3NZ0A

Non-phosphorylated tyk2 kinase with cmp6
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
291
structure length
285
Chain Sequence
DPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title A new regulatory switch in a JAK protein kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 285
sequence length 291
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nz0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nz0A01
3DQXA 3QHRA 3HL7A 2XYUA 2VTOA 3BLRA 3C5UA 2W0JA 2ZDUA 3NNVA 3FI4A 2OFVA 4LG4A 3O2MA 2QOKA 5A3XA 4U97A 3E8DA 4CQGA 1U59A 3R7IA 3IK3A 3QZFA 1Y8GA 4KSQA 1JSTA 4FV1A 4IAKA 4NM0A 4FKLA 5CWZA 1SVGA 4RVLA 3C4XA 4DH8A 2YM4A 3R00A 5ACKA 3VBWA 4BCKA 4R5YA 3D2IA 3QQHA 3DB8A 3PVBA 4TYIA 3VHEA 3VUTA 2QLUA 4PMPA 5A4QA 4JBPA 3NMUF 2X8DA 1Q5KA 4O0RA 3R8MA 3M1SA 2OLCA 4AT5A 5BQ0A 5DT3A 3R9NA 2ZOQA 5I4NA 3LCOA 3LFQA 4RLLA 4CYIA 2BFXA 3VIDA 2WTIA 4IDTA 5BVOA 3CP9A 3D2KA 4FTOA 2G01A 3T3VA 2ZJWA 3ROYA 3NUYA 3QWKA 4G17A 5CENA 3V51A 3ZZWA 4Z7GA 2BZKB 2WFYA 4F63A 4YHJA 3VQHA 5JN2A 4GEOA 5HG7A 3PJCA 2JITA 4TWOA 2J9MA 3MIYA 4G9RA 4E5WA 4UZDA 3DNEA 2XM8A 3QALE 2I0EA 3BHVA 3E63A 3C50A 5AV3A 3KXXA 2XM9A 4V05A 3EMGA 4PMSA 3WIGA 4R8QA 3CPBA 5AR3A 4PF4A 4RQVA 1LP4A 5CU4A 4YZNA 5CVHA 4OBOA 3Q96A 4YURA 1AD5A 4FKIA 4KIKA 5HTIA 3QAME 4XP0A 1KOBA 4IAYA 4N6ZA 1ZYDA 3TZ7A 4XG4A 2C5XA 4USDA 3UMWA 4DF3A 5GINE 3RM6A 4R3PA 4H1MA 4L42A 3GFEA 1VZOA 1FVVA 3AOXA 3FUPA 1BYGA 5EH0A 4RX5A 4OTWA 2CGVA 2BAKA 2Y4IB 3NUNA 2REIA 5IQBA 1GZNA 1VEBA 5CSXA 3FL4A 3VS7A 3DDQA 2A19B 3KC3A 3WF5A 3UTOA 5H8GA 4A9UA 4M97A 4F9YA 4F1TA 3S2PA 5HIEA 3NVMB 2WPAA 3V5WA 4DEEA 4P4CA 1PYXA 4ZTMA 4EQMA 3ZZEA 2GQRA 3HMIA 5BNJA 3E64A 1BUHA 3EN4A 4PTEA 4BCPA 5JKGA 1JWHA 4FT0A 2IW9A 2UW7A 1REJA 2UZVA 4DFLA 4M7IA 3KXHA 1U54A 3ZXZA 3HX4A 3I79A 1ZMVA 4D1ZA 4S30A 1BX6A 4I20A 1YQJA 3FKNA 2C68A 4NFMA 5HVYA 5C4KA 1LEZA 3BX5A 2B7AA 3R9DA 4ZLZA 5HKMA 3JR1A 4WNPA 4F6UA 2VWWA 5J9YA 1JKSA 3VC4A 2P33A 2H8HA 3V5TA 3HNGA 4RX7A 4GCJA 3H0YA 4MWHA 3W2PA 5LVOA 5I9ZA 4AP7A 4JLCA 4PDSA 2GNGA 3D94A 4O7TA 3RGFA 1OIQA 1Q8TA 3OTUA 4QP8A 1VYWA 1ZZLA 4CD0A 1F0QA 1CKPA 3H10A 2UZBA 5HD7A 2C30A 2BPMA 2W99B 5E8UA 3FQEA 5KZIA 3SLSA 3KB7A 5DOSA 5HX8A 3NYOA 5IEXA 3F5GA 2J7TA 1I09A 3E62A 3L8VA 3F5XA 3R28A 3A7JA 3LJ1A 3FI8A 2C47A 2ITOA 4OBPA 3TNWA 1J3HA 3Q6UA 5JEBA 3O96A 4IM2A 4TNDA 4GKIA 2QONA 4C34A 5BVFA 2RGPA 1V1KA 1KV1A 2QO2A 4IE9A 5TE0A 2WTCA 3NCGA 3PXQA 2XCKA 5K0KA 4HGTA 4AAAA 1JVPP 1WBWA 4FNWA 5IDNA 3ZDIA 1GY3A 3F3WA 3MSSA 4RIYA 4KA3A 2GSFA 2JFLA 1SMHA 5IUGA 5DWRA 3SW7A 5KE0A 4O7ZA 3KVWA 2QOBA 4IFGA 3FSFA 2X7OA 4E4LA 1H1SA 4C4JA 4JBOA 3NWWA 4TYHA 1H1PA 3U9NA 3DGKA 2OFUA 3EQIA 2QQ7A 2XBAA 3MFRA 4XX9A 5EKOA 1ERKA 3LQ5A 5IQCA 2YISA 2H6DA 4UZHA 3DBDA 4N70A 4MCVA 1UWHA 4WBBB 4BYJA 3FMKA 5ITAA 4L3PA 2BRGA 4C58A 4XRLA 2AUHA 3QCSA 3VUIA 2R3HA 2O3PA 3PA5A 3PSBA 3RBWA 5M07A 3MH2A 4M68A 4GFGA 1MQBA 3TN8A 3VBTA 1YHWA 2HZIA 5IQGA 3OG7A 5CU3A 5HE1A 3LJ2A 3ZSIA 2PVFA 4WO5A 3W8QA 5HLWA 1IAJA 3VWAA 3HAVA 4DFNA 4NTTA 5CU6A 2PVMA 5AP2A 4GK4A 5AAGA 4CVAA 3RM7A 3COKA 4TWPA 4HCVA 2RG6A 1EH4A 4DEBA 3WE8A 2VTJA 4NWMA 5K9IA 1DAWA 3U6JA 5DFPA 3FZ1A 4I5CA 3VF8A 4UMTA 3VUMA 1Q61A 4BIBA 4IZ7A 2C6EA 5CNNA 4F4PA 4QOXA 3D5UA 2OXXA 4PPBA 5HX6A 4OAUC 2YM7A 2J90A 3K3JA 4FIGA 3HMPA 4FT5A 3TKIA 2HAKA 3COHA 3W33A 4JR3A 5IDPA 2B4SB 3NIEA 3BGPA 1KE7A 5CASA 4J95A 2B9IA 3R0TA 3ORXA 4CFUA 1JAMA 3JXWA 5LMKC 4P90A 5KO1A 5HQ0A 5HZNA 5CSWA 4YTHA 1IEPA 2WTKC 2ITXA 2OJFE 4ALUA 1NA7A 3E7VA 5D7VA 4QQTA 5HO8A 3BWFA 4EK4A 2YWVA 1M7NA 5I3OA 1W82A 2EB2A 4O84A 1BI7A 4YTIA 3E7OA 3W2SA 5CANA 4MD9E 4EHEA 3P79A 5DT4A 3A7GA 4BVUA 4H1JA 4M13A 4YZBA 5EI2A 5KBQA 3GOPA 4QQ5A 4QO9A 2JGZA 2CKPA 2UW4A 1UKHA 5KMMA 3S3IA 2WMVA 4GU6A 1HOWA 2PMNX 4Q5HA 4DBNA 4IFCA 2R3JA 5HE3A 5JQ8A 3WZKA 4ZJVA 2R3LA 5DMZA 2PY3A 4GU9A 4KIKB 1LR4A 3ZM9A 4JT3A 2CKEA 4AN9A 4AA0A 4H05A 1IR3A 2GU8A 2JKOA 3HDNA 3FQSA 4E3CA 4O6LA 5IH6A 3DK6A 3KXGA 4IB1A 3KA0A 2BIKB 1BMKA 2PHKA 3VQUA 4PL4A 3ZFXA 3DPKA 3POZA 4NW5A 2X7GA 1A48A 3MFTA 3T9TA 4BWKA 5HORA 4FIFA 1E1XA 1ZZ2A 3KN5A 4IXPA 4XLVA 4AN2A 4DH7A 3MY5A 4AGUA 1W0XC 1FVTA 3REPA 2VWXA 4AFEA 4BRXA 2PZYA 2XIXA 3IW8A 2GHLA 4Y85A 3Q4TA 5JGBA 2BHHA 2W96B 3R73A 1IG1A 4FIEA 4AQCA 4HZRA 2OGVA 4FTQA 3GI3A 2VTHA 2JDVA 4BGHA 2YM8A 2W1IA 2GNLA 2VNWA 4YGAA 5DR2A 3TNHA 4F1MA 5KHXA 5J7BA 4O6EA 3GU4A 4D2TA 5IPJA 2CLQA 4DYMA 1P2AA 3CS9A 3GCQA 4PTGA 3HVCA 4UYNA 4R7HA 5D12A 2YZAA 2Y7JA 2YCQA 3ZUVA 5C01A 4DAWA 1BL6A 2QOFA 4WNMA 3C4ZA 5IZFA 4BCOA 4EK8A 3QQKA 4EH3A 5CEPA 4G3CA 1PMEA 4MEDA 2GFCA 3MIAA 4F65A 4M67A 2AYPA 3R8PA 4W9XA 2CGWA 4Z7HA 4GUEA 1WBSA 4FKVA 1ZWSA 3QXOA 4XG3A 4ARKA 3NUSA 3UE4A 1PKGA 4FZDB 1ZY4A 3EQPA 3IGGA 1R39A 3G2FA 3DXPA 2QD9A 2VTQA 4HYIA 2VZ6A 3AC8A 4FV6A 4TTHB 3ZS5A 4BCIA 2VO6A 3UC4A 4DCEA 2BAJA 3DKCA 3FHRA 5AIKA 2XKEA 4M66A 1WMKA 3D7TB 4ZJIA 2HENA 2DYLA 5E9EA 4ZSGA 1GIHA 1OKWA 2FSTX 3CJGA 2XS0A 1NVSA 2F7ZE 2UW3A 3F3TA 2XA4A 4P5ZA 4X3JA 2JFMA 4CNHA 2BIYA 4EHGA 4RIYB 3EHAA 3OEZA 5FP6A 4HPUE 3CTJA 4CT2A 3E8NA 5DIAA 4LGHA 3KULA 3WI6A 3HAMA 4O7RA 4YHTA 3ZO2A 2CLXA 5C8NA 4O0WA 2H96A 3IOPA 4UEUA 4XOZA 3TZ9A 3MFSA 1H07A 3PP1A 3PPZA 5ICPA 5DN3A 5KX8A 3R9OA 3A7FA 4B8LA 4ZZMA 3C4FA 3WYXA 3LMIA 1XH5A 5FM3A 5FTOA 4WG5A 3VUKA 4I5MA 1OVEA 2WOUA 4WSYA 5ETAA 3GGFA 5I9UA 5AR7A 3P7BA 3HECA 4QPSA 3P86A 4ZZOA 4IADA 3OXZA 2PSQA 1OBDA 2J5FA 1ZYCA 2OO8X 3KKVA 5ANOA 4RSSA 3TTIA 1NT2A 4R1YA 4G34A 4EOLA 4NJDA 4OGRA 5FEQA 5M55A 5AUTA 2QOLA 4XCUA 4YC3A 4BWXA 4DLIA 3PJ2A 4EC9A 3ZLYA 4GG5A 4O2ZA 1ZMUA 1ZYJA 3R83A 1Q8UA 2J0LA 2OF2A 4GW8A 3KN6A 4C57A 4BR3A 3ZEWA 4BCNA 3OWJA 3RP9A 2G2FA 3DFCB 3GU5A 5L6PA 2FSOX 2J0MB 3EL8A 1ZLTA 5E92A 5HNIX 2XK9A 3QD4A 5BUIA 4EYJA 1CTPE 1OL7A 5ANIA 3LCKA 4G9CA 1CM8A 3KRLA 4KKGA 4PPAA 2OK1A 3TG1A 3R8UA 2VV9A 2WTVA 3R21A 2PVKA 3TIYA 5EQEA 3I5NA 3VUDA 3F69A 4FICA 5AX9A 2R3KA 4E4NA 3F7WA 2G2IA 2ETKA 2R7IA 3HP2A 3QYWA 3KFAA 3W18A 5A46A 4FYNA 1YDTE 3ENMA 4NKAA 4PP9A 2UUEA 4TY1A 2YM6A 3RKBA 5DYJA 2ITYA 3GU7A 4I3ZA 4N0SA 1YXXA 3P5KA 3OXIA 2CHLA 3WIKA 4LOQA 3O23A 3TJCA 5IH5A 5DPVA 2XNNA 4FSTA 3CPCA 2GTMA 5EYKA 3TV7A 4EJNA 2A4LA 5E4HA 3F61A 3FE3A 3UOJA 1YOLA 4ENYA 4AGCA 1APME 4KRCA 5HCYA 3E3PA 2QLQA 1TQPA 2W1HA 4L01A 4TWNA 4HGLA 2QOCA 3Q6WA 2BROA 3IS5A 3W1FA 4BDIA 2OZAA 3SA0A 3CLYA 4I22A 3EYGA 4CRLA 4RQKA 1XH6A 2J0KA 3BLQA 3E88A 2CNUA 4U45A 4YNOA 2PVLA 4QD6A 5HLNA 5HGIA 4L46A 4D1XA 3QD3A 4NIFA 2EXCX 3FMHA 2XYNA 1JOWB 1WFCA 2OU7A 2PUUA 2Q83A 2QG7A 3UOKA 1PW2A 1Y8YA 3B2TA 3R7YA 2QVSE 3GP0A 4YBJA 3NDMA 2PPQA 3QZIA 2IVVA 4FC0A 4RRVA 3CSVA 4IZYA 4G6NA 5AFVA 2VO7A 4A4LA 2VX1A 5GNKA 1NXKA 4M3QA 5EM7A 3PXZA 3S1HA 4H36A 4D0XA 5TKDA 4EH2A 2BZJA 3MWUA 5G1XA 2P4IA 3ZXTA 5I3RA 4LOOA 3DU8A 4JQ7A 5A4TA 3ZLWA 1QPEA 2CKQA 3I0OA 5D1JA 4RWKA 4PX6A 3BYVA 3R2BA 4FEVA 1PY5A 3O8TA 3EYHA 4V04A 1XHAA 3FLYA 1F3MC 3L8PA 3EIDA 4MX9A 4YJUA 3LAUA 3QZGA 4YZCA 2W9FB 4BC6A 4ZY4A 2WHBA 3BHUA 4A9RA 2R9SA 2YM5A 2IZSA 4FTCA 5CAOA 4L7FA 3NYNA 3R8ZA 5D41A 4R1VA 2VD5A 3OW4A 4FA2A 4H3QA 1WBNA 3UYTA 3V01A 4YLJA 4ZP5A 3FZPA 4IAFA 4F64A 3KGAA 4WHZA 1BLXA 5IG1A 1UU8A 3DBEA 4IJ9A 2C5NA 4K1BA 2VTLA 4BDBA 4AN3A 4CXAA 1Q8WA 3MPMA 5J9LA 5FEEA 2C6MA 2OF4A 2UW6A 4XUFA 3QYZA 5F1ZA 2PTKA 4AOTA 5ANGA 3I81A 2BKZA 5GHVA 3QX2A 5BVKA 3ZUTA 4DG2E 1VR2A 4CZUA 4OTIA 4WUAA 2CN5A 3C4WA 4RJ3A 1WAKA 2XKFA 5D7AA 4WUNA 3K54A 2QI8A 3R1SA 4FSWA 1J7IA 2UZLA 4NM5A 3K5UA 3SHEA 4FKJA 3OW3A 3UZRA 2X81A 3BBWA 3PSDA 4DH5A 3LM5A 2C3JA 1OECA 2NNWB 3F82A 4MTAA 3H9RA 4S31A 4CT1A 4GVAA 5CF6A 1J1CA 2YJRA 3O7LB 1FOTA 3CKWA 2GS6A 4HPTE 1PMUA 4II5A 2OSCA 4I6FA 4I5HA 4GVJA 4I6HA 4QT1A 4WNKA 5AM7A 2F2UA 1NW1A 4FSYA 5DRDA 1QPCA 3PG1A 2JKQA 5BMSA 4E6CA 5HBEA 3W2CA 3AC5A 1PMNA 4Y5QA 4QNYA 5E1EA 4KNBA 3VS1A 2A2AA 2VWYA 3JY9A 4CEGA 3EQFA 5CALA 3FHIA 5F20A 4ACMA 4Q2AA 1OL2A 3NGAA 1RW8A 3FYJX 3V8WA 1Q41A 2EU9A 4F0FA 4OTQA 2ZB0A 2WQOA 4FTNA 2I0HA 5KZ0A 2OJGA 4XG6A 4Y8DA 3M42A 3ZFYA 1ATPE 4QYHA 4K2RA 2W5HA 4FKGA 4FUXA 2YITA 4TYEA 1UKIA 2UVXA 3EWHA 4KABA 3UO4A 3OCSA 5JRQA 3UZTA 4DT9A 4GG7A 4U3YA 4BN1A 3ODYX 5I5ZA 3T3UA 2XJ1A 2ITZA 2YZLA 5E1SA 3S0OA 5HD4A 4MF1A 3R1QA 4FL1A 5EKNA 3R1YA 4FSMA 2UZEA 2YHVA 3OCTA 4ZOGA 5C03A 2E9UA 3KMWA 5BUEA 4FBXA 5M4IA 5IQEA 1Y6BA 5AR5A 1OB3A 2F7EE 2ZVAA 3WYYA 4RJ4A 2C5VA 5M09A 4ZSJA 5CAUA 4FV0A 2BUJA 4MXZA 4I21A 2WMTA 2C3IB 3EN6A 3QQLA 5CXHA 4AT4A 3QZHA 2O65A 2XEZA 2DS1A 4QP7A 2QR7A 1XWSA 1NVRA 4J7BA 4WD5A 2Q0BA 5DLSA 4S2ZA 3CGOA 4OW8A 2FSMX 2R3QA 4OTPA 3G51A 3FDNA 3L8SA 2VTIA 4IZ5A 4RZWA 3ANRA 3MH0A 1RQQA 4BBMA 2BDFA 3QRJA 5AV4A 1S9IA 1WBOA 4DG0E 2O0UA 1IASA 2J6MA 4JIKA 4CMTA 4NSTA 4C37A 3GCUA 4EH9A 3PXKA 3P7AA 5IA5A 4FKRA 2B53A 3QQGA 3FY2A 2BALA 3RALA 3OMVA 4IWDA 2JIVA 2OZAB 2ERKA 2FGIA 2PE0A 3I6WA 4PNIA 4AW1A 3PVWA 4Q9SA 3ZLXA 2W17A 3UJGA 3EFWA 3NIZA 1YKRA 1Q3DA 4NIFB 5C9CA 4W8EA 3PXRA 2ZV2A 4M14A 4RWJA 4KBCA 3AC1A 4A4OA 3DAKA 4ZY5A 4HOKA 4S34A 3QKLA 1NY3A 3SDJA 3UIMA 4QMPA 4E4MA 3TDWA 2WB8A 3QCYA 5CSHA 3TV4A 4GT3A 2BKKA 2R3RA 3LQ3A 3HV3A 2OXYA 3TCPA 2R3NA 4BZOA 2UZWE 3RNYA 5C1QB 2P3GX 4QTAA 3BI6A 1GIIA 3G6HA 3UNJA 4O91A 4YSJA 2JKMA 3EN5A 3EQCA 1PRYA 4PDOA 5TO8A 1IAHA 4MVFA 1WBVA 3QRKA 3JUHA 4HZSA 4F6SA 2RFNA 3BRBA 3QUPA 1MRUA 3UBDA 3N4TA 3OUKA 2QNJA 2G2HA 1SZMA 2C0TA 5FM2A 4C61A 2IPXA 1JSUA 3LHJA 4GSBA 4G2FA 4IZAA 4KD1A 4PWNA 1FMOE 3PP0A 4MQ2A 4RX8A 4FTKA 4FE2A 2X1NA 2XIYA 2YDIA 4WRGA 4DLJA 4EH8A 2QG5A 2GNHA 4APPA 2XNMA 5FXQA 4QQJA 2RL5A 4LV8A 3V6SA 4F0GA 4MBJA 4QP3A 5TF9A 2YM3A 4LUDA 1FVRA 3KMUA 2ONLA 3RAHA 3ZBFA 5M53A 2QKWB 3A8WA 3QRUA 4DGOA 3WILA 3P7CA 2C6IA 2QODA 4R7BA 1CSNA 4FT7A 2EVAA 2R0IA 4BTJA 3NUPA 2WMXA 2VTPA 2BRHA 2I7QA 2XZSA 4IWPA 4PUZA 4HVDA 1H8FA 4OTFA 2JLDA 4TW9A 3HZTA 3CBLA 4K77A 3NX8A 3NCZA 3FLQA 4IJPA 4IX5A 4YJPA 3R7OA 3BU3A 2JDRA 3OZ6A 3PWYA 4G6LA 4GV1A 3BWJA 4AF3A 4X2GA 4BZDA 4U79A 1QMZA 4RPVA 4PY1A 1PMVA 4JOAA 3CTQA 4J71A 4JX3A 4E26A 4FZFB 2GPHA 3AGMA 5CF8A 4MNEA 4XS2A 3HP5A 3FMJA 3PFQA 3BE9A 3OXTA 4KBAA 3D83A 4O0UA 4QMVA 4YZDA 5A4CA 5GZAA 4R77A 3UIBA 3VS3A 4QPAA 5B2LA 3ZYAA 2HYYA 4BKJA 4AW5A 1QPDA 2PZPA 4GFOA 4IC8A 4U5JA 4XG2A 3QLFA 2E2BA 5AR4A 5A9UA 2W7XA 3H9OA 4L52A 4YC6A 3L8XA 4U44A 2R3MA 5GJGA 3ULZA 1BL7A 3PUPA 1XBAA 4U3ZA 4E20A 3PIYA 4H58A 3JPVA 4EZ7A 3MY0A 2F2CB 2FO0A 4J99A 2JDSA 3ETAA 4B4LA 2PMIA 4FKOA 2XH5A 4FV5A 4GH2A 4ACHA 3KXMA 2FUMA 2BVAA 3G9NA 3DS6A 4FTIA 4WG4A 2JEDA 3V5QA 1H25A 1STCE 4X6RA 5D11A 4ONAA 5CEKA 5AV2A 3ATSA 3V5PA 3HUCA 2PVHA 3ZEPA 3NW7A 3RAWA 3BU5A 3N4UA 5L2QA 4O0XA 3P9JA 2WGJA 3OWPA 3RK7A 3EFKA 1IA8A 1SYKA 3GFWA 2VTNA 5CEOA 4PDYA 3PXYA 3O7LD 3GCSA 5BVWA 4I41A 4ZTLA 2R3OA 2Y4IC 3GC8A 1Q8ZA 3NUUA 5AP6A 5AP7A 4F70A 3E93A 2XMYA 3KXNA 5AUXA 3W2OA 4ID7A 4Y95A 2HW7A 3DZQA 3QTXA 2OBJA 4LRKA 5L2SA 4FTJA 3Q2JA 4BDFA 2YAAA 1B6CB 1ZRZA 4U80A 1H1QA 2Z7QA 1J1BA 4BCFA 5F9EA 2VNYA 1SNUA 5LMAA 2OW3A 4YU2A 3PJ3A 3FEGA 4DFUA 4E6QA 3CQUA 4FT3A 4RFZA 2JBOA 3D7TA 4TXCA 3E8EA 1PXNA 2O63A 3G6GA 4NH1A 4ZLOA 3OF0A 2QCSA 4BDDA 4ZTSA 4FX3A 4G16A 1H27A 4FNZA 4R7IA 3IOKA 4AG8A 1R0EA 2ZM1A 3WZEA 4TYJA 4FV4A 2W1EA 4RFMA 3ORTA 4RWLA 2ZB1A 5EFQA 5I9XA 3II5A 4V01A 5JK3A 3WOWA 2UZTA 2C69A 4PTCA 4G3EA 2XKCA 5EM6A 1WVWA 4NYEA 3O8UA 5CYIA 2YIWA 5AUVA 3UPXA 4OAVB 3LIJA 5DR6A 3RAIA 5K4JA 4IDVA 2Z7LA 3FY0A 1FGKA 1P14A 4D28A 5I0BA 2UZDA 4JG8A 4BBFA 4GK2A 3CKXA 3EH9A 3EQDA 3WZUA 3QCQA 4EWQA 2WMUA 3B2WA 4F08A 4M0ZA 2X7FA 3SOCA 4EOQA 3RWPA 3EQRA 4WT6A 3IONA 1XH4A 3GVUA 2Z02A 1S9JA 4BDJA 5FQDC 2PVJA 2UZNA 1WCCA 4EYMA 3NNXA 1V0PA 4E93A 5CAPA 3GC9A 1WZYA 5KMOA 2HXQA 4L00A 4FTAA 4FSRA 4UX9A 5EI8A 4QMTA 5LARA 1WVXA 2R3PA 3QC4A 2BDJA 2IVSA 2V55A 4ZMFA 3QBNA 2R5TA 3IKAA 3PXFA 3U51A 2F57A 4A07A 3GENA 4ANLA 1YW2A 2F9GA 3LFFA 5JGAA 4FVRA 3UYSA 4F7LA 3IW5A 4W4WA 4WA9A 1IA9A 3KRRA 3VN9A 4EEVA 3PIXA 4OBQA 3RI1A 4IAIA 2Q0NA 2YCSA 2GNFA 3R01A 3BYOA 2CGUA 2LGCA 5CI6A 2VUWA 4FZ6A 3ORPA 1WBPA 3U55A 2FB8A 4EUTA 3RPOA 4XHKB 3MVJA 3VBYA 3MH3A 4YP8A 4GKHA 5BX0A 2BMCA 5EDQA 3DOGA 2C6LA 2A0CX 2WQNA 4WG3A 5KUPA 2PULA 3TM0A 4GRBA 1OL1A 3L1SA 4W4YA 1IRKA 4CSVA 4Z9LA 4FVPA 4I1ZA 3ZRLA 4FNYA 3FC1X 5DGZA 5EI6A 5FLFA 1ZYSA 4FMQA 2ZV8A 3UVRA 2X6DA 4EOIA 3C5IA 1OKYA 4Y5HA 3UDBA 2HW6A 1JKTA 4FG7A 4BZNA 1H08A 2X6EA 2VTSA 2VGPA 3MS9A 3S00A 1MQ4A 2HY81 4UB7A 2A27A 2IWIA 3VS5A 4GMYA 2VWBA 2PUPA 2CDZA 4GIIA 2B9JA 3P23A 5EHYA 4MNEB 3QTSA 4RC4A 4I0SA 5HVKA 4GL9A 2GDOA 4DA5A 5KMIA 1M2QA 4KWPA 2WTDA 2OIQA 3Q4CA 1JKLA 5DVRA 5HNGA 1LEWA 4JDIA 2KTYA 3SXRA 4U43A 4HW7A 4IW0A 4A9YA 4ZZNA 4F7NA 2YAKA 3JVRA 3L9MA 5AUZA 4YJSA 4BCHA 4UWCA 1O9UA 1F5QA 3RINA 1GZ8A 4C35A 2ONLC 4FV3A 4M69B 3SXFA 2IG7A 3G15A 5DT0A 4TZRA 3RVGA 5KKRB 5JFVA 2WTJA 5BYZA 4S32A 2PVYA 4WNOA 3ZUUA 3PWDA 3EKNA 3R71A 1KUTA 3WF7A 2C6DA 3TWJA 1OITA 4FEUA 3DTWA 5AAFA 3R7EA 1KV2A 2PE1A 2XKDA 5FG8A 1OBGA 3BQRA 3FXWA 4GK3A 4O0SA 3VW8A 3KU2A 4EK3A 4D1SA 4I6BA 3ELJA 3FYKX 4GT5A 4GUBA 5LQFA 5EDPA 4YBKA 2XF0A 4UBAA 4K18A 2W5AA 2OJIA 5HBJA 5IEVA 2ZM3A 3LCSA 5HE0A 4HVSA 4O7YA 5GIOE 4E6DA 2NRYA 4GFMA 1OPJA 5K3YA 3NNWA 2HK5A 4S33A 4AA5A 4D5KA 5CQWA 5BYYA 1DI8A 5L6WL 3SKCA 4NM7A 1YWRA 2OWBA 2WQMA 3LZBA 4EH7A 3WZDA 2UZUE 4IM0A 4QMXA 3PJ1A 5K5NA 5FGKA 4L3LA 5CS6A 5AP1A 3DB6A 5HO6A 5AA9A 2IO6A 3U87A 4I24A 4DGMA 2WQEA 3ENHA 4MK0A 4BYIA 2J4ZA 2BTRA 4J1RA 2UZOA 4BGGA 4FSNA 2ZMCA 3HMNA 3FMEA 2Z7RA 4AZSA 3K5VA 3PTGA 3LFSA 3A60A 3QTWA 4J8MA 5M56A 2G15A 1OL6A 2WO6A 3HV6A 4NW6A 1T46A 1MRVA 3OBJA 3R1NA 3UQGA 3AT4A 4XEYA 4MWIA 5T68A 4OTDA 1YVJA 2FYSA 3A2CA 3DCVA 3BIZA 4P7EA 3MVHA 4EH5A 5EYMA 4FEWA 3CJFA 3O50A 2QOHA 5AM6A 4EZ5A 1Y6AA 4HVIA 4O7NA 4FZ7A 2RG5A 4JX7A 5AP3A 5H8BA 3N4VA 3E5AA 4RJ7A 5AA8A 3QCXA 1XQZA 2FH9A 2IW8A 3MVLA 3QX4A 2W05A 2CNVA 2Y4PA 2UW8A 5DG5A 2ZV7A 1RE8A 2ZDTA 3Q04A 5CX9A 4J98A 3MBLA 2WZJA 5A4LA 3I7CA 2R4BA 2C0IA 3TEIA 4XG9A 5EOLA 1UU7A 1M14A 2OH4A 2Y0AA 3NAYA 1CKIA 1FPUA 1YXTA 2ITPA 4E1ZA 2QOQA 3FSKA 4YO4A 1YXSA 1XR1A 3PIZA 3QTZA 3FLNC 3QKMA 4X0MA 4K6ZA 4BGQA 4MAOA 5ANJA 3HV4A 4F9AA 4QMQA 2BRMA 5J95A 5IA2A 4OTGA 3C13A 3DDPA 2OICA 4O82A 4BL1A 5FDPA 3TZMA 1ZARA 3QHWA 5HO7A 4DTBA 1GAGA 2Y6MA 4MYGA 4B6LA 3OT8A 2R64A 1NVQA 1PXLA 3RWQA 3WF8A 3ZONA 4DEDA 3FZTA 2YIRA 4ZEGA 3WF6A 5J1VA 2HELA 2Z7SA 3P1AA 4B0GA 1M52A 2UW9A 4X3FB 4PMMA 4AW2A 3DK3A 2VRXA 4IACA 2CCHA 3BU6A 4QMOA 2CSNA 2HOGA 3E87A 4W9WA 4IVDA 3H3CA 4G5PA 3Q3BA 4F09A 4XV2A 4JBQA 4U6RA 2FA2A 3ALNA 3F5UA 4RJ8A 3VULA 4A9TA 1A06A 2OG8A 1H00A 5IH4A 3BYSA 3IG7A 3PVGA 4J8NA 3HDMA 2DUVA 3U4UA 3RCDA 3TKUA 3N9XA 3EKKA 3R22A 3W2QA 3DLZA 4BDCA 3ZFMA 2PU8A 3ACKA 4GYGA 4UV0A 4L43A 4YJVA 2XJ2A 4O27B 3HGKA 3PY3A 1OKVA 2ZV9A 3GNIB 1CMKE 4G3DA 3FI2A 5LWNA 4FIJA 4JIAA 4PPCA 4CV9A 4KIQA 1PJKA 3RHXA 5KMNA 4EH4A 4O83A 3G0EA 3KREA 4N4SA 4F9BA 3GQLA 4IIRA 4O0YA 4FK6A 4LGGA 3FXZA 2PYWA 4MH7A 3RPSA 4CGAA 4Y73A 2QHMA 5CT0A 1CDKA 4AUAA 3KRJA 4CZYB 3SXSA 4F1OA 2F7XE 2B54A 3D15A 3ORMA 4FI1A 4RZVA 3FXXA 3BV3A 4IB0A 4N57A 2NP8A 3TNIA 3QGYA 3FZSA 5L4QA 2ETMA 5IA0A 1OUYA 3OC1A 4KIPA 4BDKA 3DT1A 2VX0A 3AD6A 5EHOA 5LJJA 3WF9A 3HMMA 3LXPA 2E9PA 2ESMA 4AZFA 3R2YA 4Z3VA 2I1MA 3TI1A 4NCTA 5IQDA 2R3FA 4IHPA 2GS2A 3R6XA 2B52A 5F4NA 2P2IA 2RSVA 2XRWA 4UYAA 4X2FA 3ACJA 4MXYA 4ERWA 2QO9A 2VTAA 4ASDA 3KRXA 4RJ5A 3OROA 1OPKA 3LXLA 4EWHA 3P08A 4K33A 4ZTHA 4TKSA 4CTCA 4X2JA 1DS5A 4R3CA 3HYHA 4CFWA 3OVVA 3VNTA 4JG6A 2XIKA 4ERKA 2CPKE 4BICA 4ZAUA 1H0VA 1RDQE 4H39A 1UU9A 4IB5A 5IQHA 4ALWA 3TUCA 2NRUA 3O71A 2VWZA 3NLBA 4TL0A 3L9NA 5EM8A 3SAYA 2WMWA 4OUCA 4ACDA 2ITWA 4NUSA 4BI2A 1W8CA 1Q3WA 1YDRE 4G1WA 4EQUA 1UNLA 4RIXB 2C3KA 3OOMA 4EONA 4ZSAA 5AR2A 3F3ZA 2HY0A 5I9YA 2W4JA 2WMRA 3U9CA 3Q32A 3KF7A 1R78A 2R3IA 3EQGA 3OFMA 4CMOA 3W32A 3HMOA 4Y72A 2HXLA 2CNQA 3UGCA 3NRMA 5ETCA 3OWKA 3SVVA 1M17A 4NT4A 4AGWA 3D7ZA 4E73A 5EK7A 4JR7A 3FZRA 3V8TA 3VS4A 4D2WA 5M57A 4QMWA 1GNGA 4D4RA 2ZM4A 1W83A 3T9IA 1U46A 4C36A 1YHSA 4C3FA 4YUQA 4FL2A 4FKTA 3WBLA 3FMMA 3ITZA 1OPLA 2QO7A 3OOGA 4AOIA 4AX8A 2PMOX 3A4OX 3DBFA 4JVGA 4RWIA 5AIRA 4EBWA 1JNKA 1OIYA 3RPRA 5FXSA 5HTBA 1SVEA 3FV8A 5ANEA 3RAKA 4BCJA 3NS9A 1Z9XA 3VUHA 5CT7A 3UIXA 2OH0E 3NUAA 1GZOA 4X21A 4LQMA 1J7UA 4QQCA 4QMUA 2RKUA 3H4JA 5M4FA 5AUYA 4JDKA 2E9VA 3QGWA 2X2LA 4L68A 4CV8A 3FJQE 3F5PA 5IQIA 3SV0A 1AQ1A 5TT7A 4YJTA 2R2PA 3NSZA 5FD2A 1YXVA 3ZC5A 4GT4A 4FEXA 2O8YA 3NVKI 4JJRA 2XP2A 2A1AB 5EOBA 4Q5EA 4MF0A 1U4DA 3AT2A 2I6LA 3MA6A 4O21A 4B9DA 4ANQA 3LMHA 4FF8A 2W5BA 3BELA 3Q53A 4UMQA 2VTTA 2GFSA 2YIQA 4LL5A 4C4EA 4EOOA 4I94A 3LW0A 3CQWA 3FZOA 3HRCA 3KL8A 3MV5A 4JQ8A 2IZUA 2ITNA 2YEXA 2P0CA 4LV5A 3OHTA 3ZSHA 4AZEA 1A9UA 2QC6A 1R1WA 4Z16A 4XG8A 1GIJA 2WKMA 4KB8A 3BHHA 2OZOA 2WU7A 2XRUA 5DI1A 2GNJA 3LVPA 4ITHA 4R5SA 3TZ8A 1DM2A 2BDWA 2PUNA 3B8QA 1Q4LA 3FMNA 4MQ1A 3PRFA 4MBLA 5E8XA 4AZVA 4W4XA 4QMMA 4BF2A 5DHJA 4DCAA 2F4JA 4UY9A 1ZAOA 4FTRA 4BIEA 3ORLA 1GJOA 5CXZA 3ZTXA 4DITA 4P2KA 1PXIA 3LFCA 4L7SA 5HVJA 3R7UA 4E4XA 5IA4A 4DINA 2I0VA 3IGOA 4RG0A 2O5KA 2JIIA 3GCVA 4M84A 5CF4A 4RVKA 5HU3A 2QR8A 5E91A 4AT3A 2XB7A 3K2LA 4G3GA 2QOIA 4D4SA 3Q52A 3F2RA 5FTGA 2DWBA 2W4KA 4DGGA 2W06A 3HA6A 5AX3A 3VHKA 3VJNA 5AUUA 2Y8OA 2WEIA 4WKQA 4XG7A 2CKOA 3C0GA 4YPSA 4FSUA 1M7QA 5AR8A 2RFEA 3Q9YA 2UVYA 1H28A 1H26A 3DKFA 3FPMA 4GJ2A 3PPJA 2WXVA 4BI1A 2ETRA 4I0TA 3ROCA 4XRJA 3HV7A 3R7VA 2UW0A 2XBJA 4A7CA 3ODZX 4YJNA 4R78A 3EJ1A 3LLAA 1UWJA 4EL9A 2BR1A 3MTLA 5M06A 4FR4A 3RNIA 3FLZA 4J52A 4IEBA 5FWKK 3BEAA 4H3PA 4ALVA 5JFXA 3TKHA 4J53A 3OS3A 1G8AA 4FKPA 2YABA 4QP2A 4IWQA 3AC3A 4JG7A 2V5QA 3D5VA 3COIA 4R6VA 4AZWA 1G5SA 3BCEA 5IU2A 2HCKA 1HCLA 3EQBA 3R8VA 2YN8A 2Z2WA 4I4FA 1OL5A 3QA8A 4U81A 4GJ3A 3MB6A 3ALOA 5AJQA 3ET7A 4O22A 3PG3A 4U7ZA 1YXUA 2J5EA 4YZMA 5E8TA 4D2VA 5GZ9A 2J0JA 2WU6A 3OBGA 1QCFA 4X2NA 3LCDA 4KINA 3EZRA 5EG3A 4D4VA 1SM2A 3PYYA 4NZWB 4AFJA 4C0TA 2W9ZB 5EHLA 2ZYBA 4JDJA 4K9YA 3FQHA 1ZY5A 4RA4A 4ASXA 4EHZA 4BDEA 4BHZA 1OIUA 4WIHA 3GC7A 1YWNA 4V0GA 3RTPA 2X9FA 3QLGA 3O8PA 3SC1A 2JBPA 4CQEA 4JQEA 3C4EA 3KF4A 3B8RA 3CE3A 3LM0A 3A99A 3AD4A 3C9WA 5T6KA 3CD8A 5CTPA 3RHKA 4BB4A 5LVPA 3DXQA 4U8ZA 1XKKA 1H01A 3GU8A 3VVHA 4XV9A 4CKJA 1WVYA 5CI7A 1M2RA 3KEXA 3SOAA 4C02A 3QF9A 3W55A 3KY2A 5HHWA 2V62A 4RX9A 3CY3A 3DQWA 3UNKA 4AWIA 4F7SA 2XNEA 4JXFA 3GEQA 2BZIB 4TYGA 2EXEA 4HVGA 3UQCA 4O0TA 4U9AA 1O6KA 5JFWA 3EL7A 3LCTA 1TVOA 3C51A 2OI4X 1Q97A 5CQUA 5DR9A 3PE1A 2B1PA 1I44A 3TL8A 3TTJA 4XV3A 5EQYA 3MA3A 3FMDA 1Z5MA 2OXDA 3VF9A 3LFDA 4M0YA 3DAJA 3NYVA 5CEQA 4BDHA 4C2VA 4ZLYA 5J5TA 4YPDA 4X6QC 4UMUA 5JMSA 2X4ZA 2BFYA 4NCTC 4NFNA 4EOPA 5DNRA 4O7WA 3UIUA 3UOLA 1V0BA 3H30A 4IH8A 4DFYA 5J1WA 4RIWB 3D4QA 2J50A 4XBUA 4DGNA 3MB7A 4CFNA 5EYDA 3QTQA 1ZYLA 4G31A 5KMJA 3O0GA 2OIDA 4JAJA 1XJDA 4YHFA 1K2PA 4FG8A 3ZLSA 4BDAA 5IQFA 2XK7A 4BTFA 5C27A 4ZSLA 3Q5IA 3GOKA 3QD2B 3QQUA 1FINA 1KWPA 2QU6A 1URWA 2IZTA 3F6XA 3AXWA 2X2KA 3V8SA 4C7TA 4HGSA 5BVDA 4E5BA 3F3UA 4I5PA 4TPTA 1KE9A 4G5JA 1UA2A 2V7OA 3BEGA 3CIKA 1AGWA 3E3BX 4K11A 4AE9A 3G9LX 3ZRMA 5M4CA 5ETFA 3EFJA 3A8XA 4FOCA 3DNDA 3Q9ZA 5J87A 5JZJA 3PSCA 2QURA 4U40A 3DBCA 4IAAA 3AMBA 5CF5A 5JFSA 2YA9A 1OUKA 3H9FA 4ASEA 3ZSGA 3L9LA 5IQAA 3MPAA 2P55A 4ANSA 2DQ7X 4AA4A 2X39A 2W1DA 2UW5A 4M69A 3SRVB 5AV1A 5J5SA 4IB3A 5A14A 3MTFA 3EOCA 1PKDA 3UZPA 4D9UA 3DZOA 4QTCA 5H3QA 3QTRA 4IBMA 3JVSA 3OCGA 3MYGA 3OT3A 5L8LA 2CMWA 5FBNC 5FUTA 2YWPA 3GC0A 2IZRA 4O86A 5H2UA 4WSQA 4F0IA 4FV8A 5I9WA 4YZ9A 2IVTA 2Y9QA 3LLTA 4L3JA 1V0OA 5L8JA 1ZOGA 3D5WA 3D9VA 3ZMMA 2B0QA 4FZAB 3OTVA 4DH1A 3FI3A 3BHTA 2C5OA 3KXZA 3RJCA 4U41A 4ORKA 3DJ7A 4KS7A 3Q60A 4O7SA 4MD7E 4ANBA 2WMBA 4Z55A 4AE6A 2WAJA 3FWQA 4PV0A 1YDSE 3VRZA 4EBVA 4EUUA 3DY7A 1PHKA 3QKKA 2QKRA 3I0QA 1U5QA 3NZ0A 3RZFA 2XK3A 3GB2A 4IAZA 3O17A 2WD1A 5C26A 5HIDA 5LXMA 1SVHA 3BYMA 2C3LA 5K5XA 3QU0A 2EB3A 3QRIA 4W4VA 1UNGA 2H9VA 4QNAA 3CCNA 5EDRA 2ITVA 3WARA 4FIHA 2O2UA 5FXRA 3BQCA 1UVRA 1QL6A 1ZXEA 3OY3A 4BIDA 2RFSA 2ITUA 3BHYA 2YCFA 4WRSA 4CFVA 4FKSA 4RBLA 4I4EA 5HBHA 5J79A 1LUFA 1MUOA 4C3RA 4OTHA 3V3VA 2XNBA 4F6WA 4O0VA 3LQ8A 4L44A 4ZSEA 5LVMA 2YLFA 4BCGA 3PZHA 4D2PA 4DE4A 4KKEA 5T3QA 3MFUA 1UV5A 4BWPA 3SGCA 4KBKA 3HKOA 1KE6A 5KMKA 2PUIA 1ND4A 4FKWA 5L2WA 2XEYA 3LMGA 4C62A 2KULA 1OM1A 1T45A 5IF1A 3FKLA 1X8BA 4QP6A 2QOOA 5BPYA 4OR5A 3GT8A 4CRSA 5E8SA 4XLIA 1O6YA 4LUEA 3HEGA 1ZOEA 1W7HA 4V0GB 4LYNA 3GXLA 5DEYA 3JYAA 4RFYA 3OD6X 3U8WA 4EK5A 3RK9A 3U54A 3ZO3A 3QA0A 1UU3A 3R30A 2WEVA 5CY3A 4CMUA 2W1ZA 2Z8CA 1W98A 4DC2A 3THBA 3NW5A 3HV5A 4LRJA 4X2KA 4FL3A 5AP5A 3TACA 4L6QA 4CFFA 4O7LA 1B39A 2PL0A 2YCRA 3MY1A 4CFXA 4HNFA 4QMYA 3W16A 1TKIA 3Q5ZA 5L6OA 3RMFA 2RF9A 4EJ7A 2YLEA 4QMSA 4W8DA 3RPVA 3P4KA 4EC8A 3IECA 3NAXA 4E5AX 3CC6A 4QP9A 4X3FA 1P5EA 1H1RA 4NKSA 2QU5A 2B55A 3P78A 3SX9A 3JY0A 3K3IA 2WMQA 4U42A 3TXOA 5CSVA 4RC3A 4IX4A 4TN6A 3H0ZA 4BTMA 3MPTA 3R8LA 2WTKB 4Y46A 4YJOA 4NEUA 3DLSA 2V22A 3A7IA 4I92A 1Y57A 3F2NA 3HUBA 3KMMA 5B2MA 1Z57A 4XP3A 1JLUE 4FIIA 4RC2A 5FRIA 4IVBA 3LFBA 3TJDA 1Q8YA 4L9IA 4ZTQA 1GZKA 5E8ZA 3W10A 2OKRA 3ZH8A 4AGDA 5I9VA 3UVQA 1L8TA 1URCA 4HGEA 4FNXA 5H8EA 4D5HA 3VS6A 4FK3A 4EKLA 1FGIA 4ACGA 2VWVA 4O38A 2BAQA 4PMTA 2CN8A 1H4LA 4FKQA 5EW3A 3IW6A 4A9SA 3DJ5A 4M12A 3W2RA 4KSPA 2E9NA 3PA4A 4YC8A 3TV6A 3PDTA 2J2IB 2W4OA 2O64A 5EYCA 2GNIA 3DKGA 2PE2A 5GJDA 3TDVA 2P2HA 4ZMEA 4OT5A 3IQ7A 4QMNA 2X2MA 4HNIA 3IW4A 2W1CA 5GZ8A 4G6OA 2C5YA 3F7ZA 5DRBA 2BZHB 2OJ9A 5HU9A 4FV7A 5IISA 4BY9E 3Q4ZA 2X8IA 4O1PA 2GMXA 2XK4A 3C0IA 3PRIA 4G3FA 1FMKA 4NK9A 3IW7A 3QQFA 3NUXA 4FTLA 4IANA 4DN5A 3BKBA 2VAGA 4BDGA 4HVHA 4LFIA 3FL5A 5F95A 4AS0A 4RVTA 3SG8A 1YOJA 2R3GA 1OMWA 4BTKA 3NNUA 1PF8A 1H24A 2XIRA 3QL8A 4L45A 4P5QA 2GQSA 2C0OA 3POOA 4JNWA 1M2PA 3U6HA 3DA6A 4YO6A 3PY0A 5KMLA 2C1BA 3HRBA 3VBVA 1B38A 5F94A 4IX6A 5IKWA 4APCA 3IPHA 1SNXA 5LCJA 3MJ2A 5BVEA 1E9HA 5FBOA 4XP2A 5EM5A 5HG5A 4A06A 4UXLA 3DXNA 3DTCA 2XNPA 2OIBA 3R63A 3PY1A 1PXPA 4BI0A 2RFDA 3BBTB 4C4FA 4CFMA 3QUEA 3Q2MA 4KRDA 4UMPA 4RIXA 2ITTA 1PYEA 2XK6A 4FOBA 3Q4UA 2X8EA 4O7VA 2XJ0A 3A7HA 4FV9A 4I0RA 1W84A 2VWUA 3KQ7A 2LAVA 4J97A 2AC3A 4DEAA 4FUYA 4BCMA 3MJ1A 1REKA 1RJBA 3R04A 4FGBA 4JDHA 4IM3A 4DTKA 3EN7A 3G90X 4X7QA 4E6AA 1FBNA 5JH6A 1YRPA 3DK7A 1J91A 3ZDUA 2JAVA 3I7BA 4C4IA 3RK5A 4PP7A 3UVPA 4KIOA 5HOAA 1OIRA 1PXJA 3TUDA 2ZMDA 3IDPA 5CU2A 4Q9ZA 4QTEA 2GHMA 3EB0A 1U54B 5KKRC 4C2WA 3FLSA 4GS6A 1R0PA 2PMLX 5AV0A 1DAYA 3OP5A 4C33A 4HCUA 4LOPA 5K0XA 3GCPA 4R3RA 4N6YA 5KBRA 5HEZA 4DFZE 5CVFA 3UC3A 1Q62A 3MDYA 4USFA 4AOJA 5IMXA 5DA3A 1H0WA 4F9WA 4AXAA 2W1GA 1OZ1A 5AP4A 3UNZA 3G33A 4FV2A 2XUUA 5FEDA 4EORA 4YJRA 3S95A 4TT7A 4BFMA 1HCKA 4ITJA 5LMBA 3UODA 3TNPC 5EW8A 5DH3A 4QMLA 2G9XA 3LFNA 3PPKA 4EK6A 5EQPA 3QFVA 2FVDA 3BYUA 3V6RA 2VN9A 5J7HA 1YI3A 2VTMA 1XH7A 2EUFB 3OCBA 3QRTA 3OUNB 3PE2A 2R0UA 4CLJA 3E92A 1OKZA 5FP5A 2WQBA 4ZY6A 2PK9A 3LXKA 3FPQA 4ANOA 5LWMA 5HTCA 5M51A 2B9FA 4EH6A 3FMLA 3ATTA 2BILB 5HESA 3M11A 4DEHA 1GOLA 3DAEA 5HICA 3SW4A 3VS2A 5CSPA 3R9RA 4HYSA 5JT2A 4TNBA 4F9CA 5HCZA 2VX3A 4IC7A 5E90A 2JIUA 2JKKA 2W1FA 3PA3A 5AP0A 3ZU7A 5CU0A 5M44A 2X9EA 2GHGA 2VTRA 3LFEA 2F49A 2PVNA 2H34A 3BV2A 3TT0A 3SD0A 3WZJA 2GTNA 3FKOA 4YTFA 4TYHB 4KKHA 5AWMA 4C59A 3R02A 1PXMA 2VO0A 4C4GA 3ORNA 3LKMA 3I1AA 2HZ4A 4XBRA 4YMJA 2B9HA 5L3AA 3MH1A 2PZ5A 5AUWA 3C4CA 3LOKA 4HYUA 1K3AA 4L67A 3V04A 3AQVA 2J51A 5M08A 3QTUA 1MRYA 5DE2A 1OI9A 4AZTA 4JI9A 4YLLA 1XH9A 3UPZA 4DG3E 4EKKA 5B0XA 5IEYA 3ORIA 3DBQA 3MVMA 3VBXA 3UP2A 5HI2A 3I4BA 5E8WA 3E8CA 4UXQA 4JRNA 4BHNA 5HNBA 1PXOA 3GUBA 4PQNA 4DGLC 3PJ8A 1LPUA 2WELA 4FSQA 3C7QA 5BYLA 4DT8A 3CY2A 3I6UA 5L2IA 3NYXA 4RJ6A 3N51A 2XNGA 4CCBA 1O6LA 5IA1A 2GQGA 2PZIA 3W8LA 1TQIA 3MI9A 4MD8E 4QYFA 4WBOA 3LPBA 1XO2B 4TWCA 3UG1A 5CZIA 3ID6C 5ETIA 1ZOHA 2PZRA 3VRYA 3G5DA 1TQMA 5CAQA 3EZVA 1XBCA 3KCKA 4X3FC 4MHAA 5AMNA 4CKIA 5C8MA 3DKOA 2EWAA 4FEQA 5LCKA 5M4UA 1Y91A 2JD5A 1VJYA 3CEKA 3COMA 5ACBC 5BUJA 2C6TA 2ITQA 4UN0C 2UVZA 3OEFX 4ZJJA 5J8IA 1J7LA 5E7RA 1UNHA 2YJSA 3F9NA 2EXMA 3QWJA 3BE2A 3UO5A 1K9AA 4IMYA 3VO3A 5TOZA 4M15A 5HCXA 2VGOA 3ANQA 3VUGA 5B7VA 4HYHA 2VWIA 2YERA 4KS8A 4FGRA 1JPAA 5LOHA 4UALA 3CXWA 3S4QA 4MNFA 5AADA 1WBTA 3UP7A 3ZO1A 5FDXA 4YLKA 1DI9A 3D5XA 4ZS0A 5IUIA 3ZHPC 2JC6A 4AU8A 1Q24A 1PXKA 1BI8A 2Y6OA 3PVUA 4FYOA 3ZRKA 4A4XA 4E8AA 4JAIA 2PWLA 4YR8A 4CKRA 3NW6A 5A6OA 4GYIA 3M2WA 3C1XA 1YHVA 4EI4A 2SRCA 1JQHA 3KVXA 3MESA 5D10A 5JSMA 2ACXA 2HIWA 3Q9XA 4QYGA 2HZ0A 3QC9A 5DEWA 5GIPE 3GBZA 4EOSA 3U6IA 3VJOA 3AT3A 4F7JA 4J96A 4ANNA 2XNOA 2VO3A 3EN9A 4XH6A 5A4EA 1R3CA 4QYEA 4RGJA 3RZBA 3TUBA 2CCIA 4PNKA 2ZAZA 3KCFA 4XNEA 3UG2A 4QP4A 3ZBXA 2X0GA 2Z60A 4ZXTA 1MP8A 4Y83A 4JRVA 5HG8A 4NTSA 3KRWA 5TR6A 3QTIA 4QP1A 3BPRA 3R9HA 4D9TA 4NL0A 3CTHA 3HLLA 5AAEA 3QQJA 4HCTA 3FAAA 5FTQA 4DFXE 3DJ6A 3AMYA 1JBPE 4KAOA 4B8MA 2J0IA 4ITIA 4MXXA 2JDTA 2XK8A 4RIWA 3TNQB 5H9BA 1Q99A 4IVCA 2BCJA 3C0HA 5KNJA 4UMRA 1KE8A 3AC4A 4I23A 4JS8A 4CCUA 4IVAA 5GJFA 5HE2A 2WIPA 2C6KA 3EQHA 3FBVA 2BRNA 2IN6A 3I5ZA 4TRLA 3ZM4A 3GU6A 3VAPA 1G3NA 4UWBA 2WNTA 4FSZA 5CAVA 4HJOA 4DBXA 3F3VA 4IX3A 3A62A 4JBVA 5C8KA 4I6QA 1JKKA 2CJMA 4OLIA 4YTCA 3ULIA 2E9OA 5JGDA 2C4GA 5EW9A 4D0WA 3UO6A 4FT9A 4QPMA 5J9ZA 4RIOA 5HG9A 4DH3A 2NPQA 1ZMWA 3F88A 4O2PA 2YIYA 4LM5A 5E8VA 4E7WA 5E8YA 4MKCA 3AGLA 4XV1A 4MXOA 2HZNA 2NO3A 5BVNA 3SG9A 2I0YA 1H1WA 4QTBA 5CLPA 5JRSA 3LXNA 3ZO4A 5HLPA 1P4OA 4YSMA 2FSLX 4ASZA 4D2RA 4BKZA 3QUDA 3SRVA 3R7GA 3MN3A 5JQ5A 4KUJA 2WOTA 4XJ0A 3A4PA 4JL9A 3AC2A 4MXAA 3LE6A 1L3RE 5AEPA 2RIOA 3RCJA 3OWLA 3KULB 3PLSA 4NM3A 5CVGA 3RPYA 3NEWA 3T8OA 4MXCA 4C3PA 5B2KA 3L9PA 1OGUA 3WE4A 2BRBA 4LMUA 2UV2A 4CYJA 3PZEA 4XOYA 5A6NA 4CTBA 2IJMA 3ERKA 5DBXA 2BHEA 3LFAA 3GQIA 2YACA 3P0MA 4ANMA 4EHVA 4WOVA 4FTTA 3AG9A 2WTWA 2OJJA 3HA8A 4QMZA 1QPJA 5IA3A 3G0FA 4AW0A 1YI6A 3BGZA 3QD0A 2R7BA 5JZNA 3ZCLA 3U4WA 4FODA 4D2SA 4IQ6A 5KHWA 5CNOA 4EOMA 3PLAE 3F66A 4DEIA 2AC5A 2WMSA 1BKXA 2XVDA 3OY1A 4B7TA 3FC2A 4XMOA 3ORKA 4NJ3A 3ZC6A 3FLWA 5ANKA 4FG9A 2V7AA 2ERZE 2WMAA 4UWYA 4RT7A 2C6OA 4EOKA 4DFBA 4ACCA 1E1VA 4USEA 5IMEA 3JS2A 4NU1A 4RVMA 3SQQA 4F99A 4K0YA 4OTRA 4QYYA 5G6VA 3V5LA 3A61A 4D4YA 4DHFA 4BKYA 3MW1A 4PRJA 4L8MA 4EQCA 5A54A 4D55A 4U0IA 1YWVA 4RMZA 5D9HA 5CEIA 3UQFA 4IWOA 1CKJA 5LVNA 3AD5A 4RLKA 3O51A 4C38A 3CD3A 1FQ1B 1KOAA 1P4FA 1VYZA 3DV3A 4ZK5A 5CEMA 2IW6A 2X4FA 3CGFA 3IO7A 4O96A 2PVRA 4CG9A 1XBBA 4EOJA 1JSVA 4D58A 2HWOA 4I93A 3TIZA 3KK9A 3I60A 3D0EA 2YIXA 4OT6A 3BZ3A 3ORZA 3UMXA 4EZ3A 4MBIA 5ANDA 4M8TA 5CZHA 4ZTRA 3ZOSA 2XIZA 4CZTA 4LRMA 1KE5A 3D14A 3EFLA 4BCQA 4C4HA 3KK8A 3MGYA 1G8SA 5C4LA 5K4IA 2CGXA 4FVQA 2IVUA 4FTUA 3IDCA 1YI4A 4ZIMA 4DEGA 4ENXA 4GIHA 2VU3A 3V5JA 3VBQA 2GCDA 4LI5A 3QXPA 4B99A 2XCHA 4QTDA 4C8BA 2JDOA 4LMNA 2QHNA 4L53A 3F2AA 3AMAA 4YJQA 4ZS4A 2HWPA 4K8AA 4DTAA 4LGDA 2G1TA 4CLIA 2V0DA 4PL3A 2JAMA 4QRCA 3NR9A 5BMMA 3CR0A 5IUHA 3UOHA 2BTSA 1U5RA 2I40A 3VW6A 4PDPA 2YDJA 4PL5A 3HRFA 4H3BA 5L8KA 4RA5A 1YOMA 4O81A 4YNEA 2GS7A 5LVLA 2C1AA 5LMKA 3BGQA 4FTMA 4CG8A 4LL0A 2WIHA 4FKUA 3DFAA 1XH8A 5L2TA 1KSWA 3CQEA 2YDKA 2YFXA 5HIBA 3IDBA 3Q9WA 4O1OA 4AACA 4XYFA 5KCVA 3NPCA 4ZTNA 3VS0A 3BLHA 3LJ0A 4BBEA
chains in the Genus database with same CATH superfamily
3DQXA 3QHRA 3HL7A 2XYUA 2VTOA 3BLRA 3C5UA 2W0JA 2ZDUA 3NNVA 3FI4A 2OFVA 4LG4A 3O2MA 2QOKA 5A3XA 4U97A 3E8DA 4CQGA 1U59A 3R7IA 3IK3A 3QZFA 1Y8GA 4KSQA 1JSTA 4FV1A 4IAKA 4NM0A 4FKLA 5CWZA 1SVGA 4RVLA 3C4XA 4DH8A 2YM4A 3R00A 5ACKA 3VBWA 4BCKA 4R5YA 3D2IA 3QQHA 3DB8A 3PVBA 4TYIA 3VHEA 3VUTA 2QLUA 4PMPA 5A4QA 4JBPA 3NMUF 2X8DA 1Q5KA 4O0RA 3R8MA 3M1SA 2OLCA 4AT5A 5BQ0A 5DT3A 3R9NA 2ZOQA 5I4NA 3LCOA 3LFQA 4RLLA 4CYIA 2BFXA 3VIDA 2WTIA 4IDTA 5BVOA 3CP9A 3D2KA 4FTOA 2G01A 3T3VA 2ZJWA 3ROYA 3NUYA 3QWKA 4G17A 5CENA 3V51A 3ZZWA 4Z7GA 2BZKB 2WFYA 4F63A 4YHJA 3VQHA 5JN2A 4GEOA 5HG7A 3PJCA 2JITA 4TWOA 2J9MA 3MIYA 4G9RA 4E5WA 4UZDA 3DNEA 2XM8A 3QALE 2I0EA 3BHVA 3E63A 3C50A 5AV3A 3KXXA 2XM9A 4V05A 3EMGA 4PMSA 3WIGA 4R8QA 3CPBA 5AR3A 4PF4A 4RQVA 1LP4A 5CU4A 4YZNA 5CVHA 4OBOA 3Q96A 4YURA 1AD5A 4FKIA 4KIKA 5HTIA 3QAME 4XP0A 1KOBA 4IAYA 4N6ZA 1ZYDA 3TZ7A 4XG4A 2C5XA 4USDA 3UMWA 4DF3A 5GINE 3RM6A 4R3PA 4H1MA 2AEGA 4L42A 3GFEA 1VZOA 1FVVA 3AOXA 3FUPA 1BYGA 5EH0A 4RX5A 4OTWA 2CGVA 2BAKA 2Y4IB 3NUNA 2REIA 5IQBA 1GZNA 1VEBA 5CSXA 3FL4A 3VS7A 3DDQA 2A19B 3KC3A 3WF5A 3UTOA 5H8GA 4A9UA 4M97A 4F9YA 4F1TA 3S2PA 5HIEA 3NVMB 2WPAA 3V5WA 4DEEA 4P4CA 1PYXA 4ZTMA 3UDSA 4EQMA 3ZZEA 2GQRA 3HMIA 5BNJA 3E64A 1BUHA 3EN4A 4PTEA 4BCPA 5JKGA 1JWHA 4FT0A 2IW9A 2UW7A 1REJA 2UZVA 4DFLA 4M7IA 4AXEA 3KXHA 1U54A 3ZXZA 3HX4A 2XALA 3I79A 1ZMVA 4D1ZA 4S30A 1BX6A 4I20A 1YQJA 3FKNA 2C68A 4NFMA 5HVYA 5C4KA 1LEZA 3BX5A 2B7AA 3R9DA 4ZLZA 5HKMA 3JR1A 4WNPA 4F6UA 2VWWA 5J9YA 1JKSA 3VC4A 2P33A 2H8HA 3V5TA 3HNGA 4RX7A 4GCJA 3H0YA 4MWHA 3W2PA 5LVOA 5I9ZA 4AP7A 4JLCA 4PDSA 5BV3A 2GNGA 3D94A 4O7TA 3RGFA 1OIQA 1Q8TA 3OTUA 4QP8A 1VYWA 1ZZLA 4CD0A 1F0QA 1CKPA 3H10A 2UZBA 5HD7A 2C30A 2BPMA 2W99B 5E8UA 3FQEA 5KZIA 3SLSA 3KB7A 5DOSA 5HX8A 3NYOA 5IEXA 3F5GA 2J7TA 1I09A 3E62A 3L8VA 3F5XA 3R28A 3A7JA 3LJ1A 3FI8A 2C47A 2ITOA 4OBPA 3TNWA 1J3HA 3Q6UA 5JEBA 3O96A 4IM2A 4TNDA 4GKIA 2QONA 4C34A 5BVFA 2RGPA 1V1KA 1KV1A 2QO2A 4IE9A 5TE0A 2WTCA 3NCGA 3PXQA 2XCKA 5K0KA 4HGTA 4AAAA 1JVPP 1WBWA 4FNWA 5IDNA 3ZDIA 1GY3A 3F3WA 3MSSA 4RIYA 4KA3A 2GSFA 2JFLA 1SMHA 5IUGA 5DWRA 3SW7A 5KE0A 4O7ZA 3W0NA 3KVWA 2QOBA 4IFGA 3FSFA 2X7OA 4E4LA 1H1SA 4C4JA 4JBOA 3NWWA 4TYHA 1H1PA 3U9NA 3DGKA 2OFUA 3EQIA 2QQ7A 2XBAA 3MFRA 4XX9A 5EKOA 1ERKA 3LQ5A 5IQCA 2YISA 2H6DA 4UZHA 3DBDA 4N70A 4MCVA 1UWHA 4WBBB 4BYJA 3FMKA 5ITAA 4L3PA 2BRGA 4C58A 4XRLA 2AUHA 3QCSA 3VUIA 2R3HA 2O3PA 3PA5A 3PSBA 3RBWA 5M07A 3MH2A 4M68A 4GFGA 1MQBA 3TN8A 3VBTA 1YHWA 2HZIA 5IQGA 3OG7A 5CU3A 5HE1A 3LJ2A 3ZSIA 2PVFA 4WO5A 3W8QA 5HLWA 1IAJA 3VWAA 3HAVA 4DFNA 4NTTA 5CU6A 2PVMA 5AP2A 4GK4A 5AAGA 4CVAA 3RM7A 3COKA 4TWPA 4HCVA 2RG6A 1EH4A 4DEBA 3WE8A 2VTJA 4NWMA 5K9IA 1DAWA 3U6JA 5DFPA 3FZ1A 4I5CA 3VF8A 4UMTA 3VUMA 1Q61A 4BIBA 4IZ7A 2C6EA 5CNNA 4F4PA 4QOXA 3D5UA 2OXXA 4PPBA 5HX6A 4OAUC 2YM7A 2J90A 3K3JA 4FIGA 3HMPA 4FT5A 3TKIA 2HAKA 3COHA 3W33A 4JR3A 5IDPA 2B4SB 3NIEA 3BGPA 1KE7A 5CASA 4J95A 2B9IA 3R0TA 3ORXA 4CFUA 1JAMA 3JXWA 5LMKC 4P90A 5KO1A 5HQ0A 5HZNA 5CSWA 4YTHA 1IEPA 2WTKC 2ITXA 2OJFE 4ALUA 1NA7A 3E7VA 5D7VA 4QQTA 4DHIB 5HO8A 3BWFA 4EK4A 2YWVA 1M7NA 5I3OA 1W82A 2EB2A 4O84A 1BI7A 4YTIA 3E7OA 3W2SA 5CANA 4MD9E 4EHEA 3P79A 5DT4A 3A7GA 4BVUA 4H1JA 4M13A 4YZBA 5EI2A 5KBQA 3GOPA 4QQ5A 4QO9A 2JGZA 2CKPA 2UW4A 1UKHA 5KMMA 4MUQA 3S3IA 2WMVA 4GU6A 1HOWA 2PMNX 4Q5HA 4DBNA 4IFCA 2R3JA 5HE3A 5JQ8A 3WZKA 4ZJVA 2R3LA 5DMZA 2PY3A 4GU9A 4KIKB 1LR4A 3ZM9A 4JT3A 2CKEA 4AN9A 4AA0A 4H05A 1IR3A 2GU8A 2JKOA 3HDNA 3FQSA 4E3CA 4O6LA 5IH6A 3DK6A 3KXGA 4IB1A 3KA0A 2BIKB 1BMKA 2PHKA 3VQUA 4PL4A 3ZFXA 3DPKA 3POZA 4NW5A 2X7GA 1A48A 3MFTA 3T9TA 4BWKA 5HORA 4FIFA 1E1XA 1ZZ2A 3KN5A 4IXPA 4XLVA 4AN2A 4DH7A 3MY5A 4AGUA 1W0XC 1FVTA 3REPA 2VWXA 3KIOC 4AFEA 4BRXA 2PZYA 2XIXA 3IW8A 2GHLA 4F78A 4Y85A 3Q4TA 2X0PA 5JGBA 2BHHA 2W96B 3R73A 1IG1A 4FIEA 4AQCA 4HZRA 2OGVA 4FTQA 3GI3A 2VTHA 2JDVA 4BGHA 2YM8A 2W1IA 2GNLA 1W2FA 2VNWA 4YGAA 5DR2A 3TNHA 4F1MA 5J7BA 4O6EA 3GU4A 4D2TA 5IPJA 2CLQA 4DYMA 1P2AA 3CS9A 3GCQA 4PTGA 3HVCA 4UYNA 4R7HA 5D12A 2YZAA 2Y7JA 2YCQA 3ZUVA 5C01A 4DAWA 1BL6A 2QOFA 4WNMA 3C4ZA 5IZFA 4BCOA 4EK8A 3QQKA 4EH3A 5CEPA 4G3CA 1PMEA 4MEDA 2GFCA 3MIAA 4F65A 4M67A 2AYPA 3R8PA 4W9XA 2CGWA 4Z7HA 4O4DA 4GUEA 1WBSA 4FKVA 1ZWSA 3QXOA 4XG3A 4ARKA 3NUSA 3UE4A 1PKGA 4FZDB 1ZY4A 3EQPA 3IGGA 1R39A 3G2FA 3DXPA 2QD9A 2VTQA 4HYIA 2VZ6A 3AC8A 4FV6A 4TTHB 3ZS5A 4BCIA 2VO6A 3UC4A 4DCEA 2BAJA 3DKCA 3FHRA 5AIKA 2XKEA 4M66A 1WMKA 3D7TB 4ZJIA 2HENA 2DYLA 5E9EA 4ZSGA 1GIHA 1OKWA 2FSTX 3CJGA 2XS0A 1NVSA 2F7ZE 2UW3A 3F3TA 2XA4A 4P5ZA 4X3JA 2JFMA 4CNHA 2BIYA 4EHGA 4RIYB 3EHAA 3OEZA 5FP6A 4HPUE 3CTJA 4CT2A 3E8NA 5DIAA 4LGHA 3KULA 3WI6A 3HAMA 4O7RA 4YHTA 3ZO2A 2CLXA 2XARA 5C8NA 4O0WA 2H96A 3IOPA 4UEUA 4XOZA 3TZ9A 3MFSA 1H07A 3PP1A 3PPZA 5ICPA 5DN3A 5KX8A 3R9OA 3A7FA 4B8LA 4ZZMA 3C4FA 3WYXA 3LMIA 1XH5A 5FM3A 4I6LA 5FTOA 4WG5A 3VUKA 4I5MA 1OVEA 2WOUA 4WSYA 5ETAA 3GGFA 5I9UA 5AR7A 3P7BA 3HECA 4QPSA 3P86A 4ZZOA 4IADA 3OXZA 2PSQA 1OBDA 2J5FA 1ZYCA 2OO8X 3KKVA 5ANOA 4RSSA 3TTIA 1NT2A 4R1YA 4G34A 4EOLA 4NJDA 4OGRA 5FEQA 3W0MA 5M55A 5AUTA 2QOLA 4XCUA 4YC3A 4BWXA 4DLIA 1G8JA 3PJ2A 4EC9A 3ZLYA 4GG5A 4O2ZA 1ZMUA 1ZYJA 3R83A 1Q8UA 2J0LA 2OF2A 4GW8A 3KN6A 4C57A 4BR3A 3ZEWA 4BCNA 3OWJA 3RP9A 2G2FA 3DFCB 3GU5A 5L6PA 2FSOX 2J0MB 3EL8A 1ZLTA 5E92A 5HNIX 2XK9A 2A98A 3QD4A 5BUIA 4EYJA 1CTPE 1OL7A 5ANIA 3LCKA 4G9CA 1CM8A 3KRLA 4KKGA 4PPAA 3UDZA 2OK1A 3TG1A 3R8UA 2VV9A 2WTVA 3R21A 2PVKA 3TIYA 5EQEA 3I5NA 3VUDA 3F69A 4FICA 5AX9A 2R3KA 4E4NA 3F7WA 2G2IA 2ETKA 2R7IA 3HP2A 3QYWA 3KFAA 3W18A 5A46A 4FYNA 1YDTE 3ENMA 4NKAA 4PP9A 2UUEA 4TY1A 2YM6A 3RKBA 5DYJA 2ITYA 3GU7A 4I3ZA 4N0SA 1YXXA 3P5KA 3OXIA 2CHLA 3WIKA 4LOQA 3O23A 3TJCA 5IH5A 5DPVA 2XNNA 4FSTA 3CPCA 2GTMA 5EYKA 3TV7A 4EJNA 2A4LA 5E4HA 3F61A 3FE3A 3UOJA 1YOLA 4ENYA 4AGCA 1APME 4KRCA 5HCYA 3E3PA 2QLQA 1TQPA 2W1HA 4L01A 4TWNA 4HGLA 2QOCA 3Q6WA 2BROA 3IS5A 3W1FA 4BDIA 2OZAA 3SA0A 3CLYA 4I22A 3EYGA 4CRLA 1OGYA 4RQKA 1XH6A 2J0KA 3BLQA 3E88A 2CNUA 4U45A 4YNOA 2PVLA 4QD6A 5HLNA 5HGIA 4L46A 4D1XA 3QD3A 4NIFA 2EXCX 3FMHA 2XYNA 1JOWB 1WFCA 2OU7A 2PUUA 2Q83A 2QG7A 3UOKA 1PW2A 1Y8YA 3B2TA 3R7YA 2QVSE 3GP0A 4YBJA 3NDMA 2PPQA 3QZIA 2IVVA 4FC0A 4RRVA 2XAOA 3CSVA 4IZYA 4G6NA 3PFYA 5AFVA 2VO7A 4A4LA 2VX1A 5GNKA 1NXKA 4M3QA 5EM7A 3PXZA 3S1HA 4H36A 4D0XA 5TKDA 4EH2A 2BZJA 3MWUA 5G1XA 2P4IA 3ZXTA 3TMOA 5I3RA 4LOOA 3DU8A 4JQ7A 5A4TA 3ZLWA 1QPEA 2CKQA 3I0OA 5D1JA 4RWKA 4PX6A 3BYVA 3R2BA 4FEVA 1PY5A 3O8TA 4LV7A 3EYHA 4V04A 1XHAA 3FLYA 1F3MC 3L8PA 3EIDA 4MX9A 4YJUA 3LAUA 3QZGA 4YZCA 2W9FB 4BC6A 4ZY4A 2WHBA 3BHUA 4A9RA 2R9SA 2YM5A 2IZSA 4FTCA 5CAOA 4L7FA 3NYNA 3R8ZA 3W0SA 5D41A 4R1VA 2VD5A 3OW4A 4FA2A 4H3QA 1WBNA 3UYTA 3V01A 4YLJA 4ZP5A 3FZPA 4IAFA 4F64A 3KGAA 4WHZA 1BLXA 5IG1A 1UU8A 3DBEA 4IJ9A 2C5NA 4K1BA 2VTLA 4BDBA 4AN3A 4CXAA 1Q8WA 3MPMA 5J9LA 5FEEA 2C6MA 2OF4A 2UW6A 4XUFA 3QYZA 5F1ZA 2PTKA 4AOTA 5ANGA 3I81A 2BKZA 5GHVA 3QX2A 5BVKA 3ZUTA 4DG2E 1VR2A 4CZUA 4OTIA 4WUAA 2CN5A 3C4WA 4RJ3A 1WAKA 2XKFA 5D7AA 4WUNA 3K54A 2QI8A 3R1SA 4FSWA 4O4BB 2UZLA 4NM5A 1J7IA 3K5UA 3SHEA 4FKJA 3OW3A 3UZRA 2X81A 3BBWA 3PSDA 4DH5A 3LM5A 2C3JA 1OECA 2NNWB 3F82A 4MTAA 3H9RA 4S31A 4CT1A 4GVAA 5CF6A 1J1CA 2YJRA 3O7LB 1FOTA 3CKWA 2GS6A 4HPTE 1PMUA 4II5A 2OSCA 4I6FA 4I5HA 4GVJA 4I6HA 4QT1A 4WNKA 5AM7A 2F2UA 1NW1A 4FSYA 5DRDA 1QPCA 3PG1A 2JKQA 5BMSA 4E6CA 5HBEA 3W2CA 3AC5A 1PMNA 4Y5QA 4QNYA 5E1EA 4KNBA 3VS1A 2A2AA 2VWYA 3JY9A 4CEGA 3EQFA 5CALA 3FHIA 1TFFA 5F20A 4ACMA 4Q2AA 1OL2A 3NGAA 1RW8A 3FYJX 3V8WA 1Q41A 2EU9A 4F0FA 4OTQA 2ZB0A 2WQOA 4FTNA 2I0HA 5KZ0A 2OJGA 4XG6A 4Y8DA 3M42A 3ZFYA 1ATPE 4QYHA 4K2RA 2W5HA 4FKGA 4FUXA 2YITA 4TYEA 1UKIA 2UVXA 3EWHA 4KABA 3UO4A 3OCSA 5JRQA 3UZTA 4DT9A 4GG7A 4U3YA 4BN1A 3ODYX 5I5ZA 3T3UA 2XJ1A 2ITZA 2YZLA 5E1SA 3S0OA 5HD4A 4MF1A 3R1QA 4FL1A 5EKNA 3R1YA 4FSMA 2UZEA 2YHVA 3OCTA 4ZOGA 5C03A 2E9UA 3KMWA 5BUEA 4FBXA 5M4IA 5IQEA 1Y6BA 5AR5A 1OB3A 2F7EE 2ZVAA 3WYYA 4RJ4A 2C5VA 5M09A 4ZSJA 5CAUA 4FV0A 2BUJA 4MXZA 4I21A 2WMTA 2C3IB 3EN6A 3QQLA 5CXHA 4AT4A 2X0OA 2O65A 3QZHA 2XEZA 2DS1A 4QP7A 2QR7A 1XWSA 1NVRA 4J7BA 4WD5A 2AQXA 2Q0BA 5DLSA 4S2ZA 3CGOA 4OW8A 2FSMX 2R3QA 4OTPA 3G51A 3FDNA 3L8SA 2VTIA 4IZ5A 4RZWA 3ANRA 3MH0A 1RQQA 4BBMA 2BDFA 3QRJA 5AV4A 1S9IA 1WBOA 4DG0E 2O0UA 1IASA 2J6MA 4JIKA 4CMTA 4NSTA 4C37A 3GCUA 4EH9A 3PXKA 3P7AA 5IA5A 4FKRA 2B53A 3QQGA 3FY2A 2BALA 3RALA 3PUFC 4LDTA 3OMVA 4IWDA 2JIVA 2OZAB 2ERKA 2FGIA 2PE0A 3I6WA 4PNIA 4AW1A 4DDGA 3PVWA 4Q9SA 3ZLXA 2W17A 3UJGA 3EFWA 3NIZA 1YKRA 1Q3DA 4NIFB 5C9CA 4W8EA 3PXRA 2ZV2A 4M14A 4RWJA 4KBCA 3AC1A 4A4OA 3DAKA 4ZY5A 4HOKA 4S34A 3QKLA 1NY3A 3SDJA 3UIMA 4QMPA 4E4MA 3TDWA 2WB8A 3QCYA 5CSHA 3TV4A 4GT3A 2BKKA 2R3RA 3LQ3A 3HV3A 2OXYA 3TCPA 2R3NA 4BZOA 2UZWE 3RNYA 5C1QB 2P3GX 4QTAA 3BI6A 1GIIA 3G6HA 3UNJA 4O91A 4YSJA 2JKMA 3EN5A 3EQCA 1PRYA 4PDOA 5TO8A 1IAHA 4MVFA 1WBVA 3QRKA 3JUHA 4HZSA 4F6SA 2RFNA 3BRBA 3QUPA 1MRUA 3UBDA 3N4TA 3OUKA 2QNJA 2G2HA 1SZMA 2C0TA 5FM2A 4C61A 2IPXA 1JSUA 3LHJA 4GSBA 4G2FA 4IZAA 4KD1A 4PWNA 1FMOE 3PP0A 4MQ2A 4RX8A 4FTKA 4FE2A 2X1NA 2XIYA 2YDIA 4WRGA 4DLJA 4EH8A 2QG5A 2GNHA 4APPA 2XNMA 5FXQA 4QQJA 2RL5A 4LV8A 3V6SA 4F0GA 4MBJA 3O5AA 4QP3A 5TF9A 2YM3A 4LUDA 1FVRA 3KMUA 2ONLA 3RAHA 3ZBFA 5M53A 2QKWB 3A8WA 3QRUA 4DGOA 3WILA 3P7CA 2C6IA 2QODA 4R7BA 1CSNA 4FT7A 2EVAA 2R0IA 4BTJA 3NUPA 2WMXA 2VTPA 2BRHA 2I7QA 2XZSA 4IWPA 4PUZA 4HVDA 1H8FA 4OTFA 2JLDA 4TW9A 3HZTA 3CBLA 4FRFA 4K77A 3NX8A 3NCZA 3FLQA 4IJPA 4IX5A 4YJPA 3R7OA 3BU3A 2JDRA 3OZ6A 3PWYA 4G6LA 4GV1A 3BWJA 4AF3A 4X2GA 4BZDA 4U79A 1QMZA 4RPVA 4PY1A 1PMVA 4JOAA 3CTQA 4J71A 4JX3A 4E26A 4FZFB 2GPHA 3AGMA 5CF8A 4MNEA 4XS2A 3HP5A 3FMJA 3PFQA 3BE9A 3OXTA 4KBAA 3D83A 4O0UA 4QMVA 4YZDA 5A4CA 5GZAA 4R77A 3UIBA 3VS3A 4QPAA 5B2LA 3ZYAA 2HYYA 4BKJA 4AW5A 1QPDA 2PZPA 4GFOA 4IC8A 4U5JA 4XG2A 3QLFA 2E2BA 5AR4A 5A9UA 2W7XA 3H9OA 4L52A 4YC6A 3L8XA 4U44A 2R3MA 5GJGA 3ULZA 1BL7A 3PUPA 1XBAA 4U3ZA 4E20A 3PIYA 4H58A 3JPVA 4EZ7A 3MY0A 2F2CB 2FO0A 4J99A 2JDSA 3ETAA 4B4LA 2PMIA 4FKOA 2XH5A 4FV5A 4GH2A 4ACHA 3KXMA 2FUMA 4DHJA 2BVAA 3G9NA 3DS6A 3AKKA 4FTIA 4WG4A 2JEDA 3V5QA 1H25A 1STCE 4X6RA 5D11A 4ONAA 5CEKA 5AV2A 3ATSA 3V5PA 3HUCA 2PVHA 3ZEPA 3NW7A 3RAWA 3BU5A 3N4UA 5L2QA 4O0XA 3P9JA 2WGJA 3OWPA 3RK7A 3EFKA 1IA8A 1SYKA 3GFWA 2VTNA 5CEOA 4PDYA 3PXYA 3O7LD 3GCSA 5BVWA 2ZFYA 4I41A 4ZTLA 2R3OA 2Y4IC 3GC8A 1Q8ZA 3NUUA 5AP6A 5AP7A 4F70A 3E93A 2XMYA 3KXNA 5AUXA 3W2OA 4ID7A 4Y95A 2HW7A 3DZQA 3QTXA 2OBJA 4LRKA 5L2SA 4FTJA 3Q2JA 4BDFA 2YAAA 1B6CB 1ZRZA 4U80A 1H1QA 2Z7QA 1J1BA 4BCFA 5F9EA 2VNYA 1SNUA 5LMAA 2OW3A 4YU2A 3PJ3A 3FEGA 4DFUA 4E6QA 3CQUA 4FT3A 4RFZA 2JBOA 3D7TA 4TXCA 3E8EA 1PXNA 2O63A 3G6GA 4NH1A 4ZLOA 3OF0A 2QCSA 4BDDA 4ZTSA 4FX3A 4G16A 1H27A 4FNZA 4R7IA 3IOKA 4AG8A 1R0EA 2ZM1A 3WZEA 4TYJA 4FV4A 2W1EA 4RFMA 3ORTA 4RWLA 2ZB1A 5EFQA 5I9XA 3II5A 4V01A 5JK3A 3WOWA 2UZTA 2C69A 4PTCA 4G3EA 2XKCA 5EM6A 1WVWA 4NYEA 3O8UA 5CYIA 2YIWA 5AUVA 3UPXA 4OAVB 3LIJA 5DR6A 3RAIA 5K4JA 4IDVA 2Z7LA 3FY0A 1FGKA 1P14A 4D28A 5I0BA 2UZDA 4JG8A 4BBFA 4GK2A 3CKXA 3EH9A 3EQDA 3WZUA 3QCQA 4EWQA 2WMUA 3B2WA 4F08A 4M0ZA 2X7FA 3SOCA 4EOQA 3RWPA 3EQRA 4WT6A 3IONA 1XH4A 3GVUA 2Z02A 1S9JA 4BDJA 5FQDC 2PVJA 2UZNA 1WCCA 4EYMA 3NNXA 1V0PA 4E93A 5CAPA 3GC9A 1WZYA 5KMOA 2HXQA 4L00A 4FTAA 4FSRA 4UX9A 5EI8A 4QMTA 5LARA 1WVXA 2R3PA 3QC4A 2BDJA 2IVSA 2V55A 4ZMFA 3QBNA 2R5TA 3IKAA 3PXFA 3U51A 2F57A 4A07A 3GENA 4ANLA 1YW2A 2F9GA 3LFFA 5JGAA 4FVRA 3UYSA 4F7LA 3IW5A 4W4WA 4WA9A 1IA9A 3KRRA 3VN9A 4EEVA 3PIXA 4OBQA 3RI1A 4IAIA 2Q0NA 2YCSA 2GNFA 3R01A 3BYOA 2CGUA 2LGCA 5CI6A 2VUWA 4FZ6A 3ORPA 1WBPA 3U55A 2FB8A 4EUTA 3RPOA 4XHKB 3MVJA 3VBYA 3MH3A 4YP8A 4GKHA 5BX0A 2BMCA 5EDQA 3DOGA 2C6LA 2A0CX 2WQNA 4WG3A 5KUPA 2PULA 3TM0A 4GRBA 1OL1A 3L1SA 4W4YA 1IRKA 4CSVA 4Z9LA 4FVPA 4I1ZA 3ZRLA 4FNYA 3FC1X 5DGZA 5EI6A 5FLFA 1ZYSA 4FMQA 2ZV8A 3UVRA 2X6DA 4EOIA 3C5IA 1OKYA 4Y5HA 3UDBA 2HW6A 1JKTA 4FG7A 4BZNA 1H08A 2X6EA 2VTSA 2VGPA 3MS9A 3S00A 1MQ4A 2HY81 4UB7A 2A27A 2IWIA 3VS5A 4GMYA 2VWBA 2PUPA 2CDZA 4GIIA 2B9JA 3P23A 5EHYA 4MNEB 3QTSA 4RC4A 4I0SA 5HVKA 4GL9A 2GDOA 4DA5A 5KMIA 1M2QA 4KWPA 2WTDA 2OIQA 3Q4CA 1JKLA 5DVRA 5HNGA 1LEWA 4JDIA 2KTYA 3SXRA 4U43A 4HW7A 4IW0A 4A9YA 4ZZNA 4F7NA 2YAKA 3JVRA 3L9MA 5AUZA 4YJSA 4BCHA 4UWCA 1O9UA 1F5QA 3RINA 1GZ8A 4C35A 2ONLC 4FV3A 4M69B 3SXFA 2IG7A 3G15A 5DT0A 4TZRA 3RVGA 5KKRB 5JFVA 2WTJA 5BYZA 4S32A 2PVYA 4WNOA 3ZUUA 3PWDA 3EKNA 3R71A 1KUTA 3WF7A 2C6DA 3TWJA 1OITA 4FEUA 3DTWA 5AAFA 3NFGB 3R7EA 1KV2A 2PE1A 2XKDA 5FG8A 1OBGA 3BQRA 3FXWA 4GK3A 4O0SA 3VW8A 3KU2A 4EK3A 3VONA 4D1SA 4I6BA 3ELJA 3FYKX 4GT5A 4GUBA 5LQFA 5EDPA 4YBKA 2XF0A 4UBAA 4K18A 2W5AA 2OJIA 5HBJA 5IEVA 2ZM3A 3LCSA 5HE0A 4HVSA 4O7YA 5GIOE 4E6DA 2NRYA 4GFMA 1OPJA 5K3YA 3NNWA 4JMQA 2HK5A 4S33A 4AA5A 4D5KA 5CQWA 5BYYA 1DI8A 5L6WL 3SKCA 4NM7A 1YWRA 2OWBA 2WQMA 3LZBA 4EH7A 3WZDA 2UZUE 4IM0A 4QMXA 3PJ1A 5K5NA 5FGKA 4L3LA 5CS6A 5AP1A 3DB6A 5HO6A 5AA9A 2IO6A 3U87A 4I24A 4DGMA 2WQEA 3ENHA 4MK0A 4BYIA 2J4ZA 2BTRA 4J1RA 2UZOA 4BGGA 4FSNA 2ZMCA 3HMNA 3FMEA 2Z7RA 4AZSA 3K5VA 3PTGA 3LFSA 3A60A 3QTWA 4J8MA 5M56A 2G15A 1OL6A 2WO6A 3HV6A 4NW6A 1T46A 1MRVA 3OBJA 3R1NA 3UQGA 3AT4A 4XEYA 4MWIA 5T68A 4OTDA 1YVJA 2FYSA 3A2CA 3DCVA 3BIZA 4P7EA 3MVHA 4EH5A 5EYMA 4FEWA 3CJFA 4AQKA 3O50A 2QOHA 5AM6A 4EZ5A 1Y6AA 4HVIA 4O7NA 4FZ7A 2RG5A 4JX7A 5AP3A 5H8BA 3N4VA 3E5AA 4RJ7A 5AA8A 3QCXA 1XQZA 2FH9A 2IW8A 3MVLA 3QX4A 2W05A 2CNVA 2Y4PA 2UW8A 5DG5A 2ZV7A 1RE8A 2ZDTA 3Q04A 5CX9A 4J98A 3MBLA 2WZJA 5A4LA 3I7CA 2R4BA 2C0IA 3TEIA 4XG9A 5EOLA 1UU7A 1M14A 2OH4A 2Y0AA 3NAYA 1CKIA 1FPUA 1YXTA 2ITPA 4E1ZA 2QOQA 3FSKA 4YO4A 1YXSA 1XR1A 3PIZA 3QTZA 3FLNC 3QKMA 4X0MA 4K6ZA 4BGQA 4MAOA 5ANJA 3HV4A 4F9AA 4QMQA 2BRMA 5J95A 5IA2A 4OTGA 3C13A 3DDPA 2OICA 4O82A 4BL1A 5FDPA 3TZMA 1ZARA 3QHWA