3NZ0A

Non-phosphorylated tyk2 kinase with cmp6
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
291
structure length
285
Chain Sequence
DPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title A new regulatory switch in a JAK protein kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 285
sequence length 291
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nz0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nz0A01
1Q97A 1R0EA 4GIHA 2OW3A 1FINA 4L01A 2BALA 2PVNA 2RG5A 4ZOGA 4I41A 3UDBA 4D2RA 4EH5A 3VJOA 2P2HA 1KE5A 1VR2A 3GI3A 4K8AA 1GZ8A 3ZS5A 5C4LA 1JSVA 4HJOA 4XG2A 4F7NA 3ZRLA 4FK6A 1YXUA 3H9FA 3BE2A 4TYEA 3R7VA 1OL2A 4F09A 5I9XA 3NVMB 2W1IA 3D7TA 3SHEA 1LEZA 3Q6UA 3PVGA 4L8MA 3ZC6A 3OD6X 3TKHA 5KHWA 1GOLA 1PYXA 3CE3A 4M0ZA 4M84A 5M4CA 4PMSA 4BYJA 3LXKA 1SNXA 4TN6A 4IB1A 4RFMA 4Z55A 4C58A 3EQPA 4EH9A 3LIJA 4I6FA 2EXEA 4S32A 4O84A 1FVRA 4IB3A 1ZRZA 3D94A 3UZPA 4IC7A 3UVQA 4N0SA 2C1AA 2JAVA 5J79A 2OXDA 1A06A 2WQMA 2QVSE 4D5HA 5LVMA 4O81A 4MWHA 3TV6A 4M0YA 4ZTLA 3RWPA 3TJCA 1O6YA 4EORA 3EN5A 3HL7A 3HP2A 4E6AA 2PWLA 4H1MA 3R8UA 1R78A 1KV2A 3GB2A 4EH7A 2B53A 3WYYA 2VWWA 3CS9A 4GRBA 3QRIA 4N4SA 4AXAA 5BYYA 4O86A 3EFJA 4V0GB 4EI4A 4FL2A 3VW8A 3ANQA 1LEWA 3LCTA 3K54A 3TG1A 4XV1A 3ZLXA 4F70A 2X8DA 4N6YA 3L8SA 3CQWA 3QXPA 4R7BA 1CTPE 2GNIA 3QQKA 4G16A 5HGIA 3ORXA 4IFCA 5HLNA 4XV9A 2CGUA 2IZUA 4FT5A 2QKWB 5JSMA 1GAGA 3ZHPC 3E8DA 3RVGA 3WF8A 3CEKA 3HNGA 4F4PA 5HBJA 4C57A 3DK6A 4I5HA 1PMEA 4XG9A 2IZTA 5LVOA 4S2ZA 4GFGA 2VTLA 3OUKA 5DVRA 5AR7A 2WGJA 3TXOA 2JLDA 2XK9A 1WFCA 3LFEA 3QU0A 4OBQA 3DDPA 3P9JA 3PUPA 5I9UA 4X2KA 4OTGA 3TM0A 2IVSA 2H8HA 2UW3A 5M56A 3EWHA 4BL1A 4DBXA 3QLGA 1R3CA 4FBXA 4G2FA 4HCVA 1U54A 1GZOA 1PMUA 2FSOX 5GIPE 3GU7A 2W1DA 4JDKA 3R83A 5JGAA 4QPSA 2W1CA 2B54A 5ETCA 2BFXA 5C8KA 1B39A 5JFVA 1BUHA 2UVXA 4CZTA 2WOUA 4OTQA 2ZV7A 2X7OA 1XKKA 4FNWA 3RAKA 1F0QA 4XP3A 4FI1A 4OGRA 4RZWA 5AUUA 4GIIA 2VNYA 3BPRA 3S95A 3TUCA 3FMMA 1A9UA 1UU8A 3I7BA 3MH3A 2XK8A 4GS6A 4EL9A 4KIOA 3NLBA 3MIYA 3RI1A 1M7QA 3HRCA 3T9TA 3NUYA 1E9HA 3CC6A 4I22A 3RPSA 3RK7A 3QA0A 1WZYA 1TQIA 4QMNA 3HV6A 4FV7A 5JQ5A 2C3KA 3TV7A 4KSQA 5CY3A 2CNQA 5EK7A 4JT3A 4RX7A 1AGWA 2C0TA 2LGCA 5J5SA 2O63A 4BHZA 4UB7A 2QR7A 2Q83A 3AQVA 4J8NA 3TKUA 3BIZA 3FLZA 5KE0A 3PYYA 1P5EA 3ZZEA 2OLCA 1CKPA 4II5A 3RHKA 2B55A 5CANA 1UNHA 3LQ5A 2ZMCA 4M66A 3PDTA 4OBPA 2WTIA 5J7HA 4RWKA 4DEGA 4MKCA 4ANBA 1JKLA 2CPKE 3E5AA 2UZNA 3PP1A 4FIFA 3UOHA 2VWYA 1UU7A 4ALUA 3A60A 4ARKA 4TL0A 3DKGA 5A9UA 3H0ZA 4Z7HA 3GEQA 4W4XA 1Y91A 1OPLA 3EQBA 4AW5A 3RPVA 3U87A 1OGUA 5DBXA 1XBCA 1ZOHA 2JC6A 4XEYA 4ZZOA 3DOGA 5IDNA 3SDJA 4U81A 4CEGA 3GU8A 4GVJA 2X9FA 4LV8A 4RVLA 3VAPA 2B1PA 4HVSA 5D7AA 4LL0A 4A4XA 2OZOA 3Q4ZA 4FSTA 1YWVA 4AGUA 4KSPA 5KMKA 5GHVA 3M2WA 4C0TA 3PVWA 5ITAA 4NW6A 2JBPA 4O7LA 4JBQA 5KKRB 4L3JA 2B7AA 3EFWA 3PPKA 4NW5A 5C1QB 4C4EA 2VUWA 2UZUE 2F9GA 4ALWA 3NS9A 3NW6A 4IMYA 5J9ZA 3F2AA 2JFMA 3MJ1A 4FZAB 5CU6A 2OSCA 3BU3A 2XBJA 1OKYA 3KK9A 3MS9A 3RTPA 1QPCA 2C3IB 3LCDA 4EOQA 4IAIA 3JVSA 2EU9A 3DXPA 2OIDA 2PHKA 4ITIA 2PVRA 2VTIA 4DH7A 3IECA 1OIRA 4CQEA 1YWNA 3DBCA 4HYIA 4PRJA 2GS6A 2X2LA 5T3QA 5IDPA 4LYNA 2PL0A 4HYUA 1P14A 3EKKA 3C9WA 4X2JA 3RHXA 2CHLA 4XH6A 3RZBA 2YWVA 4LRKA 2REIA 3R02A 3EL8A 4PPCA 4R8QA 3KCKA 4QMSA 2XCKA 1REKA 3JUHA 1MRUA 4XV2A 4NM5A 3O50A 1EH4A 5FLFA 5L2WA 4OR5A 1ND4A 3EOCA 3E3PA 3L8PA 3LPBA 5EG3A 2ZAZA 4PWNA 3W2QA 2OJIA 4DFXE 2HCKA 3A62A 3OW4A 4JQ8A 4BTMA 1OBDA 4ZY5A 1L8TA 4QOXA 2YZAA 3H0YA 3O7LD 4MWIA 5E1SA 4NSTA 4UWBA 1SMHA 4GYGA 2P33A 3MWUA 3PA4A 5CU3A 2J2IB 4GV1A 2C3JA 2KTYA 4HYHA 4S30A 4U79A 5IA0A 5EM5A 5HO8A 4PDYA 5F94A 3LFBA 5HORA 4QNYA 3Q4CA 4CTCA 1AQ1A 5GZ8A 5IQIA 3G6HA 2OKRA 5AP6A 3QLFA 2HENA 5DNRA 4J98A 3OEZA 4AF3A 4UV0A 2ZOQA 4YJRA 4BY9E 4BDHA 5L3AA 2PSQA 2ITVA 5AM7A 3N51A 3DLZA 2UV2A 3PTGA 3P7CA 4YZ9A 3OY1A 2XNEA 3BYVA 5AP7A 4CLJA 3FMLA 5IU2A 4QTDA 4ACGA 2XM9A 3TUDA 3QQFA 3E64A 5FUTA 4BRXA 1YVJA 3KXNA 4GMYA 2VU3A 3PSBA 4GJ2A 2YABA 1LR4A 4QMTA 4IVDA 2W9ZB 1Q41A 3OXTA 1W98A 2QHNA 3WF6A 3CY2A 4PV0A 4C37A 3PA3A 2UVZA 4FKGA 4LI5A 3BWFA 3ZUTA 1T45A 3IW5A 3VUDA 2BAQA 2XIXA 5A4QA 4E6DA 1FVTA 4QMXA 4FTCA 2G9XA 4X6QC 4J1RA 4FVQA 4MD8E 4HVIA 3UQFA 3N4VA 1Q24A 1VJYA 4XMOA 2PVHA 4ZLZA 2X6DA 5A46A 4PQNA 5HHWA 5IA2A 4J7BA 3ET7A 2X7FA 1XQZA 3ZUVA 5JRQA 3VF9A 4DAWA 4QT1A 2C5VA 5AP5A 3FMDA 3FMNA 3ORMA 5CZHA 4QD6A 5CAOA 4Y95A 3UIXA 4O82A 4DT9A 5F9EA 5ACBC 3NYOA 2NRYA 5DT4A 5LMBA 3F3UA 3IDCA 5M09A 5FXQA 1KSWA 3LQ8A 2XIRA 2C3LA 4YTIA 1QPJA 2LAVA 5JZJA 1CDKA 3RMFA 2XNGA 4CRSA 3RCJA 1IA8A 4BGHA 4BKZA 5JGDA 4AAAA 3BV3A 2F2CB 1U5QA 4J95A 5BQ0A 4IACA 4D4YA 3V5JA 4IHPA 3VBQA 4RIWA 3ORZA 4M69B 1R1WA 2VWUA 5CXZA 4ZP5A 4F9BA 3DXQA 3BKBA 4U3ZA 2DYLA 3R1SA 4GK4A 2Z7QA 3QRUA 4RIXA 3UZTA 3AC5A 3R22A 2W99B 3MI9A 3CKWA 4KABA 5HTBA 4BZDA 4IB0A 1KUTA 2YLFA 4L7SA 2C0OA 3QA8A 4DTBA 1Y6BA 5ANEA 3QGYA 4C3PA 1HCKA 1M2RA 4HVHA 2J0IA 1O9UA 1U59A 2PVYA 4EH8A 3OCBA 2ZYBA 3DQXA 1GNGA 2OZAA 3FYKX 2UW7A 3I6UA 3SOCA 4BB4A 5CSVA 1Y8YA 5A4LA 2R3OA 4FTRA 4Q2AA 4UN0C 4R77A 4MQ2A 4EC9A 2R0IA 4AWIA 4O21A 3QZHA 2J0JA 4MF1A 1SVGA 4WRGA 3WF7A 2XJ0A 3CTQA 5IQBA 2OGVA 5AUTA 1H1QA 1H4LA 3EFLA 3CPBA 4EHEA 4K6ZA 2E9NA 4PX6A 4Q9ZA 5H8EA 4D0WA 4XNEA 3NCZA 4FIEA 2HWOA 3QL8A 4E6QA 2WMVA 1OKZA 4GUEA 4L7FA 3KEXA 5D9HA 3II5A 3ZOSA 5FD2A 3S4QA 1JOWB 3NRMA 3L9NA 1K9AA 4B99A 4BCHA 1X8BA 5M4IA 3NIEA 5H8BA 1H1SA 3KMMA 3OMVA 4OTPA 1FGKA 4O6EA 1NVRA 4JIKA 3AC3A 5CAUA 1UU3A 5LWMA 4USFA 3ZC5A 5DLSA 3V01A 3ZSIA 5HBEA 2YJRA 2RSVA 4F7JA 4E4NA 4BWPA 2G2HA 3C4EA 4QQTA 3MH1A 4KRCA 1V0OA 2I7QA 4IAZA 1MRYA 5KZ0A 4EK4A 4C61A 3DKFA 5EW8A 4D4RA 5E8WA 4YJOA 4FZ6A 1JLUE 4B7TA 3KXMA 3QQGA 2IZSA 3NPCA 2C5OA 4FZFB 2XNBA 1HOWA 2J6MA 3CY3A 1BLXA 3HMMA 4DEDA 5ETFA 4RX5A 4G3GA 3BEGA 3DB6A 4U0IA 1J7IA 1M17A 2C1BA 1IA9A 3QRJA 4QP8A 4LRJA 3JXWA 1P4OA 4FL1A 3BRBA 5HEZA 1CMKE 2WQBA 3Q4UA 3V6SA 2BZKB 4IWPA 4QYFA 5DWRA 3OHTA 4EOLA 3UYSA 3LFFA 1Q8ZA 2R3MA 4IB5A 4CT2A 4IZYA 3VUHA 2WELA 3P4KA 2W1ZA 3AMBA 4HOKA 3TV4A 3I6WA 3U51A 3RBWA 4AACA 3IDPA 4ZTQA 2R7IA 4E8AA 1NVSA 5EDPA 3DFCB 3NAYA 4GG7A 4QYGA 2XKDA 2OIBA 3PJ3A 3PY0A 4LFIA 2QR8A 5ICPA 2NPQA 4YP8A 3BYOA 4QTAA 2Y4IC 1H00A 2ZVAA 3DZOA 3DK3A 3GT8A 3NUUA 3LJ1A 5ETAA 3W10A 4FUYA 3BU6A 3LJ2A 4PTGA 3OTUA 3BLHA 2WEVA 4CFVA 3NYXA 3FC1X 4IFGA 5GINE 3QCSA 3LM0A 4JQEA 5AX9A 3BLQA 1OBGA 4DGMA 3FUPA 3A7IA 3VNTA 4TNDA 4PTCA 5JFWA 4O0RA 2BZJA 3VS4A 3QWKA 4CTBA 3G15A 3NSZA 3R04A 5D41A 1VYZA 4D1XA 3F5UA 5L6PA 3IPHA 3RGFA 3H9OA 3SAYA 4FNZA 4FE2A 3ZMMA 4HYSA 5BUJA 5H3QA 4FYOA 3WZKA 4IC8A 4P7EA 1XBBA 4J52A 3UP7A 4CV8A 3UP2A 2GQSA 1U5RA 1CM8A 4H1JA 3ZUUA 3FKOA 2IVUA 4FKWA 4A07A 3OT3A 1QPDA 2W4KA 3E8CA 2X0GA 3NZ0A 3UGCA 4MF0A 4QMYA 4FK3A 4WG3A 4PDOA 2XCHA 4MTAA 2YAKA 2XNNA 4FSWA 4B8MA 2WMRA 4M15A 5FDXA 2A4LA 4EZ7A 3BGPA 4H3QA 1NA7A 4ACDA 2J7TA 4DITA 1JKKA 2ONLA 5FTOA 3Q9XA 1F3MC 1Q8UA 4RLLA 3RAIA 3UNJA 3S1HA 4OTRA 3QF9A 4D2WA 2PMOX 1M2PA 1OUYA 4J99A 4Y5QA 4MXYA 2R3JA 3HA6A 5AWMA 3FWQA 3KU2A 3OCSA 3F3TA 4YHFA 4KD1A 1ZMWA 3CD3A 4LOPA 5M4UA 3A8XA 2FSMX 5C8NA 3QQUA 4TYGA 5IQCA 2OU7A 3PP0A 3SD0A 4PPAA 2W5BA 2PMNX 4FG8A 4BCJA 5IA3A 5DN3A 3NMUF 4LMUA 4BTKA 5M55A 2YDIA 2B0QA 4LM5A 3F2RA 5C27A 2YIQA 5JQ8A 4R1YA 3KGAA 3IGGA 3RINA 4A4LA 4IX6A 4FL3A 4ASZA 4ASDA 4D2TA 4P2KA 1ZOEA 4BWXA 5BYLA 2XK7A 3MY5A 5DHJA 3R9DA 1Q8YA 4FIHA 1UU9A 3ZH8A 5EI8A 2YN8A 3IKAA 3N9XA 3V8SA 2ERKA 2R3GA 2G2FA 1BL7A 3L8XA 2CDZA 2AC3A 4FMQA 4MXCA 1KE7A 3BHHA 2C6EA 5M51A 3LM5A 2ZV8A 4I0RA 4JX3A 5DR2A 4F0GA 4BDCA 4CGAA 4USDA 4FV6A 4XS2A 4RWLA 4Z3VA 2NP8A 4QQ5A 3Q2MA 4HCUA 3D7ZA 4BBEA 4ZY6A 4BICA 4C4HA 3LFAA 3QD2B 3R21A 4FKIA 2IN6A 4BCGA 2XK4A 2WMWA 3B2WA 4GL9A 2YISA 3HAMA 4P5ZA 3FMEA 3KC3A 4C34A 3ZFXA 3LQ3A 5LOHA 3Q5ZA 4JIAA 4XP0A 5ANKA 5FRIA 3I0OA 4ZLOA 1GIJA 2C6KA 4D2SA 2J51A 4H3PA 4R1VA 4YLKA 4BR3A 4H3BA 5EQPA 1JKSA 5CAVA 3FQHA 5AUXA 4BFMA 1XH4A 3AGLA 4H39A 4IM0A 3GOPA 4MBIA 5HD4A 1PY5A 4FOCA 1H8FA 4ZS4A 4IH8A 3NIZA 3OCTA 2Y6OA 1PMVA 2XBAA 2UZTA 3G90X 1OITA 4O2PA 1G8AA 4DCAA 4JR7A 2PE1A 5LQFA 3UNZA 4W8DA 3M42A 4CKJA 4UX9A 4FF8A 4EOPA 4O7RA 3O23A 1ATPE 1URWA 4I1ZA 4FKLA 2BIKB 1KOAA 3RZFA 3QX2A 4J71A 2P0CA 2ITNA 3LXPA 1UWHA 1ZYCA 3RALA 4G5JA 5CWZA 4AGDA 4JVGA 4Q9SA 5LMKA 4GT3A 4RMZA 4TYHB 5J1VA 2QLQA 4DH8A 2O5KA 5H2UA 5BVDA 5A54A 5HX8A 3ACJA 2PZYA 3FE3A 5IKWA 3W2RA 4EH6A 5BVOA 4GUBA 5IQEA 4NH1A 2QLUA 2O64A 4I6QA 4FG9A 5HCXA 4DFNA 5L2SA 5HLWA 4M7IA 4TY1A 5EDRA 2Z02A 3P5KA 5JGBA 4FTJA 5AV0A 1H01A 5M06A 2QNJA 4CFUA 3N4TA 2F2UA 3A4OX 5K4JA 4I0SA 5D12A 4JI9A 4EK8A 4AQCA 3ORKA 3PJ8A 4BIDA 4DYMA 3HECA 4UXLA 2I6LA 2WTWA 4IQ6A 3ATTA 2WIPA 3VHKA 3L9LA 3QTZA 3FC2A 3UPXA 4DFYA 2IPXA 4OTFA 5ETIA 4XBUA 5DH3A 2GDOA 4QP7A 3F61A 4CQGA 4TRLA 5KO1A 1SZMA 2IW6A 2XIKA 2NNWB 4FSMA 4UZDA 3W2PA 4C35A 1URCA 3R1YA 2VTAA 4FSQA 3E8NA 3FJQE 3R01A 4K18A 4KKEA 4BCNA 4XRLA 2J0KA 2YCRA 3Q9WA 4KS8A 2QURA 5D11A 4H05A 2PU8A 4NM0A 3ULIA 5LWNA 1WBTA 3FBVA 3TUBA 1RJBA 4RLKA 4X6RA 4IDTA 3TTIA 3LW0A 4W4VA 5CLPA 3OBJA 2WTDA 2UZOA 3RPRA 1OKWA 4TYIA 3W1FA 4Y8DA 2HIWA 4MBJA 1UKIA 1Z9XA 2F7EE 4M8TA 1CKIA 3WILA 4DG2E 4ANMA 5C4KA 1OL5A 3TNHA 1YHWA 3LMGA 3P0MA 4KAOA 1Y6AA 2VWBA 3DY7A 5LVNA 3PIXA 2CMWA 2VO3A 2VTNA 1W82A 3MSSA 1OMWA 3D5VA 3R28A 4C3RA 5D7VA 4GFOA 2PMLX 4YC8A 2VO0A 4U7ZA 3UG1A 3M1SA 4O7SA 3QHRA 4MNEB 3F2NA 1TQPA 3AD6A 5L4QA 2H34A 4IWQA 3OVVA 4QTEA 3O7LB 3UZRA 5JRSA 3RKBA 4BCFA 3NW5A 4AZTA 2ITTA 4EBVA 2W1HA 4GG5A 3FKNA 2EWAA 4P90A 5K3YA 4ZSGA 4QMZA 4DH5A 3HMNA 3WOWA 3IW6A 4K2RA 5CF4A 4HGSA 5CASA 5L6OA 4DT8A 1SYKA 3OP5A 4F7LA 3UTOA 4BTFA 4A06A 4JDHA 5LVLA 2UVYA 5C8MA 5I9VA 3IK3A 4FEVA 5FEDA 3KN5A 4K11A 3RWQA 3R9NA 4UY9A 3R7IA 5HG5A 4F65A 4NZWB 3F66A 3ZEWA 1Y57A 2W5HA 2X4ZA 3VUTA 4QYYA 4KBAA 3E92A 4E4MA 3HX4A 2YA9A 1GJOA 5IPJA 4AA4A 3EFKA 1XH9A 3FEGA 3FMKA 3WE8A 1NT2A 2V7AA 4XRJA 3IW7A 3ANRA 3NCGA 3HV7A 3W8LA 3O8UA 2XIYA 5IMXA 2WOTA 2YIYA 5AR2A 2JEDA 3HUBA 4GKIA 3RPOA 4E5WA 1WVWA 5FM3A 4EQCA 3MA6A 5FEEA 4IIRA 2V7OA 5BX0A 4O7YA 3DNDA 5FBOA 3HP5A 4QMMA 4TZRA 3LMIA 2QC6A 3NAXA 4ONAA 5BMMA 3RP9A 4AFJA 2X6EA 4UMTA 3AC2A 2GHLA 4EJ7A 3MPTA 2QOLA 3OOMA 1JSTA 4FKTA 4JLCA 3ZONA 3DK7A 5CEOA 2BKKA 5EI2A 4RWIA 2C6DA 4DEIA 4EYMA 4M12A 3MH2A 1PW2A 4KIKB 2AYPA 3C5IA 2FSTX 4QO9A 3R71A 3W2OA 2UW8A 4G3EA 3CIKA 2F57A 4TW9A 4V04A 2DUVA 2ZDTA 4C62A 4CFMA 5DOSA 3U9CA 4E4XA 4EH2A 4EQMA 2OK1A 4FTLA 5AR3A 3VBVA 4KS7A 1KOBA 3KREA 3EQHA 2ETRA 4JNWA 4O0VA 5EM7A 5FWKK 4BCPA 4LRMA 2QOFA 4FSNA 3EQRA 4JG7A 2JDTA 3S3IA 4MD9E 1Q8WA 3MVLA 3PPJA 2FB8A 3UE4A 5HZNA 1YRPA 3FV8A 2AUHA 4U9AA 2IO6A 4WG4A 2OFVA 3SOAA 4R3CA 5B7VA 2P3GX 4EHGA 2JAMA 3RNIA 2I0YA 3QCXA 4M67A 5EYDA 3DAEA 4TT7A 4ZZMA 3D7TB 2BDFA 4BDJA 2ITPA 3AOXA 3GCPA 5CX9A 4Y83A 4EUTA 2YZLA 4YJVA 1OI9A 4QP4A 4R3PA 4F08A 5E7RA 3F3WA 2ZMDA 4QRCA 4O0YA 4AFEA 2UZLA 4MXXA 4NKSA 2JIUA 4NIFA 3I0QA 2XNPA 1PJKA 4L46A 4FTAA 4ASEA 3ID6C 3JYAA 3F5GA 2X39A 4QYHA 5DGZA 4ZTRA 3MVHA 3ENMA 3V6RA 4DH3A 1GZKA 3GC9A 4I5CA 4RFYA 2IZRA 3VS6A 3GC8A 4RIOA 1KE8A 4IWDA 4FC0A 4JQ7A 5AR8A 2WMBA 2PUPA 2JIIA 2PMIA 2QONA 4MD7E 4R7IA 4BC6A 5E9EA 3SW4A 3I4BA 4MXAA 1W83A 2RG6A 5GNKA 3TNIA 1Q3DA 4B6LA 1UKHA 3R7YA 4D9UA 5M57A 4XG3A 2BRNA 3FMHA 4QQCA 3FPQA 4ZMEA 3ZBXA 3OY3A 3QALE 4MBLA 5LVPA 2BAKA 4J53A 3REPA 2GHMA 4JG6A 2R7BA 3Q9ZA 4I20A 2Z2WA 4XUFA 4CMOA 1JQHA 3TZMA 4FKRA 3TZ7A 3OWKA 4GK2A 4EUUA 2GFCA 4BCMA 2CKPA 4RX8A 3DCVA 4XG8A 4U42A 4EK5A 1SVHA 3W18A 4UALA 4AG8A 3EKNA 2RL5A 3UOJA 3DAJA 2PZPA 2HW6A 2YDJA 3DAKA 4ITJA 3RJCA 4D2PA 3NUAA 3GENA 4FT9A 1BMKA 3DJ6A 3KXZA 3R0TA 3MA3A 3PIYA 3L9PA 5CS6A 4GKHA 5LJJA 4I6HA 4FV8A 2WPAA 4RJ7A 4HNIA 4FGRA 2BTRA 3NDMA 2J9MA 1U54B 4QTBA 3PXQA 1MQBA 3PVUA 4RC4A 3COIA 3OG7A 2QCSA 3C7QA 2WFYA 1J91A 4D1ZA 3KVXA 2PPQA 5CU2A 2PVKA 1H07A 2PVFA 3OWJA 4LUDA 2DWBA 4A9TA 2V62A 4D2VA 3FZOA 3MIAA 3D15A 3WI6A 1APME 1M7NA 2Y4IB 3ZU7A 4EOSA 5AAEA 4LGGA 2JITA 3TNQB 4BTJA 1R0PA 1OZ1A 3P23A 2QU5A 4ORKA 4PMTA 3GVUA 4FV9A 3CLYA 4IAYA 4NU1A 3SV0A 3T3UA 4EHZA 3TNWA 3G33A 3SXFA 5HQ0A 4DFBA 2OF4A 2QG5A 3P08A 4MCVA 3R2BA 2WMSA 3ZCLA 2ERZE 4AT5A 3DA6A 3O8PA 2O0UA 4HGEA 4AE6A 3OCGA 4CYIA 5CEQA 3ENHA 4I92A 5L8LA 4YSMA 5IUHA 4DLJA 5HO7A 2C6MA 2WMUA 2YEXA 2ITOA 3MW1A 1OM1A 2OG8A 2PVMA 3AMAA 3E93A 3R2YA 4GSBA 5CVFA 1IR3A 2CLXA 4BBMA 2QO7A 4CCUA 3FAAA 4F1OA 5A4EA 3U8WA 5IEYA 1RQQA 1IAHA 4NYEA 5GJDA 4M14A 3UO5A 2X9EA 5EYKA 3F5XA 2I0HA 3FL4A 2E9OA 5K0KA 4R3RA 3WARA 3IW4A 1JWHA 4YBKA 4YU2A 3JR1A 3BCEA 3HMOA 4L45A 4OAVB 2BVAA 1JNKA 3RAWA 4RA5A 1PXIA 4RA4A 5HG7A 4OT5A 1H27A 5AV4A 2HAKA 5BVKA 3BX5A 4QP9A 4YJUA 4BDEA 1BI7A 3CCNA 1WBVA 5A3XA 3IDBA 5J7BA 3A7HA 3WIGA 4D58A 1PXKA 3OWLA 4OAUC 3LE6A 5FTGA 3AMYA 1S9IA 3DJ5A 4GCJA 3MH0A 4FZ7A 4KA3A 1DI8A 3MVMA 4CNHA 3FI3A 4FKOA 3QFVA 5JEBA 3GU5A 4K1BA 4PP9A 1OUKA 1Z5MA 3PZHA 3LLAA 3T8OA 4L43A 2VTRA 3QRTA 2WTJA 3QAME 4FV0A 3DXNA 3R00A 4FTUA 2PE2A 4H58A 4BDIA 1YQJA 1XH7A 4D0XA 3HKOA 3O71A 3KRRA 3P78A 4JXFA 2NRUA 4C33A 4CMUA 3QRKA 3WBLA 3NW7A 4LQMA 4IX4A 3SLSA 5BUIA 1XH6A 4YC6A 2WMXA 1YWRA 2ITZA 1ZY4A 4X0MA 3BZ3A 1ZYJA 3UMWA 3GCVA 4DINA 5JMSA 5L8KA 1TVOA 4E5BA 1OIUA 4QMQA 3QTSA 2HW7A 5HVKA 2XRWA 4OTHA 3V5QA 4F9YA 5HVJA 2XKCA 3QX4A 3FXZA 4F0IA 1WBSA 1ZXEA 4BDKA 3DLSA 1V0PA 2QO9A 1YOLA 4Q5EA 4EOMA 4FKVA 3KL8A 3FYJX 4O0TA 3QYWA 4EOJA 1OVEA 5M44A 4YZDA 4FKPA 2B52A 2QOBA 3AG9A 5KNJA 4ZJIA 5DT0A 3A61A 3CQEA 5E8SA 3SRVA 1H08A 3QD0A 4IX3A 3W32A 3EB0A 3G6GA 4FX3A 4ALVA 3PVBA 3ZXTA 1M2QA 3GCUA 4FKQA 5HU3A 3HEGA 4FEQA 3IOPA 1FVVA 4BDFA 3NVKI 1H1PA 3KFAA 3QQLA 1M14A 4BKYA 4RJ4A 4X2NA 3QUEA 3U9NA 2G1TA 5EOBA 3FSKA 4S31A 3GNIB 5HE3A 2QOCA 4F6UA 3AT4A 1H28A 3Q52A 1H0VA 4YZMA 5AFVA 3DB8A 2YCFA 3PY1A 3BI6A 1XO2B 2WNTA 3FXWA 4I6BA 2XEZA 3JS2A 4D4SA 3E7OA 5AV3A 2PE0A 3AGMA 3D2IA 4FV5A 4CG8A 4MNFA 4NL0A 4YZNA 2DS1A 1MP8A 4YC3A 3GOKA 4CFWA 3EN4A 2XKFA 2WTCA 3BGZA 5L6WL 4YNEA 2PZRA 5IUIA 2RFEA 3ZRKA 2HK5A 2XIZA 3FY0A 3G51A 4ID7A 3BYMA 2Z7RA 3R7EA 2Y0AA 3NEWA 5CSPA 3UQGA 2QOIA 4X3JA 2Z8CA 3FLSA 3MDYA 5EHYA 3VN9A 2Y6MA 3VUGA 2PUUA 3PPZA 1PYEA 3BYUA 3KULA 2CCIA 4WNMA 3DFAA 4PNKA 4PPBA 4I23A 4CFNA 3LZBA 3DBQA 5GIOE 2VO7A 3IONA 4XHKB 5FQDC 3SQQA 2YAAA 1IRKA 2BPMA 3NR9A 4NTTA 4ZSEA 4YSJA 4ZSLA 3LMHA 4O0WA 4PL3A 3AD5A 3UODA 3VJNA 4ANQA 1ZMVA 3FQEA 3HV5A 1BL6A 1W0XC 4DGNA 4ENYA 1A48A 1T46A 2FO0A 3SC1A 2OO8X 5CU4A 5M53A 1YXSA 3MESA 4C02A 1YXXA 2XNOA 5AUYA 2X1NA 3HGKA 1GZNA 4OT6A 4U97A 5HE2A 3Q04A 5DI1A 2W17A 1OL7A 2CSNA 1G5SA 2UZVA 3FHRA 3QTXA 4FSYA 2A0CX 2R3PA 4TWCA 4XCUA 4CFXA 5GZAA 1E1VA 5D1JA 5JKGA 4R6VA 3UBDA 3OBGA 4RIWB 4TYJA 1XH8A 2QOKA 3ACKA 3UOKA 3SW7A 3U54A 3D9VA 3FDNA 4KBKA 3D0EA 2GNHA 2QOQA 1VZOA 4O0SA 2BZIB 2I1MA 3Q3BA 4RIXB 4F99A 1WMKA 1IASA 3QKLA 4F7SA 5AP0A 4LV5A 4ZJVA 4DFLA 3PXZA 4TXCA 2Y4PA 5IH6A 1PHKA 2VTOA 3H10A 2V55A 2YM7A 5CQWA 3VUKA 4I94A 4ZMFA 5IMEA 2GS2A 3HUCA 3OF0A 3BBTB 4GJ3A 3R9OA 5G1XA 5KMLA 4FICA 4O1OA 5EHLA 3KVWA 4QMPA 4MQ1A 2R5TA 2VTPA 2W5AA 3U4UA 4FKJA 3FI2A 4ACCA 2OZAB 5AEPA 3U6JA 2O8YA 2GSFA 3FQSA 4DLIA 5GZ9A 1OKVA 4BKJA 2YM8A 5HG9A 3RM6A 4ERKA 5IQGA 3NX8A 5CI6A 3DDQA 4NT4A 1WBWA 3BHVA 1Q99A 3UIUA 4IDVA 4HVGA 4KNBA 5CVGA 1WCCA 5B2MA 1R39A 5KMIA 4KINA 5TF9A 3GXLA 4BGQA 5ACKA 4JBPA 4ACHA 5DT3A 3F7WA 3LFQA 2W7XA 5EM8A 2ZB0A 5J8IA 4QNAA 2XF0A 4Z7GA 3GCQA 4UXQA 4NKAA 2BAJA 3PE2A 4TWPA 5AIKA 2J50A 4FT3A 5EM6A 4FTKA 1RE8A 2ITXA 3LCOA 1J7UA 1OL6A 2J5EA 3AT2A 3LFCA 1PXPA 4YPSA 5HIBA 1WBPA 4FVPA 5I3OA 3R73A 2R3NA 2R64A 2VV9A 4FTNA 3GBZA 5IEXA 5E92A 3VS1A 2JIVA 3BHTA 3HA8A 5C03A 5I9WA 2BKZA 4RVTA 2B9IA 3ZDUA 4NK9A 2Q0NA 2PULA 5EW9A 3HLLA 1G3NA 5F4NA 3QKKA 4PL5A 2FGIA 4WNKA 4AGCA 2H6DA 3KK8A 3LCSA 4C59A 4YUQA 3FI4A 3KMUA 3R1QA 5ANDA 2CGVA 3HZTA 3VS7A 3F88A 5AV2A 4BCQA 3ETAA 2HZ0A 3LXNA 4RRVA 2CJMA 4YJSA 3KXXA 3OW3A 4FIGA 2W0JA 2WXVA 3FZPA 4QP1A 4ZTNA 4OTWA 4FSUA 3NYNA 3WF9A 4UEUA 2VZ6A 4CRLA 4A4OA 5I5ZA 2WAJA 3ERKA 3F3VA 4PDSA 4TTHB 5E8VA 3ORTA 4YNOA 3QD3A 3P86A 4CZYB 4IX5A 5FP6A 2YITA 1H24A 4FUXA 5CSHA 2A2AA 2VWXA 4OW8A 5KHXA 2B4SB 2WQOA 2X8IA 2PZIA 2QOHA 3ORPA 2O2UA 2X7GA 2WKMA 3ORLA 3OWPA 5HCYA 2XZSA 5A4TA 1ZYDA 2YM5A 2RKUA 3C0GA 2X8EA 4DGOA 1NXKA 2G01A 3R9HA 2BTSA 4ZSAA 3CPCA 3I5NA 3BLRA 4JRVA 4L52A 4FA2A 5KMMA 2R3LA 3QD4A 1YHVA 1Y8GA 4RIYA 4GH2A 1ZMUA 3C51A 3G5DA 3COHA 4MK0A 3PSDA 5KZIA 3PG1A 4QTCA 5K4IA 1Q4LA 4AOJA 4ZIMA 3SA0A 1NY3A 2E9UA 2P4IA 3GFWA 1Z57A 3MVJA 3R8MA 2YACA 3UIMA 5I0BA 3G9LX 3H30A 3R8PA 5K9IA 5EDQA 2C5YA 4APPA 2UW4A 2VTHA 5CU0A 5JH6A 4LUEA 4RSSA 5B2KA 3THBA 3LFDA 3BHYA 5DIAA 4WOVA 4GT4A 4DG3E 2IWIA 4LG4A 3QCYA 3DKCA 4EQUA 2QG7A 2P55A 5T6KA 2W1GA 3ZSGA 3D14A 3T9IA 3FL5A 3DTWA 4FNYA 3TTJA 2Z7SA 1FBNA 4XOZA 1RDQE 3ALNA 3EMGA 4UZHA 3COMA 4DG0E 4DGLC 3TDWA 4HZRA 1M52A 4X3FA 3W8QA 4FOBA 3C50A 4CSVA 3LHJA 1LP4A 3QZIA 4FG7A 3LOKA 1GY3A 3AC1A 2W4JA 2XH5A 3KXGA 4FTIA 1UNLA 3QC4A 4O1PA 3QCQA 3BV2A 2J4ZA 3C4ZA 3QZGA 2YCQA 4KIQA 3TDVA 1P4FA 4IZ5A 3B8QA 5AMNA 3RK9A 4DE4A 2QHMA 5CVHA 3MFSA 5C26A 4JL9A 2ACXA 2YHVA 2PTKA 3QXOA 3FPMA 2CCHA 3R1NA 4AT4A 5ANOA 3ZM4A 4A9SA 4ZXTA 2W06A 4ANNA 4ENXA 1OL1A 4XG7A 3P7AA 3FKLA 1JSUA 5DR9A 4BZOA 4XX9A 3P1AA 3MY1A 3CP9A 3MFUA 4WT6A 1OPKA 3K5UA 5EQYA 4PUZA 3R8ZA 5GJGA 3VRZA 3KN6A 2C6IA 5AR4A 2G15A 4YJTA 4DTAA 4A9RA 4WSYA 4PTEA 3MBLA 4E20A 5HIDA 3TACA 2JDVA 1PF8A 3WZEA 1PXNA 3CXWA 4ASXA 2A19B 4YMJA 4TKSA 2QOOA 4UMRA 4YTFA 5C01A 3KF7A 1DAYA 2GPHA 3WZDA 3BE9A 2HZNA 5AUVA 4L9IA 5KMJA 3NYVA 2JFLA 5JT2A 2H9VA 2HELA 2WB8A 3CTHA 4ZEGA 5HTCA 4HNFA 3FLYA 2ZM3A 1V1KA 3EZRA 4U6RA 2O65A 4HGLA 3ZDIA 3RM7A 4OUCA 4DEHA 4BIEA 4IVCA 3RAHA 2JDRA 4RC3A 4LOQA 2XS0A 4QMLA 4D28A 2V5QA 4X7QA 1Q61A 3NUPA 4DA5A 1IG1A 5HVYA 5BUEA 4V0GA 3PJ2A 4MYGA 4IAFA 3F82A 2XVDA 5BMSA 4A9YA 4IWOA 5EH0A 2OH4A 4D1SA 1WAKA 3FZ1A 2VTSA 3TZ8A 3V5PA 1MQ4A 3CTJA 3ZYAA 4RG0A 3E62A 2I0EA 4TNBA 1FPUA 3UYTA 3VO3A 5J5TA 5BPYA 2WD1A 2A1AB 5CF6A 3LKMA 2C5XA 4JR3A 5C9CA 3VQHA 4IJ9A 4DTKA 5CAQA 4NUSA 4DBNA 4I5PA 5AAFA 3ELJA 5FXRA 4DC2A 1WBNA 3KB7A 4XP2A 4ZY4A 3O0GA 5KMNA 3EN6A 2WTVA 5AADA 3TEIA 4DHFA 1O6LA 4GVAA 3JVRA 3IG7A 3DQWA 1KWPA 5AP1A 3SXRA 2C68A 3Q2JA 4I93A 4G3DA 4EWHA 3FLNC 4EK3A 4O7NA 4AP7A 3OUNB 3DPKA 5E90A 2WTKB 3FZRA 3CJFA 4EKKA 2VRXA 4M97A 2YIWA 3TI1A 1OIQA 3KY2A 5HX6A 3LLTA 4KIPA 4YJNA 4CKIA 4LMNA 2OH0E 4CZUA 1ZAOA 2OBJA 2R3IA 3BBWA 3QTRA 4N70A 3DJ7A 5HE1A 4BGGA 2EXMA 4OBOA 3AXWA 1YXTA 3IQ7A 4IBMA 4G31A 4V01A 4YLJA 4APCA 1FMOE 2WU7A 4XJ0A 4YO6A 3DTCA 4C2WA 4E5AX 1Q3WA 2Z60A 5AUWA 4AN9A 1PXLA 2BHEA 4UYNA 1BKXA 4GU9A 2JDOA 2R3FA 2SRCA 3D4QA 4IJPA 4Z9LA 4BVUA 1YDTE 4EZ3A 2RFSA 3E63A 5DR6A 1I09A 5JZNA 2W1FA 4WBBB 4UMPA 4Z16A 4FV1A 4C8BA 5HESA 3AC4A 4WBOA 4DEEA 3NUXA 4QPAA 5AAGA 2CLQA 1H25A 2IVTA 5EHOA 4L53A 4WUNA 3ZSHA 3PXYA 1GIIA 2IW8A 5J9LA 3BEAA 3VVHA 4KKHA 4AW0A 5BNJA 4U43A 4UMQA 4XG6A 4KB8A 3CBLA 1MRVA 2UW9A 1ZWSA 3ZTXA 2QODA 4YTHA 4IVBA 3VULA 1W84A 2JGZA 3E8EA 3KCFA 3UOLA 4ERWA 1YKRA 5CQUA 1OB3A 1J1CA 4FNXA 4NCTA 4UWYA 3PY3A 2ZM4A 3HMPA 3ALOA 5E8XA 4G3CA 5LCKA 4PMPA 4CG9A 3QQJA 4IEBA 4BI0A 3PXRA 3MTLA 2IG7A 3K3JA 3U6IA 5AM6A 3PFQA 4EONA 3A7JA 2RF9A 3KRWA 1NVQA 4YZBA 3C4CA 3WYXA 4X21A 5J95A 4UBAA 5IZFA 1JKTA 4O7ZA 2VTJA 2YIRA 3FZSA 3DU8A 4NJ3A 2WQEA 4JJRA 2PK9A 3Q60A 4USEA 1UV5A 2BIYA 2OJJA 2Y7JA 3VQUA 5E91A 4JBVA 3ORNA 3EN9A 4E26A 5L8JA 2GNLA 4FR4A 3VHEA 2OJGA 3DV3A 5CEMA 2VX3A 5AA9A 5KUPA 1ZARA 2CNVA 3S00A 5CT7A 3G9NA 5DPVA 4FTQA 4RZVA 3VW6A 3V5TA 5EFQA 3C0IA 1YI6A 3ITZA 2FYSA 3FI8A 4F9AA 3BWJA 2V22A 3PRIA 2BDJA 5DRBA 5J1WA 1ERKA 4TPTA 4RBLA 5HLPA 3G2FA 4L00A 3GQLA 5ANIA 3CR0A 2UW6A 5TKDA 4PY1A 4BDAA 4Y5HA 4JX7A 2C47A 2GQGA 1BYGA 3HYHA 3DS6A 3R30A 1J1BA 2XKEA 3VUMA 5I9YA 3U55A 4FEUA 2BILB 4C2VA 3W33A 2BR1A 2GU8A 3W2SA 1YXVA 4RX9A 3QQHA 5FM2A 3VWAA 5DMZA 4CCBA 2X2MA 4RJ6A 4G6NA 1WBOA 3ZO3A 2J0MB 2PVLA 4CV9A 2BMCA 4QP6A 4WIHA 3PWDA 3PJCA 4O96A 3EZVA 4I4FA 1ZLTA 2VTQA 1XJDA 2XYNA 4QMVA 5AJQA 2ONLC 4ZJJA 2VX0A 4BYIA 2XK3A 4AA0A 4NWMA 4M68A 3V8TA 1O6KA 3ZLWA 4GT5A 5A6OA 4PDPA 3ROCA 2X2KA 4E4LA 4YURA 4IM2A 4IZ7A 3DKOA 1PXOA 2Z7LA 2W1EA 2YWPA 4V05A 1W7HA 3A7FA 1JBPE 5I3RA 2XYUA 3EYGA 2UW0A 4U8ZA 1YI3A 4W9XA 2HY0A 3SG8A 3H3CA 2CKOA 5E8TA 2J0LA 4FYNA 3QBNA 1U4DA 3Q32A 3ZBFA 4ZAUA 5EI6A 5HNIX 4YHTA 5LXMA 3EQIA 3OEFX 2BZHB 4BCKA 4RT7A 4IAKA 4WA9A 2F4JA 3UC3A 3V5LA 2XK6A 4WUAA 4AT3A 1U46A 4F9WA 3L1SA 3O96A 4RQKA 5A14A 2JKKA 3AC8A 4W8EA 4KBCA 2XUUA 3BQCA 4CKRA 3F9NA 3G0FA 3I5ZA 4AZVA 2X81A 4FSZA 3HV4A 4F6SA 1JVPP 2GTMA 3PXFA 3IS5A 2WIHA 3FLWA 3V3VA 1H26A 4N6ZA 3PG3A 3HRBA 5DRDA 4MX9A 3RK5A 4BCOA 1RW8A 4JS8A 2EB3A 4ZSJA 5TE0A 4HPUE 5DG5A 1DM2A 1ZZ2A 1H1RA 2HXQA 2UZBA 3FHIA 4WSQA 5KBQA 4C4IA 3QWJA 3I79A 4C36A 4DF3A 2OXXA 1TKIA 2YJSA 5ANJA 5E1EA 4OTIA 5IEVA 3UNKA 4R7HA 4I4EA 4QP2A 4L42A 3HV3A 4D55A 5IG1A 2VTMA 4Y72A 3F69A 3IW8A 4A7CA 4BWKA 2YDKA 1SVEA 5CNNA 4Q5HA 3GP0A 3CGOA 2XB7A 5CXHA 4BCIA 2F49A 3KF4A 2BFYA 4RC2A 1CSNA 4BF2A 3MFRA 3ZO4A 2YCSA 4G3FA 3R6XA 4NIFB 2PY3A 3GGFA 4IAAA 3MB7A 4LOOA 4M69A 4MXZA 4QMOA 4F6WA 2WTKC 1ZYLA 3P79A 4L3PA 4RJ5A 4B8LA 5BVEA 4X3FC 3JPVA 4IW0A 5IA1A 3OS3A 4FTMA 5EYMA 5TOZA 4O7WA 3PLAE 2YFXA 2ITWA 2VN9A 4PP7A 2BRMA 5TR6A 5AR5A 2RFNA 4DCEA 3QUDA 1UA2A 3D5XA 2XP2A 3NNVA 4K77A 3OC1A 5HIEA 5LMKC 5IISA 2YERA 3OZ6A 3QTWA 4LGHA 2BUJA 4ZZNA 4YLLA 5F1ZA 3ZM9A 2FUMA 4ZTMA 3RNYA 4QMWA 1K2PA 2C30A 5HNGA 3JY9A 3HAVA 4JDIA 4TWOA 4BDBA 4Y73A 4RWJA 2IJMA 4EKLA 2IVVA 3PA5A 4XV3A 4AZFA 4O0UA 4YGAA 1ZOGA 4G5PA 4BDGA 2OJFE 4UYAA 3EL7A 2AC5A 2OF2A 5AIRA 5CF8A 2HZ4A 2CNUA 3MFTA 1TQMA 4FSRA 4XOYA 4XG4A 4HW7A 3S0OA 3VS2A 3O17A 5I4NA 5AUZA 3RPYA 5CSWA 3UVRA 1F5QA 1SNUA 3D2KA 3R63A 3Q96A 3GCSA 2BRGA 1XR1A 4MHAA 3V5WA 4AZSA 2VWZA 1BI8A 4C4GA 5IH5A 3I7CA 4WO5A 4IXPA 3EH9A 4L67A 5FTQA 5LARA 2R3QA 4EWQA 5B2LA 3R8LA 3C1XA 2JD5A 4AN2A 4AW1A 3C4FA 4FTOA 2VO6A 5HE0A 4WG5A 3ORIA 3TIYA 2WZJA 3SKCA 4DEAA 4I3ZA 3ZRMA 3FXXA 2C69A 3QTIA 3E88A 3C4WA 3WZJA 3R7GA 4AUAA 3MJ2A 2YM6A 3R7UA 4L68A 2OI4X 2GHGA 4HVDA 1CKJA 3OXIA 3LXLA 2B9HA 4HCTA 3MYGA 3Q5IA 1PMNA 2EVAA 3EQCA 3HVCA 4ZK5A 4E73A 4CYJA 4DN5A 3B8RA 1OECA 5HNBA 3BELA 4RFZA 4F63A 4AOTA 4R5SA 2PVJA 2YLEA 5BVWA 3NUNA 3KRLA 4MVFA 4C3FA 4FIJA 3VBTA 2JBOA 4F1TA 4AU8A 3SXSA 4G9CA 5FBNC 3S2PA 3MPAA 4BIBA 4S34A 1NW1A 2OICA 2Y8OA 5DA3A 2OWBA 2WO6A 4NM7A 3VBXA 5IQDA 2ITYA 3PE1A 5CENA 4G6OA 4I5MA 2UZWE 3SGCA 5AP4A 3NUSA 4GW8A 5CTPA 3Q9YA 5FEQA 5FP5A 2CGWA 1YW2A 1J3HA 1FMKA 2VGOA 4AS0A 5HO6A 1QPEA 2BHHA 5IQFA 3OFMA 4RVMA 4O2ZA 3B2TA 3ZZWA 3KMWA 3OT8A 5EOLA 2QU6A 5CYIA 4YR8A 3L9MA 3MN3A 3LFNA 5IQHA 3TT0A 2CKQA 1PRYA 3O51A 1QMZA 3LCKA 4P4CA 4W9WA 2EB2A 5DFPA 5HICA 2QI8A 3VS5A 2O3PA 3OROA 3F7ZA 4EH4A 5JK3A 5DEYA 4O0XA 4DGGA 5CF5A 3K2LA 5HBHA 5I9ZA 1UWJA 3K5VA 4HPTE 3K3IA 3UVPA 3ZEPA 5A4CA 2W05A 4WHZA 2FVDA 3I81A 1H1WA 1J7LA 1Q62A 2ZM1A 4GFMA 2HZIA 3UC4A 4FEWA 5TT7A 4B0GA 1REJA 2IW9A 1WVXA 3MB6A 4XYFA 4YHJA 2GMXA 4GK3A 4PNIA 4BI2A 5JFSA 2PYWA 1JPAA 2ZV9A 2BROA 1E1XA 3HMIA 4RJ8A 2R2PA 2VWIA 3AT3A 3COKA 4QP3A 2HXLA 2WEIA 5L2QA 3EQGA 3PLSA 4OLIA 5H9BA 4PL4A 2GFSA 4BI1A 2XJ2A 5DE2A 4DFZE 4YZCA 2OJ9A 4RQVA 4EC8A 3C0HA 2YM3A 2W4OA 4FKUA 4JG8A 3ZO1A 4DH1A 4FVRA 4E3CA 2JKOA 3UIBA 3BU5A 4NCTC 4D5KA 3BHUA 1L3RE 3NNUA 2VD5A 1Q5KA 4FZDB 4JAJA 5ANGA 5HI2A 2W96B 4EH3A 5JFXA 4KRDA 4NTSA 2GTNA 3POZA 5CEKA 1H0WA 4RPVA 1XBAA 3PRFA 3TN8A 3QUPA 3OTVA 4U80A 4PMMA 4RJ3A 3FSFA 3C4XA 1S9JA 3QC9A 1DI9A 4U3YA 2R9SA 4WNPA 4XBRA 2ZJWA 4G34A 4AW2A 5M07A 3DBFA 1IAJA 3A7GA 5E8YA 3VIDA 4JDJA 4ANLA 2ZDUA 5AV1A 3UJGA 3WF5A 4MAOA 2GNGA 3PZEA 1YHSA 2Q0BA 5KKRC 3SRVB 3GU4A 2RGPA 4ITHA 4NEUA 1I44A 3R8VA 4KKGA 3N4UA 4CT1A 5GJFA 2R0UA 5IA5A 4K33A 3V51A 3FY2A 4E93A 3CSVA 4O7TA 4O7VA 2H96A 2VTTA 5CT0A 3ZFMA 4O91A 5A6NA 3C5UA 4F9CA 5D10A 4O22A 4EOIA 4FIIA 2ETMA 3PJ1A 4IVAA 1K3AA 5EW3A 2E9PA 5FG8A 1V0BA 2R4BA 3HDMA 5BYZA 2B9JA 3TKIA 3EJ1A 5TO8A 1LUFA 2R3RA 3SX9A 1DS5A 4AA5A 3HDNA 3NWWA 4AGWA 3CD8A 4F1MA 1OPJA 5L2IA 3DBDA 4LGDA 5HKMA 4F64A 1XWSA 3QHWA 2VWVA 4G17A 3LVPA 2RFDA 4M3QA 4NFMA 3U4WA 5J87A 1QL6A 3V04A 4C38A 1KE6A 3O8TA 4C7TA 5DEWA 5BVNA 1ZYSA 2VNWA 2UW5A 2QQ7A 4P5QA 2DQ7X 3TWJA 3VS3A 3ZO2A 4AZWA 5CEPA 3KQ7A 4FV4A 3VBWA 1VYWA 5IH4A 1MUOA 1XH5A 2C5NA 4WKQA 4X2GA 1ZZLA 3KA0A 3QGWA 4JOAA 2B9FA 3W16A 3PSCA 5F20A 1SM2A 2BCJA 1LPUA 4O6LA 4FV2A 4BN1A 4EEVA 4CLIA 2GQRA 1HCLA 3TCPA 3KULB 2X4FA 5BVFA 4MXOA 3EHAA 3UPZA 4E6CA 5HTIA 2GCDA 2HYYA 3IOKA 4AZEA 3F6XA 2HY81 4EBWA 3MTFA 2FH9A 4L6QA 5KMOA 3C13A 2R3HA 3KRXA 4FTTA 4J8MA 2XRUA 4QMUA 1IEPA 5HCZA 3ATSA 5M08A 2G2IA 5KX8A 2OXYA 2XMYA 4M13A 2CKEA 1W8CA 4KWPA 3MV5A 3VRYA 5LCJA 2WMTA 2UUEA 2J90A 4FODA 4OTDA 4PF4A 4W4WA 4W4YA 5CSXA 3WZUA 4WD5A 1PKDA 4EK6A 5AP2A 2E9VA 4YJQA 4F0FA 4IE9A 1YDRE 2GS7A 3EQFA 3NNXA 4I0TA 4RGJA 4YO4A 4IADA 4DFUA 3LJ0A 3BGQA 4BBFA 2PZ5A 3DNEA 3VS0A 4G1WA 4U45A 4C4FA 3JY0A 4UMUA 5J9YA 3VUIA 2VAGA 4TYHA 5EQEA 2RIOA 4GYIA 2KULA 5F95A 1WVYA 4JBOA 4ANOA 2ITUA 3I60A 5E8ZA 4FGBA 5E8UA 2F7ZE 2ZV2A 5LMAA 3A8WA 2ZB1A 3R7OA 4NJDA 2C6TA 1YDSE 5EKNA 2W9FB 3EYHA 5CZIA 3CQUA 4NM3A 2C6LA 4IANA 4UWCA 3ZLYA 3V8WA 3IGOA 4J97A 4FT0A 4MH7A 1BX6A 2UZEA 4EYJA 3UO6A 2C0IA 2PUNA 3DZQA 3EQDA 4FV3A 2XEYA 4ZTHA 1PKGA 3SG9A 4G9RA 4ZS0A 3DGKA 3UO4A 3BQRA 3MGYA 4XLVA 4J96A 2UZDA 1UNGA 3E87A 5B0XA 2HWPA 4GU6A 1ZY5A 4JAIA 3QTQA 1YOJA 4WNOA 3ZLSA 3AD4A 4U5JA 3POOA 4I24A 2FSLX 2WMQA 3ZXZA 3UG2A 4ANSA 4EJNA 3H9RA 5AA8A 5FDPA 2CN5A 3CGFA 3OOGA 4Y85A 4AX8A 4CVAA 2Y9QA 2CN8A 1FOTA 5IF1A 1AD5A 4CXAA 3F5PA 2XJ1A 4B9DA 3ULZA 3ODYX 3Q53A 4G6LA 4CFFA 4R5YA 2YM4A 3D5WA 2EXCX 3GC7A 3PIZA 4O38A 3Q6WA 1XHAA 3MY0A 4E7WA 3LFSA 5K5XA 4AE9A 4CMTA 4BZNA 3TL8A 4BHNA 3D5UA 2V0DA 3VBYA 4TWNA 3TJDA 2XNMA 3LAUA 4D4VA 2GNFA 2JKMA 3UMXA 2WU6A 3T3VA 4YTCA 3QZFA 3NNWA 5CNOA 3PWYA 4K9YA 2JKQA 4FKSA 2BRBA 5HOAA 3OXZA 3G0EA 3EN7A 3CJGA 1KV1A 1STCE 3F3ZA 4JRNA 2OIQA 3IO7A 1YI4A 1FQ1B 4L44A 3W2CA 1FGIA 3GU6A 4HGTA 1PXMA 2F7XE 5FGKA 5CEIA 4FT7A 4MNEA 3KKVA 5HG8A 4ZLYA 1JAMA 3TNPC 4AN3A 4LL5A 3VC4A 2I0VA 3GQIA 4O27B 4H36A 3U6HA 4ACMA 3KXHA 4D9TA 5EYCA 2A27A 3D83A 4EOOA 3DT1A 1B6CB 4X2FA 2ESMA 2ITQA 4YPDA 2VX1A 5IUGA 2VGPA 3DBEA 4NFNA 4DEBA 2EUFB 3M11A 4EHVA 1KE9A 1YOMA 2QD9A 5CAPA 4AOIA 3PXKA 4S33A 2QO2A 5KBRA 4HZSA 3R9RA 4QQJA 3RCDA 5K5NA 2C6OA 3WE4A 3MPMA 4FEXA 4ZTSA 3ZFYA 1Q8TA 3A4PA 1B38A 3BYSA 3E7VA 2BRHA 3HRFA 3CKXA 3UQCA 2PUIA 5T68A 2I40A 4U41A 5HD7A 5DYJA 4CD0A 1PXJA 4C4JA 2YIXA 1VEBA 4EZ5A 2WHBA 4QPMA 3SVVA 5CI7A 4YJPA 2WQNA 4E1ZA 3H4JA 4YBJA 3FZTA 2OFUA 3NGAA 4U40A 3I1AA 5AP3A 5EKOA 3W55A 2NO3A 5CALA 2XA4A 4RIYB 1G8SA 3P7BA 3TIZA 3ODZX 2QKRA 5M4FA 3QTUA 4A9UA 5K0XA 1OIYA 2CGXA 1QCFA 4BDDA 4EOKA 1P2AA 3GC0A 3A99A 4I21A 4RVKA 4U44A 3FMJA 2J5FA 4R78A 5L2TA 3GFEA 4Y46A 5E4HA 4GEOA 3L8VA 3ROYA 2C4GA 3QKMA 3EIDA 1GIHA 5H8GA 4MEDA 4KUJA 2P2IA 4O83A 2E2BA 4B4LA 2GNJA 3O2MA 4N57A 4WRSA 3A2CA 4KIKA 2FA2A 4L3LA 4K0YA 5G6VA 5KCVA 5HU9A 4IZAA 3QYZA 2ETKA 3FLQA 3KRJA 5IA4A 2BDWA 2WMAA 3E3BX 3GUBA 5FXSA 2R3KA 1UVRA 2JDSA 5IQAA 4QYEA 3VF8A 4X3FB 5AX3A 3WIKA 2HOGA 5JN2A 3TZ9A 1DAWA 2XM8A 3Q4TA 4IM3A 4XLIA
chains in the Genus database with same CATH superfamily
1Q97A 1R0EA 4GIHA 2OW3A 1FINA 4L01A 2BALA 2PVNA 2RG5A 4ZOGA 4I41A 3UDBA 4D2RA 4EH5A 3VJOA 2P2HA 1KE5A 1VR2A 3GI3A 4K8AA 1GZ8A 3ZS5A 5C4LA 1JSVA 4HJOA 4XG2A 4F7NA 3ZRLA 4FK6A 1YXUA 3H9FA 3BE2A 4TYEA 3R7VA 1OL2A 4F09A 5I9XA 3NVMB 2W1IA 3D7TA 1W2DA 3SHEA 1LEZA 3Q6UA 3PVGA 4L8MA 3ZC6A 3OD6X 3TKHA 5KHWA 1GOLA 1PYXA 3CE3A 4M0ZA 4M84A 5M4CA 4PMSA 4F78A 4BYJA 3LXKA 1SNXA 4TN6A 4IB1A 4RFMA 4Z55A 4C58A 3EQPA 4EH9A 3LIJA 4I6FA 2EXEA 4S32A 4O84A 1FVRA 4IB3A 1ZRZA 3D94A 3UZPA 4IC7A 3UVQA 4N0SA 2C1AA 2JAVA 5J79A 2OXDA 1A06A 2WQMA 2QVSE 4D5HA 5LVMA 4O81A 4MWHA 3TV6A 4M0YA 4ZTLA 3RWPA 3TJCA 1O6YA 4EORA 3EN5A 3HL7A 3HP2A 4E6AA 2PWLA 4H1MA 3R8UA 1R78A 1KV2A 3GB2A 4EH7A 2B53A 3WYYA 2VWWA 3CS9A 4GRBA 3QRIA 4N4SA 4AXAA 5BYYA 4O86A 3EFJA 4V0GB 4EI4A 4FL2A 3VW8A 3ANQA 1LEWA 3LCTA 3K54A 3TG1A 4XV1A 3ZLXA 4F70A 2X8DA 4N6YA 3L8SA 3CQWA 3QXPA 4R7BA 1CTPE 2GNIA 3QQKA 4G16A 5HGIA 3ORXA 4IFCA 5HLNA 4XV9A 2CGUA 2IZUA 4FT5A 2QKWB 5JSMA 1GAGA 3ZHPC 3E8DA 3RVGA 3WF8A 3CEKA 3HNGA 4F4PA 5HBJA 4C57A 3DK6A 4I5HA 1PMEA 4XG9A 2IZTA 5LVOA 4S2ZA 4GFGA 2VTLA 3OUKA 5DVRA 5AR7A 2WGJA 3TXOA 2JLDA 2XK9A 1WFCA 3LFEA 3QU0A 4I6LA 4OBQA 3DDPA 3P9JA 3PUPA 5I9UA 4X2KA 4OTGA 3TM0A 2IVSA 2H8HA 2UW3A 5M56A 3EWHA 4BL1A 4DBXA 3QLGA 1R3CA 4FBXA 4G2FA 4HCVA 1U54A 1GZOA 1PMUA 2FSOX 3PFYA 5GIPE 3GU7A 2W1DA 4JDKA 3R83A 5JGAA 4QPSA 2W1CA 2B54A 5ETCA 2BFXA 5C8KA 1B39A 5JFVA 1BUHA 2UVXA 4CZTA 2WOUA 4OTQA 2ZV7A 2X7OA 1XKKA 4FNWA 3RAKA 1F0QA 4XP3A 4FI1A 4OGRA 4RZWA 5AUUA 1ST0A 4GIIA 2VNYA 3BPRA 3S95A 3TUCA 3FMMA 1A9UA 1UU8A 3I7BA 3MH3A 2XK8A 4GS6A 4EL9A 4KIOA 3NLBA 3MIYA 3RI1A 1M7QA 3HRCA 3T9TA 2X0PA 3NUYA 1E9HA 3CC6A 4I22A 3RPSA 3RK7A 3QA0A 1WZYA 1TQIA 4QMNA 3HV6A 4FV7A 5JQ5A 2C3KA 3TV7A 4KSQA 5CY3A 2CNQA 5EK7A 4JT3A 4RX7A 1AGWA 2C0TA 2LGCA 5J5SA 2O63A 4BHZA 4UB7A 2QR7A 2Q83A 3AQVA 3W0MA 4J8NA 3TKUA 3BIZA 3FLZA 5KE0A 3PYYA 1P5EA 3ZZEA 2OLCA 1CKPA 4II5A 3RHKA 2B55A 5CANA 1UNHA 3LQ5A 2ZMCA 4M66A 3PDTA 4OBPA 2WTIA 5J7HA 4RWKA 4DEGA 4MKCA 4ANBA 1JKLA 2CPKE 3E5AA 2UZNA 3PP1A 4FIFA 3UOHA 2VWYA 1UU7A 4ALUA 3A60A 4ARKA 4TL0A 3DKGA 5A9UA 3H0ZA 4Z7HA 3GEQA 4W4XA 1Y91A 1OPLA 3EQBA 4AW5A 3RPVA 3U87A 1OGUA 5DBXA 1XBCA 1ZOHA 2JC6A 4XEYA 4ZZOA 3DOGA 5IDNA 3SDJA 4U81A 4CEGA 3GU8A 4GVJA 2X9FA 4LV8A 4RVLA 3VAPA 2B1PA 4HVSA 4MUQA 4BJJA 5D7AA 4LL0A 4A4XA 2OZOA 3Q4ZA 4FSTA 1YWVA 4AGUA 4KSPA 5KMKA 5GHVA 3M2WA 4C0TA 3PVWA 5ITAA 4NW6A 2JBPA 4O7LA 4JBQA 5KKRB 4L3JA 2B7AA 3EFWA 3PPKA 4NW5A 5C1QB 4C4EA 2VUWA 1XMMA 2UZUE 2F9GA 4ALWA 3NS9A 3NW6A 4IMYA 5J9ZA 3F2AA 2JFMA 3MJ1A 4FZAB 5CU6A 2OSCA 3BU3A 2XBJA 1OKYA 3KK9A 3MS9A 3RTPA 1QPCA 2C3IB 3LCDA 4EOQA 4IAIA 3JVSA 2EU9A 3DXPA 2OIDA 2PHKA 4ITIA 2PVRA 2VTIA 4DH7A 3IECA 1OIRA 4CQEA 1YWNA 3DBCA 4HYIA 4PRJA 2GS6A 2X2LA 5T3QA 5IDPA 4LYNA 2PL0A 4HYUA 1P14A 3EKKA 3C9WA 4X2JA 3RHXA 2CHLA 4XH6A 3RZBA 2YWVA 4LRKA 2REIA 3R02A 3EL8A 4PPCA 4R8QA 3KCKA 4QMSA 2XCKA 1REKA 3JUHA 1MRUA 4XV2A 4NM5A 4JMQA 3O50A 1EH4A 5FLFA 5L2WA 4OR5A 1ND4A 3EOCA 3E3PA 3L8PA 3LPBA 5EG3A 2ZAZA 4PWNA 3W2QA 2OJIA 4DFXE 2HCKA 3A62A 3OW4A 4JQ8A 4BTMA 1OBDA 4ZY5A 1L8TA 4QOXA 3ML1A 2YZAA 3H0YA 3O7LD 4MWIA 5E1SA 4NSTA 4UWBA 1SMHA 4GYGA 2P33A 3MWUA 3PA4A 5CU3A 2J2IB 4GV1A 2C3JA 2KTYA 4HYHA 4S30A 4U79A 5IA0A 5EM5A 5HO8A 4PDYA 5F94A 3LFBA 5HORA 4QNYA 3Q4CA 4CTCA 1AQ1A 5GZ8A 5IQIA 3G6HA 2OKRA 5AP6A 3QLFA 2HENA 5DNRA 4J98A 3OEZA 4AF3A 4UV0A 2ZOQA 4YJRA 4BY9E 4BDHA 5L3AA 2PSQA 2ITVA 5AM7A 3N51A 3DLZA 3UDTA 2UV2A 3PTGA 3P7CA 4YZ9A 3OY1A 2XNEA 3BYVA 5AP7A 4CLJA 3FMLA 5IU2A 4QTDA 4ACGA 2XM9A 3TUDA 3QQFA 3E64A 5FUTA 4BRXA 1YVJA 3KXNA 4GMYA 2VU3A 3PSBA 4GJ2A 2YABA 1LR4A 4QMTA 4IVDA 2W9ZB 1Q41A 3OXTA 1W98A 2QHNA 3WF6A 3CY2A 4PV0A 4C37A 3PA3A 2UVZA 4FKGA 4LI5A 3BWFA 3ZUTA 1T45A 3IW5A 3VUDA 2BAQA 2XIXA 5A4QA 4E6DA 1FVTA 4QMXA 4FTCA 2G9XA 4X6QC 4J1RA 4FVQA 4MD8E 4HVIA 3UQFA 3N4VA 1Q24A 1VJYA 4XMOA 2PVHA 4ZLZA 2X6DA 5A46A 4PQNA 5HHWA 5IA2A 4J7BA 3ET7A 2X7FA 1XQZA 3ZUVA 5JRQA 3VF9A 4DAWA 4QT1A 2C5VA 5AP5A 3FMDA 3FMNA 3ORMA 5CZHA 4QD6A 5CAOA 4Y95A 3UIXA 4O82A 4DT9A 5F9EA 5ACBC 3NYOA 2NRYA 5DT4A 5LMBA 3F3UA 3IDCA 5M09A 5FXQA 1KSWA 3LQ8A 2XIRA 2C3LA 4YTIA 1QPJA 2LAVA 5JZJA 4QEBA 1CDKA 3RMFA 2XNGA 4CRSA 3RCJA 1IA8A 4BGHA 4BKZA 5JGDA 4AAAA 3BV3A 2F2CB 1U5QA 4J95A 5BQ0A 4IACA 4D4YA 3V5JA 4IHPA 3VBQA 4RIWA 3ORZA 4M69B 1R1WA 2VWUA 5CXZA 4ZP5A 4F9BA 3DXQA 3BKBA 4U3ZA 2DYLA 3R1SA 4GK4A 2Z7QA 3QRUA 4RIXA 3UZTA 3AC5A 3R22A 2W99B 3MI9A 3CKWA 4KABA 5HTBA 4BZDA 4IB0A 1KUTA 2YLFA 4L7SA 2C0OA 3QA8A 4DTBA 1Y6BA 4QDEA 5ANEA 3AKKA 3QGYA 4C3PA 1HCKA 1M2RA 4HVHA 2J0IA 1O9UA 1U59A 2PVYA 4EH8A 3OCBA 2ZYBA 3DQXA 1GNGA 2OZAA 3FYKX 2UW7A 3I6UA 3SOCA 4BB4A 5CSVA 1Y8YA 5A4LA 2R3OA 4FTRA 4Q2AA 4UN0C 4R77A 4MQ2A 4EC9A 2R0IA 4AWIA 4O21A 3QZHA 2J0JA 4MF1A 1SVGA 4WRGA 3WF7A 2XJ0A 3CTQA 5IQBA 2OGVA 5AUTA 1H1QA 1H4LA 3EFLA 3CPBA 4EHEA 4K6ZA 1G8JA 2E9NA 4PX6A 4Q9ZA 5H8EA 4D0WA 4XNEA 3NCZA 4FIEA 2HWOA 3QL8A 4E6QA 4LDTA 2WMVA 1OKZA 4GUEA 4L7FA 3KEXA 5D9HA 3II5A 3ZOSA 5FD2A 3S4QA 1JOWB 3NRMA 3L9NA 1K9AA 4B99A 4BCHA 1X8BA 5M4IA 3NIEA 5H8BA 1H1SA 3KMMA 3OMVA 4OTPA 1FGKA 4O6EA 1NVRA 4JIKA 3AC3A 5CAUA 1UU3A 5LWMA 4USFA 4AXCA 3ZC5A 5DLSA 3V01A 3ZSIA 5HBEA 2YJRA 2RSVA 4F7JA 4E4NA 4BWPA 2G2HA 3C4EA 4QQTA 3MH1A 4KRCA 1V0OA 2I7QA 4IAZA 1MRYA 5KZ0A 4EK4A 4C61A 3DKFA 5EW8A 4D4RA 5E8WA 4YJOA 4FZ6A 1JLUE 4B7TA 3KXMA 3QQGA 2IZSA 3NPCA 2C5OA 4FZFB 2XNBA 1HOWA 2J6MA 3CY3A 1BLXA 3HMMA 4DEDA 5ETFA 4RX5A 4G3GA 3BEGA 3DB6A 4U0IA 3KIOC 1J7IA 1M17A 2C1BA 1IA9A 3QRJA 4QP8A 4LRJA 3JXWA 1P4OA 4FL1A 3BRBA 5HEZA 1CMKE 2WQBA 4DHIB 3Q4UA 3V6SA 2BZKB 4IWPA 4QYFA 5DWRA 3OHTA 4EOLA 3UYSA 3LFFA 1Q8ZA 2R3MA 4IB5A 4CT2A 4IZYA 3VUHA 2WELA 3P4KA 2W1ZA 3AMBA 4HOKA 3TV4A 3I6WA 3U51A 3RBWA 4AACA 3IDPA 4ZTQA 2R7IA 4E8AA 1NVSA 5EDPA 3DFCB 3NAYA 4GG7A 4QYGA 2XKDA 2OIBA 3PJ3A 3PY0A 4LFIA 2QR8A 5ICPA 2NPQA 4YP8A 3BYOA 4QTAA 2Y4IC 1H00A 2ZVAA 3DZOA 3DK3A 3GT8A 3NUUA 3LJ1A 5ETAA 3W10A 4FUYA 3BU6A 3LJ2A 4PTGA 3OTUA 3BLHA 2WEVA 4CFVA 3NYXA 3FC1X 4IFGA 5GINE 1W2FA 3LM0A 3QCSA 4JQEA 5AX9A 3BLQA 1OBGA 4DGMA 3FUPA 3A7IA 3VNTA 4TNDA 4PTCA 5JFWA 4O0RA 2BZJA 3VS4A 3QWKA 4CTBA 3G15A 3NSZA 3R04A 5D41A 1VYZA 4D1XA 3F5UA 5L6PA 3IPHA 3RGFA 3H9OA 3SAYA 4FNZA 4FE2A 3ZMMA 4HYSA 5BUJA 5H3QA 4FYOA 3WZKA 4IC8A 4P7EA 1XBBA 4J52A 3UP7A 4CV8A 3UP2A 2GQSA 1U5RA 1CM8A 4H1JA 3ZUUA 3FKOA 2IVUA 4FKWA 4A07A 3OT3A 1QPDA 2W4KA 3UDZA 3E8CA 2X0GA 3NZ0A 3UGCA 4MF0A 4QMYA 4FK3A 4WG3A 4PDOA 2AQXA 2XCHA 4MTAA 2YAKA 2XNNA 4FSWA 4B8MA 2WMRA 4M15A 5FDXA 2A4LA 4EZ7A 3BGPA 4H3QA 1NA7A 4ACDA 2J7TA 4DITA 1JKKA 2ONLA 5FTOA 3Q9XA 1F3MC 1Q8UA 4RLLA 3RAIA 3UNJA 3S1HA 4OTRA 3QF9A 4D2WA 2PMOX 1M2PA 1OUYA 4J99A 4Y5QA 4MXYA 2R3JA 3HA6A 5AWMA 3FWQA 3KU2A 3OCSA 3F3TA 4YHFA 4KD1A 1ZMWA 3CD3A 4LOPA 5M4UA 3A8XA 2FSMX 5C8NA 3QQUA 4TYGA 5IQCA 2OU7A 3PP0A 3SD0A 4PPAA 2W5BA 2PMNX 4FG8A 4BCJA 5IA3A 5DN3A 3NMUF 4LMUA 4BTKA 5M55A 2YDIA 2B0QA 4LM5A 3F2RA 5C27A 2YIQA 5JQ8A 4R1YA 3KGAA 3IGGA 3RINA 4A4LA 4IX6A 4FL3A 4ASZA 4ASDA 4D2TA 4P2KA 1ZOEA 4BWXA 5BYLA 4O4EA 2XK7A 3MY5A 5DHJA 3R9DA 1Q8YA 4FIHA 1UU9A 3ZH8A 5EI8A 2YN8A 3IKAA 3N9XA 3V8SA 2ERKA 2R3GA 2G2FA 1BL7A 3L8XA 2CDZA 2AC3A 4FMQA 4MXCA 1KE7A 3BHHA 2C6EA 5M51A 3LM5A 2ZV8A 4I0RA 4JX3A 5DR2A 4F0GA 4BDCA 4CGAA 4USDA 4FV6A 4XS2A 4RWLA 4Z3VA 2NP8A 4QQ5A 3Q2MA 2X0OA 4HCUA 3D7ZA 4BBEA 4ZY6A 4BICA 4C4HA 3LFAA 3QD2B 3R21A 4FKIA 2IN6A 4BCGA 2XK4A 2WMWA 3B2WA 4GL9A 2YISA 3HAMA 4P5ZA 3FMEA 3KC3A 4C34A 3ZFXA 1XMLA 3LQ3A 5LOHA 3Q5ZA 4JIAA 4XP0A 5ANKA 5FRIA 3I0OA 4ZLOA 1GIJA 2C6KA 4D2SA 2J51A 4H3PA 4R1VA 4YLKA 4BR3A 4H3BA 5EQPA 1JKSA 5CAVA 3FQHA 5AUXA 4BFMA 1XH4A 3AGLA 4H39A 4IM0A 3GOPA 4MBIA 5HD4A 1PY5A 4FOCA 1H8FA 4LV7A 4ZS4A 4IH8A 3NIZA 3W0SA 3OCTA 2Y6OA 1PMVA 2XBAA 2UZTA 3G90X 1OITA 4O2PA 1G8AA 4DCAA 2X0QA 4JR7A 2PE1A 5LQFA 2XAOA 3UNZA 4W8DA 3M42A 4CKJA 4AXFA 4UX9A 4FF8A 4EOPA 4O7RA 3O23A 1ATPE 1URWA 4I1ZA 4FKLA 2BIKB 1KOAA 3RZFA 3QX2A 4J71A 2P0CA 2ITNA 3LXPA 1UWHA 1ZYCA 3RALA 4G5JA 5CWZA 4AGDA 4JVGA 4Q9SA 5LMKA 4GT3A 4RMZA 4TYHB 5J1VA 2QLQA 4DH8A 2O5KA 5H2UA 5BVDA 5A54A 5HX8A 3ACJA 2PZYA 3FE3A 5IKWA 3W2RA 4EH6A 5BVOA 4GUBA 5IQEA 4NH1A 2QLUA 2O64A 4I6QA 4FG9A 5HCXA 4DFNA 5L2SA 4AXDA 5HLWA 4M7IA 4TY1A 5EDRA 2Z02A 3P5KA 5JGBA 4FTJA 5AV0A 1H01A 5M06A 2QNJA 4CFUA 3N4TA 2F2UA 3A4OX 5K4JA 4I0SA 5D12A 4JI9A 4EK8A 4AQCA 3ORKA 3PJ8A 4BIDA 4DYMA 3HECA 4UXLA 2I6LA 2WTWA 4IQ6A 3ATTA 2WIPA 3VHKA 3L9LA 3QTZA 3FC2A 3UPXA 4DFYA 2IPXA 4OTFA 5ETIA 4XBUA 5DH3A 2GDOA 4QP7A 3F61A 4CQGA 4TRLA 5KO1A 1SZMA 2IW6A 2XIKA 2NNWB 4FSMA 4UZDA 3W2PA 4C35A 1URCA 3R1YA 2VTAA 4FSQA 3E8NA 3FJQE 3R01A 4K18A 4KKEA 4BCNA 4XRLA 2J0KA 2YCRA 3Q9WA 4KS8A 2QURA 5D11A 4H05A 2PU8A 4NM0A 3ULIA 5LWNA 1WBTA 3FBVA 3TUBA 1RJBA 4RLKA 4X6RA 4IDTA 3TTIA 3LW0A 4W4VA 5CLPA 3OBJA 2WTDA 2UZOA 3RPRA 1OKWA 4TYIA 3W1FA 4Y8DA 2HIWA 4MBJA 1UKIA 1Z9XA 2F7EE 4M8TA 1CKIA 3WILA 4DG2E 4ANMA 5C4KA 1OL5A 3TNHA 1YHWA 3LMGA 3P0MA 4KAOA 1Y6AA 2VWBA 3DY7A 5LVNA 3PIXA 2CMWA 2VO3A 2VTNA 1W82A 3MSSA 1OMWA 3D5VA 3R28A 4C3RA 5D7VA 4GFOA 2PMLX 4YC8A 2VO0A 4U7ZA 3UG1A 3M1SA 4O7SA 3QHRA 4MNEB 3F2NA 1TQPA 3AD6A 5L4QA 5BV3A 2H34A 4IWQA 3OVVA 4QTEA 3O7LB 3UZRA 5JRSA 3RKBA 4BCFA 3NW5A 4AZTA 2ITTA 4EBVA 2W1HA 4GG5A 3FKNA 2EWAA 4P90A 5K3YA 4ZSGA 4QMZA 4DH5A 3HMNA 3WOWA 3IW6A 4K2RA 5CF4A 4HGSA 5CASA 5L6OA 4DT8A 1SYKA 3OP5A 4F7LA 3UTOA 4BTFA 4A06A 4JDHA 5LVLA 2UVYA 5C8MA 5I9VA 3IK3A 4FEVA 5FEDA 3KN5A 4K11A 3RWQA 3R9NA 4UY9A 3R7IA 5HG5A 4F65A 4NZWB 3F66A 3ZEWA 1Y57A 2W5HA 2X4ZA 3VUTA 4QYYA 4KBAA 3E92A 4E4MA 3HX4A 2YA9A 1GJOA 5IPJA 4AA4A 3EFKA 1XH9A 3FEGA 3FMKA 3WE8A 1NT2A 2V7AA 4XRJA 3IW7A 3ANRA 3NCGA 3HV7A 3W8LA 3O8UA 2XIYA 5IMXA 2WOTA 2YIYA 5AR2A 2JEDA 3HUBA 4GKIA 3RPOA 4E5WA 1WVWA 5FM3A 4EQCA 3MA6A 5FEEA 4IIRA 2V7OA 5BX0A 4O7YA 3DNDA 5FBOA 3HP5A 4QMMA 4TZRA 3LMIA 2QC6A 3NAXA 4ONAA 5BMMA 3RP9A 4AFJA 2X6EA 4UMTA 3AC2A 2GHLA 4EJ7A 3MPTA 2QOLA 3OOMA 1JSTA 4FKTA 4JLCA 3ZONA 3DK7A 5CEOA 2BKKA 5EI2A 4RWIA 2C6DA 4DEIA 4EYMA 4M12A 3MH2A 1PW2A 4KIKB 2AYPA 3C5IA 2FSTX 4QO9A 3R71A 3W2OA 2UW8A 4G3EA 3CIKA 2F57A 4TW9A 4V04A 2DUVA 2ZDTA 4C62A 4CFMA 5DOSA 3U9CA 4E4XA 4EH2A 1TFFA 4EQMA 2OK1A 4FTLA 5AR3A 3VBVA 4KS7A 1KOBA 3KREA 3EQHA 2ETRA 4JNWA 4O0VA 5EM7A 5FWKK 4BCPA 4LRMA 2QOFA 4FSNA 3EQRA 4JG7A 2JDTA 3S3IA 4MD9E 1Q8WA 3MVLA 3PPJA 2ZFYA 2FB8A 3UE4A 5HZNA 1YRPA 3FV8A 2AUHA 4U9AA 2IO6A 4WG4A 2OFVA 3SOAA 4R3CA 5B7VA 2P3GX 4EHGA 2JAMA 3RNIA 2I0YA 3QCXA 4M67A 5EYDA 3DAEA 4TT7A 4ZZMA 3D7TB 2BDFA 4BDJA 2ITPA 3AOXA 3GCPA 5CX9A 4Y83A 4O4BB 4EUTA 2YZLA 4YJVA 1OI9A 3P5JC 4QP4A 4R3PA 4F08A 5E7RA 3F3WA 2ZMDA 4QRCA 4O0YA 4AFEA 2UZLA 4MXXA 4NKSA 2JIUA 4NIFA 3I0QA 2XNPA 1PJKA 4L46A 4FTAA 4ASEA 3ID6C 3JYAA 3F5GA 2X39A 4QYHA 5DGZA 4ZTRA 3MVHA 3ENMA 3V6RA 4DH3A 1GZKA 3GC9A 4I5CA 4RFYA 2IZRA 3VS6A 3GC8A 4RIOA 1KE8A 4IWDA 4FC0A 4JQ7A 5AR8A 2WMBA 2PUPA 2JIIA 2PMIA 2QONA 4MD7E 4R7IA 4BC6A 5E9EA 3SW4A 3I4BA 4MXAA 1W83A 1W2CA 2RG6A 5GNKA 3TNIA 1Q3DA 4B6LA 1UKHA 3R7YA 4D9UA 5M57A 4XG3A 2BRNA 3FMHA 3NFGB 4QQCA 3FPQA 4ZMEA 3ZBXA 3OY3A 3QALE 4MBLA 5LVPA 2BAKA 4J53A 3REPA 2GHMA 4JG6A 2R7BA 3Q9ZA 4I20A 2Z2WA 4XUFA 4CMOA 1JQHA 3TZMA 4FKRA 3TZ7A 3OWKA 4GK2A 4EUUA 2GFCA 4BCMA 2CKPA 4RX8A 3DCVA 4XG8A 4U42A 4EK5A 1SVHA 3W18A 4UALA 4AG8A 3EKNA 2RL5A 3UOJA 3DAJA 2PZPA 2HW6A 2YDJA 3DAKA 4ITJA 3RJCA 4D2PA 3NUAA 3GENA 4FT9A 1BMKA 3DJ6A 3KXZA 3R0TA 3MA3A 3PIYA 3L9PA 5CS6A 4GKHA 5LJJA 4I6HA 4FV8A 2WPAA 4RJ7A 4HNIA 4FGRA 2BTRA 3NDMA 2J9MA 1U54B 4QTBA 3PXQA 1MQBA 3PVUA 4RC4A 3COIA 3OG7A 2QCSA 3C7QA 2WFYA 1J91A 4AQKA 4D1ZA 3KVXA 2PPQA 5CU2A 2PVKA 1H07A 2PVFA 3OWJA 4LUDA 2DWBA 4A9TA 2V62A 4D2VA 3FZOA 3MIAA 3D15A 3WI6A 1APME 1M7NA 2Y4IB 3ZU7A 4EOSA 5AAEA 4LGGA 2JITA 4FRFA 3TNQB 1R0PA 4BTJA 1OZ1A 3P23A 2QU5A 4ORKA 4PMTA 3GVUA 4FV9A 3CLYA 4IAYA 4NU1A 3SV0A 3T3UA 4EHZA 3TNWA 3G33A 3SXFA 5HQ0A 4DFBA 2OF4A 2QG5A 3P08A 4MCVA 3R2BA 2WMSA 3ZCLA 2ERZE 4AT5A 1OGYA 3DA6A 3O8PA 2O0UA 4HGEA 4AE6A 3OCGA 4CYIA 5CEQA 3ENHA 4I92A 5L8LA 4YSMA 5IUHA 4DLJA 5HO7A 2C6MA 2WMUA 2YEXA 2ITOA 3MW1A 3PUFC 1OM1A 2OG8A 2PVMA 3AMAA 3E93A 3R2YA 4GSBA 5CVFA 1IR3A 2CLXA 4BBMA 2QO7A 4CCUA 3FAAA 4F1OA 5A4EA 3U8WA 5IEYA 1RQQA 1IAHA 4NYEA 5GJDA 3BLAA 4M14A 3UO5A 2X9EA 5EYKA 3F5XA 2I0HA 3FL4A 2E9OA 5K0KA 4R3RA 3WARA 3IW4A 1JWHA 4YBKA 4YU2A 3JR1A 3BCEA 3HMOA 4L45A 4OAVB 2BVAA 1JNKA 3RAWA 3BL7A 4RA5A 1PXIA 4RA4A 5HG7A 4OT5A 1H27A 5AV4A 2HAKA 5BVKA 3BX5A 4QP9A 4YJUA 4BDEA 1BI7A 3CCNA 1WBVA 5A3XA 4BJJB 3IDBA 5J7BA 3A7HA 3WIGA 4D58A 1PXKA 2AEGA 3OWLA 4OAUC 3LE6A 5FTGA 3AMYA 1S9IA 3DJ5A 4GCJA 3MH0A 4FZ7A 4KA3A 1DI8A 3MVMA 4CNHA 3FI3A 4FKOA 3QFVA 4O4DA 5JEBA 3GU5A 4K1BA 4PP9A 1OUKA 1Z5MA 3PZHA 3LLAA 3T8OA 4L43A 2VTRA 3QRTA 2WTJA 3QAME 4FV0A 3DXNA 3R00A 4FTUA 2PE2A 4H58A 4BDIA 1YQJA 1XH7A 4D0XA 3HKOA 3O71A 3KRRA 3P78A 4JXFA 2NRUA 4C33A 4CMUA 3QRKA 3WBLA 3NW7A 4LQMA 4IX4A 3SLSA 5BUIA 1XH6A 4YC6A 1ST4A 2WMXA 1YWRA 2ITZA 1ZY4A 4X0MA 3BZ3A 1ZYJA 3UMWA 3GCVA 4DINA 5JMSA 5L8KA 1TVOA 4E5BA 1OIUA 4QMQA 3QTSA 2HW7A 5HVKA 2XRWA 4OTHA 3V5QA 4F9YA 5HVJA 2XKCA 3QX4A 3FXZA 4F0IA 1WBSA 1ZXEA 4BDKA 3DLSA 1V0PA 2QO9A 1YOLA 4Q5EA 4EOMA 4FKVA 3KL8A 3FYJX 4O0TA 3QYWA 4EOJA 1OVEA 5M44A 4YZDA 4FKPA 2B52A 2QOBA 3AG9A 5KNJA 4ZJIA 5DT0A 3A61A 3CQEA 5E8SA 3SRVA 1H08A 3QD0A 4IX3A 3W32A 3EB0A 3G6GA 4FX3A 4ALVA 3PVBA 3ZXTA 1M2QA 3GCUA 4FKQA 5HU3A 3HEGA 4FEQA 3IOPA 1FVVA 4BDFA 3NVKI 3VONA 1H1PA 3KFAA 3QQLA 1M14A 4BKYA 4RJ4A 4X2NA 3QUEA 3U9NA 2G1TA 5EOBA 3FSKA 4S31A 3GNIB 5HE3A 2QOCA 4F6UA 3AT4A 1H28A 3Q52A 1H0VA 4YZMA 5AFVA 3DB8A 2YCFA 3PY1A 3BI6A 1XO2B 2WNTA 3FXWA 4I6BA 2XEZA 3JS2A 4D4SA 3E7OA 5AV3A 2PE0A 3AGMA 3D2IA 4FV5A 4CG8A 4MNFA 4NL0A 4YZNA 2DS1A 1MP8A 4YC3A 4QDVA 3GOKA 4CFWA 3EN4A 2XKFA 2WTCA 3BGZA 5L6WL 4YNEA 2PZRA 5IUIA 2RFEA 3ZRKA 2HK5A 4DDIA 2XIZA 3FY0A 3G51A 4ID7A 2NYAA 3BYMA 2Z7RA 3R7EA 2Y0AA 3NEWA 5CSPA 3UQGA 2QO