMA 4DH1A 4O7TA 4L44A 3ANQA 3AC5A 3DNEA 3G15A 3IGOA 2WIHA 2UZBA 4QP6A 5IZFA 3V5PA 2AC5A 3DKFA 2WTKC 3CTJA 4WO5A 4IACA 4O0UA 2VO3A 3HUBA 3LFSA 3KULA 4WD5A 4LV8A 2QLQA 4DG2E 3NEWA 3QTWA 4OBQA 4DT8A 3R04A 3CGOA 3FKOA 4BDGA 3DTWA 4ASXA 4KKHA 2Z02A 1UA2A 3KVXA 3RALA 4I0SA 4F0GA 3EN5A 3TCPA 5GIOE 2RG5A 4EHGA 3LXLA 1H26A 2W4KA 4KNBA 1K2PA 4EHVA 1UU9A 2Y4IC 2VAGA 5B0XA 3UYSA 4MVFA 4YUQA 4U41A 2PY3A 1KUTA 3D7ZA 2JAMA 4MAOA 4J96A 3FMEA 1B38A 4IB5A 2VV9A 5HKMA 2G9XA 3AOXA 1OL6A 3PSCA 4RX7A 3CBLA 3P9JA 4O6LA 3S3IA 3LHJA 2ETRA 3VVHA 1WCCA 4RJ5A 3CPCA 1LR4A 3GC7A 1NY3A 4F1OA 3MY1A 3EKKA 5A6OA 2W4JA 5GNKA 4DA5A 1FPUA 3OP5A 4HVSA 4BL1A 4IAIA 4YBJA 2XYUA 4IWOA 1PKGA 3EH9A 5HCZA 3OOGA 3BWFA 2PUNA 3UO5A 4J1RA 3QYZA 2BHHA 4TW9A 2WTDA 3DXQA 3DLZA 5KMLA 1AQ1A 1SVHA 5BMMA 4JG7A 1E9HA 1U59A 5DN3A 3WIGA 1ZMWA 3PVGA 4FV0A 4BGHA 2WTJA 3DXNA 5AADA 2RFEA 3DGKA 2HZ4A 3F3ZA 3AT3A 3FQEA 3LMIA 2R3FA 4W9WA 5CVHA 3BLRA 4CVAA 2C1BA 4C34A 5CEOA 1KWPA 1J1BA 2KTYA 2YEXA 3VC4A 3KFAA 4K0YA 4O96A 2OJIA 1IRKA 2WB8A 4AQCA 2E9PA 3T3VA 4G9RA 4FKWA 1Q8WA 4XS2A 3VUHA 5DT3A 2J0KA 5LMKC 3PXFA 4PL5A 5H8EA 4ACDA 4O0YA 3ULZA 2B52A 3KXXA 1PMEA 3C50A 2P55A 4XNEA 4JAJA 1XKKA 4KKEA 4I6BA 2CNUA 4E5AX 4TN6A 4KRCA 3MIAA 4GUEA 4XH6A 3BU6A 2CGWA 4IE9A 4YJNA 4ZTNA 3AD6A 5FDXA 4EOQA 5HTIA 1WVXA 4JDKA 5AR7A 2ACXA 3ELJA 3LIJA 1VYWA 2F2UA 1OVEA 3IDBA 4WIHA 5DR9A 4PF4A 4FKSA 4C37A 2IPXA 4CV8A 3LFNA 4D5HA 4KD1A 2X9EA 3A2CA 4OT6A 3NUUA 2HAKA 2IVTA 5AV1A 4FSMA 4OTFA 4QMPA 5HO7A 4O6EA 3ZUTA 4D4YA 2XIZA 4QNAA 3ROCA 3R7EA 3PJ2A 3Q4ZA 4WHZA 4RIXA 4QT1A 2G01A 4FKRA 3UZPA 1PXJA 4FKPA 2WMAA 2Y6MA 4PX6A 3DA6A 3BV2A 3VNTA 4FEQA 2I0EA 2IVUA 4P5ZA 3EOCA 4AA5A 4YSMA 4FR4A 3BGZA 3DJ7A 4OTDA 4BBMA 4FT0A 4I0RA 4ZTRA 4QP7A 5E91A 4FICA 3UMXA 4FV7A 3C7QA 1Y6BA 3I81A 3FBVA 4NKSA 4EK3A 4GCJA 3BE9A 3DS6A 4EH3A 4YURA 4Z55A 4USEA 4BIBA 4EBVA 2VWWA 5FG8A 5GJGA 1CTPE 2RSVA 5IEVA 1YDTE 1SMHA 5C01A 2J5EA 1XBAA 5TO8A 3FAAA 3IDPA 3BYOA 1H27A 2VTHA 4YJRA 5KKRC 1CSNA 2HY81 5GINE 3GCQA 4ZY6A 2XCHA 5HE0A 4JG6A 1ZYCA 3PZEA 4MWIA 4TYIA 5ANOA 3ZSHA 4IAYA 4AGWA 2QOCA 4QMTA 3ZFYA 3QTQA 3R2YA 4DFBA 1YW2A 4AW0A 3QUDA 3V8TA 2Z7RA 3JVSA 2I0HA 3NWWA 1ZAOA 4O7SA 4GW8A 4QP4A 3S2PA 1FGIA 4BC6A 2ITNA 2QHMA 4BCPA 3RNIA 4PY1A 3DAKA 5K3YA 5CAQA 2EB3A 4F7NA 3QX2A 2VTOA 3RWPA 3ZXZA 4E6DA 3FC1X 5HNGA 4FIIA 3LPBA 1BLXA 4EOSA 3ZM9A 4O27B 4BHZA 3G33A 3L8VA 1PY5A 3KMUA 2ERZE 4JXFA 1YWVA 1RQQA 4MKCA 2UW0A 2XJ2A 1AD5A 4AN9A 3TDWA 4HCVA 2B55A 4AZFA 1PYXA 2OJJA 1OIQA 3VUTA 2UUEA 3KN5A 3SDJA 5BVNA 4WRSA 4YMJA 1H01A 4L3JA 4ZS4A 2C6EA 4GK4A 4CTBA 3E93A 2R3IA 4QMXA 3MY5A 4KINA 1V0PA 3RMFA 3LJ1A 2BKKA 2XF0A 1M2PA 2CCIA 4MK0A 3RK7A 3UIUA 5HLNA 5GIPE 5DEWA 4GYIA 2QOIA 2YLFA 4W4WA 5J8IA
chains in the Genus database with same CATH superfamily
3ORNA 3VW8A 3QGYA 2UW5A 4V01A 2UZWE 2PMNX 5ICPA 3HA6A 3UJGA 3ML1A 3ZUUA 4L68A 3HDMA 3DFCB 4DCEA 2J0JA 1CMKE 2GU8A 2ITZA 1JNKA 2ZM1A 3FMNA 1M17A 3TKUA 4KSPA 3VS2A 4LMNA 1WZYA 4Y85A 3SGCA 5CNNA 2EXCX 4D2RA 3VUDA 2ITUA 1RDQE 2JIIA 2BCJA 2YM3A 3R63A 3U6HA 1M14A 3MH0A 2XARA 5ACBC 4DFLA 4AGUA 4DFYA 4FC0A 2OFUA 2WU6A 4L8MA 4JQ7A 4LOQA 2ZMDA 1H1SA 4MXYA 2UW6A 3KCKA 1OMWA 4CCBA 3FC2A 1Q61A 2OO8X 3CJFA 3ACKA 3ENMA 4G16A 4O22A 1PRYA 3ZONA 4XBUA 3FV8A 3GXLA 3EQFA 3SA0A 4MCVA 3BLAA 3VRYA 4AW1A 3I5ZA 4QQCA 4MTAA 2XRWA 3VBWA 4BTMA 5I9ZA 4FTAA 5AR4A 1SVGA 3MB6A 3QRUA 4FT7A 4YTHA 4HVHA 3HP5A 2PUUA 3K3JA 3NUXA 1Q3WA 4GRBA 1Q8ZA 1Z9XA 2PZIA 3QC9A 2VGOA 2WOTA 2QO2A 3DU8A 4HNFA 1H1QA 3HZTA 1PHKA 2QNJA 3IW8A 5EDPA 4DBNA 3CJGA 5EI6A 1P2AA 1HCKA 2RFDA 4RVTA 2GS7A 2GMXA 2EWAA 4YLKA 4EZ5A 2RFNA 4I94A 5J9ZA 4GL9A 3FHRA 5EM7A 2BHEA 2WMTA 4KIQA 4KIPA 2Y9QA 5CU4A 1QL6A 2XNOA 5LCJA 4FVRA 3TIZA 5LMKA 3BHVA 5CXZA 5BVEA 4D5KA 1OPJA 3LLAA 3RVGA 5CF5A 3FKNA 4WOVA 4X3FB 4R3PA 1VR2A 4FT9A 5CSXA 2YZAA 3IKAA 4D28A 3KEXA 5H2UA 3NAYA 4FIGA 2FVDA 3DY7A 5DGZA 4RWJA 2WMWA 4L52A 4WRGA 4EOIA 5M57A 3DQXA 3ORMA 3GOPA 3L8PA 3R1YA 4I23A 5A54A 1SVEA 3GVUA 4M69A 2W5AA 4YC6A 1MUOA 2PULA 4KIKA 5M08A 3WE4A 5AFVA 4QYEA 3IW6A 5HG5A 3VONA 3UTOA 4BYJA 3M1SA 2JIVA 4N6YA 3R8LA 5I3RA 2GS2A 4K9YA 4KABA 3LCDA 3E7VA 3C4XA 4E93A 5ANJA 3CCNA 4JDIA 4U42A 3D5UA 2YDIA 2PVLA 2IZRA 4FF8A 4UN0C 4Z3VA 5GZAA 1J7UA 2X2LA 4ANQA 3QQKA 1Q41A 3OY3A 5BPYA 4LL0A 3LCTA 4UYAA 4FZDB 3UP2A 4CT2A 3UOJA 3BU3A 4YNEA 3EQDA 5L2IA 2GSFA 5JGDA 2CGVA 1GZOA 5I4NA 1CDKA 3QQJA 4Q5EA 4ZSLA 4GUBA 4JNWA 3H9FA 5ETAA 3UYTA 2OZAB 4ZSAA 5HBHA 2C0IA 4OAVB 5IQGA 2YDJA 3GC9A 1URCA 5F20A 3BEAA 2ETMA 3ET7A 3EJ1A 3NFGB 3OXIA 4D1SA 5C03A 3AMBA 4R77A 3LW0A 3MSSA 2VO7A 5CX9A 1QPJA 3R8VA 4TYGA 4YPDA 2OIDA 4F1TA 1H0VA 4D2SA 3C0HA 2PUPA 4WT6A 1GZKA 2XH5A 2CSNA 1XH9A 3AC3A 3KMWA 3UVRA 3CIKA 4PTCA 2B53A 4O4BB 1YWNA 4I5MA 4IJ9A 4FKTA 2C5YA 4FSTA 2BDWA 3PLSA 3PA5A 4QMVA 3R9NA 2J0MB 4IZ7A 2X0OA 4ZP5A 4EQCA 5IDPA 5AP2A 4YZMA 5D1JA 5AV3A 4YLLA 1J7LA 3U9NA 4UMQA 2C0TA 5M4FA 4F9CA 1A06A 2VNYA 2O3PA 5E8UA 3HV3A 2CDZA 4FKLA 4J97A 4AW2A 2YN8A 2VD5A 2WQBA 2XIKA 4I4FA 1KSWA 4RJ6A 2V7AA 1JKLA 3TMOA 4G6NA 4JBQA 1T45A 2XNMA 4QP9A 3ZRKA 4E6AA 3LVPA 4ZIMA 4E4NA 1XH8A 2BRHA 2ITTA 2XK9A 3QC4A 3AC8A 3RPVA 1IAJA 4R5SA 4OTWA 5L8JA 4CMTA 2PZYA 4MF1A 2EVAA 2OJGA 5LVMA 4A06A 4I93A 4IHPA 1FOTA 2XVDA 3HMPA 4H1JA 4U45A 1BKXA 3C9WA 2FO0A 4C38A 5EHLA 4WSQA 4PNKA 3PLAE 1JSVA 2VTTA 3TEIA 4MBIA 3KXZA 5EYDA 3TIYA 5E1SA 5HIEA 2HK5A 2R64A 4XYFA 2WTCA 3PIXA 5HE2A 4G3FA 3PA4A 2BTSA 2VWXA 2X6DA 4Q9ZA 5JRQA 3VHEA 5ANIA 4H3BA 4CZYB 3U9CA 2BKZA 2E9UA 4B7TA 2PZRA 5D10A 4RIYA 2XNGA 2QU6A 3CPBA 4RIWA 4OLIA 3CEKA 3VAPA 3U4WA 1WBWA 2FH9A 2JDRA 4D2WA 5IH4A 4O7WA 2LGCA 2UZDA 4K6ZA 5AP1A 1W8CA 4E4LA 3VULA 4XG9A 3ZFXA 4C62A 4MNEA 5HNBA 3GC8A 4FTKA 3DCVA 2QD9A 5IA1A 4E26A 3G2FA 3KXHA 3DAJA 3EQGA 4FL2A 4FSUA 4NT4A 3KULB 4MXZA 4BCQA 2C5NA 1WFCA 3BIZA 4F7SA 4O7LA 3G51A 1KE5A 4PTEA 5D7AA 2PE2A 5LVPA 5A4QA 3QAME 2VX1A 2Z7QA 4U79A 3MWUA 5IA4A 4GJ2A 5KE0A 4ZZNA 3V3VA 3O8UA 4MXAA 4U80A 5KBQA 5BVKA 2O64A 3G0FA 1OL1A 2OU7A 2YZLA 4IZ5A 1G8SA 1GOLA 4M3QA 2GHLA 4FKGA 2CN8A 5DFPA 5EKOA 5L8KA 2R3KA 5FBNC 4BCJA 4JOAA 5IQIA 3MH1A 4UMUA 3BHYA 3EQPA 5DRDA 4B0GA 4FEUA 4C36A 2WELA 3L1SA 4IWDA 4MQ2A 2VWUA 2VX3A 4UXLA 3VHKA 5CF6A 4FZFB 4BJJB 2VWIA 4DTKA 3P79A 4PTGA 4QD6A 3PP0A 4NWMA 1WBPA 3O71A 3GNIB 4DEIA 1REJA 3ROYA 4FOCA 3DZQA 4JIAA 5IU2A 4BICA 5EQEA 4FODA 2XKEA 4LMUA 4L7SA 4EJNA 2XA4A 4A9YA 3CP9A 4HPTE 5T3QA 4PP7A 5ETIA 3V6SA 3BWJA 4WNOA 3ORKA 3F5PA 5DNRA 3CTHA 2C6OA 3UDTA 4LGDA 4U7ZA 4IZYA 4DEHA 2B1PA 4FSQA 2OK1A 1GY3A 3NPCA 2YM6A 4CMUA 3EMGA 1U46A 4GG7A 2JIUA 3NRMA 4O86A 2GQSA 1KE8A 5IQAA 3F82A 4F7JA 3A7FA 3NIZA 3KF7A 4IB3A 1U5QA 2VRXA 4I3ZA 3DOGA 3NSZA 3MH2A 4XV2A 4B8MA 1Y91A 4DTBA 2B54A 2VO6A 3GP0A 3P1AA 3PXQA 4NTTA 4RJ3A 3NZ0A 5AAGA 2IF8A 3UQGA 5KMOA 3UNJA 3OFMA 4AZTA 4AZSA 4FOBA 2BRGA 1CKJA 4K1BA 4CLIA 4CZUA 3GCSA 1KE9A 3TNPC 2RG6A 4FEXA 4YTFA 5HOAA 4EK5A 4UYNA 2ZJWA 3QHRA 5CYIA 4BCGA 3BHUA 4GU9A 5BYYA 4AU8A 5AMNA 4QQTA 1H00A 4D9UA 2QKRA 4G9CA 2XJ0A 5EKNA 2CNQA 4ARKA 3N4TA 3NYNA 2W9FB 4JDJA 4Y72A 4D9TA 3HMOA 4NJDA 2OBJA 3UOKA 3VIDA 1JKSA 4JJRA 5IUGA 2QKWB 5IUIA 4MHAA 4AXAA 2BFXA 4MD9E 2B9FA 3ZO1A 2W4OA 5BQ0A 3UZRA 4IVBA 2P33A 4E3CA 1W98A 4PP9A 4O83A 5DOSA 2VTMA 3AMAA 2VNWA 3FUPA 3GU4A 2ZV8A 4TWCA 3MVHA 1E1XA 1UU8A 4FKVA 2GTMA 3BEGA 5AX9A 2YIWA 3BGPA 5JRSA 4CNHA 1FVTA 3HGKA 4NU1A 4YO4A 4RVKA 1P4FA 1WBTA 1ZWSA 4E8AA 5I9YA 3W2CA 1G8JA 3DBFA 3RPSA 4ZTMA 2QOQA 3R8MA 2I6LA 4NSTA 1Q8UA 4ZMFA 4I20A 2J4ZA 4CFNA 4RFYA 4TYEA 2CPKE 2WMUA 4GIIA 4JBVA 4R1VA 5KCVA 5AP4A 2WTWA 3QRTA 1YOJA 3Q4CA 4Y5HA 3MTLA 2JLDA 3Q96A 4RIOA 1WBSA 1U4DA 4MX9A 4L3PA 2QI8A 1FINA 2R2PA 4IH8A 3IGGA 4U97A 4FV2A 4IAZA 2XEYA 5AP0A 4C3PA 5K5NA 3R30A 5FXQA 2CN5A 3LJ0A 2JDVA 3H10A 4R1YA 4W4XA 5AP3A 2PHKA 3WE8A 3ZEPA 2NNWB 3EN7A 4M0YA 3LOKA 4HZRA 1YVJA 2WU7A 5I9VA 2WTIA 1KOAA 2OKRA 2YCRA 1PXOA 1TQMA 4DCAA 2P2IA 3CD3A 3POOA 3BYVA 5JK3A 4GT3A 3G6GA 2UW3A 4UWCA 4OTGA 4CG8A 3CKXA 3FMMA 2BMCA 4IQ6A 2VTIA 3GT8A 3PDTA 4GJ3A 1YOLA 3ALOA 2XALA 3NNWA 2Y0AA 4NZWB 3R83A 3RK9A 4ZZOA 5BNJA 3H9OA 5CU2A 4IZAA 2F49A 3PXZA 4EL9A 1GNGA 1WVYA 3QQHA 5GJDA 5GZ8A 3QKLA 3LFBA 3QZHA 4RSSA 4TT7A 4EOLA 5JFSA 3FDNA 4QP1A 4TZRA 4BRXA 3ULIA 2VWBA 4IANA 5A3XA 4DF3A 1L3RE 5J87A 1IAHA 5IH6A 5C8NA 4EYJA 4N57A 2E9NA 4QTBA 3LAUA 4EK8A 2V62A 1XO2B 2YM8A 5CU6A 3CE3A 4TNBA 5AIRA 2XKFA 4FJVA 4CYJA 3R7VA 2WMQA 2QVSE 3FMDA 3VUMA 5K0XA 2VTSA 4IX3A 3VO3A 4P4CA 4KSQA 4M7IA 2P3GX 4RMZA 5AR8A 3ZDIA 4F1MA 2J2IB 3F66A 1XWSA 3MVLA 2UZVA 4X2GA 3HLLA 3BYSA 3QKKA 2VWZA 5AAEA 5ITAA 3PPKA 4GFGA 3R9HA 4EK4A 4CG9A 4TY1A 1Q5KA 3MY0A 4QYGA 3D2KA 3PIZA 1UKIA 3OZ6A 3VQHA 5EYKA 4G31A 3FMJA 1PXNA 4BR3A 5EOBA 3WIKA 4GIHA 3SD0A 2YIXA 3LQ5A 3W32A 1ZZLA 4O0VA 1HCLA 4G5PA 5BMSA 1LEZA 2PWLA 3RAKA 2QU5A 2PYWA 3SG8A 1FGKA 5TR6A 3MVJA 3OXZA 3ORPA 4RRVA 5EYMA 3W10A 5C8KA 5LWNA 3SW7A 1A9UA 3PSBA 5FXSA 3SLSA 2R3GA 1TFFA 2F57A 1ZOHA 1URWA 1LEWA 2W1GA 3GU6A 4GEOA 5J7HA 5FTOA 2OG8A 3QZFA 2E2BA 3HV4A 4IB1A 5EQYA 4QO9A 3PY0A 3QQUA 4KAOA 2R3QA 4CFMA 4MXXA 3UGCA 2C4GA 1PXPA 3PJCA 5E92A 3UPXA 2OH4A 4FIHA 3FXZA 4GG5A 5DBXA 3RM7A 3SXSA 3S00A 4RJ8A 1OI9A 3F2NA 1M2RA 1PXLA 5GJFA 4ZEGA 2ITXA 5BYZA 4B4LA 4AZEA 2Z2WA 3AKLA 3NVMB 5EI8A 5C4LA 5EM6A 4AWIA 3RHXA 3RPRA 5AUZA 4FTRA 3QL8A 3MFSA 3EQBA 1QPCA 4M12A 2GNLA 4JT3A 1CM8A 4W4VA 4BZNA 3PXRA 5LARA 2YA9A 1I44A 3ZC6A 4D2VA 3EFLA 4QMZA 2XM8A 3LCKA 5ANEA 3D15A 3Q9ZA 5AR5A 1Q97A 2ZDUA 5HVKA 2FSTX 4AT3A 3MYGA 3LFEA 3Q04A 4Q5HA 3CSVA 2BIKB 3KF4A 3W0RA 3GQIA 3JXWA 3CQEA 3E8NA 3QD0A 2VTJA 2ONLC 3DT1A 3F5XA 5HLPA 1OL5A 1T46A 2JDSA 4BCKA 5L6OA 4FK3A 4EC9A 4LOPA 5EG3A 3R1QA 2R4BA 2PMIA 3LXNA 3QCYA 4TWPA 4F64A 1HOWA 4FV4A 3KK9A 4NIFA 3RINA 4AN2A 5TOZA 4H1MA 5HQ0A 4I6LA 4PDYA 3OBGA 5E1EA 3O23A 4M69B 3W0PA 4C4JA 3NYVA 4KIKB 4L6QA 5IISA 2YIYA 1H24A 3I1AA 2GHMA 4I41A 4DN5A 3O7LD 3R71A 1YHSA 2ITQA 5E9EA 3P4KA 2KULA 1BMKA 2W1HA 1DAWA 2AUHA 2Z60A 4JMQA 4FV5A 4RJ7A 5D7VA 5AP5A 1YKRA 1IEPA 3WF5A 2BTRA 3A7IA 2RIOA 3KU2A 3OOMA 3U6JA 1H1PA 3C5UA 4LOOA 3AD4A 2YFXA 3VBQA 2UZTA 1JQHA 4FZ7A 4QTCA 4QYFA 2QOLA 4ZLYA 5LMBA 3EQHA 4GKHA 2G1TA 4EHZA 2YAAA 2W5BA 5E8SA 4CKRA 1B6CB 2R3LA 4EONA 4F7LA 5M4UA 2A4LA 1UU7A 3HDNA 3PSDA 4PNIA 2OF2A 4AGDA 4AF3A 3PWDA 3HA8A 2PPQA 3EHAA 2C30A 3M42A 3BYMA 3OTVA 4XLVA 3LM5A 3MI9A 4FG8A 4GFOA 4WKQA 2R3JA 5ANGA 4ZS0A 3SRVA 5DLSA 1JSUA 2IJMA 2F9GA 3KRJA 4BY9E 5FLFA 3Q9XA 5H8GA 5A46A 3REPA 3QFVA 2CKQA 3FL5A 3MBLA 4IFCA 4IFGA 3DKOA 4DH5A 4DG0E 1SNUA 2PUIA 3OCSA 3A7GA 3MTFA 5CXHA 3SVVA 4A4XA 4MXCA 3NCZA 1O6KA 1ZZ2A 4ZY5A 2YM7A 2PTKA 4CEGA 1R0PA 4NTSA 3D4QA 4YJPA 3DXPA 2BZHB 4PPCA 4FSWA 3MV5A 3B8RA 3P86A 2IVVA 3OHTA 3BCEA 4HVDA 3DJ5A 3N51A 4QEBA 2R3OA 4IM3A 3GCVA 5FEEA 5FUTA 4RC2A 5DHJA 3GC0A 4FMQA 4BCIA 3SG9A 2GDOA 3TV7A 4FV9A 2BUJA 2XS0A 3O8PA 2IZTA 4O21A 4M68A 4DHJA 1XH5A 4II5A 3V04A 4IM2A 1ND4A 4G6LA 3AC4A 5AUUA 5L2WA 3RPOA 3O50A 4BYIA 2REIA 4QMYA 4EEVA 3PP1A 4M14A 4DC2A 2UZOA 4OTRA 2XMYA 3AKJA 1DS5A 3DBEA 1PW2A 3VS1A 4O0SA 4RIYB 4V0GA 3G90X 5HORA 2UZUE 3VW6A 1H1RA 2YABA 3DKGA 4RIWB 5CSWA 5TF9A 3ZO4A 1YQJA 3FWQA 2H6DA 4Y83A 4LV7A 5A9UA 4L42A 2WMSA 3RCDA 3LQ8A 4BF2A 2XK6A 5EK7A 2NYAA 4MNEB 4D4VA 4QRCA 1UKHA 2OIQA 1YI3A 2V0DA 1PJKA 3MVMA 4QYYA 3RK5A 2FUMA 2F7XE 3ALNA 4FKIA 4NW6A 5CAVA 2CNVA 2XAOA 2PVHA 2ZOQA 5DR2A 3GFWA 4LRJA 3VUGA 1MRVA 1UWHA 3OWJA 4FSRA 4AT4A 2PK9A 2XK3A 4R5YA 4ANNA 2WPAA 4EKKA 4BGQA 3V6RA 4C02A 4XJ0A 4X2NA 4GT4A 2ETKA 3MB7A 3FZ1A 2HZIA 4CV9A 1H1WA 2QODA 4XV9A 4OTIA 2C68A 3TG1A 4M97A 3ZZEA 3C51A 2X81A 3OS3A 4GU6A 4WBOA 5AP7A 1BUHA 3TWJA 3C1XA 4DGNA 3W16A 3BELA 3UDBA 4QTEA 2YJSA 4XG6A 1H25A 2GTNA 3MFUA 4EC8A 3Q2JA 4DDGA 3D5VA 3OUNB 3V5JA 4HYUA 5DRBA 2F7EE 1RJBA 4BDJA 3UG2A 2HELA 2JKQA 4CQGA 3P08A 2IWIA 1OIRA 2YLEA 3AMYA 4QPMA 2CJMA 3FQHA 5C27A 5TT7A 3W2QA 4C61A 4FEWA 4D0WA 3U87A 5JGAA 1NA7A 1STCE 5D11A 5EM8A 3R7IA 5L8LA 4MF0A 2CKPA 3FI8A 3MPTA 4ZAUA 2HIWA 3U8WA 5JFWA 4CYIA 4AE6A 5DEYA 4YNOA 4MWHA 4E7WA 1G8AA 4F9YA 5A4CA 2F7ZE 3UP7A 4DFUA 1JKTA 2W5HA 3IW5A 2ZAZA 1ZYLA 4WUAA 5EDRA 5CEPA 5HX8A 2A27A 5IQFA 3R1SA 4GMYA 2UZEA 2R3PA 5ETCA 1XHAA 3POZA 2VX0A 5HIDA 4S32A 4U5JA 5C9CA 3E3PA 2ONLA 2VTAA 1OM1A 2WD1A 3D0EA 5FP5A 4J52A 4O4CA 3BPRA 5CSHA 3PJ3A 1YHVA 2J0IA 2EB2A 4OTPA 4F0FA 4R3RA 2DS1A 4JQ8A 4AUAA 1JLUE 2CCHA 4EQUA 2GNHA 2HWPA 4K11A 1GAGA 5M44A 4QMNA 3NIEA 2F4JA 1UV5A 5FP6A 4LGGA 4IW0A 4UB7A 3U4UA 4JRNA 5FRIA 3W1FA 3IONA 5D12A 2IG7A 4Y46A 3WZDA 4O4EA 4QYHA 5M53A 5C1QB 2G2FA 2UVYA 3LQ3A 1Y57A 3BV3A 1YXTA 2QOOA 2BAQA 4I92A 4QTDA 4QP3A 4G1WA 2B0QA 4O4FA 4WA9A 3QTIA 3DK6A 4KBAA 2XIYA 5IEXA 1IA9A 2OICA 4F78A 3FZPA 1ZY4A 5CU3A 4EHEA 1QCFA 3QCSA 3WBLA 3F7ZA 3ORLA 4RJ4A 4I6FA 4ZJIA 2GNJA 4RZWA 3P7BA 5K4JA 2V55A 2C69A 2XIXA 2AYPA 3EZRA 4S30A 3R02A 3BHTA 4RWIA 3V51A 4IXPA 1OL7A 2X9FA 3UODA 5M09A 4D4SA 2W06A 5LXMA 1SM2A 3DNDA 4ANLA 1OKYA 5IMXA 3FMKA 3OEZA 2W1IA 1G3NA 2X8EA 4NFNA 4H3QA 4DLJA 2Y8OA 4YZDA 3UNZA 4GFMA 4AOIA 1OKZA 3E64A 2QHNA 2Z8CA 3L9MA 4OBOA 3E8CA 2XEZA 2XKDA 4OGRA 3FLSA 4YJVA 5DPVA 1NVRA 4FI1A 4P2KA 4JR3A 4B99A 4KS7A 4FSYA 3GFEA 3LLTA 3UE4A 2JC6A 4DDIA 3C4CA 1JAMA 3LMHA 1H28A 1TQPA 2UZLA 4GT5A 4RVMA 5DH3A 3HNGA 3KXGA 4O0TA 4FT3A 3W0OA 4F09A 4HYHA 1B39A 1OZ1A 2W05A 3E88A 4ZOGA 1XR1A 3Q5IA 3BL9A 3HV5A 4H05A 1OIYA 4BB4A 3BLHA 3NYOA 1ST0A 5B2KA 2Q0BA 4BHNA 3QF9A 2J50A 1S9JA 5DWRA 4XV1A 5I9WA 2O5KA 3CY3A 2R0UA 1F0QA 4LRMA 2YWPA 4AA0A 3F3VA 4QTAA 5HZNA 1U54A 2PVRA 3BKBA 4TRLA 2NPQA 5K4IA 4AXFA 3LCOA 1M2QA 2EXEA 5FGKA 3GGFA 2IN6A 3KRXA 4U0IA 2VTLA 4L43A 3HL7A 4EWQA 3PPZA 1O6LA 4DH7A 2P0CA 4KWPA 4RQKA 3LCSA 2H8HA 5KZ0A 1FVVA 5E8WA 4RC3A 4YZCA 4C4EA 2R9SA 2CGUA 5HTBA 3JUHA 3RTPA 4J95A 3L9PA 4Z7GA 4YPSA 4B8LA 2DYLA 2FA2A 2FB8A 5LVLA 1TQIA 4NCTC 3QQFA 3UOHA 3PFQA 5BVFA 2X2MA 3AQVA 3W2PA 2XYNA 3AKKA 4K2RA 2FYSA 2ZYBA 3TTIA 3BBWA 4FIFA 5B7VA 5IQEA 5TE0A 3ZU7A 2UW4A 2XZSA 4BKJA 2X4ZA 3ZDUA 3RM6A 4ALUA 5EH0A 2RFSA 2A0CX 3OCBA 3UC3A 5I9XA 5IEYA 3BLQA 3QU0A 3OD6X 2WQNA 4XLIA 4GK2A 2Y4PA 2NO3A 2W1CA 5LCKA 4QMWA 3OT3A 1TVOA 5I5ZA 3QRKA 2A1AB 3SXFA 1Q8TA 2YDKA 5ACKA 4ITHA 3A60A 3FZRA 3PZHA 4CRSA 1MRUA 2JITA 3HVCA 3QUPA 4PRJA 1PXMA 3NLBA 4DITA 3VF9A 4EOKA 3R28A 4BWKA 4YHTA 1NW1A 4R3CA 3GBZA 2C6DA 1MP8A 3V5TA 3ZO3A 4IVAA 3ATTA 3QLFA 3CQUA 3LE6A 3C5IA 3DZOA 1U5RA 5J5TA 4YP8A 1Q4LA 3NAXA 4U40A 2XNPA 4FRFA 3HMMA 2OXXA 4U3ZA 4YJUA 4BTKA 2C3IB 2JBOA 3T9IA 3EQRA 3EN4A 4YHJA 3DBDA 3EIDA 3L8XA 5E4HA 2AQXA 5DMZA 2PVNA 4V05A 3HKOA 4EZ3A 2JFMA 4HNIA 4O7VA 2JD5A 4L00A 4BIDA 5L6WL 4F99A 2ITVA 2GS6A 5IKWA 3I0QA 2WMVA 3LZBA 4X2JA 3F6XA 3QGWA 4C57A 3P78A 4GSBA 5CEIA 4BN1A 4O0RA 3PG1A 3MIYA 4EH2A 3VQUA 4RFZA 4ACMA 2OJFE 2Y7JA 5HCYA 5AJQA 3F7WA 4S34A 5HHWA 1E1VA 3ODYX 4W8EA 3UMWA 3BI6A 5EM5A 3UG1A 2OSCA 3WF9A 4F4PA 2X6EA 4I22A 4KBCA 3KREA 3NUAA 2C6TA 3W2RA 3FYKX 4GK3A 5IA0A 1KE7A 3C13A 3FYJX 4O7YA 4Z9LA 2BRMA 4XV3A 4QMMA 1J1CA 4U6RA 3O2MA 3DAEA 4I5PA 4D0XA 5BVOA 3PFYA 3RKBA 2A19B 4L45A 2R7IA 4X2FA 1OKWA 3KGAA 5AA8A 1V0BA 1ZY5A 2YJRA 3E87A 3KCFA 4KIOA 4FV1A 5CLPA 4QPSA 3RZBA 4D1ZA 4PPBA 5M4CA 4ZLZA 1F5QA 1UU3A 1Q62A 2QONA 3FHIA 1UWJA 5BX0A 1MQ4A 2HZNA 4Z16A 1BI7A 3F3WA 3PVWA 5CNOA 1MQBA 1QMZA 3FZTA 3VS3A 4XG4A 4O2PA 2VO0A 4ZY4A 1XMMA 3OMVA 2ITOA 2JKOA 1XH6A 5FM2A 4QP8A 1WBVA 3TNWA 5JEBA 2AC3A 5CZHA 4OAUC 5CEMA 4NIFB 4QMQA 2QR8A 4NM3A 4U81A 2H34A 3TZ8A 1L8TA 5HO6A 2VWVA 3KRRA 4I5HA 4BBEA 5HD4A 5LQFA 3DQWA 4TTHB 5AWMA 4C0TA 3QZIA 2XK8A 3D14A 3E5AA 5AUTA 3FI4A 5HCXA 5A14A 2BALA 3I60A 3WZEA 5FWKK 1QPEA 2GFSA 3QRJA 4YJQA 4D55A 3ZLYA 4CFUA 1LP4A 3EKNA 5JH6A 1R78A 4IX6A 4RLKA 2C3LA 3NVKI 4Y73A 1ZMVA 4MXOA 5CEQA 2BROA 4V04A 1PMUA 2IW8A 4KRDA 4EH9A 4QDEA 3KB7A 3ZLXA 5M07A 3WZUA 4C8BA 1WBNA 4GH2A 4IAKA 5DR6A 4RG0A 4ANSA 5EQPA 4K8AA 4A9UA 4BDDA 4FTOA 4IIRA 4LUDA 4TNDA 3ANRA 1NVQA 3PIYA 2W9ZB 3MFRA 3V8WA 4HYIA 3MGYA 4O91A 4X6RA 3R8UA 3TNIA 1K3AA 4F63A 2C6KA 3D2IA 3FPMA 5C8MA 4IX4A 4MD8E 5CVFA 3OCGA 3D7TA 3VBVA 4BZDA 1DAYA 2C5XA 4J8NA 4OBPA 2JDTA 3FSKA 2J6MA 4BCFA 4IVDA 4EH8A 3B2TA 2JKKA 5J5SA 2XNNA 4FSZA 4ERWA 4FTTA 3IO7A 5LVNA 2VU3A 3LXKA 4FKOA 4NM7A 5ANDA 4FNXA 4RIXB 4C7TA 2BZKB 1W83A 3E92A 5AV0A 5IMEA 3R7YA 3ZEWA 3SRVB 2WMRA 4EBWA 3VS0A 3NCGA 4X0MA 3PWYA 4A4OA 3FXWA 4C2VA 1CKPA 1YXVA 4IC8A 3OY1A 4UBAA 3F69A 3EN6A 2XBJA 3A8XA 1BYGA 3RI1A 4FTLA 1K9AA 1WMKA 5CEKA 3QTRA 2WO6A 3VRZA 4LQMA 2PVKA 3QWKA 2QO9A 4A7CA 5E8ZA 1ZYSA 4FKQA 3UZTA 1IA8A 2OJ9A 3PY1A 1OITA 3A61A 2IEWA 3W0MA 4BKZA 2YISA 2X0GA 2BRNA 2Q0NA 3PE2A 4FGBA 2PMLX 4MBLA 1A48A 3U55A 4PMPA 2VZ6A 4TPTA 1ZXEA 2ZFYA 4NFMA 3F9NA 4QP2A 4NCTA 4JL9A 5EYCA