3NZ0A

Non-phosphorylated tyk2 kinase with cmp6
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
291
structure length
285
Chain Sequence
DPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A new regulatory switch in a JAK protein kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Non-receptor tyrosine-protein kinase TYK2
total genus 92
structure length 285
sequence length 291
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nz0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nz0A01
3B8QA 3QA8A 3CY3A 4FL3A 4EEVA 3O8TA 1XBBA 5AP3A 3MFSA 3P08A 3O8PA 4GUBA 4YJUA 2C6OA 4E73A 4EH2A 3GFWA 4TYGA 3QZFA 3A60A 2QKWB 4RC4A 2QG7A 2X6EA 2XK6A 1FMKA 3PIXA 3FBVA 1KV2A 2W5HA 1RDQE 3IW5A 3CKXA 4C4EA 5C8KA 3QD0A 5EHOA 3FPQA 2IWIA 3O7LB 2IW6A 1GJOA 4A9TA 4I1ZA 3R9NA 3D4QA 3ZC5A 4FTAA 3MVLA 3FC1X 3HV4A 3H9OA 3ZLYA 2VRXA 3U54A 3FSFA 4ASXA 3PXRA 3OCTA 3ETAA 2VAGA 2GQSA 4K8AA 1W82A 2AC3A 4DH8A 4FTRA 1FMOE 3UNJA 2W17A 4ZJJA 1H1SA 4O22A 3BZ3A 4EWQA 5EI2A 3LHJA 2VUWA 5BPYA 2C1BA 2IVUA 2Y9QA 3AC4A 4QP3A 2WTWA 3CJFA 3DB6A 4TXCA 4GEOA 4U97A 3BHHA 2BILB 2A19B 4FOBA 4K11A 4BCMA 3KVXA 4B7TA 5KMNA 2YHVA 1LEZA 2GHMA 3AD6A 4ZP5A 2JKMA 3LE6A 3QXOA 5IKWA 4BF2A 3O71A 1ZYLA 3FXWA 3HP5A 3H0YA 2OICA 2YAAA 1WCCA 1Q3DA 4NFMA 4UYAA 4CEGA 2J0IA 3GUBA 3PZHA 3QGWA 3TDVA 5EM7A 2BMCA 3W2QA 3AOXA 3MFTA 5J5SA 2YITA 4IWOA 3WZUA 4IAZA 4PPBA 4C4FA 2FVDA 4EHEA 2W1ZA 2Q0NA 2W1HA 4OT5A 2NO3A 1GAGA 1NXKA 4EH8A 5LARA 4IVDA 5AA9A 4A9YA 4PRJA 2JD5A 4CKIA 5JSMA 4EBWA 5HKMA 4FZFB 5DBXA 4DLIA 4EBVA 4CSVA 1HCLA 5HIEA 2VN9A 2XCKA 3ORXA 5H8BA 4EKLA 5KO1A 1B38A 3GU5A 4YTFA 3LJ0A 4IWDA 4Z7HA 5IU2A 3A2CA 3S0OA 3A61A 4MTAA 4R6VA 5BNJA 2J51A 2XIRA 1Y6BA 3HMOA 4MNEB 3DJ5A 2XF0A 3L8SA 4KBAA 4BI0A 3U55A 5M4UA 3GQLA 2O5KA 5CAOA 3QBNA 2VWUA 2C4GA 1W0XC 5HNBA 4BCJA 4QP6A 4BWXA 1GZNA 4L3PA 3DY7A 3E8NA 3GT8A 3IO7A 2V7AA 2IO6A 3F3UA 5CF6A 2QOOA 4MQ1A 1PXJA 3QU0A 4ANNA 4OTHA 3FZTA 3MVMA 4O6LA 2BIKB 4I94A 3EFKA 5CQUA 4BB4A 2XK8A 3EQGA 2VU3A 3PA3A 4AE9A 3NNXA 5I9YA 1LPUA 1T46A 3BQCA 3U6HA 1JAMA 3UE4A 4NUSA 1NW1A 4DGOA 1J3HA 3PFQA 2ITVA 3NUNA 4RG0A 5TE0A 3MDYA 1IG1A 2P33A 3ZOSA 1U46A 2PSQA 1PMNA 4GG7A 4DFUA 4BDEA 1Q8YA 3R8PA 3QF9A 2J50A 4XMOA 4C34A 1FBNA 1GZKA 2X4FA 5DI1A 5GJFA 4EC9A 4MD8E 5DMZA 3C4XA 2OF4A 3NMUF 4XP0A 2ZMCA 5FM2A 3TKHA 4DYMA 5BVNA 5HX6A 2VWBA 3ORKA 2ITWA 4R3PA 5HBHA 3BRBA 2QHMA 3VO3A 3FMHA 5AR2A 5HLWA 4B0GA 4O7WA 4MD7E 4YHTA 5EW3A 3KMMA 1Q5KA 4K0YA 4FR4A 4ZTHA 3SDJA 4W8EA 4G31A 1KE8A 4MBIA 4P5QA 5FTGA 3PPKA 3QKMA 5E8XA 4F7JA 5KZIA 2XKCA 4Y85A 1ZMUA 1T45A 3Q9ZA 4FKOA 4IE9A 2FGIA 3FDNA 5BUJA 4ZTLA 2PE1A 1Z9XA 5AP6A 3KF7A 4Y72A 3R7GA 4L46A 1FGKA 3C0IA 5EYDA 5JK3A 4S2ZA 5L6PA 4N6ZA 4MH7A 2HZNA 3MH1A 5HIDA 2VO0A 4OTDA 1R78A 4OLIA 5TOZA 3S00A 3NRMA 3BHUA 2UV2A 2FSLX 2XRWA 5ANIA 4U42A 4BCNA 5T68A 5HLPA 4GFOA 5HD4A 3HP2A 2UZTA 4FIFA 3RPRA 3IDPA 4QP7A 1RW8A 4QQ5A 4GK4A 1NA7A 2JBPA 3KK9A 5A14A 5HG5A 3ALNA 4TT7A 1Q3WA 4KNBA 2PVHA 5F1ZA 1Q24A 2XCHA 1HOWA 2DYLA 3PTGA 4TTHB 4I20A 2YIRA 2XNBA 5FD2A 3RM6A 2F9GA 3HMIA 3MTLA 3QTQA 4RIWB 3OC1A 4FV3A 4MXXA 1U59A 2W1DA 4IJPA 1KV1A 4JLCA 4KD1A 4KBCA 4RFYA 4O7TA 5TF9A 2Y6OA 3OTVA 3OP5A 5B7VA 4APPA 4D5HA 5HZNA 3MPMA 3T9TA 3TUBA 3TIYA 5M4CA 4FKTA 3BGQA 4FX3A 4FC0A 3KREA 4L7FA 5EDQA 5IF1A 2QONA 4AGCA 3PIZA 4CFMA 3FQSA 4P2KA 2PK9A 3B8RA 1OL5A 2H6DA 2O8YA 3ANQA 3KN5A 4FT7A 4I93A 5HOAA 3GB2A 2X2LA 3EFJA 4C4HA 3ORNA 3R8ZA 1J1CA 3PP0A 4G6OA 4PMMA 3QLFA 4C58A 4AX8A 4WD5A 2WOUA 4G2FA 2OF2A 4NM5A 1W84A 4JBQA 1UV5A 3FC2A 1TQMA 3HDNA 4EOLA 1YXSA 1JBPE 4CXAA 4AU8A 3S2PA 4ZZOA 3E7VA 1UU8A 4IAKA 3BHTA 4XRJA 3VS6A 4YLLA 2XNEA 4IAIA 3O96A 5CZIA 4O83A 3CTQA 3DFCB 5FTQA 3MESA 3OEZA 5EQYA 3RK5A 3RPYA 3PSBA 5I9ZA 5E4HA 2C6LA 3D7TA 3G51A 3ZSHA 3QQGA 2DQ7X 1A9UA 3DS6A 3LXPA 2R3IA 5AAFA 2ZVAA 3MY0A 4PTEA 5HTCA 4MKCA 4OGRA 5AUWA 2WAJA 4O1PA 5HGIA 4IB0A 3MS9A 5EG3A 2WMUA 4GVJA 5BYYA 4J95A 2QG5A 4BL1A 3TCPA 3DFAA 4FGRA 4E6DA 4H1MA 5C8NA 5IQFA 4MNEA 2ETKA 2Z8CA 3LLAA 4C57A 2C3LA 4ASEA 2I0VA 1UA2A 1GZ8A 3EB0A 3QTIA 4O7YA 4ERKA 1OL6A 1H28A 3REPA 5I9VA 1ZMVA 3MB7A 3BCEA 4WSQA 3HRBA 2XEYA 3H30A 4WG4A 5LMKC 3UG2A 2GSFA 3M2WA 4FG8A 3F88A 1UVRA 3VW8A 2QD9A 4OTFA 2E9UA 4CCBA 5J9ZA 4EH7A 2P2HA 3UVPA 4TPTA 4JBOA 2JKQA 4BCQA 3F6XA 5CU4A 3O0GA 1Q61A 1JNKA 2B53A 5CEOA 3CBLA 4M84A 3RNIA 4XV1A 4O7VA 2CHLA 2HZ4A 1HCKA 4D4SA 4ANSA 5IA0A 2PMNX 4KRCA 4DTBA 2VTIA 3UQFA 2EVAA 2FSMX 3WIGA 1DAYA 1H08A 3VS2A 4B99A 4TKSA 3HV6A 2GS2A 3MB6A 4H3PA 3ZO1A 4HVSA 3QYWA 4R7IA 3C4EA 4JAIA 4PPAA 2JKOA 3QTRA 5HLNA 2GNFA 1YHVA 3IW7A 4KINA 4BDGA 4F7NA 4FGBA 4I23A 5KHWA 5H2UA 4YTIA 3U51A 5FDPA 5AP2A 3ZXTA 4OT6A 4C3FA 3MV5A 5CANA 1J7IA 2W99B 3L9PA 2XVDA 4UX9A 4ALWA 2HAKA 3OS3A 4XG4A 5I9WA 4XG3A 4FVPA 5IEYA 3C5IA 4QP8A 3R7EA 4RWJA 3TI1A 2C69A 4QTBA 3FHRA 5HU9A 3HMMA 1WAKA 3D5XA 4FKIA 4I0SA 3MH0A 3DB8A 3DA6A 5LJJA 2OG8A 3W2OA 4AACA 4LGHA 3GCVA 3GXLA 4QP4A 2RFSA 3CTJA 4C61A 4Z16A 3CQWA 2V62A 4I24A 3PXQA 4QMYA 5KE0A 1APME 4GKIA 3NPCA 4ASDA 4Z9LA 2JIIA 3E87A 3RAHA 4BCOA 5JGAA 4O2PA 4ZTQA 2ERKA 4ZTSA 1VZOA 2BZIB 4RA4A 2C6IA 3MFUA 4RT7A 3L8XA 4HVDA 3CEKA 5I4NA 3FY2A 3Q5IA 3UC4A 5KKRC 4DH5A 2J5FA 3F7WA 3R01A 4FTNA 4BZDA 3FSKA 3U9NA 3PPJA 1XH6A 2UW6A 5AIRA 4WNOA 4CZYB 5CEKA 1YXTA 1OI9A 2CJMA 5EM6A 2UW5A 5JFWA 1YHSA 2PUUA 3FMNA 3PY1A 4IWPA 5C27A 1XO2B 2WTDA 4YC3A 1FPUA 3AD4A 3JUHA 2P4IA 3MIYA 1YI6A 3PRFA 3AGLA 3KEXA 2VWYA 5HO7A 2WTKC 4AAAA 5IG1A 3AMYA 3NUXA 4IX6A 2V0DA 4ACDA 3TXOA 3FWQA 3NIZA 3PVBA 1H0VA 3PJCA 4KKHA 3TT0A 5B0XA 2XM8A 4PP7A 4F64A 4C4GA 4QMWA 3ZC6A 4KIKA 5E8TA 2DS1A 4E6CA 4YBJA 1SM2A 2O3PA 3QD4A 5M55A 3W2CA 1G5SA 2ZM1A 3GCUA 3W2SA 3BHYA 4NKSA 2R64A 3C51A 1K3AA 5EOBA 3W32A 5LCKA 3BE2A 2PVFA 5J7BA 2PVYA 5ICPA 4O82A 2Y0AA 3ZCLA 1ZYSA 4DGMA 3DK6A 3UIMA 1E9HA 4QMLA 4YGAA 3ORLA 1ND4A 5IQBA 3DXQA 4DTAA 5CASA 1O6LA 3F3WA 2B9IA 4YJVA 4F7LA 4RX9A 1J1BA 5JEBA 1ZWSA 3LCSA 2HOGA 3ZO4A 5KCVA 4R77A 3GBZA 1ZXEA 4BC6A 2YIYA 3OWPA 1G8SA 1BX6A 4UMPA 1Z5MA 3Q32A 3FV8A 3GP0A 3VS4A 4F1TA 4XG7A 2WMQA 3SW7A 5GZAA 5IQGA 3K3JA 3ID6C 5CF4A 3FZRA 3FLZA 3SGCA 2BALA 1Q4LA 1IASA 4MVFA 1L3RE 3NW5A 4M69A 4RVTA 3W8LA 5IEVA 1XHAA 3RAIA 4TYIA 3E92A 3RALA 4XEYA 1RE8A 3R04A 2O65A 2ESMA 3KVWA 3S4QA 5FXSA 4GRBA 3VBXA 2CCIA 1XH8A 4HPUE 4XYFA 4C8BA 5IH4A 1XQZA 4RJ3A 4NSTA 4FODA 3ZYAA 5H8GA 3RNYA 1G3NA 3I6WA 4JXFA 5CEQA 1H00A 2PZYA 3AT3A 4IB5A 5M07A 4D1XA 4R7HA 4RX7A 3HVCA 3ZEWA 4D5KA 4JL9A 1Q8ZA 2CKEA 3QQLA 4LV8A 3SVVA 4HGEA 2YIQA 5CEIA 4TZRA 4DITA 5CALA 2WIPA 4OTGA 3MGYA 2WTKB 1R0PA 4QMTA 4M15A 4WA9A 4AZEA 4AN3A 3I0QA 3U6JA 2X8DA 2XUUA 5LVLA 3F61A 3BLHA 3ZRKA 3S1HA 4FIIA 4NJDA 3UNKA 4QMXA 4UMTA 4Q9ZA 2ZDTA 1YXUA 1K9AA 2BRNA 4TWCA 4WRGA 3R8MA 3I81A 1ZAOA 4EQMA 4FKQA 5AA8A 3DAKA 4V05A 5M56A 2X9FA 1IAHA 4ZMFA 4EZ5A 4XX9A 3WZKA 3UO4A 3FLYA 2BFYA 2GS7A 2H9VA 2ITUA 2ZM3A 3ELJA 4J1RA 4PNIA 2RIOA 3DJ7A 5F94A 4USFA 1J7UA 4AWIA 3QGYA 1MRYA 2JITA 3R1YA 4F7SA 3SG8A 3FXXA 4J7BA 4LV5A 3R7YA 4CGAA 3LZBA 4JDIA 2WXVA 3ENMA 2GDOA 2YJSA 4U40A 4UV0A 4DG0E 3LFFA 3KL8A 4O84A 1OGUA 2BTSA 3P78A 4YJSA 1FINA 4J97A 1CSNA 2F49A 2DWBA 3CQUA 4C2VA 1YXXA 4ANBA 3IPHA 4JVGA 3U87A 2P2IA 4TN6A 5EYCA 4AT4A 1OPKA 4ZIMA 4IFCA 4O0YA 3LMIA 4MXCA 5F9EA 5AFVA 4BTKA 2G01A 1P5EA 2PZRA 1Y91A 3HGKA 3OUNB 4EH9A 3R02A 3IG7A 2O63A 3EN5A 3CD3A 2PZIA 5DNRA 4QMNA 3AD5A 2Y4IB 3UTOA 4BN1A 4GJ3A 4X6QC 2OH4A 3DXNA 4RFZA 2XK3A 3JYAA 4NW5A 4YHJA 3BWFA 2ETRA 1JQHA 2EXCX 4FZAB 2EXEA 2GCDA 3D94A 3K2LA 3UBDA 5JN2A 4E26A 4ONAA 5KKRB 2UZLA 3DDPA 4LM5A 5EI6A 3UIBA 3F5UA 4HNFA 1OPLA 4L67A 3I60A 4Z55A 5KHXA 3Q2JA 4FEUA 2VTOA 1XH7A 4G3EA 5FP6A 4CQGA 4OBOA 4DGGA 3HDMA 3OCBA 4FG7A 3JVSA 5IEXA 2WMAA 3OG7A 4I21A 3LFAA 2PHKA 2OZAB 4RIYB 3RZFA 3MJ1A 4QT1A 3UZPA 3BX5A 3D83A 3Q2MA 4XOYA 4EJ7A 4FZDB 1QCFA 4U81A 4AGUA 3EFWA 3OBGA 1XR1A 3E3BX 4FNWA 4NKAA 2OZOA 5L6WL 4EK4A 4LFIA 4BBEA 3A7GA 1AGWA 3R8VA 5AV0A 4YTHA 3VRYA 4O86A 4ZTNA 5C4KA 3NYVA 1UU3A 2RSVA 2BRGA 2JGZA 4UMQA 1QL6A 2XNPA 4F9CA 1B6CB 3CR0A 3GOPA 2VTAA 2VNWA 2LGCA 3OXTA 3QUPA 4YUQA 3PJ2A 1VR2A 2RFEA 3POZA 4I5PA 3PXZA 3EOCA 2CN8A 4ZSJA 4LRMA 4AFEA 5A54A 5IDPA 3BU6A 4FZ7A 2H96A 2YABA 1YXVA 4ZSLA 4G3CA 3VWAA 3NYNA 5A4CA 1Y8YA 4GFMA 4AFJA 3EN4A 4ZZNA 3G15A 5E9EA 3RM7A 2ZDUA 4RIWA 5DR6A 3VHEA 4EZ3A 4QRCA 4QTEA 2W9FB 4ZTMA 2QLUA 3OHTA 4NZWB 1YVJA 3ZXZA 5JZNA 4BDCA 2VX0A 3QRKA 3VS0A 1WBPA 3H0ZA 3QZGA 1XH4A 3NNWA 4LI5A 5T6KA 1KE6A 5DR9A 2VWXA 2OJGA 4OTQA 1H26A 3ERKA 3LVPA 5AV1A 1JVPP 3DKOA 3JXWA 3TWJA 4E1ZA 5C1QB 3KXGA 4W4XA 4W9XA 4QPAA 2R9SA 3QKLA 3AMAA 1WBVA 3DV3A 2QQ7A 2BAKA 2CNVA 4ITHA 3TV4A 3KQ7A 2E9NA 1SZMA 5FTOA 3W2RA 3UVRA 4AE6A 4AGDA 2CCHA 2ITZA 1FVRA 4L7SA 2RFNA 3MW1A 1NVQA 5FQDC 1FVVA 4ZY5A 1YWNA 3QXPA 4PDOA 4QP9A 2LAVA 4HVIA 5J8IA 4F9WA 4DTKA 4EWHA 3R28A 4D0XA 4N6YA 1MRVA 4GU9A 4NWMA 1DM2A 4RRVA 4YHFA 5DLSA 5EHLA 5L2SA 1JPAA 1Q99A 4QMMA 4GT4A 4QYGA 4F70A 4C2WA 5K0XA 4WBBB 1CKIA 3NVKI 4RSSA 4D2PA 3PRIA 5ETCA 3TEIA 4D4VA 3A7FA 1UU9A 2A27A 3IS5A 4IZ5A 4PMPA 2CSNA 5CAPA 4UB7A 2GS6A 3Q3BA 3RVGA 4J96A 3KULA 1GZOA 4X2GA 5AADA 2UZNA 3N4UA 5DR2A 3OCGA 3VQUA 1FQ1B 4XV2A 4G3FA 3FI3A 3FZSA 1R1WA 2VV9A 4L9IA 2ZB0A 4BWKA 4DINA 3N4VA 4JG7A 4A9SA 4KKEA 2A0CX 2C5YA 2QURA 4ITJA 4IM2A 1YKRA 5JFSA 3NS9A 3WE4A 1CDKA 2X2KA 4U5JA 5CT7A 4TW9A 2YDIA 3QCYA 2WOTA 3ROCA 5M4IA 4Y8DA 2Y6MA 5AR3A 3N4TA 4HYSA 3QCQA 4I0RA 4D2SA 3QTUA 4YJTA 3BKBA 3DKFA 5A4LA 3PLAE 4P7EA 3I5NA 3ZBXA 5FXRA 2PUPA 5FWKK 4I6BA 3U9CA 2CKOA 4JBVA 2R7BA 3NX8A 3Q5ZA 4E4NA 3LPBA 5EQEA 3TV7A 2CLQA 2XKDA 5F20A 5LMBA 1MUOA 2HXLA 3T3VA 3GEQA 3IW4A 4IAFA 4UWCA 4U43A 4CFNA 2YIWA 2VWVA 4EYMA 3PXFA 4PDSA 5KUPA 3SD0A 3MPTA 3AC5A 4FV5A 2UVXA 3QUEA 4GH2A 5AAEA 3HAVA 2J0MB 4QO9A 5A6NA 2O0UA 3ORZA 4E5AX 5DOSA 3GC8A 3A8WA 5J1WA 3LCOA 3VS1A 5AM6A 4N4SA 3L9LA 4RJ5A 4PDPA 3ROYA 4IWQA 3C4CA 1W98A 2CGUA 4KIOA 3GC7A 4IFGA 4XJ0A 5CXZA 2BZKB 5EK7A 3FZ1A 3F2NA 4XNEA 4I0TA 4L68A 1PHKA 1JKSA 4V0GA 4YZNA 2IW8A 5D7VA 4BZOA 5J9LA 4D0WA 5DG5A 3M42A 3ORIA 3G0EA 1ERKA 4DGLC 1FVTA 5EKNA 3R2YA 3WF7A 5L8JA 3QA0A 5A9UA 1CM8A 5IUHA 3WF8A 5BVDA 1UKHA 2R3RA 4TYHA 4JJRA 3P5KA 3OOGA 2E9PA 3PSCA 4O7SA 4O81A 1TQIA 3IW8A 4L52A 4HW7A 4QYEA 4CYJA 2XJ0A 3R21A 5LCJA 3LFSA 3LQ3A 5HG7A 4NIFA 5E92A 1VEBA 3EJ1A 4O0WA 1PKDA 2OIBA 2UW4A 3I6UA 2F7XE 4NM7A 4DGNA 3R0TA 3LFQA 4MQ2A 4BDJA 4YURA 4LRKA 1JLUE 2XK4A 5CSVA 3MA3A 4KIQA 4QYYA 4YLKA 4FE2A 1YI3A 4QPSA 1ZLTA 2VWZA 4EOKA 3B2TA 4RX8A 1PXNA 4ZY6A 1ZYJA 5IA5A 4FK6A 2B54A 3VW6A 2FSOX 2JEDA 3QUDA 2R3MA 3TV6A 2WMTA 2PVKA 3EFLA 2RF9A 4WG5A 3FI8A 5AV3A 1F3MC 2JDVA 4F6SA 4GUEA 2QOQA 3OBJA 5EYKA 2UUEA 3QRJA 4BBMA 2UZWE 5M09A 3GI3A 5IA4A 4O7ZA 3GCSA 2ETMA 4W9WA 3QC4A 1H07A 2XH5A 4LUEA 4RFMA 4RVLA 4EL9A 4FA2A 2Z02A 2R3NA 5CNOA 5IUIA 3TTIA 4EUTA 3FLWA 4UY9A 2FYSA 3N9XA 3QWJA 4QTAA 4ARKA 4FK3A 4HJOA 4XOZA 3II5A 4FNXA 3ACJA 4PQNA 4AA0A 4BYJA 5CS6A 1K2PA 4C7TA 4ERWA 5FG8A 3ZU7A 1G8AA 1OBGA 2F7EE 4YU2A 3PJ3A 4MEDA 5BVEA 4GS6A 3PZEA 3EYHA 4C3RA 4X2KA 4W4VA 4X6RA 2ZV7A 4XBRA 2BR1A 3PE1A 3IQ7A 4JNWA 4YO6A 3RI1A 3FE3A 2HXQA 2X2MA 4FTMA 3WZDA 2OH0E 5FRIA 4PMTA 2WMVA 4FIJA 2UZBA 2WU6A 3HA6A 2W06A 4PNKA 2I6LA 5CSXA 3SXFA 4DCAA 1WBNA 4IVCA 4RIYA 3F69A 3RCJA 5CAUA 3NEWA 5FEEA 2BTRA 4NW6A 2UW9A 3CPBA 4JRNA 2GTMA 2R7IA 4GU6A 4CMTA 4WSYA 5AUVA 4AN9A 3CC6A 5J7HA 3V51A 3LQ5A 5KBQA 4C02A 2BAQA 3SHEA 3CD8A 1IEPA 1VYWA 3FXZA 3D2KA 4I4EA 2XRUA 4CFWA 4F63A 4OAUC 2ITNA 4MXOA 3MY1A 4RQKA 5FXQA 3ZEPA 3RWPA 5EKOA 4M69B 4O0XA 3D0EA 1U4DA 4G9CA 4X3FB 4PDYA 3G9LX 3N51A 2CMWA 4FKJA 3ZM9A 5A4EA 4BDFA 4QMVA 3R83A 2G1TA 2BKKA 2B9FA 2YFXA 3BYSA 5I9XA 3R6XA 5LOHA 2E9OA 3NW6A 4MAOA 3EWHA 2EUFB 3VBVA 1YWRA 3G2FA 3AC2A 3DDQA 3W18A 4IJ9A 2XKFA 1PXKA 2ZB1A 4GT5A 2B7AA 3W33A 4YLJA 4D2RA 5AX9A 4EHGA 2YWVA 4XP3A 1IA8A 2XJ2A 3VBTA 4D4RA 3TL8A 3ODZX 4RGJA 2YIXA 4BKJA 4A06A 4ANMA 2JBOA 4F9BA 4ZK5A 4IX4A 5EW8A 1M52A 2ZV2A 1ZYCA 4IDVA 3QRUA 4YJOA 1LP4A 3DTCA 4C4JA 2A2AA 5HD7A 5TO8A 4A07A 2XK9A 4FVQA 4R3CA 5ANGA 4M0ZA 2CGVA 3QZHA 4BZNA 3VUKA 2YCFA 2XB7A 4FEXA 4N57A 5K0KA 4AZTA 1NY3A 3AGMA 3FQHA 3KA0A 3NR9A 3KRRA 4A7CA 2IPXA 4DEGA 4ID7A 5IZFA 4CVAA 3R9OA 2YZAA 2IG7A 3FMEA 2X8IA 2O2UA 1W83A 3BI6A 1WBTA 3UDBA 3ZFYA 4E20A 3EL7A 5E1EA 2W1FA 2YWPA 4BDIA 4GG5A 2UW0A 4F09A 3SQQA 4DCEA 5CAQA 3Q4ZA 2QNJA 4IQ6A 2HW6A 2R5TA 5BVWA 2I7QA 1YDSE 4GIHA 3W2PA 2WMBA 2YM5A 4PMSA 3DK3A 5HG8A 5DYJA 4DEHA 1EH4A 2QU6A 4DEBA 2C3JA 4L00A 1OMWA 4D9TA 4DG3E 2CNQA 4IADA 3VAPA 4C35A 3DZQA 4RJ8A 3DAJA 3HX4A 3TM0A 1BL7A 1S9IA 1V0OA 4FI1A 1WZYA 1MQBA 4E5BA 4F6WA 4U80A 3RK7A 4HGTA 1OB3A 3RBWA 4F6UA 4QP2A 4DEEA 3NNUA 2XNNA 3A99A 3UOLA 3Q96A 1ZY4A 4AF3A 4F99A 4NTTA 5HNIX 3FKNA 2XIZA 1KWPA 2ZJWA 2QOKA 3D5UA 1R3CA 4I92A 3P0MA 4QMUA 2WHBA 3GOKA 2EWAA 4U3ZA 5DN3A 3BBTB 2HY0A 2OO8X 4XP2A 3DBCA 4P5ZA 3W16A 1OIYA 2BROA 3VBQA 4KIKB 4DFYA 5I9UA 3EQBA 3MH2A 4YZ9A 3TKUA 3RZBA 1XBCA 3VS5A 3V04A 4TNBA 3C4WA 1KUTA 3ORMA 4BHZA 4DFNA 4UMRA 2A4LA 2F2UA 2WO6A 3EQPA 4U9AA 2JDRA 5EM5A 4JIAA 3HNGA 2QCSA 4P4CA 3PPZA 2OGVA 3UZRA 2CGWA 5JRQA 2R3KA 3W55A 2HZ0A 4FBXA 4FKWA 3U4UA 3FL4A 4Y5HA 4AT5A 4F1MA 4FIGA 2AYPA 4CTCA 3TNPC 4I22A 1YQJA 4B8LA 2PUIA 3WE8A 3MVHA 4CFXA 2Q0BA 2QR7A 3TZ7A 1WFCA 3E62A 5HCYA 1U54B 2F7ZE 2PY3A 3IDBA 4JG8A 4XLVA 2C30A 1H4LA 2V22A 1DAWA 3KGAA 4XG6A 1PMVA 3HMNA 5DEWA 5E8SA 5EOLA 4YTCA 5IPJA 3NUSA 4C38A 3MYGA 4HZSA 4J53A 2C6EA 2C68A 3FHIA 3KRLA 4FVRA 4KWPA 2FUMA 2WTIA 4YC8A 2QR8A 3C9WA 1U5QA 2OIDA 2RG6A 2YM8A 4K2RA 4NCTC 5BMMA 5IH6A 3H10A 3NW7A 1YI4A 3KRWA 2B4SB 2C5VA 4JIKA 3F9NA 1H25A 3FMJA 4LOQA 2OI4X 4LOOA 2FO0A 2R3GA 3H9RA 5E1SA 4QQCA 2QKRA 2H8HA 5A46A 1Q8UA 4CRSA 1O9UA 4EOMA 3UQCA 3DK7A 5AUXA 4FL2A 3DNEA 2X7FA 4YZMA 3AT2A 3UOKA 5J5TA 1ZOEA 4W4WA 5CF5A 4RVKA 1ZOHA 3GNIB 3EN6A 4CNHA 1AD5A 5C9CA 4BHNA 2X7GA 4NIFB 2ITOA 4IM3A 5AP0A 3M11A 4AG8A 2W5AA 1WVYA 4CV8A 2E9VA 3ZUVA 4BTMA 4EHZA 4F4PA 1OITA 2HWOA 2YN8A 2G2IA 4GSBA 4CKRA 4I5HA 4LMUA 4BDKA 3OW4A 5E8UA 2A1AB 2BDJA 3R1SA 4USEA 1XBAA 3SRVA 2VGPA 2WD1A 2XBJA 4U7ZA 2PMLX 3NUYA 5DE2A 1KSWA 3WBLA 3ZSGA 1M2QA 4EK8A 5GHVA 2HCKA 3R30A 2PMIA 3UQGA 5HVYA 3UG1A 4YJNA 1X8BA 3QAME 3COIA 5AR5A 4F1OA 3QKKA 3Q9WA 3KXHA 2R0IA 4WUNA 2BDFA 4GVAA 4XV3A 1RQQA 2VX1A 3DQXA 2PVRA 4IANA 4RLLA 4U3YA 3WIKA 4ACHA 4E4LA 2DUVA 3MPAA 3VUDA 4AW1A 1R39A 3PA4A 4FT9A 4MF0A 4UXLA 3BELA 5GZ8A 4DE4A 4I3ZA 3BHVA 2W1EA 5HTIA 3R22A 2JFLA 4JQ8A 4WKQA 3RCDA 3SG9A 4IX5A 4R78A 4JOAA 2FA2A 3LW0A 5D1JA 5CSHA 4ZSGA 3T9IA 4FIHA 1M17A 5KMOA 4CYIA 1KE7A 5HESA 5J79A 2W5BA 4M67A 2I1MA 5IUGA 3SW4A 4FV7A 3PLSA 4FMQA 4LG4A 4JDJA 2Y8OA 4Y83A 4ENYA 4M14A 4IEBA 3QYZA 3RPVA 4FSNA 3SV0A 3FZPA 3KB7A 3CCNA 4E8AA 5JQ5A 1YW2A 5CQWA 5CT0A 3BLRA 1H8FA 4E6QA 1WBWA 2R3FA 4G17A 1U5RA 3C13A 3C7QA 3Q4CA 3SOAA 4YJRA 3HA8A 1QPCA 2VTHA 3DZOA 3R7IA 1BUHA 4FT3A 5L2QA 5IA1A 1TVOA 4DH1A 5C01A 4ANLA 1L8TA 3DT1A 4X3FC 3ZFMA 5GNKA 4H05A 3PDTA 3I79A 2OW3A 2J0JA 2PE2A 4BFMA 5FGKA 3R7VA 3COMA 3KF4A 1PYXA 1QMZA 1WVXA 1ZZ2A 4ANQA 3U6IA 2PPQA 1H01A 4J98A 4FV8A 4S31A 3R9RA 3QCXA 5DA3A 4C0TA 2YA9A 3B2WA 4ZS0A 5GIOE 3TNHA 2F57A 4J8NA 3C1XA 2CPKE 4FV0A 4KA3A 3NWWA 3PYYA 5G1XA 4GKHA 5LQFA 4RWIA 5J9YA 4Y46A 4Q5HA 5E91A 5B2LA 4M0YA 4MF1A 5E90A 5HCXA 4ZS4A 4NCTA 2OJJA 3RK9A 4O91A 4GJ2A 3V6RA 4BI2A 4FTLA 2VX3A 4Y95A 2WQEA 3LFCA 4XG9A 5K4IA 1M2RA 3O50A 4X7QA 3SAYA 4UBAA 4AGWA 3NNVA 2XKEA 4DFBA 5M06A 2P0CA 3BYMA 5ANEA 4FSUA 4RPVA 2VZ6A 3UVQA 3MVJA 2C1AA 4M12A 4YP8A 3VNTA 4CT1A 1OIQA 2YM4A 4M66A 4EI4A 3CKWA 3U4WA 4RJ7A 4TWPA 1KOBA 5B2MA 2VNYA 1OL7A 3WZEA 4BGGA 1REKA 4DT9A 2WQOA 2UZUE 3TJDA 4G16A 2FSTX 2XEZA 3PIYA 2OJ9A 2W4OA 4FTUA 4FZ6A 4WHZA 3EN9A 5BYZA 2WELA 4L44A 5JRSA 4N70A 1PXLA 1Y8GA 3PVGA 4PX6A 2VTTA 4O7RA 1S9JA 3DPKA 3KMWA 3HYHA 1YRPA 3LJ2A 4D2WA 3ULIA 2YLEA 4DFLA 3FY0A 2PYWA 5L6OA 3NYXA 2VGOA 3ZUUA 3GU4A 3E8EA 3FYJX 4JRVA 4N0SA 4CLJA 1WVWA 4FSMA 4X21A 3UP2A 2QVSE 3E7OA 4IZAA 4CV9A 5AR7A 4O0TA 4OUCA 4C33A 4QD6A 2BUJA 3IONA 3UODA 5M4FA 4FKPA 4B8MA 2OSCA 5K9IA 4UEUA 5IQEA 4PV0A 3RMFA 2YACA 2CKPA 5DPVA 4FTKA 3OMVA 4APCA 4OR5A 5AWMA 2VD5A 3IKAA 3OFMA 2P55A 3L9MA 3RPOA 4FSYA 4OAVB 4G34A 1YDTE 5J1VA 1YOJA 4M13A 5FM3A 3F3VA 1SVHA 3SLSA 1MRUA 4R1YA 5E8VA 4RVMA 4YZCA 4QYHA 5JGDA 3FLSA 4EK3A 4FSTA 1UNLA 5L2TA 2W05A 5KMIA 3VC4A 4BYIA 1E1XA 3DXPA 4AW2A 5EI8A 5FDXA 4M3QA 3VF9A 2BCJA 2OFVA 3SOCA 2J90A 2VWIA 4BCGA 2X4ZA 2R3QA 1URCA 1FGIA 2I40A 3KY2A 1XH9A 4QPMA 4ACMA 4DBXA 1OKYA 4MBJA 4ZLYA 3CE3A 2VO3A 4I6FA 3FI2A 3OOMA 4E3CA 1FOTA 3EKNA 2X9EA 2NP8A 4IBMA 4A9RA 4BGQA 3RHKA 3R7OA 3OD6X 1V0BA 3NDMA 3NYOA 2VTLA 4QMSA 2BIYA 4EZ7A 3JY9A 4XS2A 4DFXE 2PE0A 3ULZA 1WMKA 3NCZA 2XJ1A 4JBPA 4X3FA 3SRVB 3R73A 3T3UA 3VUGA 4DC2A 4FEVA 3LFEA 4TWOA 5EYMA 2BZHB 1B39A 1I09A 4ACGA 4E6AA 3VQHA 5M08A 4OW8A 2WNTA 4JT3A 2ZMDA 3RHXA 4O0VA 4Z7GA 5JGBA 1KE5A 3IW6A 3UC3A 2W0JA 4GV1A 2C5NA 5HE1A 2JIUA 2SRCA 3L8PA 5F95A 3WARA 5CI7A 5HVJA 3GENA 3Q6WA 4WIHA 5CF8A 2ITTA 2HELA 3PG1A 3TNWA 2YJRA 3CP9A 4GT3A 5D9HA 4ZTRA 1ZY5A 4Q9SA 4EOIA 3M1SA 2QOHA 3KRXA 4KIPA 3BEGA 2ITYA 4LQMA 4K18A 3JR1A 3FLQA 4EH6A 4B6LA 4Y73A 5HHWA 4AXAA 1OECA 2RGPA 5DRDA 2BPMA 4EK6A 2GQRA 4V01A 4KB8A 2GHGA 1A06A 3PY3A 5CAVA 2G2HA 1R0EA 4I6HA 2XIYA 5TR6A 3I7CA 3TUCA 4AW5A 4QTDA 4IX3A 3E88A 5BVFA 1J91A 2W4JA 2W1GA 3R00A 3ZLWA 1ZMWA 4R3RA 2KTYA 5C4LA 4I6QA 3ATTA 2UW8A 2C0TA 2HYYA 3A7HA 5BQ0A 4ENXA 3Q6UA 4Q2AA 3ZH8A 5HTBA 2R3OA 3LLTA 4RQVA 4BTFA 4ZXTA 4YJPA 4KSPA 3F7ZA 4K33A 4O27B 3IGGA 3QQUA 5BVOA 3LM0A 2B52A 2VTQA 3ZDUA 4AN2A 5L8LA 4L01A 5EDPA 4F0FA 4EQCA 3FZOA 1XWSA 4QOXA 5D7AA 2UVYA 3HMPA 3V01A 3K54A 3AMBA 1P4OA 1OKVA 4H3QA 4L3JA 5ITAA 3LCDA 2GNLA 4O0SA 3EKKA 3V5TA 4ZJIA 2KULA 2HY81 4XG2A 4O0RA 5AX3A 5ACKA 4EYJA 1STCE 3VN9A 2REIA 4FTIA 3TZMA 2IZSA 5DIAA 1DI8A 5HE0A 5HORA 1V1KA 2ERZE 3F82A 1JKKA 3QTWA 3NUUA 2UZVA 2J6MA 3QC9A 4FF8A 4MXYA 4EOQA 2HIWA 4CFFA 3FKOA 4J99A 3P4KA 1BI8A 2XYUA 2YLFA 4LUDA 3AC1A 4YBKA 4DN5A 3RWQA 3CGOA 1M2PA 3DTWA 2JDOA 3L8VA 5AAGA 3EQFA 4G1WA 4DH3A 3SC1A 3EYGA 3BPRA 3CJGA 4NH1A 3V5LA 4AUAA 1AQ1A 4YNEA 4YSMA 3GCPA 4L45A 1ZRZA 4OTPA 5BMSA 1V0PA 3I7BA 4MBLA 4NU1A 4HVHA 4ZJVA 3C50A 4H3BA 3QLGA 2J0KA 2OLCA 2C0OA 2JIVA 4HCVA 3V8TA 2BRHA 4M68A 4G5JA 5L2IA 5A4QA 5AP1A 4BR3A 3EQCA 4RIXB 3DU8A 4FTQA 4L53A 4B9DA 4MK0A 3ZO3A 4L8MA 4BCIA 3IOPA 4BDHA 3A7IA 3VULA 4F08A 3OY1A 3OWJA 1J7LA 5GIPE 4BCFA 1ZZLA 2WU7A 4FV1A 5AP4A 2PULA 1ZYDA 2YISA 3QX2A 3SX9A 4YZBA 3Q4UA 3ITZA 1H1QA 1M7QA 2CNUA 3QALE 2X6DA 3OROA 1M7NA 4XH6A 2C3IB 3WOWA 3ANRA 4G5PA 4FV2A 4M7IA 4ZMEA 4X2FA 2VTJA 4ZZMA 2ZYBA 3Q53A 5M51A 2H34A 4KRDA 5HI2A 4O7NA 4D2TA 5FBNC 4CT2A 3P23A 1MP8A 4G9RA 4LMNA 4PWNA 2VTRA 1W8CA 2C5OA 2YCQA 2GQGA 4NL0A 4GCJA 4QP1A 4WT6A 4FV6A 2CGXA 4R5YA 2OBJA 2JDSA 2YEXA 3G6HA 4FOCA 4J71A 2JKKA 4HGLA 4OBPA 2QODA 2Y4IC 4B4LA 3OXIA 4AZSA 3VF8A 1PW2A 4DBNA 3EH9A 2WIHA 5H3QA 2ONLC 2E2BA 3QQJA 2JLDA 4NTSA 3EZVA 3BYOA 3QQFA 4GFGA 1PF8A 3MY5A 5HQ0A 2JAVA 5CI6A 5DT4A 3W8QA 4AZVA 3D9VA 4NEUA 2B0QA 3VUIA 4FSWA 2XNGA 4YZDA 1OUKA 5T3QA 3G5DA 4O21A 3CS9A 5BVKA 5CNNA 1Q41A 3KU2A 4PF4A 2XIXA 4E4XA 4KS8A 1O6KA 3PVUA 1OM1A 5DT3A 2BZJA 1PKGA 2HK5A 3OY3A 4MX9A 4UZHA 5IQDA 1GIJA 3O7LD 5D12A 2GNHA 3ENHA 3R71A 3UGCA 3QTZA 2JAMA 2EXMA 4USDA 5KBRA 5CSWA 2ZV9A 3GQIA 4MNFA 2UVZA 2O64A 3GU7A 4FTJA 1QPJA 3PXYA 1GIIA 3E93A 3R2BA 4WUAA 5LWMA 4WNMA 4PTCA 2C6KA 2QOBA 3HUCA 3MA6A 3FLNC 4HYUA 4YSJA 2NRUA 2YM3A 3JY0A 4F9AA 2XNOA 1H0WA 3GGFA 3ZLSA 2PVJA 4NM3A 4CFUA 3WF5A 3A4PA 2OZAA 5EDRA 3F3TA 2EB2A 3R1NA 4CLIA 3SA0A 4GMYA 2VO7A 5CVHA 3OXZA 3PUPA 3CGFA 2OJIA 4L6QA 1URWA 5GJDA 5AUTA 3DKGA 3VJNA 3TNIA 2GFSA 4QMOA 5FP5A 4IM0A 5ANDA 2UZOA 2RKUA 5ETAA 3ALOA 4IDTA 4JS8A 3G6GA 4L42A 4RA5A 5CEPA 2XS0A 5AP5A 4U0IA 4K9YA 4GW8A 4OTWA 2IVSA 3DQWA 3R1QA 4K1BA 3ZTXA 3W1FA 4PPCA 5IA3A 3OVVA 1GNGA 5DT0A 4OBQA 4XBUA 4DHFA 4LL5A 5HE3A 3GC0A 3EZRA 4CZUA 5AP7A 2PTKA 3POOA 2XP2A 3OF0A 3EQIA 4YPDA 4C3PA 2HWPA 2CKQA 3SKCA 3DBFA 4O6EA 3F5PA 3EQRA 3G9NA 4U8ZA 3AQVA 4C36A 2J4ZA 4CQEA 1VYZA 3OT8A 1TKIA 4HCUA 2G9XA 1P4FA 5FBOA 3V6SA 2W1IA 2C0IA 5BUIA 2RFDA 1PJKA 3HRCA 4BICA 3KXZA 3C4ZA 2GU8A 3PSDA 5CU0A 2Z7RA 5HE2A 4R1VA 3KK8A 3NIEA 4NYEA 4KKGA 3GU6A 5A6OA 4IMYA 4JAJA 3UJGA 4DT8A 4IVBA 4ALVA 2GHLA 2R4BA 3NUPA 2YERA 2GPHA 2NRYA 3BYUA 2YDKA 4IC8A 4RBLA 4RC3A 4AS0A 4QNYA 2YM6A 3LXLA 4G3DA 2F4JA 2GNJA 2XK7A 3O23A 4JR7A 4F9YA 3VBYA 2WMSA 3OUKA 4HYHA 3UNZA 5AM7A 1GOLA 4M97A 5M57A 3DGKA 4U41A 2PU8A 3SXRA 4MXZA 3LAUA 3V5QA 3EQDA 3FUPA 3ZSIA 4BI1A 5JH6A 3EHAA 4ASZA 4D28A 4FKUA 4OTRA 3VS3A 4RX5A 5KNJA 3CXWA 5E8WA 4PP9A 4DH7A 4CKJA 5CY3A 2VTNA 3ZM4A 5HX8A 4FNYA 3JPVA 4FTOA 4PL4A 2P3GX 2HENA 3OW3A 4U6RA 4DEIA 2XMYA 5DH3A 1OZ1A 5J95A 1BI7A 1Q62A 3DOGA 3E5AA 2AC5A 2BHEA 3H3CA 3VVHA 3QD2B 3PP1A 4EK5A 4FSQA 2WQNA 1H1WA 3RKBA 2IZUA 3FL5A 3CQEA 2RL5A 5ANKA 1BLXA 3AG9A 4MHAA 4UALA 3BE9A 3ZS5A 5E8ZA 3MTFA 5DRBA 1NVSA 3TACA 1KE9A 2ZAZA 3AC3A 3CTHA 1XJDA 2UW3A 3L9NA 4HNIA 4AOJA 4ZAUA 4ZSAA 2Q83A 3AXWA 3K3IA 2CLXA 5FEDA 4C59A 3S95A 3KN6A 2WTCA 4A9UA 3F2RA 2J7TA 3BV2A 3MIAA 3QHWA 5IA2A 4FV9A 1XKKA 1O6YA 4KSQA 4AP7A 4DEDA 3EN7A 4MD9E 3UP7A 2WEIA 4X0MA 5G6VA 3D7TB 3DBDA 4QMZA 4ZLOA 3F2AA 3MFRA 3HEGA 3TZ8A 1PXPA 3QX4A 3CSVA 2ITPA 4PTGA 3LFDA 3NLBA 3WYXA 4NM0A 4JQ7A 4NK9A 1JOWB 4C62A 3QD3A 3QL8A 2WB8A 1PXIA 3KMUA 1CMKE 1KOAA 4BWPA 1RJBA 2PL0A 4FKSA 3QRTA 1UU7A 4V04A 4XG8A 5IH5A 2WZJA 3D2IA 3FKLA 1OIRA 3LOKA 4IH8A 4HGSA 3QQKA 4HCTA 1PMUA 4IAYA 4M8TA 2QOLA 4FTCA 2EB3A 2Y4PA 4GK3A 4BKZA 4Q5EA 5TKDA 3FEGA 3BU5A 5I3OA 3UIUA 3FQEA 3VJOA 2BDWA 4FUXA 4O0UA 4EJNA 4OTIA 4RC2A 2YZLA 3HV5A 1BMKA 4I41A 4IXPA 4EOJA 1Q8TA 3NAYA 4YMJA 3PE2A 4QQTA 4ANOA 3HKOA 3ZONA 3UPXA 4QNAA 5L8KA 5A3XA 3G0FA 4MXAA 3ZO2A 3P7AA 4DLJA 5HU3A 3V5JA 5IMEA 5GINE 4MYGA 5D10A 2XNMA 4EOSA 1PY5A 1WBSA 3BEAA 3BU3A 3R9HA 4CMOA 1PRYA 3VRZA 3D14A 3NZ0A 1BYGA 3D5VA 4PUZA 4WRSA 3GU8A 3UOHA 4BCHA 4LYNA 1OVEA 4E93A 3V3VA 3OTUA 1BKXA 4O1OA 4YO4A 2IN6A 4KBKA 4GK2A 1OUYA 3F66A 5IMXA 3VIDA 3ZBFA 3C5UA 1VJYA 3ET7A 4LL0A 4D55A 5CYIA 2Z7LA 2B9HA 3OT3A 4FKRA 1SVGA 3COHA 5AUYA 3WYYA 3DKCA 2YCRA 3FPMA 4KABA 4O2ZA 4WBOA 1JSTA 2GTNA 3QHRA 4TL0A 3A7JA 5HIBA 1IAJA 4IB1A 3TUDA 2WQMA 3DBQA 1YOLA 3TZ9A 4A4OA 2V7OA 4DG2E 2QO7A 3D15A 3MBLA 2WMRA 4P90A 3EIDA 3LJ1A 2Z2WA 3OEFX 4IVAA 3TG1A 5L2WA 3UO5A 2CN5A 2HW7A 5DFPA 2XM9A 5BUEA 4DFZE 1IA9A 5DGZA 3PWDA 2BKZA 2Z60A 2CDZA 3MH3A 2FH9A 4JDHA 2GNIA 4LRJA 5CSPA 3R9DA 5EFQA 5CVGA 4R5SA 5ANOA 5ACBC 4EOPA 4KS7A 3GC9A 5HCZA 3I0OA 2C6MA 5DHJA 3IOKA 3E63A 1UWHA 5H8EA 5LMKA 3C4FA 3TJCA 4GYGA 5C26A 3IDCA 3OWKA 4J52A 4GIIA 4WNKA 5CU2A 4C37A 3LCKA 2OK1A 3P1AA 4IAAA 4ZOGA 2IZTA 2C6TA 3GVUA 4F0GA 5LMAA 3Q04A 4FNZA 5BYLA 4RJ4A 1P2AA 3EL8A 3HAMA 1OPJA 3Q9YA 2WMWA 3FMLA 2OU7A 4FEQA 2X1NA 4AOTA 4KUJA 1JKTA 3ZUTA 3ZRLA 4EH3A 3G90X 1ZARA 3NSZA 3THBA 3R63A 4G6NA 2WKMA 3TDWA 3QFVA 2ONLA 4NJ3A 1Q97A 3HV7A 2QI8A 2QLQA 1A48A 2QO9A 2F2CB 3Q4TA 3FYKX 3ZFXA 4EKKA 5I0BA 3LKMA 3Q9XA 4HOKA 3UMXA 4R8QA 5K5XA 5IDNA 2VO6A 1PYEA 4XHKB 5HICA 3S3IA 5GJGA 3VBWA 1YWVA 3JS2A 4RIOA 5CZHA 5AR4A 5AV2A 4AQCA 3PJ8A 2J0LA 5C8MA 2C5XA 3KC3A 2VTPA 4S32A 3RJCA 3RP9A 2QC6A 3DJ6A 3HLLA 5AV4A 2WTJA 3FMKA 5M44A 3A8XA 5K5NA 5CVFA 1Y57A 4U45A 2ZM4A 2J5EA 4RWLA 1F5QA 2R0UA 1PMEA 3BGZA 3WZJA 1I44A 5EQPA 2OKRA 4CZTA 5H9BA 3Q60A 4WOVA 5AJQA 5GZ9A 4ZY4A 2W1CA 3OWLA 4CCUA 3ZRMA 4EH5A 4HVGA 2WFYA 3HRFA 4W8DA 3LXKA 1TQPA 3LMHA 4FT0A 4AW0A 5LVPA 5K3YA 3IECA 1CKPA 3D7ZA 4X3JA 3TKIA 3LCTA 4UWYA 4L3LA 2W4KA 4ZEGA 1YHWA 4DEAA 2R2PA 3MSSA 2VTMA 2YM7A 4FICA 4QMPA 4FEWA 3I1AA 5FUTA 1REJA 2B55A 2GFCA 3NGAA 4CG9A 1JKLA 3K5UA 1SVEA 4DF3A 3ORTA 1QPDA 2I0HA 4JR3A 4H1JA 5J87A 3RGFA 4E4MA 1W7HA 5M53A 3VUTA 3HECA 3NAXA 5I5ZA 4RZVA 3PY0A 5CX9A 3EQHA 3TTJA 3C0HA 4RZWA 5CWZA 4EHVA 5IQAA 4RWKA 3KCFA 3LQ8A 3GCQA 1PXMA 3UYTA 2XA4A 2W9ZB 3P79A 2V5QA 3C0GA 4BBFA 4BCKA 4MWIA 3IK3A 2VWWA 1OIUA 3HUBA 3AC8A 2BHHA 5E8YA 4FV4A 4BY9E 5HEZA 3GFEA 3HV3A 5HO6A 2BFXA 4FTTA 5EW9A 3UIXA 3DBEA 3KRJA 5TT7A 4ZSEA 3AT4A 3IGOA 4FKLA 5LWNA 3UMWA 5AUUA 4E5WA 4PY1A 4X2JA 3ZMMA 1MQ4A 2G15A 4PL3A 4H36A 4XCUA 5JFXA 3KXMA 2R3PA 3O2MA 1LEWA 4IZYA 3KFAA 4JI9A 1H1RA 3F5GA 4S30A 3MI9A 5HNGA 3O17A 4FSRA 4CMUA 4NFNA 3R7UA 3NCGA 4XLIA 2I0YA 2W96B 2ITQA 2QO2A 1Z57A 3VS7A 5I3RA 2PWLA 4BRXA 3ORPA 4FYNA 3OZ6A 5CENA 1GY3A 3V8SA 3ZDIA 4I4FA 3P7CA 2C3KA 3W10A 4GYIA 4QQJA 4H39A 4BDBA 5CU6A 2PZPA 4IACA 3CY2A 4U79A 3ZHPC 3DCVA 4UZDA 2PMOX 4BVUA 4CTBA 5DVRA 5F4NA 3V5WA 2EU9A 4Z3VA 2IW9A 4BTJA 2B9JA 3BLQA 4JQEA 2Z7SA 1LUFA 4FUYA 3FMMA 4JX3A 3H4JA 4W4YA 3QQHA 4BKYA 3NVMB 4ZLZA 1NVRA 2Z7QA 1H27A 4RMZA 2XYNA 4FG9A 4UN0C 5ANJA 3COKA 2X7OA 4MCVA 4F0IA 5KMLA 1H1PA 3RINA 1SNUA 3DLSA 2ZV8A 4G3GA 4AZWA 2R3LA 4EC8A 3L1SA 3MN3A 3P9JA 1JWHA 4EOOA 5CLPA 4YJQA 4Y5QA 4DA5A 4TY1A 5AEPA 2PVLA 2GNGA 3WF6A 4NT4A 2BVAA 3KXXA 1DS5A 2XIKA 3KXNA 4YC6A 4LGDA 4TWNA 5L3AA 5IQIA 4S34A 4O7LA 4RLKA 2FB8A 3ACKA 1ATPE 2Y7JA 5D11A 4RIXA 2WEVA 3FI4A 5EH0A 3WF9A 2YCSA 1UNGA 5DWRA 2G2FA 4JDKA 4YPSA 3G33A 1U54A 2R3JA 3KCKA 5FEQA 5E7RA 4EQUA 3F3ZA 4X2NA 1DI9A 2PZ5A 5LVOA 3LFBA 2QU5A 3P7BA 2PVMA 5JT2A 3PJ1A 5JFVA 3RAKA 5AR8A 3UPZA 4YR8A 2ITXA 4IIRA 4S33A 4A4LA 3F5XA 3DLZA 3O51A 2PUNA 4XRLA 3DNDA 2OFUA 5CXHA 5CU3A 4FIEA 4ACCA 5KMKA 5K4JA 3KULB 4FL1A 2WPAA 3FAAA 4JX7A 5ETFA 5A4TA 3A4OX 4IB3A 5JZJA 4UYNA 2QHNA 4D9UA 5CTPA 4LGGA 4R7BA 4KAOA 3LMGA 3HL7A 3QCSA 3CIKA 2AUHA 4BDDA 2RG5A 3I5ZA 4HZRA 3ZZWA 4IW0A 4RJ6A 3BBWA 4IC7A 3BGPA 5IQHA 2X39A 3E8DA 5HBJA 5LXMA 3E64A 3DAEA 4YNOA 4AA5A 2WMXA 2WTVA 3QTXA 3WI6A 5KX8A 4D58A 4FSZA 3LFNA 4ITIA 4BGHA 5HVKA 3BQRA 1SMHA 3BIZA 2WGJA 4A4XA 5IQCA 5JQ8A 3SXSA 3E3PA 3H9FA 4GL9A 4JG6A 5AUZA 3EMGA 3LXNA 1JSVA 1PXOA 2OXDA 4IHPA 2OXYA 4BIBA 5KMJA 2X8EA 1E1VA 3MJ2A 4HYIA 3RAWA 4DAWA 5D41A 5IISA 4WNPA 5LVNA 4EH4A 2BRMA 5C03A 3TNQB 4BIEA 2X0GA 3UO6A 3KKVA 2IZRA 3VUMA 1IRKA 2UZDA 2XBAA 1SNXA 2B1PA 4K77A 4XV9A 2VTSA 4CG8A 2YDJA 2BAJA 4QYFA 2JC6A 4J8MA 1H24A 2UZEA 3QZIA 3V8WA 2JFMA 4O96A 1ZOGA 3U8WA 3LIJA 3ZZEA 4C4IA 3MWUA 4D2VA 2HZIA 4WG3A 5JMSA 3PA5A 5ETIA 1WBOA 3E8CA 3D5WA 2WQBA 2JDTA 1UKIA 4FKVA 2ACXA 1Q8WA 4G6LA 3TIZA 3HZTA 3V5PA 5JKGA 2BRBA 3I4BA 5BX0A 2OWBA 5B2KA 3NUAA 1YDRE 4QTCA 4CFVA 2C47A 2GMXA 5LVMA 2V55A 2XZSA 4EUUA 5AIKA 4CRLA 3FMDA 3VUHA 4BCPA 5DEYA 4I5MA 1IR3A 1F0QA 2OIQA 3R8LA 1QPEA 4UMUA 4UXQA 4AZFA 3BV3A 2ZOQA 4L43A 4I5CA 2IVVA 1SYKA 3A62A 4FKGA 3FJQE 2NNWB 3RPSA 3R8UA 2NPQA 4TRLA 5CEMA 5FLFA 3PXKA 1UNHA 3JVRA 3ZLXA 1P14A 2OJFE 4XUFA 3RTPA 1CTPE 3ODYX 4FT5A 3UZTA 2J2IB 4AT3A 3QRIA 3WILA 3T8OA 5EM8A 1OBDA 5HG9A 1CKJA 5HO8A 4F65A 1XH5A 2IVTA 2W7XA 1GIHA 3QWKA 4UWBA 3VHKA 5KMMA 4II5A 4BIDA 4EONA 2PVNA 4AA4A 3Q52A 3ATSA 4IZ7A 2QOCA 4TYJA 5AMNA 1OL1A 4QMQA 3PVWA 2X81A 2C6DA 4AOIA 2J9MA 1JSUA 2QOIA 3BWJA 4ORKA 3OCSA 1NT2A 1Y6AA 3QTSA 4CD0A 4MWHA 2R3HA 4PL5A 4U44A 4ALUA 3LM5A 2I0EA 4V0GB 4LOPA 1LR4A 2YAKA 2IJMA 3CPCA 2UW7A 4WO5A 3K5VA 3PG3A 4D1SA 4D4YA 3O8UA 4TNDA 4D1ZA 1BL6A 1YOMA 2OXXA 1OKWA 3UOJA 1UWJA 1M14A 1OKZA 3UYSA 3BYVA 4O38A 4TYHB 5HBEA 3P86A 4K6ZA 5KZ0A 4FYOA 4BDAA 4TYEA 4E7WA 3PWYA 3TN8A 5L4QA 4HPTE 1OL2A 2QOFA 5EHYA 3CLYA 4H58A 4EORA
chains in the Genus database with same CATH superfamily
3B8QA 3QA8A 3CY3A 4FL3A 4EEVA 3O8TA 1XBBA 5AP3A 3MFSA 3P08A 3O8PA 4GUBA 4YJUA 2C6OA 4E73A 1ST0A 4EH2A 3GFWA 4TYGA 3QZFA 3A60A 2QKWB 4RC4A 2QG7A 2X6EA 2XK6A 1FMKA 3PIXA 3FBVA 1KV2A 2W5HA 1RDQE 3IW5A 3CKXA 4C4EA 5C8KA 3QD0A 5EHOA 3FPQA 2IWIA 3O7LB 2IW6A 1GJOA 4A9TA 4I1ZA 3R9NA 3D4QA 3ZC5A 4FTAA 4O4DA 3MVLA 3FC1X 3HV4A 3H9OA 3ZLYA 4AXEA 2VRXA 3U54A 3FSFA 4ASXA 3PXRA 3OCTA 3ETAA 2VAGA 2GQSA 4K8AA 1W82A 2AC3A 4DH8A 4FTRA 1FMOE 3UNJA 2W17A 4ZJJA 1H1SA 4O22A 3BZ3A 4EWQA 5EI2A 3LHJA 2VUWA 5BPYA 2C1BA 2IVUA 2Y9QA 3AC4A 4QP3A 2WTWA 3CJFA 3DB6A 4TXCA 4GEOA 4U97A 3BHHA 2BILB 2A19B 4FOBA 4K11A 4BCMA 3KVXA 4B7TA 5KMNA 2YHVA 1LEZA 2GHMA 3AD6A 4ZP5A 2JKMA 3LE6A 3QXOA 5IKWA 4BF2A 3O71A 1ZYLA 3FXWA 3HP5A 3H0YA 2OICA 2YAAA 1WCCA 1Q3DA 4NFMA 4UYAA 4CEGA 2J0IA 3GUBA 3PZHA 3QGWA 3TDVA 5EM7A 2BMCA 3W2QA 3AOXA 3MFTA 5J5SA 2YITA 4IWOA 3WZUA 4IAZA 4PPBA 4C4FA 2FVDA 4EHEA 2W1ZA 2Q0NA 2W1HA 4OT5A 2NO3A 1GAGA 1NXKA 4EH8A 5LARA 4IVDA 5AA9A 4A9YA 4PRJA 2JD5A 4CKIA 5JSMA 4EBWA 5HKMA 4FZFB 5DBXA 4DLIA 4EBVA 4CSVA 1HCLA 5HIEA 2VN9A 2XCKA 3ORXA 5H8BA 4EKLA 5KO1A 1B38A 3GU5A 4YTFA 3LJ0A 4IWDA 4Z7HA 5IU2A 3A2CA 3S0OA 3A61A 4MTAA 4R6VA 5BNJA 2J51A 2XIRA 1Y6BA 3HMOA 4MNEB 3DJ5A 2XF0A 3L8SA 4KBAA 4BI0A 3U55A 5M4UA 3GQLA 2O5KA 5CAOA 3QBNA 2VWUA 2C4GA 1W0XC 5HNBA 4BCJA 4QP6A 4BWXA 1GZNA 4L3PA 3DY7A 3E8NA 3GT8A 3IO7A 2V7AA 2IO6A 3F3UA 5CF6A 2QOOA 4MQ1A 1PXJA 3QU0A 4ANNA 4OTHA 3BL7A 3FZTA 3MVMA 4O6LA 2BIKB 4I94A 3EFKA 5CQUA 4BB4A 2XK8A 3EQGA 2VU3A 3PA3A 4AE9A 3NNXA 5I9YA 1LPUA 1T46A 3BQCA 3U6HA 1JAMA 3UE4A 4NUSA 1NW1A 4DGOA 1J3HA 3PFQA 2ITVA 3NUNA 4RG0A 5TE0A 3MDYA 1IG1A 2P33A 3ZOSA 1U46A 2PSQA 1PMNA 4GG7A 4DFUA 4BDEA 1Q8YA 3R8PA 3QF9A 2J50A 4XMOA 4C34A 1FBNA 1GZKA 2X4FA 5DI1A 5GJFA 4EC9A 4MD8E 5DMZA 3C4XA 2OF4A 3NMUF 4XP0A 2ZMCA 5FM2A 3TKHA 4DYMA 5BVNA 5HX6A 4LV7A 2VWBA 3ORKA 2ITWA 4R3PA 5HBHA 3BRBA 2QHMA 3VO3A 3FMHA 5AR2A 5HLWA 4B0GA 4O7WA 4MD7E 1TZDA 4YHTA 5EW3A 3KMMA 1Q5KA 4K0YA 4FR4A 4ZTHA 3SDJA 4W8EA 4G31A 1KE8A 4MBIA 4P5QA 5FTGA 3PPKA 3QKMA 5E8XA 4F7JA 5KZIA 2XKCA 4Y85A 1ZMUA 1T45A 3Q9ZA 4FKOA 4IE9A 2FGIA 3FDNA 5BUJA 4ZTLA 4BJJA 2PE1A 1Z9XA 5AP6A 3KF7A 4Y72A 3R7GA 4L46A 1FGKA 3C0IA 5EYDA 5JK3A 4S2ZA 5L6PA 4N6ZA 4MH7A 2HZNA 3MH1A 5HIDA 2VO0A 4OTDA 1R78A 4OLIA 5TOZA 3S00A 3NRMA 3BHUA 2UV2A 2FSLX 2XRWA 5ANIA 4U42A 4BCNA 5T68A 5HLPA 4GFOA 5HD4A 3HP2A 2UZTA 4FIFA 3RPRA 3IDPA 4QP7A 1RW8A 4QQ5A 4GK4A 1NA7A 2JBPA 3KK9A 5A14A 5HG5A 2AEGA 3ALNA 4TT7A 1Q3WA 4KNBA 2PVHA 5F1ZA 1Q24A 2XCHA 1HOWA 2DYLA 3PTGA 4TTHB 4I20A 2YIRA 2XNBA 5FD2A 3RM6A 2F9GA 3HMIA 3MTLA 3QTQA 4RIWB 3OC1A 4FV3A 4MXXA 1U59A 2W1DA 4IJPA 1KV1A 4JLCA 4KD1A 4KBCA 4RFYA 4O7TA 5TF9A 2Y6OA 3OTVA 3OP5A 5B7VA 4APPA 4D5HA 5HZNA 3MPMA 3T9TA 3TUBA 3TIYA 5M4CA 4FKTA 3BGQA 4FX3A 4FC0A 3KREA 4L7FA 5EDQA 5IF1A 2QONA 4AGCA 3PIZA 4CFMA 3FQSA 4P2KA 2PK9A 3B8RA 1OL5A 2H6DA 2O8YA 3ANQA 3KN5A 4FT7A 4I93A 5HOAA 3GB2A 2X2LA 3EFJA 4C4HA 3ORNA 3R8ZA 1J1CA 3PP0A 4G6OA 4PMMA 3QLFA 4C58A 4AX8A 4WD5A 2WOUA 4G2FA 2OF2A 4NM5A 1W84A 4JBQA 1UV5A 3FC2A 1TQMA 3HDNA 4EOLA 1YXSA 1JBPE 4CXAA 4AU8A 3S2PA 4ZZOA 3E7VA 1UU8A 4IAKA 3BHTA 4XRJA 3VS6A 4YLLA 2XNEA 4IAIA 3O96A 5CZIA 4O83A 3CTQA 3DFCB 5FTQA 3MESA 3OEZA 5EQYA 3RK5A 3RPYA 3PSBA 5I9ZA 5E4HA 2C6LA 3D7TA 3G51A 3ZSHA 3QQGA 2DQ7X 1A9UA 3DS6A 3LXPA 2R3IA 5AAFA 2ZVAA 3MY0A 4PTEA 5HTCA 4MKCA 4OGRA 5AUWA 2WAJA 4O1PA 5HGIA 4IB0A 3MS9A 5EG3A 2WMUA 4GVJA 5BYYA 4J95A 2QG5A 4BL1A 3TCPA 3DFAA 4FGRA 4E6DA 4H1MA 5C8NA 5IQFA 4MNEA 2ETKA 2Z8CA 3LLAA 4C57A 2C3LA 4ASEA 2ZFYA 2I0VA 1UA2A 1GZ8A 3EB0A 3QTIA 4O7YA 4ERKA 1OL6A 1H28A 3REPA 5I9VA 1ZMVA 3MB7A 3BCEA 4WSQA 2XAMA 4MUQA 3HRBA 2XEYA 3H30A 4WG4A 5LMKC 3KIOC 3UG2A 2GSFA 3M2WA 4FG8A 3F88A 1UVRA 3VW8A 2QD9A 4OTFA 2E9UA 4CCBA 5J9ZA 4EH7A 2P2HA 3UVPA 4TPTA 4JBOA 2JKQA 4BCQA 3F6XA 5CU4A 3O0GA 1Q61A 1JNKA 2B53A 5CEOA 3CBLA 4M84A 3RNIA 4XV1A 4O7VA 2CHLA 2HZ4A 1HCKA 4D4SA 4ANSA 5IA0A 2PMNX 4KRCA 4DTBA 2VTIA 3UQFA 2EVAA 2FSMX 3WIGA 1DAYA 1H08A 3VS2A 4B99A 4TKSA 3HV6A 2GS2A 2X0PA 3MB6A 4H3PA 3ZO1A 4HVSA 3QYWA 4R7IA 3C4EA 4JAIA 4PPAA 2JKOA 3QTRA 5HLNA 2GNFA 1YHVA 3IW7A 4KINA 4BDGA 4F7NA 4FGBA 4I23A 5KHWA 5H2UA 4YTIA 3U51A 5FDPA 5AP2A 3ZXTA 4OT6A 4C3FA 3MV5A 5CANA 1J7IA 2W99B 3L9PA 2XVDA 4UX9A 4ALWA 2HAKA 3OS3A 4XG4A 5I9WA 4XG3A 4FVPA 5IEYA 3C5IA 4QP8A 3R7EA 4RWJA 3TI1A 2C69A 4QTBA 3FHRA 5HU9A 3HMMA 1WAKA 3D5XA 4FKIA 4I0SA 3MH0A 3DB8A 3DA6A 5LJJA 2OG8A 3W2OA 4AACA 4LGHA 1G8JA 3GCVA 3GXLA 4QP4A 2RFSA 3CTJA 4C61A 4Z16A 3CQWA 2V62A 4I24A 3PXQA 4QMYA 5KE0A 1APME 4GKIA 3NPCA 4ASDA 4Z9LA 2JIIA 3E87A 3RAHA 4BCOA 5JGAA 4O2PA 4ZTQA 2ERKA 4ZTSA 1VZOA 2BZIB 4RA4A 2C6IA 3MFUA 4RT7A 3L8XA 4HVDA 3CEKA 5I4NA 3FY2A 3Q5IA 3UC4A 5KKRC 4DH5A 2J5FA 3F7WA 3R01A 4FTNA 4BZDA 3FSKA 3U9NA 3PPJA 1XH6A 2UW6A 5AIRA 4WNOA 4CZYB 5CEKA 1YXTA 1OI9A 2CJMA 5EM6A 2UW5A 5JFWA 1YHSA 2PUUA 3FMNA 3PY1A 4IWPA 5C27A 1XO2B 2WTDA 4YC3A 1FPUA 3AD4A 3JUHA 2P4IA 3MIYA 1YI6A 3PRFA 3AGLA 3KEXA 2VWYA 5HO7A 2WTKC 4AAAA 5BV3A 5IG1A 3AMYA 3NUXA 4IX6A 2V0DA 4ACDA 3TXOA 3FWQA 3NIZA 3PVBA 1H0VA 3PJCA 4KKHA 3TT0A 5B0XA 2XM8A 4PP7A 4F64A 4C4GA 4QMWA 3ZC6A 4KIKA 5E8TA 2DS1A 4E6CA 4YBJA 1SM2A 2O3PA 3QD4A 5M55A 3W2CA 1G5SA 2ZM1A 3GCUA 3W2SA 3ML1A 3BHYA 4NKSA 2R64A 3C51A 1K3AA 5EOBA 3W32A 5LCKA 3BE2A 2PVFA 5J7BA 2PVYA 5ICPA 4O82A 2Y0AA 3ZCLA 1ZYSA 4DGMA 3DK6A 3UIMA 1E9HA 4QMLA 4YGAA 3ORLA 1ND4A 5IQBA 3DXQA 4DTAA 5CASA 1O6LA 3F3WA 2B9IA 4YJVA 4F7LA 4RX9A 1J1BA 5JEBA 1ZWSA 1VLRA 3LCSA 2HOGA 3ZO4A 5KCVA 4R77A 3GBZA 1ZXEA 4BC6A 2YIYA 3OWPA 1G8SA 1BX6A 4UMPA 1Z5MA 3Q32A 3FV8A 3GP0A 3VS4A 4F1TA 4XG7A 2WMQA 3SW7A 5GZAA 5IQGA 3K3JA 3ID6C 5CF4A 3FZRA 3FLZA 3SGCA 2BALA 1Q4LA 1IASA 4MVFA 1L3RE 3NW5A 4M69A 4RVTA 3W8LA 5IEVA 1XHAA 3RAIA 4TYIA 3E92A 3RALA 4XEYA 1RE8A 3R04A 2O65A 2ESMA 3KVWA 3S4QA 5FXSA 4GRBA 3VBXA 2CCIA 1XH8A 4HPUE 4XYFA 4C8BA 5IH4A 1XQZA 4RJ3A 4NSTA 4FODA 3ZYAA 5H8GA 3RNYA 1G3NA 3I6WA 4JXFA 5CEQA 1H00A 2PZYA 3AT3A 4IB5A 5M07A 4D1XA 4R7HA 4RX7A 3HVCA 3ZEWA 4D5KA 4JL9A 1Q8ZA 2CKEA 3QQLA 4LV8A 3SVVA 4HGEA 2YIQA 5CEIA 4TZRA 4DITA 5CALA 2WIPA 4OTGA 3MGYA 2WTKB 1R0PA 4QMTA 4M15A 4WA9A 4AZEA 4AN3A 3I0QA 3U6JA 2X8DA 2XUUA 5LVLA 3F61A 3BLHA 3ZRKA 3S1HA 4FIIA 4NJDA 3UNKA 4QMXA 4UMTA 4Q9ZA 2ZDTA 1YXUA 1K9AA 2BRNA 4TWCA 4WRGA 3R8MA 3I81A 1ZAOA 4EQMA 4FKQA 5AA8A 3DAKA 4V05A 5M56A 2X9FA 1IAHA 4ZMFA 4EZ5A 4XX9A 3WZKA 3UO4A 3FLYA 2BFYA 2GS7A 2H9VA 2ITUA 2ZM3A 3ELJA 4AXCA 4J1RA 4PNIA 2RIOA 3DJ7A 5F94A 4USFA 1J7UA 4AWIA 4AXFA 3QGYA 1MRYA 2JITA 3R1YA 4F7SA 3SG8A 3FXXA 4J7BA 4LV5A 3R7YA 4CGAA 3LZBA 4JDIA 2WXVA 3ENMA 2GDOA 2YJSA 4U40A 4UV0A 4DG0E 3LFFA 3KL8A 4O84A 1OGUA 2BTSA 3P78A 4YJSA 1FINA 4J97A 1CSNA 2F49A 2DWBA 3CQUA 4C2VA 1YXXA 4ANBA 3IPHA 4JVGA 3U87A 2P2IA 4TN6A 5EYCA 4AT4A 1OPKA 4ZIMA 4IFCA 4O0YA 3LMIA 4MXCA 5F9EA 5AFVA 4BTKA 2G01A 1P5EA 2PZRA 1Y91A 3HGKA 3OUNB 4EH9A 3R02A 3IG7A 2O63A 3EN5A 3CD3A 2PZIA 5DNRA 4QMNA 3AD5A 2Y4IB 3UTOA 4BN1A 4GJ3A 4X6QC 2OH4A 3DXNA 4RFZA 2XK3A 3JYAA 4NW5A 4YHJA 3BWFA 2ETRA 1JQHA 2EXCX 4FZAB 2EXEA 2GCDA 3D94A 3K2LA 3UBDA 5JN2A 4E26A 4ONAA 5KKRB 2UZLA 3DDPA 4LM5A 5EI6A 3UIBA 3F5UA 4HNFA 1OPLA 4L67A 3I60A 4Z55A 5KHXA 3Q2JA 4FEUA 2VTOA 1XH7A 4G3EA 5FP6A 4CQGA 4OBOA 4DGGA 3HDMA 3OCBA 4FG7A 3JVSA 5IEXA 2WMAA 3OG7A 4I21A 3LFAA 2PHKA 2OZAB 4RIYB 3RZFA 3MJ1A 4QT1A 3UZPA 3BX5A 3D83A 3Q2MA 4XOYA 4EJ7A 4FZDB 1QCFA 4U81A 4AGUA 3EFWA 3OBGA 1XR1A 3E3BX 4FNWA 4NKAA 2OZOA 5L6WL 4EK4A 4LFIA 4DHIB 4BBEA 3A7GA 1AGWA 3R8VA 5AV0A 4YTHA 3VRYA 4O86A 4ZTNA 5C4KA 3NYVA 1UU3A 2RSVA 2XANA 2BRGA 2JGZA 4UMQA 1QL6A 2XNPA 4F9CA 1B6CB 3CR0A 3GOPA 2VTAA 2VNWA 2LGCA 3OXTA 3QUPA 4YUQA 3PJ2A 4LDTA 1VR2A 2RFEA 3POZA 4I5PA 3PXZA 3EOCA 2CN8A 3W0RA 4ZSJA 4LRMA 4AFEA 5A54A 5IDPA 3BU6A 4FZ7A 2H96A 2YABA 1YXVA 4ZSLA 4G3CA 3VWAA 3NYNA 5A4CA 1Y8YA 4GFMA 4AFJA 3EN4A 4ZZNA 3G15A 5E9EA 3RM7A 2ZDUA 4RIWA 5DR6A 3VHEA 4EZ3A 4QRCA 4QTEA 2W9FB 4ZTMA 2QLUA 3OHTA 4NZWB 1YVJA 3ZXZA 3NFFB 5JZNA 4BDCA 2VX0A 3QRKA 3VS0A 1WBPA 3H0ZA 3QZGA 1XH4A 3NNWA 4LI5A 5T6KA 3NFGB 1KE6A 5DR9A 2VWXA 2OJGA 4OTQA 1H26A 3ERKA 3LVPA 5AV1A 1JVPP 3DKOA 3JXWA 3TWJA 4E1ZA 5C1QB 3KXGA 4W4XA 4W9XA 4QPAA 2R9SA 3QKLA 3AMAA 1WBVA 3DV3A 2QQ7A 2BAKA 2CNVA 4ITHA 3TV4A 3KQ7A 2E9NA 1SZMA 5FTOA 3W2RA 3UVRA 4AE6A 4AGDA 4QEBA 2CCHA 2ITZA 1FVRA 4L7SA 2RFNA 3MW1A 1NVQA 5FQDC 1FVVA 4ZY5A 1YWNA 3QXPA 4PDOA 4QP9A 2LAVA 4HVIA 5J8IA 4F9WA 4DTKA 4EWHA 3R28A 4D0XA 4N6YA 1MRVA 4GU9A 4NWMA 1DM2A 4RRVA 4YHFA 5DLSA 5EHLA 5L2SA 4AQKA 1JPAA 1Q99A 4QMMA 4GT4A 4QYGA 4F70A 4C2WA 5K0XA 4WBBB 1CKIA 3NVKI 4RSSA 4D2PA 3PRIA 5ETCA 3TEIA 4D4VA 3A7FA 1UU9A 2A27A 3IS5A 4IZ5A 4PMPA 2CSNA 5CAPA 4UB7A 2GS6A 3Q3BA 3RVGA 4J96A 3KULA 1GZOA 4X2GA 5AADA 2UZNA 3N4UA 5DR2A 3OCGA 3VQUA 1FQ1B 4XV2A 4G3FA 3FI3A 3FZSA 1R1WA 2VV9A 4O4BB 4L9IA 2ZB0A 4BWKA 4DINA 3N4VA 4JG7A 4A9SA 4KKEA 2A0CX 2C5YA 2QURA 4ITJA 4IM2A 1YKRA 5JFSA 3NS9A 3WE4A 1CDKA 2X2KA 4U5JA 5CT7A 4TW9A 2YDIA 3QCYA 2WOTA 3ROCA 5M4IA 4Y8DA 2Y6MA 5AR3A 3N4TA 4HYSA 3QCQA 4I0RA 4D2SA 3QTUA 4YJTA 3BKBA 3DKFA 5A4LA 3PLAE 4P7EA 3I5NA 3ZBXA 5FXRA 2PUPA 5FWKK 4I6BA 3U9CA 2CKOA 4JBVA 2R7BA 3NX8A 3Q5ZA 4E4NA 3LPBA 5EQEA 3TV7A 2CLQA 2XKDA 5F20A 5LMBA 1MUOA 2HXLA 3T3VA 3GEQA 3IW4A 4IAFA 4UWCA 4U43A 4CFNA 2YIWA 2VWVA 4EYMA 3PXFA 4PDSA 5KUPA 3SD0A 3MPTA 3AC5A 4FV5A 2UVXA 3QUEA 4GH2A 5AAEA 3HAVA 2J0MB 4QO9A 5A6NA 2O0UA 3ORZA 4E5AX 5DOSA 3GC8A 3A8WA 5J1WA 3LCOA 3VS1A 5AM6A 4N4SA 3L9LA 4RJ5A 4PDPA 3ROYA 4IWQA 3C4CA 1W98A 2CGUA 4KIOA 3GC7A 4IFGA 4XJ0A 5CXZA 2BZKB 5EK7A 3FZ1A 3F2NA 4XNEA 4I0TA 4L68A 1PHKA 1JKSA 4V0GA 4YZNA 2IW8A 5D7VA 4BZOA 5J9LA 4D0WA 5DG5A 3M42A 3ORIA 3G0EA 1ERKA 4DGLC 1FVTA 5EKNA 3R2YA 3WF7A 5L8JA 3QA0A 5A9UA 1CM8A 5IUHA 3WF8A 5BVDA 1UKHA 2R3RA 4TYHA 4JJRA 3P5KA 3OOGA 2E9PA 3PSCA 4O7SA 4O81A 1TQIA 3IW8A 4L52A 4HW7A 4QYEA 4CYJA 2XJ0A 3R21A 5LCJA 3LFSA 3LQ3A 5HG7A 4NIFA 5E92A 1VEBA 3EJ1A 4O0WA 1PKDA 2OIBA 2UW4A 3I6UA 2F7XE 4NM7A 4DGNA 3R0TA 3LFQA 4MQ2A 4BDJA 4YURA 4LRKA 1JLUE 2XK4A 5CSVA 3MA3A 4KIQA 4QYYA 4YLKA 4FE2A 1YI3A 4QPSA 1ZLTA 2VWZA 4EOKA 3B2TA 4RX8A 1PXNA 4ZY6A 1ZYJA 5IA5A 4FK6A 2B54A 3VW6A 2FSOX 2JEDA 3QUDA 2R3MA 3TV6A 2WMTA 1XMMA 2PVKA 3EFLA 2RF9A 4WG5A 3FI8A 5AV3A 1F3MC 2JDVA 4F6SA 4GUEA 2QOQA 3OBJA 5EYKA 2UUEA 3QRJA 4BBMA 2UZWE 5M09A 3GI3A 5IA4A 4O7ZA 3GCSA 2ETMA 4W9WA 3QC4A 1H07A 2XH5A 4LUEA 4RFMA 4RVLA 4EL9A 4FA2A 2Z02A 2R3NA 5CNOA 5IUIA 3TTIA 4EUTA 3FLWA 4UY9A 2FYSA 3N9XA 3QWJA 4QTAA 4ARKA 4FK3A 4HJOA 4XOZA 3II5A 4FNXA 3ACJA 4PQNA 4AA0A 4BYJA 5CS6A 1K2PA 4C7TA 2XAOA 4ERWA 5FG8A 3ZU7A 1G8AA 1OBGA 2F7EE 4YU2A 3PJ3A 4MEDA 5BVEA 4GS6A 3PZEA 3EYHA 4C3RA 4X2KA 4W4VA 4X6RA 2ZV7A 4XBRA 2BR1A 3PE1A 3IQ7A 4JNWA 4YO6A 3RI1A 3O5AA 3FE3A 2HXQA 2X2MA 4FTMA 3WZDA 2OH0E 5FRIA 4PMTA 2WMVA 3W0OA 4FIJA 2UZBA 2WU6A 3HA6A 2W06A 4PNKA 2I6LA 5CSXA 3SXFA 4DCAA 1WBNA 4IVCA 4RIYA 3F69A 3RCJA 5CAUA 3NEWA 5FEEA 2BTRA 4NW6A 2UW9A 3CPBA 4JRNA 2GTMA 2R7IA 4GU6A 4CMTA 4WSYA 5AUVA 4AN9A 3CC6A 5J7HA 3V51A 3LQ5A 5KBQA 4C02A 2BAQA 3SHEA 3CD8A 1IEPA 1VYWA 3FXZA 3D2KA 4I4EA 2XRUA 4CFWA 4F63A 4OAUC 2ITNA 4MXOA 3MY1A 4RQKA 5FXQA 3ZEPA 3RWPA 5EKOA 4M69B 4O0XA 3D0EA 1U4DA 4G9CA 4X3FB 4PDYA 3G9LX 3N51A 2CMWA 4FKJA 4O4FA 3ZM9A 5A4EA 4BDFA 4QMVA 3R83A 4AXDA 2G1TA 2BKKA 2B9FA 2YFXA 3BYSA 5I9XA 3R6XA 5LOHA 2E9OA 3NW6A 4MAOA 4DHZA 3EWHA 2EUFB 3VBVA 1YWRA 3G2FA 3AC2A 3DDQA 3W18A 4IJ9A 2XKFA 1PXKA 2ZB1A 4GT5A 2B7AA 3W33A 2X0QA 4YLJA 5AX9A 4D2RA 4EHGA 4XP3A 2YWVA 1IA8A 2XJ2A 3VBTA 4D4RA 3TL8A 3ODZX 4RGJA 2YIXA 4BKJA 4A06A 4ANMA 2JBOA 4F9BA 4ZK5A 4IX4A 5EW8A 1M52A 2ZV2A 3PFYA 1ZYCA 4IDVA 3QRUA 4YJOA 1LP4A 3DTCA 1ST4A 4C4JA 2A2AA 5HD7A 5TO8A 4A07A 2XK9A 4FVQA 4R3CA 5ANGA 4M0ZA 2CGVA 3QZHA 4BZNA 1W2CA 2YCFA 2XB7A 3VUKA 4FEXA 4O4CA 4N57A 5K0KA 4AZTA 1NY3A 2XARA 3AGMA 4DDIA 3FQHA 3KA0A 3NR9A 3KRRA 4A7CA 2IPXA 4DEGA 4ID7A 5IZFA 4CVAA 3R9OA 2YZAA 2IG7A 3FMEA 2X8IA 2O2UA 1W83A 3BI6A 1WBTA 3UDBA 3ZFYA 4E20A 3EL7A 5E1EA 2W1FA 2YWPA 4BDIA 4GG5A 2UW0A 4F09A 3SQQA 4DCEA 5CAQA 3Q4ZA 2QNJA 4IQ6A 2HW6A 2R5TA 5BVWA 2I7QA 1YDSE 4GIHA 3W2PA 2WMBA 2YM5A 4PMSA 3DK3A 5HG8A 5DYJA 4DEHA 1EH4A 2QU6A 4DEBA 2C3JA 2A98A 1OMWA 4L00A 4D9TA 4DG3E 4IADA 3VAPA 4C35A 2CNQA 3DZQA 4RJ8A 3DAJA 3HX4A 3TM0A 1BL7A 1S9IA 1V0OA 4FI1A 1WZYA 1MQBA 4E5BA 4F6WA 4U80A 3RK7A 4HGTA 1OB3A 3RBWA 4F6UA 4QP2A 4DEEA 3NNUA 2XNNA 3A99A 3UOLA 3AKKA 3Q96A 1ZY4A 4AF3A 4F99A 4NTTA 5HNIX 3FKNA 2XIZA 1KWPA 2ZJWA 2QOKA 3D5UA 1R3CA 4I92A 3P0MA 4QMUA 2WHBA 3GOKA 2EWAA 4U3ZA 5DN3A 3BBTB 2HY0A 2OO8X 4XP2A 3DBCA 4P5ZA 3W16A 1OIYA 2BROA 3VBQA 4KIKB 4DFYA 5I9UA 3EQBA 3MH2A 4YZ9A 3TKUA 3RZBA 1XBCA 3VS5A 3V04A 4TNBA 3C4WA 1KUTA 3ORMA 4BHZA 4DFNA 4UMRA 3BLAA 2A4LA 2F2UA 2WO6A 3EQPA 4U9AA 2JDRA 5EM5A 4JIAA 3HNGA 2QCSA 4P4CA 3PPZA 2OGVA 3UZRA 2CGWA 5JRQA 2R3KA 3W55A 2HZ0A 4FBXA 4FKWA 3U4UA 3FL4A 4Y5HA 4AT5A 4F1MA 4FIGA 2AYPA 4CTCA 3TNPC 4I22A 1YQJA 4B8LA 2PUIA 3W0PA 3WE8A 3MVHA 4CFXA 2Q0BA 2QR7A 3TZ7A 3TMOA 1WFCA 3E62A 5HCYA 1U54B 2F7ZE 2PY3A 3IDBA 4JG8A 4XLVA 2C30A 1H4LA 2V22A 1DAWA 3KGAA 4XG6A 1PMVA 3HMNA 5DEWA 5E8SA 5EOLA 4YTCA 5IPJA 3NUSA 4C38A 3MYGA 4HZSA 4J53A 2C6EA 2C68A 3FHIA 3KRLA 4FVRA 4KWPA 2FUMA 2WTIA 4YC8A 2QR8A 3C9WA 1U5QA 2OIDA 2RG6A 2YM8A 4K2RA 4NCTC 5BMMA 5IH6A 3H10A 3NW7A 1YI4A 3KRWA 2B4SB 2C5VA 4JIKA 3F9NA 1H25A 3FMJA 4LOQA 2OI4X 4LOOA 2FO0A 2R3GA 3H9RA 5E1SA 4QQCA 2QKRA 2H8HA 5A46A 1Q8UA 4CRSA 1O9UA 4EOMA 3UQCA 3DK7A 5AUXA 4FL2A 3DNEA 1OGYA 2X7FA 4YZMA 3AT2A 3UOKA 5J5TA 1ZOEA 4W4WA 5CF5A 4RVKA 1ZOHA 3GNIB 3EN6A 4CNHA 1AD5A 5C9CA 4BHNA 2X7GA 4NIFB 2ITOA 4IM3A 5AP0A 3M11A 3TYKA 4AG8A 2W5AA 1WVYA 4CV8A 2E9VA 3ZUVA 4BTMA 4EHZA 4F4PA 1OITA 2HWOA 2YN8A 2G2IA 4GSBA 4CKRA 4I5HA 4JMQA 4LMUA 4BDKA 3OW4A 5E8UA 2A1AB 2BDJA 3R1SA 4USEA 1XBAA 3SRVA 2VGPA 2WD1A 2XBJA 4U7ZA 2PMLX 3NUYA 5DE2A 1KSWA 3WBLA 3ZSGA 1M2QA 4EK8A 5GHVA 2HCKA 3R30A 1W2DA 2PMIA <