5M55A

Nek2 bound to arylaminopurine 71
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
277
structure length
238
Chain Sequence
SRAEDYEVLYTIGTRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSLKPANVFLDGKQNVKLGDTPYYMSPEQNNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase Nek2
publication title Structure-guided design of purine-based probes for selective Nek2 inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 238
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5m55A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5m55A01
4F63A 4O81A 1MQ4A 1FOTA 2QHMA 3LFNA 4JG8A 3PXFA 4ANSA 2BTRA 3MY0A 2BRNA 1RJBA 3EQHA 3BE9A 4FTQA 5IKWA 3LXLA 2JIIA 4D4YA 3QF9A 5L4QA 2BRBA 2WEIA 4PL3A 5CALA 4NU1A 2QG7A 3UC3A 4CKIA 5DE2A 3CJGA 4FF8A 1XJDA 2E9VA 3T9IA 3ACJA 4DEAA 4ZLYA 5IQBA 2PZIA 3DS6A 2OI4X 3RZBA 5IPJA 5M09A 2HIWA 2W9FB 4I4FA 3WOWA 5ICPA 3RMFA 2HXQA 3HP2A 3P7BA 5KHXA 3W8LA 1W83A 3L9LA 1OIUA 1GIJA 1ZYDA 3CQEA 4J71A 4L42A 3LW0A 4AQCA 1JLUE 3QRTA 3NRMA 4L01A 3L8VA 3PDTA 1B6CB 2EVAA 2V0DA 2CGUA 3DK6A 2YJSA 4HPUE 3SW7A 3OF0A 4YHFA 3UE4A 5E8YA 3FY2A 4FKGA 2UW8A 4HYUA 3RPSA 3WE4A 4EL9A 1FBNA 2IVSA 3NPCA 1JSTA 4X2JA 1UU7A 4QP7A 4A9RA 2WGJA 5CXZA 4U40A 3LQ3A 5AA8A 3Q96A 2OFVA 4IZAA 5M4UA 3TUDA 3SG9A 2GFSA 1KUTA 2ERKA 3ORIA 5ITAA 3CQUA 3MY5A 4N70A 3BEGA 3I79A 2Y4IC 3PPKA 4KSPA 1PHKA 2AUHA 2G15A 4JS8A 4MNFA 4X3FB 2RGPA 3KK9A 3IPHA 4RVLA 1WFCA 4FG8A 3E63A 3MYGA 4Z16A 2VTHA 4OTRA 3U6HA 3BV2A 4I5MA 1H1QA 3MSSA 2R3FA 5AM7A 3DK3A 4DFYA 5CI6A 3LLAA 4TT7A 5AUYA 4ANBA 4V04A 4DT8A 3TDWA 2YITA 3EN6A 3OCGA 4C35A 2ZM4A 3NUXA 5EM6A 3W1FA 4BCIA 2G1TA 2EXEA 4NK9A 3QRJA 3W2PA 4KINA 4D2TA 4EOIA 3ATTA 5TF9A 3R8PA 1Y8GA 4ZEGA 5LMAA 3H3CA 3G0FA 3WE8A 2XBJA 4G1WA 4EBVA 3AGMA 1H25A 2E9PA 2CN8A 2W1CA 1SZMA 2YISA 1BI8A 2X2MA 2CLXA 4IQ6A 3GU5A 1GZNA 3FYKX 3D83A 3W2RA 5GIPE 3MBLA 2C5NA 3RHXA 5HIBA 2GCDA 2BZKB 2ZAZA 4FEVA 4IJPA 5FEEA 4BDKA 4QO9A 4C7TA 4S33A 5L3AA 4GS6A 4FZFB 3ATSA 3TUCA 3DKFA 3QRIA 4QMXA 1JKLA 1H07A 2VWWA 2UW3A 4ZOGA 4W8DA 4F9AA 5IA3A 2YIRA 4CFFA 3OXZA 4BCPA 3D7TA 5J95A 2ZB1A 3FPMA 3M2WA 4PMMA 4XJ0A 3VBTA 5JSMA 1QPCA 4G6NA 2ITWA 3KVXA 3Q60A 1JKKA 4WBOA 3QYWA 2JBPA 2PVFA 2RL5A 1M7QA 5FQDC 3VBVA 4R1VA 5CF4A 4A4LA 4ZMFA 5J8IA 3QBNA 4B4LA 5I3OA 2W96B 5FM3A 4UALA 1I44A 1P4OA 1U54B 2HCKA 3R04A 1M2PA 1Q41A 1QPJA 3PVUA 3VS2A 5E7RA 4E3CA 3QC4A 2FSTX 3R30A 4FTLA 5K4JA 1OL2A 2ZV8A 3R9RA 5A46A 2E9NA 4YJOA 3NNWA 2ITVA 4PPCA 4H3PA 4OAVB 5AJQA 4GVAA 4FTNA 1P5EA 4ZP5A 4RZVA 3MWUA 1VZOA 5E8SA 3FV8A 2WU6A 4WBBB 3RPVA 4FT9A 4FT3A 4RIWB 4DFLA 2VX3A 2PWLA 4DF3A 2BZHB 1JPAA 2VU3A 3K3IA 3ORZA 3RM7A 3KQ7A 4F6SA 3ZDIA 4FV3A 4U8ZA 4XUFA 3C7QA 1OIRA 3DAKA 4BI1A 4HZRA 4FSZA 3FSFA 4EUTA 1DI9A 5EQEA 3TM0A 3SVVA 2ITZA 5AAFA 4DGLC 4LL0A 4ASZA 5A4CA 4K33A 5KZ0A 1PMEA 4KIKB 4AT3A 3HEGA 3P86A 3NUNA 2Q83A 4AGDA 2R2PA 4CZYB 4BDDA 4AT5A 5HCZA 3C0IA 4LRKA 2PMOX 2F2CB 1K3AA 5CSWA 5D1JA 4FKRA 3JPVA 4FYOA 4EKKA 5DPVA 5CVGA 4KIOA 4CFXA 5CSPA 4A4OA 4MF1A 2CKOA 2B53A 1KE7A 3W2OA 4TYGA 2YCQA 1WBOA 5GIOE 4I1ZA 4RIXB 4TYEA 4R5YA 5JK3A 4P7EA 4RT7A 3RAIA 4CLIA 1V1KA 1XWSA 2C30A 2WTKB 3I7BA 3QFVA 3I5NA 4FG9A 4MCVA 4RA4A 5BVEA 3HAMA 3ZLXA 1YKRA 3G2FA 1MRVA 4PPBA 2B0QA 4EBWA 4MNEA 5CVFA 3WF7A 1ZOGA 4LQMA 3MA6A 4AGCA 2C6IA 3DQWA 3I6UA 3UOJA 3CCNA 3W18A 1NVQA 2JFMA 4F0IA 4ORKA 3QHRA 3GCUA 3BPRA 4UZDA 1HOWA 5D7VA 3O7LD 4M69A 1YI4A 3CTHA 2QD9A 3C9WA 2PE0A 2XCKA 3NW7A 3OFMA 4EZ3A 3C4FA 5L6WL 3ET7A 4KKGA 2UUEA 4XG9A 4G3DA 3MI9A 4WRSA 3N4TA 5D7AA 1J7LA 3A7JA 3R7YA 3PVWA 4L6QA 4RIOA 3H9FA 4EOOA 2GSFA 5I4NA 3ZO3A 1M14A 1WBWA 2BDWA 4JL9A 3QYZA 3F69A 2IO6A 4K0YA 4X6RA 1H0VA 3D5WA 2UV2A 4BGHA 2GTNA 4IAIA 5AR4A 4M97A 4OR5A 3HYHA 4C02A 4HYIA 5B2MA 3GNIB 3OEFX 5EYKA 3R7EA 4RJ8A 3EZVA 2CSNA 3EQIA 3QUPA 4FKLA 4R7BA 4TXCA 3LVPA 3DBQA 4M68A 4RWLA 1KE6A 3DLZA 4GRBA 1KOBA 4J99A 3BEAA 2YIYA 5ANEA 3UVQA 2OIBA 4YJUA 5E91A 3ZUVA 4GEOA 1H0WA 4U81A 1ZYLA 4FSRA 3OBGA 1OPKA 2VTSA 2W4KA 2Y8OA 3KB7A 4XS2A 5C03A 2RFSA 5IQHA 3EL8A 2BAJA 4ANQA 2YCSA 5AP2A 4JBPA 3LXKA 3C0HA 3R63A 5HHWA 5IU2A 2FGIA 3QTQA 2EXCX 2OICA 2PL0A 4G5JA 5KKRB 3QKKA 4X3FC 4HVHA 3PZHA 2QOQA 2GS7A 4V01A 4ZSJA 3ZFMA 2I0VA 2GNLA 4ALWA 3E93A 3BHYA 3FKOA 4FTUA 3QALE 2Z7QA 2HK5A 3VHKA 3F88A 4II5A 4O1PA 4OBQA 2YFXA 5IQCA 2W4OA 4ERKA 2BDFA 4HCUA 1IG1A 4NFMA 1NXKA 4CVAA 4ENYA 3GFWA 1ZY5A 1V0BA 4QP8A 3CY3A 4BDIA 2QO9A 4UY9A 5LVPA 3LMGA 4Q2AA 3VUGA 2YM3A 3VUIA 4I6BA 5IEVA 3F2AA 3QTZA 3F5GA 5IDPA 1W0XC 2RG6A 2OGVA 4LMUA 1KV1A 4QQ5A 5F94A 4FG7A 4XYFA 3DK7A 3R8ZA 4J8MA 5CEKA 4CNHA 1Q8ZA 4JXFA 4EOJA 5B7VA 2X6DA 5CASA 2B9IA 4IB5A 1PXKA 3BGQA 3R9HA 3UC4A 4X3FA 3U87A 5KCVA 3G9LX 1W7HA 2X8DA 3MPMA 3MVHA 3LJ2A 2YZLA 4FOCA 4IX4A 4B8LA 2VWVA 3UO4A 3DAEA 5BX0A 4PDPA 3MFUA 4EQCA 5KMOA 2C4GA 3SXSA 3E7OA 3TTJA 2OJFE 1UVRA 3OW3A 4S34A 5FRIA 3DNDA 3GCPA 1MRUA 3OUNB 3QQKA 4MBIA 4W4VA 3SD0A 4DEHA 3V04A 3JVRA 3ACKA 2V22A 3DQXA 5IA4A 2VNYA 4YHJA 4MX9A 3UZPA 5I9XA 4HPTE 3BV3A 4QYEA 2GHGA 1KE5A 3QCQA 3A2CA 3TWJA 4AZVA 4MD9E 2VTAA 2VWXA 2JKOA 3I0OA 2PHKA 3QXPA 4FGRA 4U45A 2DWBA 3D0EA 3IS5A 4L00A 5AV0A 2YEXA 1UU8A 2DUVA 2OZAA 3NYVA 3PP1A 5IUIA 2WIHA 3OHTA 4Q5EA 4QMMA 4RX9A 2RG5A 4AWIA 4IM3A 3FEGA 3OVVA 2QU5A 5AP7A 4X21A 2Z7LA 1JQHA 3ZMMA 3ZHPC 5A6NA 4NH1A 5BUJA 3TCPA 4U9AA 3FAAA 1APME 4G17A 3GXLA 4JRVA 3O7LB 4DGMA 3CKXA 2E9UA 2XUUA 4AOIA 1PXJA 2F9GA 1TVOA 2VWYA 5K4IA 5B2KA 5LMKC 3FL4A 3EQPA 4OLIA 5CEPA 5LVNA 2XJ2A 3I5ZA 3KULA 4BWXA 5A4LA 5DT3A 4XEYA 3GU8A 5A6OA 4FSMA 3VBYA 4I41A 5EKOA 2A1AB 2QKRA 5K5NA 3OWKA 5E90A 2J5EA 4TN6A 3LCDA 5M51A 4G3EA 3TZ7A 2XBAA 3OOGA 3JXWA 3Q3BA 3Q4UA 4AZWA 2HZNA 5CZIA 2OF2A 3SQQA 4GFMA 3V8TA 5M06A 4LOPA 5CNNA 1J91A 3RVGA 3UP2A 1O6LA 2Q0BA 2XKDA 4EHZA 5ANOA 4XBRA 4YJNA 4F6UA 3R1SA 3EN7A 4JG6A 4RIWA 1H28A 4DCAA 4K6ZA 4NM7A 4E4MA 2Y6MA 5CXHA 3QL8A 3P4KA 2O63A 2C3JA 3LFBA 2IW6A 5EYMA 4U80A 2X39A 2CLQA 4G6OA 5AR3A 2RFNA 5FGKA 5LMKA 3S4QA 3TEIA 4W4YA 5EDPA 2GTMA 3Q2MA 4BTMA 5KMNA 2YWVA 4AOJA 1KSWA 4MBJA 4KUJA 3JUHA 4LM5A 2WQMA 1XH6A 2BKZA 3GC0A 5LVLA 5C01A 3CJFA 4BCOA 3PY1A 4WIHA 2H8HA 4FBXA 2R3JA 3FZTA 3QD3A 4CRSA 3E8DA 5BYLA 5DR2A 3VRZA 2J7TA 3Q53A 3GEQA 4U3ZA 3R7IA 2Y4PA 4EHGA 4NWMA 4KD1A 3QLFA 3AT3A 4GG5A 5CT7A 2I0EA 3E7VA 3F61A 4ZY5A 1J7IA 4AZFA 2Z2WA 2R3NA 4KABA 4BIDA 4DLJA 2XEYA 4LGDA 4ASEA 4FEXA 2XYUA 4RIXA 2YCFA 4WSYA 5CAQA 4I94A 5KX8A 1WVWA 3FMEA 4M14A 1UU3A 5AUWA 3SC1A 3BRBA 4G34A 4EWQA 2R9SA 2FSOX 4EH4A 3UIBA 2YABA 4BBFA 4KWPA 4BKYA 5AEPA 3UMXA 1GY3A 2XRUA 4UMRA 4O7RA 1H00A 5L2IA 2UW7A 4I5PA 5HQ0A 2O2UA 4M0YA 4XP2A 3IGOA 3UIXA 5DFPA 2YM7A 2VV9A 2JAVA 1PXOA 2IVUA 1IAJA 3FLWA 4IIRA 3LKMA 4R77A 5HO6A 3NAXA 2WTWA 1GIHA 4QP3A 4JIAA 2VO3A 5CYIA 1OITA 4L7FA 5GJGA 5IQDA 5KMMA 1CSNA 2WTVA 4L3PA 3R8UA 3G6HA 2HY0A 4G5PA 3FLYA 4PP7A 1Q5KA 3A4OX 2O5KA 3VRYA 3A60A 2OXXA 3C4ZA 1IA9A 3QTUA 1OUYA 3PA3A 3ZTXA 5KBQA 2UZNA 3OY3A 4YTCA 1PXMA 3K54A 5AAGA 5AR2A 5FBNC 4IZ7A 2J50A 3BU3A 3TI1A 5FUTA 4YNOA 4O22A 1ZZLA 4FSTA 4FICA 1H27A 1BL6A 2VD5A 4I23A 3R7UA 3R01A 3TV7A 4O0TA 4QP4A 4TWCA 4UZHA 3PIXA 3QQFA 5FTOA 1JSVA 2RF9A 4WKQA 5ANGA 5IQEA 4YTIA 3LLTA 4IANA 1PMNA 3NIZA 3DKGA 4AA4A 4E4LA 1OKWA 2JEDA 2Y4IB 3L8PA 3PTGA 3U51A 2VX0A 2UW4A 2X7OA 2IVVA 3PE1A 3D7TB 4DYMA 4EJNA 3Q04A 2F7EE 4FVQA 2ZOQA 4L53A 5H2UA 5GNKA 1GOLA 4NTSA 3BKBA 4P5QA 3A7FA 2P2HA 1WBPA 3LFSA 4ERWA 3DXPA 4TPTA 4CYJA 1ZOHA 4PDOA 3Q4CA 5AR7A 4F9YA 3RGFA 3QWKA 4W9XA 1PJKA 2YLFA 4KSQA 4PF4A 2Y7JA 5M56A 5JZJA 2XNMA 3WZKA 4U41A 3G5DA 4ENXA 4Z55A 4CQEA 4C0TA 5CU3A 1F5QA 2B9HA 3AD4A 3QD0A 4JR7A 3RJCA 3G51A 5B0XA 3A99A 3B8RA 3ZFYA 2GMXA 3ZSHA 4EOPA 3EN5A 4YC3A 2XZSA 4LV5A 5A54A 5L8KA 1PYEA 4YZNA 5HBEA 4O83A 2WOUA 5GJDA 4DEBA 5JFXA 4PQNA 2R3OA 5EW9A 5FD2A 4ZTMA 5M4IA 2C0IA 4HVDA 3ORNA 4FYNA 2OFUA 4CQGA 2CKQA 3R83A 1GIIA 3IOPA 3ITZA 3PVBA 3VVHA 5HICA 2UVXA 2UZUE 3EYHA 3S3IA 2ZVAA 2I6LA 5CQWA 2BROA 3Q9WA 5M44A 4YJQA 3R2YA 3R73A 1CTPE 1QL6A 1Y91A 1FVTA 3JY0A 4G3GA 4HGEA 4L44A 5AP1A 4O91A 4PPAA 2JIUA 3TIYA 4DBXA 3U55A 4O0XA 3SOAA 5HE1A 4MK0A 3CPCA 3UMWA 4QP6A 5EHYA 3V5LA 2QKWB 4YC8A 2C1AA 3MVLA 3P5KA 3U4UA 2WIPA 3QX4A 3ZXZA 2AYPA 2GPHA 1Q8YA 2XRWA 4MEDA 3VO3A 3RAHA 5AFVA 1VR2A 2EU9A 3DPKA 4FNYA 3KXMA 5CAPA 2R3RA 3PG1A 4NL0A 1M2QA 5JKGA 5EYCA 1YOMA 4J8NA 2FVDA 1WMKA 3Q9YA 4USDA 3W2CA 3KKVA 3QKLA 4ZZMA 4A4XA 4F1TA 3H9RA 4Z9LA 3L9PA 2W1IA 2ZM3A 4FTTA 5HORA 5AA9A 4UX9A 1AGWA 4M8TA 5T6KA 4JJRA 4DEGA 4QMUA 2B9FA 5DEWA 3K2LA 4IVDA 4MHAA 4BIEA 3R1NA 4YC6A 3HV3A 1GZOA 4HOKA 2UZVA 4RMZA 4B8MA 3HDMA 4CFVA 5FDPA 2JGZA 4MNEB 1CKJA 1ZYSA 5AM6A 3TV4A 4NJ3A 4WA9A 2ZDTA 3FQHA 2PUUA 4RVKA 3M1SA 5HEZA 1FQ1B 3MIAA 4OT5A 3SLSA 3U9NA 2YIWA 3FXXA 2J0JA 4H3QA 4GYGA 4M69B 4O1OA 4BCKA 2A19B 4ZSAA 2VWZA 3GC7A 3DKCA 2P4IA 3EJ1A 4JLCA 4O7YA 2C6LA 3FJQE 3LHJA 2PUIA 3ULZA 4R5SA 4MVFA 4FIEA 4PP9A 3PFQA 3MY1A 4TW9A 4BF2A 3E8EA 3OTVA 5EQYA 2JKKA 3ZS5A 3O96A 4RJ6A 1YDSE 5K0KA 3TACA 4XV3A 2C6MA 3DAJA 5E8ZA 1R3CA 5FTGA 2HW6A 4FT5A 3TL8A 3RAWA 5HI2A 4O7WA 4QMVA 2CNUA 3LOKA 3PUPA 4DG2E 2ITPA 5KO1A 3NSZA 5H8EA 3DOGA 2VTNA 4NSTA 4OTDA 3ANQA 3IW6A 4O0UA 4MWHA 2PU8A 2ERZE 4E6DA 4TY1A 2OU7A 4QTCA 2BKKA 3KRLA 4V05A 5FWKK 4CGAA 4ACDA 5F95A 2GNFA 2XS0A 3OWLA 3GB2A 2QR8A 4IAFA 3RPOA 4E5BA 4OTPA 3UVRA 5LXMA 3LM5A 4UN0C 5J7BA 1H8FA 4XRJA 2XA4A 3CY2A 4WG4A 4E26A 1CMKE 3IONA 4EKLA 5K9IA 2W7XA 4GUEA 1ZMWA 4TZRA 2IWIA 2OBJA 4FV4A 5HTIA 4UYNA 3Q9XA 2WTJA 3BCEA 5LMBA 1FGIA 2X81A 2ZYBA 3FMLA 4GUBA 5AUTA 2UZDA 3RWQA 4DGGA 1U4DA 4QMYA 3FSKA 5DOSA 5AWMA 4BBEA 3S1HA 2BRMA 4U5JA 4FEUA 2C6KA 2R7IA 3VW6A 3F9NA 4FX3A 4G6LA 4GKHA 3DBFA 3BHVA 4TYHA 3L1SA 3TNQB 5A14A 3TUBA 4W4WA 3TXOA 5HIEA 4RSSA 4IAKA 3LJ0A 4ZZOA 3BHUA 2XNNA 3WZUA 5JGBA 4FTCA 2YZAA 1OPJA 3RK7A 3DJ7A 3FMJA 3R00A 4YSJA 3KN5A 4M84A 3EFJA 3P0MA 4R3RA 4NJDA 4XG4A 4CTBA 1YOJA 4FNWA 4H3BA 4NT4A 4Y5HA 2C47A 2Q0NA 2XH5A 4DITA 2QOOA 3GC9A 3KCKA 1OIQA 1KV2A 3EFWA 4XG3A 5IQGA 3V5PA 3ZONA 4WHZA 4Y8DA 3ZZEA 3C4CA 2LGCA 3F2NA 3RNIA 2O64A 3KXZA 4D9UA 3CD8A 3E3PA 3OCTA 5BUIA 3HV5A 3Q6UA 4FKJA 4M66A 2UW0A 4V0GB 2WMAA 3UBDA 3PPZA 4M15A 2AC3A 2WTDA 2VTPA 4L46A 4DAWA 4YUQA 3DXQA 4QMWA 2J5FA 3HUBA 3UO6A 5FP6A 3ROCA 3HECA 4O7NA 4BCGA 1RW8A 4FGBA 4FK6A 4KS7A 4D4VA 5L6PA 3D2KA 5DGZA 5IA2A 4M0ZA 1YXUA 3JY9A 3BHHA 3QRUA 3WZDA 3E8NA 2OH4A 4G3CA 1P2AA 2UZWE 4BY9E 4AACA 4YZ9A 4ZZNA 3QHWA 5BVDA 5TO8A 5H8GA 4I93A 3DZOA 2X9EA 4YLJA 4G9RA 4MXXA 4D0XA 4E8AA 4AW0A 5AR5A 1YXTA 4IWOA 5HLNA 5HGIA 3SGCA 5M53A 5EDQA 4UMTA 3W32A 4AZSA 5CWZA 5DNRA 4FIHA 1UNLA 1DAYA 4OTGA 4H36A 5A3XA 4JDHA 4YU2A 4UV0A 3UIMA 1UWHA 1Z57A 3UOKA 4YURA 3UQFA 1YXXA 5CSXA 2OZAB 3MIYA 4CLJA 3P7CA 3KRJA 4CMTA 3MPTA 5IUHA 4XG8A 3UO5A 3LE6A 4CFWA 4NW6A 3ULIA 4GIIA 3FUPA 4TWPA 5FEQA 3S00A 2GFCA 2WQOA 1OGUA 2DS1A 3QXOA 1VEBA 2ZJWA 2E9OA 3FZRA 3FXWA 1Q3WA 4N57A 3SV0A 2HOGA 2VN9A 2CGVA 4BICA 2HAKA 5AIRA 3EN9A 5D9HA 1RDQE 5E1SA 3QKMA 4IHPA 3KULB 2X7GA 5CF6A 2UZEA 4DG0E 1XH4A 3KCFA 4KA3A 3NVKI 1G5SA 2YAAA 4IFGA 1W98A 3EKKA 1BMKA 4Y95A 2HELA 4L52A 4CTCA 4B0GA 4LYNA 5CEIA 1ZXEA 4XG2A 3UIUA 3SKCA 4IJ9A 2FSMX 4XOZA 5CF5A 4FSYA 4BDAA 1UU9A 3P78A 5ETCA 4D1XA 4FKUA 4JAIA 4C8BA 2HZIA 2Z02A 1CKIA 4XRLA 5J9YA 2NPQA 4YJRA 2VWUA 1FMKA 3Q4TA 5AV4A 1GZ8A 4ALUA 2CNQA 3I81A 2PVRA 5IH5A 4FMQA 3TNWA 5AP6A 4DH3A 2WQNA 2W1DA 4O0YA 1NT2A 3D7ZA 3DTWA 3L9NA 4MKCA 5I5ZA 4H05A 2XEZA 3TZ9A 2HENA 3O71A 3PJ1A 5CU6A 5CAUA 5AMNA 4U97A 3UPXA 5DH3A 4RWKA 3TN8A 3ODZX 2DQ7X 3ORKA 4CFUA 1GZKA 3POZA 5AIKA 5DT0A 3JS2A 4NKAA 3HNGA 3MW1A 4CYIA 2UZOA 5CF8A 4YJSA 3WZJA 4C61A 3RHKA 2BVAA 4L9IA 4FEQA 3VHEA 4Y46A 1OPLA 5HG7A 3F7WA 5AP0A 1WBSA 1LP4A 2CKPA 3Q2JA 4EH6A 3LFQA 5H9BA 1H24A 1GJOA 2C69A 4GT3A 2PZ5A 4FVPA 4FZ7A 3KL8A 3I7CA 3VS3A 2CHLA 2WELA 3QZIA 5C8MA 4E4NA 4B6LA 2JDOA 4F4PA 3EYGA 3F66A 2GS6A 4ZJJA 4BGGA 4CCBA 4DG3E 5T3QA 4O7LA 2XNBA 3DT1A 5HNBA 4KBCA 4ZIMA 4DGNA 4HJOA 4X2GA 2W17A 4FKQA 4D55A 3H9OA 5IH6A 2CPKE 3UDBA 1PY5A 3HZTA 1PXIA 5ANDA 4CG8A 4ACCA 2XMYA 3OOMA 4K9YA 1PMVA 4A06A 2YM6A 4LRMA 3FC2A 2FB8A 4HVSA 2C5OA 4FKIA 2NNWB 4JQEA 3LM0A 5LVMA 3UZRA 2CNVA 4MTAA 4WT6A 3FZ1A 4BVUA 2ZMDA 1R0EA 4IB0A 5HLWA 1SVEA 5M57A 4QNYA 3QQJA 2I7QA 3LMHA 2XNPA 1BX6A 4ZSGA 2VUWA 3R1YA 5HO8A 3EKNA 3FMKA 3D5XA 3NVMB 2PZRA 3EL7A 4EYJA 4FIGA 3TNPC 4MD8E 2A4LA 3DB8A 2PUNA 5BPYA 4AN3A 2C0OA 3COIA 3MS9A 4N4SA 5C8NA 5J9ZA 3H4JA 5L8LA 3D14A 2WXVA 3DBEA 3P08A 4JDJA 4IDTA 5BUEA 2YDIA 3AC1A 4QPMA 4YP8A 4A9SA 4RLLA 4IH8A 4F1MA 2VZ6A 5J87A 2ITQA 2UZLA 3CLYA 1XH7A 4RX7A 4FEWA 4WNOA 4EUUA 3NNUA 3DBDA 3R6XA 5EYDA 3MN3A 4WNKA 1ZYJA 3ZO4A 5H8BA 3HUCA 4QNAA 2C1BA 2B54A 4O86A 4PRJA 5CAOA 2WU7A 4LRJA 4X2NA 2B1PA 5DWRA 1SM2A 3W2SA 1J3HA 1O6YA 4QYGA 5LVOA 1LEWA 4FVRA 4A9UA 4EH8A 3CXWA 4UMPA 4BR3A 3HRFA 1OMWA 2XNEA 4I5HA 2BAKA 3E87A 4RFZA 1XO2B 2QLQA 4RBLA 4ZTRA 5B2LA 4OTWA 3TZ8A 5KE0A 4QQTA 3DTCA 2OJGA 4ZY6A 1OL6A 4O38A 5AR8A 3V5WA 3JYAA 5LQFA 4RVMA 3QGYA 4D2WA 4DH5A 4NEUA 1CKPA 2J6MA 4H1JA 4H58A 1XHAA 3BLHA 4OBOA 3OEZA 2B7AA 5EH0A 5D10A 3MVJA 4ZS4A 3BWFA 2Z7RA 4PY1A 4MQ1A 5EK7A 3T8OA 5E8XA 3ZBFA 2A0CX 3R28A 4JOAA 1MP8A 3PWYA 4FV1A 3GU6A 3ODYX 2R64A 4XNEA 3UQGA 3LFAA 1OIYA 3DKOA 3LZBA 2ESMA 3BGPA 2NP8A 3C4WA 2RFEA 1MQBA 2BALA 2PK9A 3OC1A 3WI6A 2BPMA 4PMSA 4A9TA 1UA2A 1ERKA 1XH9A 3TKIA 4EOKA 3AC4A 4BZOA 3CTQA 1YQJA 4ID7A 1H08A 2B4SB 3S95A 4FTJA 4JI9A 4BHNA 1F0QA 5DA3A 3WIKA 3DFCB 3M42A 2WMBA 3PIZA 4BKZA 4LI5A 4UXQA 4V0GA 5FTQA 4ZAUA 5C4LA 3F5PA 1PF8A 3UQCA 2PMNX 2QLUA 5DLSA 3QC9A 4YSMA 1YHVA 3ALOA 3PRFA 5JMSA 4IE9A 1Q61A 1YDTE 3OWPA 4MF0A 4FTKA 3NCGA 3O0GA 2XK9A 3PPJA 2BRGA 3QA8A 4QMOA 5FM2A 3U4WA 4O21A 4DTBA 3HLLA 4D4SA 2NRYA 2W5AA 4U3YA 2VTQA 3TNIA 2F49A 2OWBA 3FL5A 4RQVA 4DINA 2X4ZA 4FUYA 2R3LA 2BCJA 3KEXA 4IMYA 3KXHA 3P9JA 4FTOA 4O0VA 3WILA 3Q5ZA 4MQ2A 4IACA 2C5YA 1PXPA 4A9YA 4GK3A 4OW8A 3HMNA 3UZTA 3VWAA 1Q24A 4UWYA 4P5ZA 4DN5A 3GU4A 3W10A 3ZEPA 1AD5A 4OTIA 1QMZA 2Y0AA 5CVHA 4IX5A 2X7FA 5HKMA 4FA2A 3DV3A 3GVUA 4WRGA 3QTRA 3TKHA 3PA4A 2XKFA 3U54A 4IAZA 4KBAA 4P2KA 2P3GX 4EOQA 2XNOA 2X9FA 3EOCA 2QODA 4ZSLA 5C9CA 3PJCA 5DRDA 2HY81 3UJGA 3IK3A 4MBLA 4EC9A 3PG3A 2GQSA 4JVGA 5IDNA 5EW3A 4Z7GA 1GAGA 4FKOA 5EI2A 3LCOA 2C6EA 3AT2A 3GENA 3FXZA 3RCDA 5DN3A 3ZC5A 5KMJA 2C6TA 2OKRA 1BKXA 2WMXA 4DA5A 3WF8A 5HX6A 4X7QA 5FXRA 1UKIA 2IW8A 3GUBA 4F70A 3FI4A 3OUKA 4RGJA 3KN6A 2WHBA 4AW5A 3PXKA 5AUUA 1SVHA 3QTIA 2I0YA 3LFEA 4EH5A 4BDEA 3R9OA 2F7XE 2WQEA 4F7NA 3EQBA 2J4ZA 5AADA 3IDPA 4GU9A 5DR9A 2YDKA 2ZMCA 3DB6A 3FI2A 1ATPE 4OT6A 3TJDA 3UYSA 4L8MA 4CG9A 4Q9ZA 4YJPA 3BYOA 4HNIA 3IDCA 5H3QA 4BDFA 3GCVA 4AOTA 3WIGA 3U8WA 4JT3A 4S30A 2VTMA 3SAYA 3DDPA 3IDBA 4JQ8A 5DEYA 3GQLA 3UYTA 1JKTA 3Q4ZA 4O0RA 4G2FA 3VQUA 2YLEA 5I9ZA 3QCXA 4TTHB 4JG7A 1VYZA 3RKBA 1XH8A 3BHTA 4L3JA 1XQZA 3F3VA 3MH3A 2PVMA 4ANMA 2CN5A 3Q6WA 4ALVA 1J1CA 3RAKA 3UGCA 3V6SA 1BLXA 4CZUA 2GHLA 4RA5A 4F6WA 1Z5MA 3TZMA 2H6DA 3SDJA 1H1RA 2GU8A 3FE3A 2QOLA 3VF9A 5IH4A 1W82A 5ACBC 2OJ9A 5HLPA 3VUDA 1PYXA 5HVJA 4FTAA 3WF6A 1F3MC 4DCEA 1M7NA 5AX3A 3OS3A 1YXSA 4QMTA 2PZYA 2UVYA 2PY3A 2CKEA 2XKCA 3ZU7A 4C4HA 1YWVA 5M07A 4TYHB 4FV0A 4D1SA 4DGOA 3QRKA 2RKUA 3MESA 1J1BA 2C6OA 2GNIA 1SNXA 4LGHA 2CCHA 3RTPA 4TWNA 2J0MB 3JVSA 2W5HA 1Q8WA 1Z9XA 1XR1A 3BU5A 3ZM9A 1URCA 1KOAA 2J9MA 2VTIA 3GU7A 4F09A 4L45A 2OIQA 4JX3A 2ACXA 4IM0A 5EM8A 3NEWA 2HWOA 1K9AA 4FKSA 4E5AX 4KS8A 5I9VA 5IMXA 2Y9QA 3N9XA 5BMMA 3BYSA 4HW7A 3PA5A 3PZEA 4C4FA 4D28A 4AN2A 4EC8A 3FQSA 1X8BA 4GVJA 4L67A 4N0SA 1JSUA 3KRXA 3EB0A 4QPSA 4BCQA 2VTTA 2C6DA 5E1EA 3A61A 5EKNA 4EEVA 3QAME 5TT7A 1YVJA 4QPAA 4YBJA 3AT4A 4BKJA 1OL1A 2CDZA 4C37A 2JKQA 3C1XA 4HGLA 4BYIA 1XH5A 3CR0A 1OL5A 4AXAA 3BU6A 4EH2A 4FIFA 4FIIA 3A8XA 3PRIA 4YZDA 3ZSGA 3TDVA 4J96A 4UMUA 4O82A 2P33A 3IW8A 1YHSA 3O17A 5LCJA 4QP9A 5J1VA 4O84A 3DFAA 1DI8A 3LQ5A 3A7GA 1EH4A 4M7IA 1XBBA 2GDOA 3CKWA 3TV6A 4AF3A 4E93A 5A4EA 5F20A 5C8KA 1ZOEA 4MXZA 3FPQA 4R6VA 4L68A 1PKDA 2QHNA 4C33A 4NIFA 4ITHA 1IRKA 3QLGA 4M13A 3VS6A 4ZSEA 2ONLC 2WMVA 4LMNA 5L2QA 5TKDA 4E7WA 3AG9A 5AUXA 2QOBA 1KE8A 2C3LA 5AV3A 4O2ZA 3VBWA 5CS6A 2RFDA 5M08A 5JH6A 5LOHA 2W1EA 1PXNA 4CD0A 4PV0A 2UZTA 4IZ5A 5CAVA 4BTJA 4DLIA 3ZM4A 4IBMA 2VRXA 3BQRA 3OCBA 5FXQA 5HIDA 3T3VA 4AAAA 4AE9A 5IUGA 3BWJA 4WUAA 3BZ3A 4C4EA 3W16A 5L2SA 3ZRKA 3ZUTA 3UODA 3AC2A 1JVPP 1UNHA 4FODA 3SA0A 3QWJA 4K2RA 3HX4A 2F4JA 3ZLWA 3OTUA 2NO3A 1STCE 4D9TA 1MRYA 4QP1A 3BYUA 4IFCA 4XP0A 3MFTA 4XOYA 5E8VA 4R7IA 1IAHA 3QGWA 3KFAA 1E9HA 1SMHA 3DY7A 3NCZA 4F7JA 5KMKA 3EQRA 1H01A 3VQHA 4O7VA 2A27A 5JFVA 3OZ6A 3C50A 3TNHA 2ONLA 3QQGA 5FLFA 1Q97A 2YAKA 2R3HA 2QOCA 5E8TA 3ZBXA 3RCJA 3MB6A 5FDXA 4BGQA 2YHVA 5JQ5A 3C4EA 2EB3A 5HE3A 4C2WA 5IQFA 3UTOA 3IW7A 3PXQA 1SYKA 3DBCA 4U44A 5GJFA 2XK6A 2VTLA 3KMUA 4R1YA 4TNBA 4YZBA 3VW8A 4EJ7A 3O8TA 1OM1A 2C3KA 3F3UA 3E8CA 3NS9A 2RSVA 1BL7A 1H1PA 4ZTSA 4EH9A 2X6EA 1JWHA 3HMOA 1YXVA 3ZUUA 3DDQA 3VS7A 3C13A 3OG7A 5L2WA 3P7AA 3SX9A 2XNGA 4EZ5A 4JBVA 5I9UA 4DEEA 5IEYA 3V8WA 3LPBA 2V5QA 3UOLA 2VTOA 4HCTA 3L8SA 4FC0A 3UPZA 5JRSA 4CKJA 3KXXA 3GT8A 2R7BA 3OROA 3E62A 5L6OA 3LFCA 4WO5A 1OB3A 5LARA 4CKRA 3W2QA 5J1WA 2BZJA 1CM8A 4QTBA 4J1RA 5HCYA 4CRLA 2XCHA 3VC4A 4XH6A 5FG8A 2YN8A 4NM5A 2BIYA 4KIQA 4XCUA 3N4VA 2HXLA 3FZOA 4FK3A 2VGOA 4IVAA 1O9UA 4BCMA 1PKGA 4F99A 4YMJA 4OTHA 4EONA 4JQ7A 1U5RA 4KRCA 3D5VA 1L8TA 3OCSA 4S2ZA 3QTSA 2X2LA 3D94A 4IM2A 3PXRA 3WYXA 3D9VA 2BR1A 3MH0A 3ID6C 3V8SA 3R9NA 3QQLA 4CCUA 3Q52A 2WPAA 4JBOA 5AX9A 3FHRA 2UW5A 3R02A 5DYJA 3TKUA 2G2FA 3NZ0A 1JOWB 3CS9A 3DZQA 3QTXA 4CFMA 2G9XA 5KUPA 4ACMA 3EN4A 5EHOA 2R4BA 5L8JA 4MYGA 2I40A 2XK8A 1U59A 4GL9A 5CI7A 5E4HA 4BBMA 3E88A 5CNOA 3FQEA 5ETAA 1TQIA 3R9DA 2OJIA 5DI1A 2VO0A 2YM5A 4A7CA 5IA0A 1OL7A 3VJNA 4E20A 4OUCA 3HV4A 1IASA 4XBUA 2V62A 4AX8A 4O2PA 4Y5QA 1YWRA 2JDVA 4O7ZA 3R2BA 4LGGA 3U6IA 4J97A 4MXCA 3GP0A 3V6RA 3WZEA 5IG1A 3CP9A 2C0TA 2W5BA 3F82A 3I60A 2XIZA 1PW2A 1JKSA 3FLSA 4FTMA 5CY3A 4PL5A 3V5JA 5IEXA 1YWNA 2X1NA 2QONA 4C3RA 4F9WA 4X0MA 4BN1A 3NAYA 4IB3A 3OT3A 5D12A 4BCHA 3C0GA 5CX9A 4EOMA 4F7SA 2BFXA 4E6AA 3HV6A 5CSVA 1UWJA 2QO7A 5EDRA 4QRCA 1IA8A 4BDBA 4ZTNA 1YRPA 3VBXA 4QTEA 1H1SA 3WBLA 3NLBA 4AFJA 4D4RA 4U6RA 2W4JA 4KKHA 4RJ4A 3W33A 3AC8A 4G9CA 4NFNA 2BFYA 5EOLA 3ENHA 4AZTA 4XP3A 2XK7A 3HA6A 3NW5A 5HG9A 3OY1A 5K0XA 3SG8A 3HGKA 3CIKA 4GK4A 3UOHA 2J51A 4I92A 5DG5A 5JFSA 4F7LA 4NUSA 3R8LA 4ANOA 1NVSA 2YCRA 1WBVA 5FEDA 4XG7A 5HVKA 5JGDA 3AGLA 1H26A 5AP4A 4APPA 4CT2A 4EK3A 5CU4A 2EB2A 5I9WA 4G16A 3NGAA 4RG0A 1PXLA 4FL1A 2IPXA 1YW2A 3MJ2A 5IA1A 5JN2A 1Y6BA 4IX3A 2OJJA 4AGUA 1S9JA 4W4XA 4BDJA 4RJ3A 3AD6A 4AT4A 3ZO1A 2REIA 4PWNA 5A9UA 5EOBA 3GC8A 5BMSA 2YA9A 3OXIA 5CT0A 1ZAOA 4DBNA 3OD6X 4FTIA 5KHWA 1YHWA 3H0ZA 5AP3A 2H34A 2GNHA 4JNWA 4PTEA 2C5XA 2VX1A 3H0YA 1P4FA 5CSHA 5BNJA 2ETMA 5BQ0A 1LPUA 4ITJA 5J5TA 4J95A 4TL0A 5JT2A 1KWPA 5J79A 4O0SA 3ZSIA 5DMZA 4TWOA 1A48A 3G6GA 3VN9A 2HW7A 3DJ6A 3AOXA 4K18A 4O6EA 2XK3A 4YLKA 3ZEWA 4EQMA 2IVTA 3F3TA 3RINA 3R7VA 5HNIX 4RWIA 5LCKA 3A7HA 2JD5A 3NR9A 4U43A 4R3PA 4D2RA 4BHZA 1BI7A 3I1AA 3QUEA 5E92A 3B2WA 5IZFA 4QP2A 2WTCA 4NZWB 3SOCA 1G8AA 2I1MA 1P14A 5E9EA 2R3IA 2UW6A 2W1GA 2HZ0A 2XP2A 3PE2A 3BI6A 3PYYA 4ONAA 2W99B 4YZCA 3VS0A 3EFKA 3UNJA 4E6CA 4FV8A 4I6QA 2VWBA 4HVGA 2QQ7A 4M67A 1O6KA 2C5VA 4QYHA 4QQCA 1G8SA 4RJ7A 4HGTA 2XIRA 5HOAA 3NIEA 4RFYA 2QC6A 5BVFA 2ZM1A 5E8UA 4RRVA 2JDRA 4MAOA 1OZ1A 4Y83A 5KNJA 3CPBA 2KULA 1WVYA 5AAEA 2XIYA 4MD7E 1NW1A 2FYSA 1VYWA 4ZY4A 3MA3A 3R21A 3GBZA 4WUNA 2W06A 2QOHA 2PMIA 3NYXA 4BC6A 4RFMA 3D5UA 4YNEA 4X2FA 4C59A 2W1HA 4KB8A 5A4TA 1L3RE 4I0TA 5HX8A 1IEPA 2H96A 2R5TA 5I0BA 3NYOA 3R1QA 4L7SA 4XV9A 3IECA 2AC5A 3V5QA 5L2TA 3LXPA 1SNUA 3MFSA 1A06A 4BZDA 4EK5A 2VTRA 2C3IB 3SRVA 4LL5A 1FVVA 5CLPA 3C4XA 3LIJA 4YR8A 2VWIA 1M52A 4ANNA 4F08A 5HVYA 4FT7A 2PUPA 2QO2A 2WMSA 2ITNA 2QVSE 3CD3A 3QU0A 4HYSA 2GS2A 3FC1X 4MH7A 3UNZA 3ZRLA 2HYYA 3IW5A 3LCTA 4FSUA 4F1OA 5GZ8A 3TIZA 3RPRA 4DE4A 2WB8A 4FKVA 3G15A 4DTAA 2PTKA 2XVDA 1JBPE 3KVWA 3NYNA 4AS0A 4R8QA 4FV5A 5LWNA 2BTSA 5BVOA 2BRHA 3LCKA 1FPUA 2JDTA 2WMQA 3UG2A 4PX6A 2OW3A 2JC6A 4Z7HA 4USEA 4RLKA 4GYIA 3EIDA 4UWBA 5M55A 3GOKA 4O96A 5AP5A 1ZY4A 4M12A 4UBAA 4FUXA 4QOXA 3QCSA 2R0UA 4K11A 2BDJA 4GG7A 4WG3A 3IKAA 1REJA 5ANIA 5HE0A 1E1VA 4CMOA 2ITTA 1BYGA 2O8YA 3E5AA 4FV7A 3GFEA 2BAQA 5CZHA 5FBOA 3R0TA 3ZYAA 5D41A 3S2PA 4B99A 4DTKA 4XV1A 3EQGA 4GKIA 3ORTA 4ITIA 1H4LA 2WQBA 3Q9ZA 1J7UA 4EH7A 5ACKA 3VS1A 2R3QA 4B9DA 3U6JA 2WO6A 1YI6A 1LUFA 3UG1A 4YTHA 4D58A 5I3RA 4HVIA 1Y57A 4FV9A 5DBXA 4WD5A 5EM7A 1M17A 2F57A 4RPVA 4I0SA 4JR3A 2XYNA 5ANKA 3DU8A 4GCJA 4Y85A 3KXGA 4ZS0A 4DT9A 4IZYA 4RWJA 2BHHA 1FMOE 2IN6A 4XLIA 4F9CA 2UW9A 4AW2A 1JNKA 2RIOA 4FSWA 4FI1A 5CEQA 5HD7A 3F3WA 2IW9A 5GINE 5EI8A 3D4QA 3KGAA 4GJ3A 5M4FA 3LCSA 4FL2A 2OG8A 1Y6AA 4RC3A 5HZNA 3OW4A 5EFQA 3PXYA 2OH0E 3ZCLA 4H1MA 4DH1A 4WG5A 3POOA 3VAPA 4LOOA 2ETRA 4EHEA 2QOKA 1E1XA 2G01A 5IQAA 2FUMA 4OTFA 2FO0A 4FZAB 4K1BA 4CFNA 4EQUA 3MV5A 2WMRA 4RIYB 3SXFA 1Q62A 2BUJA 3EMGA 5DIAA 1OKZA 3W8QA 2GQGA 1YI3A 4IC8A 4EOLA 3EHAA 3WARA 2J0KA 4FV2A 4RC4A 3HDNA 3PXZA 2J0LA 3MPAA 5G1XA 3O23A 3R7OA 4J52A 4KRDA 3ZDUA 3FMHA 5TR6A 3T9TA 4JDIA 5HU3A 5JGAA 5F1ZA 4FR4A 5IMEA 5J5SA 2PVNA 4YTFA 2QCSA 2X0GA 4IXPA 2PVJA 4QMNA 5AUVA 3AMYA 1NVRA 2BILB 3OXTA 3HL7A 1PRYA 4RJ5A 4AZEA 4GH2A 4YPSA 4NIFB 2WFYA 3RM6A 2O3PA 3FBVA 5C27A 5HESA 4B7TA 3C5UA 3MTFA 3PP0A 4J98A 4NKSA 5DVRA 4YPDA 3GGFA 3IG7A 3AQVA 5BYYA 3D15A 4D5HA 2PULA 1OBGA 4GSBA 3HRBA 2QU6A 4FKWA 4GV1A 1OKVA 4JRNA 5IA5A 3VIDA 2GQRA 1FVRA 3VUHA 4WNMA 4C4GA 4TYJA 1HCKA 2IZTA 4FNZA 1ZRZA 4E6QA 3KK8A 5ANJA 1M2RA 4ZJIA 3M11A 3NUYA 2C68A 2W0JA 4GJ2A 4K77A 5HNGA 2VO6A 4L3LA 4F9BA 2PMLX 1FINA 1DAWA 2QR7A 3NW6A 3DA6A 1R1WA 3AD5A 1URWA 4U79A 4ZTHA 4D2PA 2J90A 4Q9SA 4ZTLA 3PJ8A 4APCA 3EQDA 4IWQA 1LR4A 4PMTA 2PE1A 3FDNA 3KXNA 3K5UA 3EFLA 4GK2A 3RALA 3MGYA 4F0FA 2XM8A 3I4BA 5K3YA 4ACGA 3A62A 3BLQA 4PL4A 3R8MA 4IWDA 4XMOA 5BVKA 1ZWSA 2PSQA 2WEVA 3ZXTA 4QMQA 1NY3A 3ANRA 4PUZA 1NA7A 5CU0A 4TRLA 3KRRA 3PVGA 4DFBA 3FI8A 5LJJA 1K2PA 2YIXA 1OI9A 3A8WA 2XIKA 3G0EA 3QA0A 4GMYA 4AFEA 2ITOA 3RNYA 4GIHA 4BCJA 1UKHA 4XLVA 4P4CA 1OUKA 4ZLOA 1S9IA 3LXNA 3MH1A 2OF4A 3VS4A 3O8PA 4C57A 4OBPA 5CU2A 3KC3A 3MDYA 2JDSA 3I6WA 4O0WA 4ASDA 2XJ1A 4RVTA 4HYHA 3EWHA 4RQKA 4D2VA 5IF1A 4W8EA 3E64A 4GFOA 4KNBA 3IW4A 3SXRA 4ZJVA 1YDRE 2B55A 4MXOA 4RZWA 2CGWA 2YACA 4C34A 3AXWA 4H39A 4F0GA 3DLSA 3MH2A 3HMMA 4FKTA 3TTIA 4BB4A 4GU6A 4PDYA 1Q3DA 4I24A 4N6YA 2IZRA 1QCFA 2JFLA 2UZBA 1SVGA 4IVBA 4C4IA 3LMIA 3VS5A 1T46A 4D2SA 3T3UA 4AUAA 3PIYA 2O65A 5GZ9A 1Y8YA 3RP9A 4EH3A 1XBAA 1ZMVA 2WNTA 3KRWA 2H9VA 4DC2A 5F4NA 4PMPA 4NM0A 3NX8A 3O8UA 4IW0A 4HNFA 2WAJA 4MXYA 3HAVA 4X2KA 3NDMA 4MWIA 4YLLA 2O0UA 3NNXA 3QTWA 4S31A 3QZFA 4ACHA 4BL1A 2V55A 3QX2A 2SRCA 4ASXA 5HCXA 2R0IA 3BX5A 3L9MA 3TJCA 3UP7A 3WF9A 4FT0A 2P55A 2EWAA 3O51A 1H1WA 3EQCA 4JX7A 4QMZA 4EORA 3VULA 2JITA 3IGGA 3PY0A 4FE2A 3OT8A 1DS5A 4KKEA 3COKA 1I09A 4CV9A 4DFNA 1U46A 5ETFA 4LG4A 3REPA 3R22A 2PYWA 3BBWA 3F7ZA 1A9UA 1VJYA 3H30A 5TE0A 4D5KA 5HU9A 3MB7A 3FZPA 4QMLA 5D11A 5J9LA 1JAMA 1V0OA 1LEZA 2YWPA 2CMWA 4I20A 2Z8CA 3ZOSA 3FZSA 5BVWA 2FA2A 4LUEA 3KF4A 5GHVA 4CSVA 4I6FA 3KA0A 1W84A 2X4FA 5J7HA 4J53A 3CGOA 5HE2A 4RC2A 3HV7A 2PE2A 4I0RA 4KIPA 5EHLA 2XK4A 3Q5IA 2CJMA 3R71A 3GCSA 4C62A 3CEKA 3FHIA 4I21A 2V7AA 4K8AA 4BI0A 3F2RA 3DXNA 1FGKA 3ORPA 3FMDA 3FMNA 3CTJA 2R3PA 3FKLA 3LFDA 3PY3A 3IOKA 5DR6A 1U5QA 4DEDA 5F9EA 1DM2A 2BZIB 4XHKB 2WMUA 2V7OA 4C2VA 4EHVA 3DCVA 1U54A 4I4EA 4PTCA 4AE6A 3AMBA 3P1AA 4PTGA 1QPEA 5KZIA 2XKEA 3OMVA 3PJ3A 2Z7SA 4NCTC 4DFZE 2JLDA 4D0WA 4TKSA 4HZSA 4YBKA 5JZNA 4C4JA 4ANLA 2R3MA 3COHA 5HG8A 3BBTB 3RZFA 4LOQA 2ETKA 3ALNA 1IR3A 4EK8A 3ZFXA 5HO7A 1AQ1A 4NW5A 3RI1A 4A07A 1TQPA 2WTKC 3BLRA 1KE9A 3NNVA 3QQHA 4WSQA 2QI8A 4DFUA 3SW4A 1Q4LA 5HBJA 5CEOA 3II5A 4PNKA 5AV1A 4ARKA 3ORMA 3FWQA 1YOLA 2CGXA 3F5UA 5DT4A 4PNIA 4YO4A 4Z3VA 5JQ8A 2CCIA 2VO7A 3B8QA 4GFGA 4IAAA 3QZHA 4E1ZA 3IQ7A 1OBDA 1OKYA 4FZDB 5EM5A 4F64A 4Q5HA 2Y6OA 4KIKA 4JAJA 4P90A 4BTFA 5FXSA 2ZV9A 3FYJX 4PDSA 3HP5A 3VUKA 1OECA 3L8XA 3KMWA 2GHMA 5HTBA 5BVNA 3LQ8A 3PLSA 1Q8UA 4X6QC 4NCTA 2VNWA 4FZ6A 2OK1A 4NTTA 5HG5A 1ZZ2A 4UXLA 1B39A 2PVKA 1WZYA 2IZSA 3BGZA 3H10A 5KBRA 2E2BA 2OLCA 2WKMA 4GT4A 5AV2A 4BZNA 4BDGA 2OSCA 4IDVA 3DGKA 4E73A 4EWHA 4C36A 1WVXA 4UYAA 3RK5A 3I0QA 2W1FA 1XKKA 4Y73A 3HVCA 3MTLA 4RIYA 4D1ZA 3ERKA 3N51A 1R39A 1G3NA 2HZ4A 5CANA 5CEMA 3V3VA 3GCQA 2ITYA 4KAOA 4KBKA 1R78A 4OTQA 4S32A 2NRUA 2BHEA 4QD6A 4OAUC 3THBA 4NYEA 1TQMA 4TNDA 5KMLA 5AUZA 3VJOA 2J0IA 2ITUA 3UVPA 4O7SA 1RQQA 5A4QA 3CSVA 2WD1A 4IVCA 4BFMA 3KU2A 3ENMA 2YIQA 4QT1A 3NMUF 2EXMA 3RWPA 2OXYA 4IAYA 2WMTA 4FV6A 5JFWA 2ZV7A 5IQIA 4BDCA 3GOPA 3ETAA 4Y72A 5JEBA 4AP7A 2WTIA 3BQCA 1ZYCA 5KKRC 3HKOA 3G33A 2OXDA 2W1ZA 2QOFA 3U9CA 3ZZWA 2KTYA 4FOBA 4BIBA 4WNPA 4HCVA 4FSQA 2ZDUA 4G31A 2VAGA 1WBTA 2P2IA 2YERA 4EK6A 4CZTA 3SHEA 4UB7A 3E3BX 4BCFA 4WOVA 3DJ5A 5HD4A 4X3JA 2VGPA 4BI2A 1Q99A 5C26A 4M3QA 3OP5A 4U7ZA 4CT1A 4J7BA 5T68A 4MXAA 2W9ZB 3BELA 3F6XA 3RK9A 4I6HA 2EUFB 3SRVB 4DEIA 5M4CA 4W9WA 3LFFA 4O27B 2G2HA 2ZB0A 2PZPA 3K5VA 4DHFA 4ZTQA 3QZGA 2JIVA 2W05A 3KF7A 5EG3A 4O7TA 3V51A 4E4XA 4RX5A 2DYLA 1XBCA 2OIDA 5CENA 3UNKA 2LAVA 4JIKA 2PVYA 4QQJA 2P0CA 3D2IA 3O2MA 4YGAA 4BYJA 2I0HA 5HTCA 1B38A 3HRCA 1ZMUA 3FLQA 3HMPA 4R3CA 4EYMA 3F3ZA 2UVZA 3LJ1A 2WOTA 3AC5A 2YM4A 4XG6A 2YM8A 1T45A 4F65A 2PVLA 1HCLA 3KREA 3NUAA 3PSCA 2J2IB 3EQFA 5ETIA 2A2AA 2Z60A 1W8CA 3HA8A 3JR1A 3ZRMA 2QG5A 4IC7A 2XB7A 4L43A 3N4UA 5JRQA 3E92A 2YDJA 3AMAA 4LV8A 2BIKB 4C58A 5EI6A 4LFIA 2VTJA 4YO6A 2R3KA 5E8WA 2QNJA 5I9YA 4R7HA 3A7IA 3NUSA 3VF8A 3FKNA 3A4PA 3Q32A 4G3FA 4AA5A 3FI3A 3MVMA 4EI4A 1MUOA 3GI3A 3MJ1A 4DFXE 5IISA 3CQWA 3OBJA 4LUDA 5BYZA 3MFRA 2F2UA 3NUPA 3FLZA 4UWCA 5EQPA 4FNXA 1TKIA 4HGSA 4AU8A 2XJ0A 5DHJA 1OVEA 4BDHA 4BRXA 2XM9A 3S0OA 3R7GA 4IEBA 3P23A 2IJMA 2JBOA 1Q8TA 1REKA 4O6LA 4YJTA 5DRBA 4ZK5A 5LWMA 4GW8A 2X2KA 3WYYA 4IWPA 2X8EA 4JBQA 3G90X 3ZC6A 3GQIA 1ND4A 2FSLX 2B52A 4BTKA 4EZ7A 1V0PA 3BE2A 3F5XA 4FIJA 3QUDA 1ZARA 4JDKA 3COMA 5TOZA 3K3JA 4CEGA 4USFA 4FSNA 2BMCA 3O50A 1WAKA 4FTRA 2WMWA 3CBLA 4YHTA 4RX8A 3PLAE 3C51A 3KMMA 4I5CA 2YJRA 2PPQA 4ZLZA 2F7ZE 4FL3A 2OO8X 2PVHA 3EZRA 3QQUA 5HBHA 3ZLSA 2OZOA 5CTPA 2QURA 3ELJA 3KY2A 5CQUA 2HWPA 3V5TA 4YJVA 2IG7A 1RE8A 4XV2A 4R78A 3ZO2A 4AGWA 1GNGA 2X8IA 2JAMA 1UNGA 2GNJA 3TG1A 3TT0A 4AN9A 4IB1A 4BCNA 1BUHA 1ZLTA 3FMMA 4FKPA 4C3PA 4EK4A 4NM3A 3NUUA 3C5IA 3CC6A 3BIZA 2ZV2A 4IADA 2G2IA 2GNGA 4GT5A 4XX9A 1R0PA 3IO7A 5FP5A 2WZJA 3VNTA 3OWJA 3DNEA 3RPYA 4QTAA 1CDKA 3BYMA 4BWPA 3AC3A 3V01A 4C38A 4AG8A 3HMIA 4CMUA 4CV8A 4AA0A 4DH7A 4QTDA 4I22A 4U42A 4UMQA 3QD2B 3PJ2A 3CE3A 3QD4A 3ZH8A 4U0IA 2XF0A 3NWWA 3ORXA 4QYYA 3ROYA 4CXAA 4ZMEA 4C3FA 2FH9A 3QCYA 4QMPA 1QPDA 2ITXA 4TYIA 4DH8A 4E5WA 3PSDA 1WBNA 2XIXA 4N6ZA 2IZUA 3VBQA 2JKMA 3G9NA 4UEUA 4EOSA 5GZAA 4QYFA 4QMSA 3W55A 3B2TA 3CGFA 3VUMA 1UV5A 4ZXTA 4AW1A 3PSBA 3VUTA 4BWKA 4YZMA 3WF5A 3PWDA 5EW8A 3RBWA 5KMIA 1WCCA 4IX6A 3ZLYA 1PMUA 3P79A 4I3ZA 5K5XA 3ORLA 5C1QB 2QOIA 2R3GA 3FY0A 5C4KA 3FLNC 3LAUA 3R8VA 3BYVA 4OGRA 5G6VA 3EH9A 2B9JA
chains in the Genus database with same CATH superfamily
4F63A 4O81A 1MQ4A 4QEBA 1FOTA 2QHMA 3AKKA 3LFNA 4JG8A 3PXFA 4ANSA 2BTRA 3MY0A 2BRNA 1RJBA 3EQHA 3BE9A 4FTQA 5IKWA 3LXLA 2JIIA 4D4YA 3QF9A 5L4QA 2BRBA 2WEIA 4PL3A 5CALA 1W2FA 4NU1A 2QG7A 3UC3A 4CKIA 5DE2A 3CJGA 4FF8A 2ZFYA 1XJDA 2E9VA 3T9IA 3ACJA 4DEAA 4ZLYA 5IQBA 2PZIA 3DS6A 2OI4X 3RZBA 5IPJA 5M09A 2HIWA 2W9FB 1TFFA 4I4FA 3WOWA 2AQXA 3RMFA 2HXQA 3HP2A 5ICPA 3P7BA 5KHXA 3W8LA 1W83A 3L9LA 1OIUA 1GIJA 1ZYDA 3CQEA 4J71A 4L42A 3LW0A 4AQCA 1JLUE 3QRTA 3NRMA 4L01A 3L8VA 3PDTA 1B6CB 2EVAA 2V0DA 3W0MA 2CGUA 3DK6A 2YJSA 4HPUE 3SW7A 3OF0A 4YHFA 3UE4A 5E8YA 3FY2A 4FKGA 2UW8A 4HYUA 3RPSA 3WE4A 4EL9A 1FBNA 2IVSA 3NPCA 1JSTA 4X2JA 1UU7A 4QP7A 4A9RA 2WGJA 5CXZA 4U40A 3LQ3A 5AA8A 3Q96A 2OFVA 4IZAA 5M4UA 3TUDA 3SG9A 2GFSA 1KUTA 4AXCA 2ERKA 3ORIA 5ITAA 3CQUA 3MY5A 4N70A 3BEGA 3I79A 2Y4IC 3PPKA 4KSPA 1PHKA 2AUHA 2G15A 4JS8A 4MNFA 4X3FB 2RGPA 3KK9A 3IPHA 4RVLA 1WFCA 4FG8A 3E63A 3MYGA 4Z16A 2VTHA 4OTRA 3U6HA 3BV2A 4I5MA 1H1QA 3MSSA 2R3FA 5AM7A 3DK3A 4DFYA 5CI6A 3LLAA 4TT7A 5AUYA 4ANBA 4V04A 4DT8A 3TDWA 2YITA 3EN6A 3OCGA 4C35A 2ZM4A 3NUXA 5EM6A 3W1FA 4BCIA 2G1TA 2EXEA 4NK9A 3QRJA 3W2PA 4KINA 4D2TA 4EOIA 3ATTA 5TF9A 3R8PA 1Y8GA 4ZEGA 5LMAA 3H3CA 3G0FA 3WE8A 2XBJA 4G1WA 4EBVA 3AGMA 1H25A 2E9PA 2CN8A 2W1CA 1SZMA 2YISA 1BI8A 2X2MA 2CLXA 4IQ6A 3GU5A 1GZNA 3FYKX 3D83A 3W2RA 5GIPE 3MBLA 2C5NA 3RHXA 5HIBA 2GCDA 2BZKB 2ZAZA 4FEVA 4IJPA 5FEEA 4BDKA 4QO9A 4C7TA 4S33A 5L3AA 4GS6A 4FZFB 3ATSA 3TUCA 3DKFA 3QRIA 4QMXA 1JKLA 1H07A 2VWWA 2UW3A 4ZOGA 4W8DA 4F9AA 5IA3A 2YIRA 4CFFA 3OXZA 4BCPA 3D7TA 5J95A 2ZB1A 3FPMA 3M2WA 4PMMA 4XJ0A 3VBTA 5JSMA 1QPCA 4G6NA 2ITWA 3KVXA 3Q60A 1JKKA 4WBOA 3QYWA 2JBPA 2PVFA 2RL5A 1M7QA 5FQDC 3VBVA 4R1VA 5CF4A 4A4LA 4ZMFA 5J8IA 3QBNA 3KIOC 4B4LA 5I3OA 2W96B 5FM3A 4UALA 1I44A 1P4OA 1U54B 2HCKA 3R04A 1M2PA 1Q41A 1QPJA 3PVUA 3VS2A 5E7RA 4E3CA 3QC4A 2FSTX 3R30A 4FTLA 5K4JA 1OL2A 2ZV8A 3R9RA 5A46A 2E9NA 4YJOA 3P5JC 3NNWA 2ITVA 4PPCA 4H3PA 4OAVB 5AJQA 4GVAA 4FTNA 1P5EA 4ZP5A 4RZVA 3MWUA 1VZOA 5E8SA 3FV8A 2WU6A 4WBBB 3RPVA 4FT9A 4FT3A 4RIWB 4DFLA 2VX3A 2PWLA 4DF3A 2BZHB 1JPAA 2VU3A 3K3IA 3ORZA 3RM7A 3KQ7A 4F6SA 3ZDIA 4FV3A 4U8ZA 4XUFA 3C7QA 1OIRA 4FJVA 3DAKA 4BI1A 4HZRA 4FSZA 3FSFA 4EUTA 1DI9A 5EQEA 3TM0A 3SVVA 2ITZA 5AAFA 4DGLC 4LL0A 4ASZA 5A4CA 4K33A 5KZ0A 1PMEA 4KIKB 4AT3A 3HEGA 3P86A 3NUNA 2Q83A 4AGDA 2R2PA 4CZYB 4BDDA 4AT5A 5HCZA 3C0IA 4LRKA 2PMOX 2F2CB 1K3AA 5CSWA 5D1JA 4FKRA 3JPVA 4FYOA 4EKKA 5DPVA 5CVGA 4KIOA 4CFXA 5CSPA 4A4OA 4MF1A 2CKOA 2B53A 1KE7A 4DHZA 3W2OA 4TYGA 2YCQA 1WBOA 5GIOE 4I1ZA 4RIXB 4TYEA 4R5YA 5JK3A 4P7EA 4RT7A 3RAIA 4CLIA 1V1KA 1XWSA 2C30A 2WTKB 3I7BA 3QFVA 3I5NA 4FG9A 4MCVA 4RA4A 5BVEA 3HAMA 3ZLXA 1YKRA 3G2FA 1MRVA 4PPBA 2B0QA 4EBWA 4MNEA 5CVFA 3WF7A 1ZOGA 4LQMA 3MA6A 4AGCA 2C6IA 3DQWA 3I6UA 3UOJA 4AXEA 3CCNA 3W18A 1NVQA 2JFMA 4F0IA 4ORKA 3QHRA 3GCUA 3BPRA 4UZDA 1HOWA 5D7VA 3O7LD 4M69A 1YI4A 3CTHA 2QD9A 3C9WA 2PE0A 2XCKA 3NW7A 3OFMA 4EZ3A 3C4FA 5L6WL 3ET7A 4KKGA 2UUEA 4XG9A 4G3DA 3MI9A 4WRSA 3N4TA 5D7AA 1J7LA 3A7JA 3R7YA 3PVWA 4L6QA 4RIOA 3H9FA 4EOOA 2GSFA 5I4NA 3ZO3A 1M14A 1WBWA 2BDWA 4JL9A 3QYZA 3F69A 2IO6A 4K0YA 4X6RA 1H0VA 3D5WA 2UV2A 4BGHA 2GTNA 4IAIA 5AR4A 4M97A 4OR5A 3HYHA 4C02A 4HYIA 5B2MA 3GNIB 3OEFX 5EYKA 3R7EA 4RJ8A 3EZVA 2CSNA 3EQIA 3QUPA 4FKLA 4R7BA 4TXCA 3LVPA 3DBQA 4M68A 4RWLA 1KE6A 3DLZA 4GRBA 1KOBA 4J99A 3BEAA 2YIYA 5ANEA 3UVQA 2OIBA 4YJUA 5E91A 3ZUVA 4GEOA 1G8JA 1H0WA 4U81A 1ZYLA 4FSRA 3OBGA 1OPKA 2VTSA 2W4KA 2Y8OA 3KB7A 4XS2A 5C03A 2RFSA 5IQHA 3EL8A 2BAJA 4ANQA 2YCSA 5AP2A 4JBPA 3LXKA 3C0HA 3R63A 5HHWA 5IU2A 2FGIA 3QTQA 2EXCX 2OICA 2PL0A 4G5JA 5KKRB 3QKKA 4X3FC 4HVHA 3PZHA 2QOQA 2GS7A 4V01A 4ZSJA 3ZFMA 2I0VA 2GNLA 4ALWA 3E93A 3BHYA 3FKOA 4FTUA 3QALE 2Z7QA 2HK5A 3VHKA 3F88A 4II5A 4O1PA 4OBQA 2YFXA 5IQCA 2W4OA 4ERKA 2BDFA 4HCUA 1IG1A 4NFMA 1NXKA 4CVAA 4I6LA 4ENYA 3GFWA 1ZY5A 1V0BA 4QP8A 3CY3A 4BDIA 2QO9A 4UY9A 3PFYA 5LVPA 3LMGA 4Q2AA 3VUGA 2YM3A 2X0OA 4I6BA 3VUIA 5IEVA 3F2AA 3QTZA 3F5GA 5IDPA 1W0XC 2RG6A 2OGVA 4LMUA 1KV1A 4QQ5A 5F94A 4FG7A 4XYFA 3DK7A 3R8ZA 4J8MA 5CEKA 4CNHA 1Q8ZA 4JXFA 4EOJA 5B7VA 2X6DA 5CASA 2B9IA 4IB5A 1PXKA 3BGQA 3R9HA 3UC4A 4X3FA 3U87A 5KCVA 3G9LX 1W7HA 2X8DA 3MPMA 3MVHA 3LJ2A 2YZLA 4FOCA 4IX4A 4B8LA 2VWVA 3UO4A 3DAEA 5BX0A 4PDPA 3MFUA 4EQCA 5KMOA 2C4GA 3SXSA 3E7OA 3TTJA 2OJFE 1UVRA 3OW3A 4S34A 5FRIA 3DNDA 3GCPA 1MRUA 3OUNB 3QQKA 4MBIA 4W4VA 3SD0A 4DEHA 3V04A 3JVRA 3ACKA 2V22A 3DQXA 5IA4A 2VNYA 4YHJA 4MX9A 3UZPA 5I9XA 4HPTE 3BV3A 4QYEA 2GHGA 1KE5A 3QCQA 3A2CA 3TWJA 4AZVA 4MD9E 2VTAA 2VWXA 2JKOA 3I0OA 2PHKA 3UDZA 3QXPA 4FGRA 4U45A 2DWBA 3D0EA 3IS5A 4L00A 5AV0A 2YEXA 1UU8A 2DUVA 2OZAA 3NYVA 3PP1A 5IUIA 2WIHA 3OHTA 4Q5EA 4QMMA 4RX9A 2RG5A 4AWIA 4IM3A 3FEGA 3OVVA 2QU5A 5AP7A 4X21A 2Z7LA 1JQHA 3ZMMA 3ZHPC 5A6NA 4NH1A 5BUJA 3TCPA 4U9AA 3FAAA 1APME 4G17A 3GXLA 4JRVA 3O7LB 4DGMA 3CKXA 2E9UA 2XUUA 4AOIA 1PXJA 2F9GA 1TVOA 2VWYA 5K4IA 5B2KA 5LMKC 3FL4A 3EQPA 4OLIA 5CEPA 5LVNA 2XJ2A 3I5ZA 3KULA 4BWXA 5A4LA 5DT3A 4XEYA 3GU8A 5A6OA 4FSMA 3VBYA 4I41A 5EKOA 2A1AB 2QKRA 5K5NA 3OWKA 5E90A 2J5EA 4TN6A 3LCDA 5M51A 4G3EA 3TZ7A 2XBAA 3OOGA 3JXWA 3Q3BA 3Q4UA 4AZWA 2HZNA 5CZIA 2OF2A 3SQQA 4GFMA 3V8TA 5M06A 4LOPA 5CNNA 1J91A 3RVGA 3UP2A 1O6LA 2Q0BA 2XKDA 4EHZA 5ANOA 4XBRA 4YJNA 4F6UA 3R1SA 3EN7A 4JG6A 4RIWA 1H28A 4DCAA 4K6ZA 4NM7A 4E4MA 2Y6MA 5CXHA 3QL8A 3P4KA 2O63A 2C3JA 3LFBA 2IW6A 5EYMA 4U80A 2X39A 2CLQA 4G6OA 5AR3A 2RFNA 5FGKA 5LMKA 3S4QA 3TEIA 4W4YA 5EDPA 2GTMA 3Q2MA 4BTMA 5KMNA 2YWVA 4AOJA 1KSWA 4MBJA 4KUJA 3JUHA 4LM5A 2WQMA 1XH6A 2BKZA 3GC0A 5LVLA 5C01A 3CJFA 4BCOA 3PY1A 4WIHA 2H8HA 4FBXA 2R3JA 3FZTA 3QD3A 4CRSA 3E8DA 5BYLA 5DR2A 3VRZA 2J7TA 3Q53A 3GEQA 4U3ZA 3R7IA 2Y4PA 4EHGA 4NWMA 4KD1A 3QLFA 3AT3A 4GG5A 5CT7A 2I0EA 3E7VA 3F61A 4ZY5A 1J7IA 4AZFA 2Z2WA 2R3NA 4KABA 4BIDA 4DLJA 2XEYA 4LGDA 4ASEA 4FEXA 2XYUA 4RIXA 2YCFA 4WSYA 5CAQA 4I94A 5KX8A 1WVWA 3FMEA 4M14A 1UU3A 5AUWA 3SC1A 3BRBA 4G34A 4EWQA 2R9SA 2FSOX 4EH4A 3UIBA 2YABA 4BBFA 4KWPA 4BKYA 5AEPA 3UMXA 1GY3A 2XRUA 4UMRA 4O7RA 1H00A 5L2IA 2UW7A 4I5PA 5HQ0A 2O2UA 4M0YA 4XP2A 3IGOA 3UIXA 5DFPA 2YM7A 2VV9A 2JAVA 1PXOA 2IVUA 1IAJA 3VONA 3FLWA 4IIRA 3LKMA 4R77A 5HO6A 3NAXA 2WTWA 1GIHA 4QP3A 4JIAA 2VO3A 5CYIA 1OITA 4L7FA 5GJGA 5IQDA 5KMMA 1CSNA 2WTVA 4L3PA 3R8UA 3G6HA 2HY0A 4G5PA 3FLYA 4PP7A 1Q5KA 3A4OX 2O5KA 3VRYA 3A60A 2OXXA 3C4ZA 1IA9A 3QTUA 1OUYA 3PA3A 3ZTXA 5KBQA 2UZNA 3OY3A 4YTCA 1PXMA 3K54A 5AAGA 5AR2A 5FBNC 4IZ7A 2J50A 3BU3A 3TI1A 5FUTA 4O4EA 4YNOA 4O22A 1ZZLA 4FSTA 4FICA 1H27A 1BL6A 2VD5A 4I23A 3R7UA 3R01A 3TV7A 4O0TA 4QP4A 4TWCA 4UZHA 3PIXA 3QQFA 5FTOA 1JSVA 2RF9A 4WKQA 5ANGA 5IQEA 4YTIA 3LLTA 4IANA 1PMNA 3NIZA 3DKGA 4AA4A 4E4LA 1OKWA 2JEDA 2Y4IB 3L8PA 3PTGA 3U51A 2VX0A 2UW4A 2X7OA 2IVVA 3PE1A 3UYSA 3D7TB 4DYMA 4EJNA 3Q04A 2F7EE 4FVQA 2ZOQA 4L53A 5H2UA 5GNKA 1GOLA 4NTSA 3BKBA 4P5QA 3A7FA 2P2HA 1WBPA 3LFSA 4ERWA 3DXPA 4TPTA 4CYJA 1ZOHA 4PDOA 3Q4CA 5AR7A 4F9YA 3RGFA 3QWKA 1W2DA 4W9XA 1PJKA 2YLFA 4KSQA 4PF4A 2Y7JA 5M56A 5JZJA 2XNMA 3WZKA 4U41A 3G5DA 4ENXA 4Z55A 4CQEA 4C0TA 5CU3A 1F5QA 2B9HA 3AD4A 3QD0A 4JR7A 3RJCA 3G51A 5B0XA 3A99A 3B8RA 3ZFYA 2GMXA 3ZSHA 4EOPA 3EN5A 4YC3A 2XZSA 4LV5A 5A54A 5L8KA 1PYEA 4YZNA 5HBEA 4O83A 2WOUA 5GJDA 4DEBA 5JFXA 4PQNA 2R3OA 5EW9A 5FD2A 4ZTMA 5M4IA 2C0IA 4HVDA 3ORNA 4FYNA 2OFUA 4CQGA 2CKQA 3R83A 1GIIA 3IOPA 3ITZA 3PVBA 3VVHA 5HICA 2UVXA 2UZUE 3EYHA 3S3IA 2ZVAA 2I6LA 5CQWA 2BROA 3Q9WA 5M44A 4YJQA 3R2YA 3R73A 1CTPE 1QL6A 1Y91A 1FVTA 3JY0A 4G3GA 4HGEA 4L44A 5AP1A 4O91A 4PPAA 2JIUA 3TIYA 4DBXA 3U55A 4O0XA 3SOAA 5HE1A 4MK0A 3CPCA 3UMWA 4QP6A 5EHYA 3V5LA 2QKWB 4YC8A 2C1AA 3MVLA 3P5KA 3U4UA 2WIPA 3QX4A 3ZXZA 2AYPA 2GPHA 1Q8YA 2XRWA 4MEDA 3VO3A 3RAHA 5AFVA 1VR2A 2EU9A 3DPKA 4FNYA 3KXMA 5CAPA 2R3RA 3PG1A 4NL0A 1M2QA 5JKGA 5EYCA 1YOMA 4J8NA 2FVDA 1WMKA 3Q9YA 4USDA 3W2CA 3KKVA 3NFFB 3QKLA 4ZZMA 4A4XA 4F1TA 3H9RA 4Z9LA 3L9PA 2W1IA 2ZM3A 4FTTA 5HORA 5AA9A 4UX9A 1AGWA 4M8TA 5T6KA 4JJRA 4DEGA 4DDGA 4QMUA 2B9FA 5DEWA 3K2LA 4IVDA 4MHAA 4BIEA 3R1NA 4YC6A 3HV3A 1GZOA 4HOKA 2UZVA 4RMZA 4B8MA 3HDMA 4CFVA 5FDPA 2JGZA 4MNEB 1CKJA 1ZYSA 5AM6A 3TV4A 4NJ3A 1ST0A 4WA9A 2ZDTA 3FQHA 2PUUA 4RVKA 3M1SA 5HEZA 1FQ1B 3MIAA 4OT5A 3SLSA 3U9NA 2YIWA 3FXXA 2J0JA 4H3QA 4GYGA 4M69B 4O1OA 4BCKA 2A19B 4ZSAA 2VWZA 3GC7A 3DKCA 2P4IA 3EJ1A 4JLCA 4O7YA 2C6LA 3FJQE 3LHJA 2PUIA 3ULZA 4R5SA 4MVFA 4FIEA 4PP9A 3PFQA 3MY1A 4TW9A 4BF2A 3E8EA 3OTVA 4O4BB 5EQYA 2JKKA 3ZS5A 3O96A 4RJ6A 1YDSE 5K0KA 3TACA 4XV3A 2C6MA 3DAJA 5E8ZA 1R3CA 5FTGA 2HW6A 4FT5A 3TL8A 3RAWA 5HI2A 4O7WA 4QMVA 2CNUA 3LOKA 3PUPA 4JMQA 4DG2E 2ITPA 5KO1A 3NSZA 5H8EA 3DOGA 2VTNA 4NSTA 4OTDA 3ANQA 3IW6A 4O0UA 4MWHA 2PU8A 2ERZE 4E6DA 4TY1A 2OU7A 4QTCA 2BKKA 4QDEA 3KRLA 4V05A 5FWKK 4CGAA 4ACDA 5F95A 2GNFA 2XS0A 3OWLA 3GB2A 2QR8A 4IAFA 3RPOA 4E5BA 4OTPA 3UVRA 5LXMA 3LM5A 4UN0C 5J7BA 1H8FA 4XRJA 2XA4A 3CY2A 4WG4A 4E26A 1CMKE 3IONA 4EKLA 5K9IA 2W7XA 4GUEA 1ZMWA 4TZRA 2IWIA 2OBJA 4FV4A 5HTIA 4UYNA 3Q9XA 2WTJA 3BCEA 5LMBA 1FGIA 2X81A 2ZYBA 3FMLA 4GUBA 5AUTA 2UZDA 3RWQA 4DGGA 1U4DA 4QMYA 3FSKA 5DOSA 5AWMA 4BBEA 3S1HA 2BRMA 4U5JA 4FEUA 2C6KA 2R7IA 3VW6A 3F9NA 4FX3A 4G6LA 4GKHA 3DBFA 3BHVA 4TYHA 3L1SA 3TNQB 5A14A 3TUBA 4W4WA 3TXOA 5HIEA 4RSSA 4IAKA 3LJ0A 4ZZOA 3BHUA 2XNNA 3WZUA 5JGBA 4FTCA 2YZAA 1OPJA 3RK7A 3DJ7A 3FMJA 3R00A 4YSJA 3KN5A 4M84A 3EFJA 3P0MA 4R3RA 4NJDA 4XG4A 4CTBA 1YOJA 4FNWA 4H3BA 4NT4A 4Y5HA 2C47A 2Q0NA 2XH5A 4DITA 2QOOA 3GC9A 3KCKA 1OIQA 1KV2A 3EFWA 4XG3A 2X0PA 5IQGA 3V5PA 3ZONA 4WHZA 4Y8DA 3ZZEA 3C4CA 2LGCA 3F2NA 3RNIA 2O64A 3KXZA 4D9UA 3CD8A 3E3PA 3OCTA 5BUIA 3HV5A 3Q6UA 4FKJA 4M66A 2UW0A 4V0GB 2WMAA 3UBDA 3PPZA 4M15A 2AC3A 2WTDA 2VTPA 4L46A 4DAWA 4YUQA 3DXQA 4QMWA 2J5FA 3HUBA 3UO6A 5FP6A 3ROCA 3HECA 4O7NA 4BCGA 1RW8A 4FGBA 4FK6A 4KS7A 4D4VA 5L6PA 3D2KA 5DGZA 5IA2A 4M0ZA 1YXUA 3JY9A 3BHHA 3QRUA 3WZDA 3E8NA 2OH4A 4G3CA 2IF8A 1P2AA 2UZWE 4BY9E 4AACA 4YZ9A 4ZZNA 3QHWA 5BVDA 5TO8A 5H8GA 4I93A 3DZOA 2X9EA 4YLJA 4G9RA 4MXXA 4D0XA 4E8AA 4DDIA 4QDVA 4AW0A 5AR5A 1YXTA 4IWOA 5HLNA 5HGIA 3SGCA 5M53A 5EDQA 4UMTA 3W32A 4AZSA 5CWZA 5DNRA 4FIHA 1UNLA 1DAYA 4OTGA 4H36A 5A3XA 4JDHA 4YU2A 4UV0A 3UIMA 1UWHA 1Z57A 3UOKA 4YURA 3UQFA 1YXXA 5CSXA 2OZAB 3MIYA 4CLJA 3P7CA 3KRJA 4CMTA 3MPTA 5IUHA 4XG8A 3UO5A 3LE6A 4CFWA 4NW6A 3ULIA 4GIIA 3FUPA 4TWPA 5FEQA 3S00A 2GFCA 2WQOA 1OGUA 2DS1A 3QXOA 1VEBA 2ZJWA 2E9OA 1XMMA 3FZRA 3FXWA 1Q3WA 4N57A 3TYKA 3SV0A 2HOGA 2VN9A 2CGVA 4BICA 2HAKA 5AIRA 3EN9A 5D9HA 1RDQE 5E1SA 3QKMA 4IHPA 3KULB 2X7GA 5CF6A 2UZEA 4DG0E 1XH4A 3KCFA 4KA3A 3NVKI 1G5SA 2YAAA 4IFGA 1W98A 3EKKA 1BMKA 4Y95A 2HELA 4L52A 4CTCA 4B0GA 4LYNA 5CEIA 1ZXEA 4XG2A 3UIUA 3SKCA 4IJ9A 2FSMX 4XOZA 5CF5A 4FSYA 4BDAA 1UU9A 3P78A 5ETCA 4D1XA 4FKUA 4JAIA 4C8BA 2HZIA 2Z02A 1CKIA 4XRLA 4F78A 5J9YA 2NPQA 4YJRA 2VWUA 1FMKA 3Q4TA 5AV4A 4DHJA 1GZ8A 4ALUA 2CNQA 3I81A 2PVRA 5IH5A 4FMQA 3TNWA 5AP6A 4DH3A 2WQNA 2W1DA 4O0YA 1NT2A 3D7ZA 3DTWA 3L9NA 4MKCA 5I5ZA 4H05A 2XEZA 3TZ9A 2HENA 3O71A 3PJ1A 5CU6A 5CAUA 5AMNA 4U97A 3UPXA 5DH3A 4RWKA 3TN8A 3ODZX 2DQ7X 3ORKA 4CFUA 1GZKA 3POZA 5AIKA 5DT0A 3JS2A 4NKAA 3HNGA 3MW1A 4CYIA 2UZOA 5CF8A 4YJSA 3WZJA 4C61A 3RHKA 2BVAA 4L9IA 4FEQA 3VHEA 4Y46A 1OPLA 5HG7A 3F7WA 5AP0A 1WBSA 1LP4A 2CKPA 3Q2JA 4EH6A 3LFQA 5H9BA 1H24A 1GJOA 2C69A 4GT3A 2PZ5A 4FVPA 4FZ7A 3KL8A 3I7CA 3VS3A 2CHLA 2WELA 3QZIA 5C8MA 4E4NA 4B6LA 2JDOA 4F4PA 3EYGA 3F66A 2GS6A 4ZJJA 4BGGA 4CCBA 4DG3E 5T3QA 4O7LA 2XNBA 3DT1A 5HNBA 4KBCA 4ZIMA 4DGNA 4HJOA 4X2GA 2W17A 4FKQA 4D55A 3H9OA 5IH6A 2CPKE 3UDBA 1PY5A 3HZTA 1PXIA 5ANDA 4CG8A 4ACCA 2XMYA 3OOMA 4K9YA 1PMVA 4A06A 2YM6A 4LRMA 3FC2A 2FB8A 4HVSA 2C5OA 4FKIA 2NNWB 4JQEA 3LM0A 5LVMA 3UZRA 2CNVA 4MTAA 4WT6A 3FZ1A 4BVUA 2ZMDA 1R0EA 4IB0A 5HLWA 1SVEA 5M57A 4QNYA 3QQJA 2I7QA 3LMHA 2XNPA 1BX6A 4ZSGA 2VUWA 3R1YA 5HO8A 3EKNA 3FMKA 3D5XA 3NVMB 2PZRA 4O4DA 3EL7A 4EYJA 4FIGA 3TNPC 4MD8E 2A4LA 3DB8A 2PUNA 5BPYA 4AN3A 2C0OA 3COIA 3MS9A 4N4SA 5C8NA 5J9ZA 3H4JA 5L8LA 3D14A 2WXVA 3DBEA 3P08A 4JDJA 4IDTA 5BUEA 2YDIA 3AC1A 4QPMA 4YP8A 4A9SA 4RLLA 4IH8A 4F1MA 2VZ6A 5J87A 2ITQA 2UZLA 3CLYA 1XH7A 4RX7A 4FEWA 4WNOA 4EUUA 3NNUA 3DBDA 3R6XA 5EYDA 3MN3A 4WNKA 1ZYJA 3ZO4A 5H8BA 3HUCA 4QNAA 2C1BA 2B54A 4O86A 4PRJA 5CAOA 2WU7A 4LRJA 4X2NA 2B1PA 5DWRA 1SM2A 3W2SA 1J3HA 1O6YA 4QYGA 5LVOA 1LEWA 4FVRA 4A9UA 4EH8A 3CXWA 4UMPA 4BR3A 3HRFA 1OMWA 2XNEA 4I5HA 2AEGA 2BAKA 3E87A 4RFZA 1XO2B 2QLQA 4RBLA 4ZTRA 5B2LA 4OTWA 3TZ8A 5KE0A 4QQTA 3W0RA 3DTCA 2OJGA 4ZY6A 1OL6A 4O38A 5AR8A 3V5WA 3JYAA 5LQFA 4RVMA 3QGYA 4D2WA 4DH5A 4NEUA 1CKPA 2J6MA 4H1JA 4H58A 1XHAA 3BLHA 4OBOA 3OEZA 2B7AA 5EH0A 5D10A 3MVJA 4ZS4A 3BWFA 2Z7RA 4PY1A 4MQ1A 5EK7A 3T8OA 5E8XA 3ZBFA 2A0CX 3R28A 4JOAA 1MP8A 3PWYA 4FV1A 3GU6A 3ODYX 2R64A 4XNEA 3UQGA 3LFAA 1OIYA 3DKOA 3LZBA 2ESMA 3BGPA 2NP8A 3C4WA 2RFEA 1MQBA 2BALA 2PK9A 3OC1A 3WI6A 2BPMA 4PMSA 4A9TA 1UA2A 1ERKA 1XH9A 3TKIA 4EOKA 3AC4A 4BZOA 3CTQA 1YQJA 4ID7A 1H08A 2B4SB 3S95A 4FTJA 4JI9A 4BHNA 1F0QA 5DA3A 3WIKA 3DFCB 3M42A 2WMBA 3PIZA 4BKZA 4LI5A 4UXQA 4V0GA 5FTQA 4ZAUA 2XAOA 5C4LA 3F5PA 1PF8A 3UQCA 2PMNX 2QLUA 5DLSA 3QC9A 4YSMA 3AKLA 1YHVA 3ALOA 3PRFA 5JMSA 4IE9A 1Q61A 1YDTE 3OWPA 4MF0A 4FTKA 3NCGA 3O0GA 2XK9A 3PPJA 2BRGA 3QA8A 4QMOA 5FM2A 3U4WA 4O21A 4DTBA 3HLLA 4D4SA 2NRYA 2W5AA 4U3YA 2VTQA 3TNIA 2F49A 2OWBA 3FL5A 4RQVA 4DINA 2X4ZA 4FUYA 2R3LA 2BCJA 3KEXA 4IMYA 3KXHA 3P9JA 4FTOA 4O0VA 3WILA 3W0OA 1OGYA 3Q5ZA 4MQ2A 4IACA 2C5YA 1PXPA 4A9YA 4GK3A 4OW8A 3HMNA 3UZTA 3VWAA 1Q24A 4UWYA 4P5ZA 4DN5A 3GU4A 3W10A 3ZEPA 1AD5A 4OTIA 1QMZA 1XMLA 2Y0AA 5CVHA 4IX5A 2X7FA 5HKMA 4FA2A 3DV3A 3GVUA 4WRGA 3QTRA 3TKHA 3PA4A 2XKFA 3U54A 4IAZA 4KBAA 4P2KA 2P3GX 4EOQA 2XNOA 2X9FA 3EOCA 2QODA 4ZSLA 5C9CA 3PJCA 5DRDA 4AQKA 2HY81 3UJGA