5EDRA

Egfr kinase (t790m/l858r) with inhibitor compound 27: ~{n}-(1~{h}-indazol-3-yl)-7,7-dimethyl-2-(2-methylpyrazol-3-yl)-5~{h}-furo[3,4-d]pyrimidin-4-amine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
322
structure length
299
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYEEDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title 4-Aminoindazolyl-dihydrofuro[3,4-d]pyrimidines as non-covalent inhibitors of mutant epidermal growth factor receptor tyrosine kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 299
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5edrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5edrA01
3IONA 1PJKA 4QQJA 3E3BX 1JSUA 4AGDA 3A7JA 4O81A 5M53A 1ZMVA 2PMOX 2OXXA 3MGYA 3F6XA 5EM6A 3D9VA 3TDWA 4MWIA 4FI1A 3G33A 5AIRA 2VTLA 2OWBA 2OZOA 4AZSA 4CCBA 3FLZA 4ZTQA 4RWKA 4TKSA 3P08A 4PDOA 4H39A 3VS3A 5HG7A 3FV8A 3TACA 4A4LA 1H4LA 3CKWA 4QMTA 3TUBA 5AA9A 3R1NA 2H8HA 2R3LA 5KMNA 3F7WA 3DQXA 3HGKA 2F4JA 3JVRA 3ORTA 4ASEA 2W1DA 5AP4A 2REIA 3SRVA 2CSNA 1UU3A 3KL8A 4GK2A 4IZYA 5E8XA 3GC0A 5IA5A 5M4UA 5IEVA 4E3CA 3WZEA 2ZJWA 2XNBA 4YZCA 4CEGA 3O17A 4R7HA 2XIZA 5I5ZA 1ERKA 4JRVA 4M66A 2J4ZA 1IASA 4MWHA 3EFLA 4X2NA 3ZC5A 2R3OA 3IOKA 5DA3A 5EHYA 4R1YA 4EOJA 3F7ZA 3FMNA 4PDPA 2VTIA 4G16A 4ANBA 4E93A 5BYYA 5JGDA 3WE4A 2CDZA 4M8TA 3KRRA 2J90A 2ZV7A 3E7OA 4XYFA 4I0TA 1MQBA 3QTIA 5EHLA 4EYJA 2QNJA 2BHHA 1OZ1A 2BIYA 2Z02A 5BX0A 3ZLXA 1BYGA 3UOLA 4E5BA 2QOHA 1GOLA 3FJQE 4NSTA 3RZBA 4KIPA 3KRJA 4FV9A 1PXKA 2FO0A 2DWBA 3C51A 4LI5A 4OTRA 4CT2A 2R64A 4NFMA 4ZY5A 5JQ8A 3G0FA 2Y6MA 4BF2A 5KMLA 2R4BA 2YDIA 3ULZA 3QTRA 4QMNA 3DJ5A 4FZ6A 3WARA 2OI4X 1NVQA 2PHKA 3BU6A 4V01A 4X3FA 1NA7A 1H1WA 3BYMA 4ENYA 4NUSA 2XF0A 4FVPA 1K9AA 4J97A 4D58A 1G3NA 5IU2A 3U51A 4IM2A 3NUNA 4ZJJA 2HYYA 4IACA 3HRCA 4YTHA 5FDXA 5CANA 4L01A 4KABA 4BIEA 5HI2A 4TYHB 4F0IA 5L6PA 3U6JA 3FXZA 4WG3A 4PTGA 2UZBA 4A4XA 4V04A 1NY3A 1UKHA 3DPKA 2WTKB 2HW6A 3NX8A 4FTLA 4H58A 4M68A 3UC4A 2VX1A 4FL1A 3ALOA 1R78A 2QCSA 4DFNA 4FTCA 3R30A 3HX4A 3Q32A 4FZ7A 3VRZA 3DXQA 2X8DA 3B2TA 3MS9A 4JL9A 5A4CA 2PPQA 3QTWA 4UZHA 2EXCX 4O7NA 3EHAA 4BYIA 3BGQA 3S95A 1WVYA 3ZLSA 4BDAA 3FLYA 4KAOA 1U4DA 4Z55A 3P23A 1YHVA 4GT5A 2XKFA 2W4OA 4I41A 2YIQA 3DTWA 2IN6A 4QT1A 2XM8A 2B9IA 4FKQA 4BIDA 2BAKA 1OL6A 2JIUA 2QOIA 2WEVA 3R1YA 4GSBA 3B8RA 4LRMA 4W9WA 3KREA 3N4VA 3Q9ZA 2YM5A 5F1ZA 4FEWA 2RFDA 2OH4A 3CQWA 3F5PA 3PSCA 4FODA 4NM3A 4EH8A 5M4CA 2YEXA 4QYGA 2XK9A 2WIHA 3EN7A 4F1TA 3PIXA 4MEDA 3TZ9A 3MIYA 2IPXA 1MRVA 3KRXA 1SZMA 1ZMUA 3D5UA 3TZ8A 4E4XA 4D9UA 5ETFA 3ATTA 4TNDA 3NUYA 3Q4CA 4IMYA 2QHMA 5CX9A 5KMOA 4L43A 2QI8A 2ZM4A 2A2AA 4I6HA 3FHRA 2YM6A 2WTJA 4BKJA 2OW3A 3B2WA 3DT1A 4IWDA 4LFIA 3UZPA 4EH3A 4EK5A 2BHEA 3FBVA 1IAHA 4YO4A 4A9UA 4RWLA 5HKMA 1PRYA 3DBDA 4EK8A 2W4KA 4M14A 4DFBA 1PXOA 4EYMA 2ITQA 2W1ZA 4BCMA 5GHVA 3QD4A 2GNGA 2R3FA 3FLNC 4O82A 2W17A 3IW7A 4CYIA 5JMSA 4O6LA 1IEPA 3R04A 4P2KA 5IUGA 2O2UA 2YCQA 2OFUA 3VQHA 3W16A 2WD1A 5AR3A 4ASZA 4JQ8A 2X6DA 4EH4A 5CAUA 3EQFA 5H9BA 3BV2A 3HDNA 2NO3A 2HWOA 4K8AA 2GNHA 2QQ7A 4PQNA 2OJ9A 2XCHA 4S30A 4XV3A 3HV5A 3PJ1A 2VX3A 4USFA 3K2LA 5CVFA 3W2RA 2HK5A 3F2AA 3SRVB 3VULA 4F0FA 1M7NA 2HENA 2J0LA 3FHIA 3OXIA 3UO4A 1OB3A 5A14A 2VU3A 5EQEA 4BCPA 5L2QA 2YM3A 3TZMA 4DH5A 3QD2B 2JAMA 3WYYA 3VUTA 3VJNA 1I09A 1YXTA 4ZTRA 2XIYA 4L52A 2PZ5A 4EEVA 1M14A 2ITYA 3V3VA 4C36A 3NMUF 4I6BA 2X4ZA 3VNTA 3C4XA 2Y6OA 3ZFYA 3Q04A 3RWPA 4FTNA 4G9RA 5C1QB 4YGAA 4JRNA 5CU6A 3R9OA 4JVGA 5DE2A 4QPSA 2PVNA 3VUGA 4FKJA 3KA0A 3DBEA 3OCGA 3VW8A 4EK6A 5FXQA 4JOAA 1ZZLA 5M51A 3EFJA 3A60A 3COHA 4QP4A 3AGLA 4AX8A 2BUJA 3IDBA 4FIEA 5KHWA 5CQWA 4BRXA 2PVLA 3RJCA 1YI3A 4I1ZA 3E5AA 5G1XA 4DFUA 4U42A 1W98A 2JGZA 4RGJA 2PYWA 2X6EA 3RZFA 5DHJA 4X3FB 3FZTA 2OKRA 5DWRA 5EM8A 3RI1A 3AMYA 2ITNA 5KHXA 3NR9A 3EQPA 5CNNA 2Y0AA 5J5SA 4XRLA 5GIOE 2ZDTA 5H3QA 3MPTA 2BVAA 2OICA 4EJ7A 4CKRA 1Z9XA 4YC8A 4FSQA 1QL6A 1H01A 3H9OA 2YM4A 3BPRA 4IX5A 4FV0A 5T6KA 3N51A 4O1OA 5GJFA 4A9TA 4EOSA 3VN9A 2BDFA 4BB4A 5A3XA 4G3CA 1FPUA 4PRJA 3ANQA 3ZSGA 5EDPA 3KU2A 3FMLA 4AOTA 3VS0A 3DLZA 3E8EA 4WNPA 1Y91A 4R5SA 3MB6A 4MX9A 2JDSA 5CEOA 5L2IA 5HO6A 4O2ZA 4EHGA 3N4TA 2ETRA 2O3PA 3FZ1A 3V6RA 1UWJA 2GSFA 5HTCA 2O63A 2P55A 5DYJA 3KXMA 2HXQA 1P4OA 4RJ8A 5LVMA 4W4WA 2XBJA 3GEQA 4BI2A 2R3QA 5EDQA 4ZAUA 2XZSA 1E1VA 3NNVA 4BHZA 4IZ7A 4LV5A 2JAVA 3RM6A 4EHEA 2CNQA 4IH8A 3N4UA 3R9NA 3SHEA 3GC8A 2ITPA 3F3TA 4EBWA 4FYNA 4D28A 4Z3VA 3O8TA 4K18A 3UE4A 2J0MB 3PY0A 4G3GA 2IW8A 5FUTA 2LGCA 2BPMA 2QOOA 4QP7A 1Q8UA 2PZRA 3A4PA 3ZOSA 3LMIA 4BDEA 2JFMA 3HP2A 1J1BA 5LMAA 5BMSA 1YI4A 5LMKC 5JN2A 5GZ8A 4MBLA 2H6DA 3ZO2A 4MBIA 3FL4A 4RIOA 1W82A 1OIQA 1XBCA 5FG8A 2PVMA 3QRIA 4KUJA 4R3RA 1P5EA 4LMNA 5TR6A 2LAVA 2XRWA 4U41A 5EKNA 3AXWA 3PPZA 4GL9A 1XH6A 4KBAA 1P4FA 2CNVA 4L68A 3TNWA 3CD3A 3V01A 1HCKA 4ZTNA 3ZXTA 4L3PA 4IXPA 3CTJA 4TYGA 1H1QA 3Q5IA 3V5PA 5CF4A 2ETMA 2JKMA 2XMYA 3OP5A 4J1RA 1GZNA 4UYAA 3VBXA 4AN9A 1VJYA 2VWZA 1M2QA 4X2FA 2CGVA 2WTKC 5EI2A 3C4FA 3DY7A 4OTWA 3FC1X 5JT2A 2PUPA 4FEXA 3VAPA 5A9UA 4XG8A 2JDOA 2QVSE 1QCFA 3D7TA 3PWYA 3SKCA 4DFYA 4UMRA 1Q61A 2OU7A 3POOA 5EK7A 3C0IA 4U40A 5EI8A 4JG7A 4E6CA 4ZZOA 4M7IA 2Z7RA 3ZTXA 4AE9A 5B2MA 2W1HA 2WFYA 5DH3A 4EK4A 4CKJA 4RA4A 3RWQA 1LEWA 3OXZA 3RP9A 4CQGA 4C4GA 4U45A 4FE2A 4EZ5A 2FSMX 2XJ2A 2JBOA 3ALNA 3AD6A 3FWQA 3HV4A 1XH8A 3NNUA 4IQ6A 3EQGA 1OKYA 4CFMA 2BFYA 4DN5A 3BGZA 4HCVA 5HNBA 4I0SA 4FKRA 4FZFB 4N4SA 3A2CA 5CZIA 4AZFA 5FRIA 4C7TA 1YDSE 3KCFA 2ITTA 4RC2A 5L4QA 4ANOA 4UMQA 4YJVA 3OW4A 4FNYA 4QTDA 5DN3A 3L9PA 4AZTA 4M0ZA 5AP0A 4N6ZA 4EL9A 4FIIA 5E4HA 4UBAA 3ITZA 1KE6A 5HLNA 4DEBA 4Y85A 4FK3A 5LCJA 3R7OA 4DAWA 3D2IA 2G1TA 3R8PA 2WMRA 2B9FA 4D55A 3PXZA 3RBWA 4X7QA 2CKPA 3PXYA 5DLSA 3U87A 4YHJA 1PXPA 3QZIA 4C2VA 2Q83A 2ZMCA 3BHUA 4QMUA 3R7VA 4BBFA 4WBBB 1H1PA 1JVPP 2RFEA 2YAAA 2CGWA 3FMHA 5ANJA 2PE0A 3C0HA 2E9VA 2E2BA 2WO6A 2CGUA 4XOZA 4OTGA 2R5TA 3MN3A 2KULA 3RAWA 3VRYA 2X7FA 4U79A 4CMTA 3KVWA 2YM7A 3UTOA 3ATSA 2C6KA 3LIJA 4ANQA 4F6WA 3UQFA 2DYLA 1WBPA 2B1PA 3GBZA 4GVAA 2QHNA 2O8YA 4BKYA 4YR8A 5CXZA 1W83A 2XP2A 3TNIA 3MYGA 4FTTA 3FZRA 3BWJA 4WNOA 3VUIA 2QOQA 3I7BA 2OF4A 3QQHA 4ACGA 4KIOA 2FSLX 2JKKA 3IW8A 3DB8A 4RMZA 3NRMA 2W9FB 5C9CA 3DCVA 4MD7E 4FSWA 5IQAA 2BAQA 3II5A 4II5A 4BDJA 2EXEA 4CZUA 1Y6AA 3CY3A 3C4EA 3QRKA 4S32A 4YHTA 4TYJA 5FP5A 2GNLA 4ZY4A 3S3IA 4PMTA 4O0SA 1UU7A 1WMKA 3C4WA 3TTJA 1R0PA 2OO8X 5HO8A 2YM8A 3EFWA 4QNAA 4WOVA 5JGAA 2I1MA 2YWVA 1DI9A 2WEIA 4LL0A 4EJNA 1X8BA 5DEWA 3R9HA 3BIZA 4R78A 4WNMA 3DGKA 1H07A 3THBA 5I0BA 4DT8A 4CT1A 1DAWA 1FMKA 2C6MA 2R3HA 3EB0A 4RLLA 3UPXA 1H00A 1SVGA 3CXWA 4FG9A 4I5MA 5CSXA 4ZTSA 2PUIA 4JT3A 3BU5A 5ANOA 5A4QA 3MJ2A 2BRGA 3S0OA 1H08A 4HCUA 4CZYB 2JIIA 3QC9A 4U9AA 3NNWA 4HJOA 5DPVA 5KKRC 3EYHA 3DXPA 4I92A 2VD5A 3DAJA 4X2KA 5LWMA 2GHMA 4XCUA 4IEBA 4HYIA 4XP3A 4EH6A 4IM3A 2VTPA 4FTKA 5ACBC 2NP8A 5M08A 2C6EA 2XKDA 3E8DA 3W8LA 3MFUA 5HBJA 4L7SA 3QC4A 2UZDA 1Q24A 4S2ZA 4ZJIA 3P79A 4TWCA 3ZO3A 5CSWA 4RIXA 3HYHA 4U97A 3UO5A 5L6WL 2UVYA 5CF8A 3EWHA 4MYGA 4L7FA 3WIKA 2GCDA 5ITAA 4TY1A 4DH7A 3E87A 4DH8A 3UZRA 3NW5A 3DOGA 3M42A 3D7TB 3A8XA 3DB6A 4D2TA 3RK9A 3QKLA 4L53A 2WMQA 4FF8A 4ZZNA 1CKPA 4RVKA 2YZLA 5JEBA 2A19B 3CE3A 4F1MA 3UGCA 4UALA 4ERWA 2GNFA 3SG9A 5KE0A 3UNZA 2F7EE 3R7YA 4OW8A 4K0YA 4O22A 3D83A 3R2BA 5HQ0A 4RPVA 1GZ8A 3BV3A 5HLPA 4C4HA 3NVMB 2P33A 2OXDA 3F3ZA 3Q9YA 3R1QA 4O2PA 4QPAA 4TWPA 4DEAA 4HVGA 5CU3A 3QWKA 4CRSA 3VS4A 1XJDA 3KVXA 3BHTA 1JBPE 3GCSA 4FKLA 1ZOHA 1ZYJA 3K5VA 5H8EA 3MESA 4MXCA 3OD6X 2R7IA 4EQMA 5E91A 2VV9A 3QYZA 4GH2A 3RCDA 4FV4A 4MH7A 4E20A 4O96A 3PA5A 4YZMA 4ZY6A 2ZVAA 4EOMA 2QG7A 2WXVA 4XG2A 4ALUA 1SVHA 4TZRA 3IW4A 3Q4ZA 5HIBA 4D1ZA 2C1AA 3PLAE 3ORNA 1T45A 2UW6A 3PYYA 4NT4A 1XH5A 2C0OA 1XBAA 4AQCA 1FVRA 5HD4A 2CKQA 1TKIA 4YBJA 1SM2A 3AC3A 3C5UA 5D7AA 3KQ7A 1UA2A 5IKWA 4IJPA 4BDKA 1JPAA 4DGGA 3DQWA 4JIKA 3R71A 4XP2A 3CJFA 3RINA 4DGOA 4BGGA 5CEPA 2VZ6A 3QRJA 2F57A 3QX2A 4JLCA 4BCQA 3R8VA 4UWBA 4NL0A 3Q2JA 4DFZE 4QP8A 3DLSA 3V5WA 4ANNA 5AFVA 2H9VA 4GYGA 4D4RA 4EZ7A 4GIIA 3IGOA 5J8IA 4GKHA 2AYPA 3C13A 5LMKA 3DV3A 4H1JA 1KOAA 2X9FA 5HG5A 1TQIA 3BEGA 1PMVA 4IDTA 5AAEA 5IQEA 3C9WA 3O71A 1E1XA 2CCIA 2W9ZB 4G3DA 3VC4A 3ZSHA 3WOWA 5CF5A 1UNLA 3AT3A 4KSPA 4FTUA 4CQEA 5DGZA 3PJ2A 2W99B 4YMJA 5AUUA 5EQYA 4F9AA 3IO7A 4ZLZA 2BRBA 2UZTA 4IAKA 4RIYB 2RG5A 1TQPA 2ONLC 1WAKA 3I81A 4QMVA 4QQTA 5B7VA 4F63A 3OT8A 3W18A 5C26A 3PWDA 3OF0A 2RF9A 3IGGA 3MV5A 1DAYA 3V8SA 3OCSA 2F49A 2YIRA 3Q3BA 3OMVA 3R6XA 3BGPA 4RFMA 4E5AX 2WMTA 4C34A 2VTMA 4ACHA 3C0GA 4AG8A 3ENMA 3CR0A 3F66A 3FLSA 3VS5A 4JXFA 2XCKA 3RCJA 5IQHA 4D2PA 5D9HA 5L2WA 4EOPA 3ACJA 2G01A 2YJSA 2GHGA 1OM1A 2CCHA 2RG6A 3P0MA 4GKIA 1PY5A 4FVRA 4A07A 4GJ3A 5DVRA 3NIEA 5LWNA 2GFSA 3FQSA 1YRPA 4FG7A 3ZM9A 2R3JA 4AGWA 4L46A 3R0TA 1PW2A 5AAGA 4G6NA 3UOHA 1RW8A 3LAUA 2VTNA 3QF9A 4EH9A 5TE0A 2V5QA 4PMMA 2HXLA 3HMIA 4RX8A 1Q41A 1ZZ2A 2J51A 4S33A 3MWUA 3MB7A 4WIHA 2YJRA 4LUDA 1OUYA 4IE9A 1XH9A 4RIXB 2FYSA 1S9IA 4W8DA 3ZO4A 3FZOA 4RFZA 4TXCA 3S1HA 3HRBA 2B9HA 5T3QA 4C4FA 4CYJA 3HEGA 1ZYCA 4O0WA 5IPJA 3CC6A 4RX5A 3OBJA 4KIKA 5CS6A 4C2WA 2J2IB 4FT9A 4ANSA 1GZKA 3U6IA 3TKUA 3P86A 1FQ1B 4NKSA 4DEGA 5JKGA 4D2RA 5AWMA 2P0CA 3B8QA 4UMPA 2QG5A 3OWKA 4FKPA 5AUZA 2BMCA 3Q2MA 2WTWA 3V5LA 5JGBA 4CV9A 3NNXA 2UW3A 3VS2A 3SXRA 3C5IA 3F3VA 4PY1A 4EC8A 2I0EA 4FUXA 3JY0A 4AT5A 1ZAOA 4GYIA 3Q52A 4IANA 3WF5A 4E26A 3GQLA 3P78A 3BELA 4PNKA 3ORMA 2ITWA 2J50A 1PHKA 5IMEA 3OTUA 4WSYA 3ENHA 2W96B 2QONA 3V5TA 3I6UA 3JR1A 4I93A 4BCHA 3T9TA 3V51A 2C0TA 1GIJA 3LQ5A 3A61A 3MTFA 5GIPE 4LYNA 1QPEA 2XNOA 3ACKA 1ZYDA 3NYNA 4MK0A 4RFYA 5LQFA 2C4GA 3NIZA 5E8TA 4P5QA 2XKEA 3H10A 2ETKA 3VBVA 3ORIA 4EORA 2JEDA 3ZUUA 2VTHA 5BVEA 4PWNA 2WQBA 4X2JA 2BDWA 5DBXA 5AP6A 2OJJA 3VBWA 2VTAA 4N70A 3COMA 4XMOA 2G2IA 4QMLA 4Y83A 3AT2A 3RHXA 5KMJA 3UNKA 4MXZA 5IH6A 3DZOA 2Y8OA 3NUPA 3BYOA 2X2MA 2IO6A 4K11A 1XBBA 1Q8YA 2XB7A 2Y4PA 5E1SA 5AR4A 4W4YA 4XBRA 3UP2A 4OTDA 4F09A 3CPBA 4AXAA 4XH6A 2CGXA 1PXJA 4J98A 3ORXA 4YTCA 4H05A 2EWAA 3HMPA 3CTHA 2J9MA 4TW9A 5DFPA 4DCAA 3JVSA 2YWPA 4EUUA 4F6SA 3LCTA 4OBOA 1WBOA 4BWXA 4ZOGA 1ZYSA 5K5NA 1L8TA 5AP5A 2WPAA 4IB5A 2AC5A 2C3IB 4JAJA 4DBNA 3EMGA 4C0TA 4KD1A 4EONA 4J8MA 3BBWA 4G6LA 3OWPA 4S31A 1CSNA 4FGRA 2UZWE 3DK7A 2XUUA 2F2CB 2WQNA 4C33A 5CSVA 4ZSEA 3HL7A 4U5JA 3GCQA 5AP1A 1BL7A 3GU6A 3MFTA 1JKSA 3LJ2A 3L9NA 4FTMA 3RK7A 4ERKA 5KO1A 2Q0NA 2WMAA 3DTCA 1J7IA 1SYKA 4Q9SA 3FI3A 3G15A 1CDKA 5CYIA 4CGAA 1B39A 2I0HA 4NW6A 5DR2A 3UOJA 4F7NA 1U5QA 2C6DA 3WF9A 4B99A 2PZPA 3WYXA 2RSVA 2VAGA 2R7BA 3AG9A 3D4QA 4DEIA 4GFOA 4CXAA 5DI1A 5J79A 3I0QA 3BHHA 4UXQA 2FVDA 3S00A 4IB1A 2H96A 4MAOA 2O5KA 4A7CA 4BBMA 4IX3A 4KRCA 4D4VA 4CSVA 5IDNA 5BYLA 2XK8A 3R9RA 3TNHA 4NEUA 3ZBXA 4WNKA 3V6SA 1V0PA 3IDPA 5I9VA 2BILB 2OIQA 1ZYLA 5GZ9A 4Q9ZA 1DS5A 1YXUA 2QR7A 1KSWA 4PPCA 4ENXA 4CKIA 2OH0E 3IW6A 2X7GA 3AD4A 4QYFA 4FOBA 4APPA 3UG2A 2XS0A 2ITXA 4OR5A 4O38A 4BTJA 4GVJA 2P3GX 3NW6A 4ZMFA 3RTPA 5JFSA 5EFQA 5FWKK 2WB8A 2YFXA 2IVTA 4FSTA 3JXWA 2F7XE 5HU3A 3ELJA 4J7BA 3IK3A 3R8MA 4ASXA 5F94A 3R02A 3TWJA 3MVMA 4IB3A 2Q0BA 5K3YA 4DINA 3PDTA 4BZNA 2JDTA 4P5ZA 1YWNA 3DDPA 4GUBA 4JI9A 4IBMA 5IQCA 5KUPA 3FI2A 3IPHA 4KIKB 3HV6A 5IQDA 2PE2A 4OTPA 3H30A 5AUXA 3I60A 5KMKA 4BI0A 5A4EA 4CFUA 3OOMA 3R00A 4L8MA 5E92A 2JDVA 3G51A 3TI1A 3VO3A 5CENA 3BWFA 4EH2A 4U81A 2QOCA 2Z60A 5CVHA 2A4LA 4KBCA 5J9YA 1U59A 4ZSAA 1OPJA 4BDGA 5BVDA 4BZOA 4RZWA 3LCSA 3BQRA 4MVFA 3WZUA 4XX9A 4WO5A 2YZAA 4BTMA 4X3JA 3EOCA 3CBLA 2GNIA 3OFMA 2XIRA 4JBPA 2E9OA 3F69A 1XO2B 4AW2A 4NW5A 4RJ7A 2C30A 4WKQA 4BHNA 1WBSA 3Q6WA 4EHZA 4HCTA 4BCJA 3A99A 3QA8A 4O91A 2B9JA 5I4NA 3FSFA 1F5QA 3KN6A 3CLYA 2PWLA 3HA8A 5E8UA 4C62A 4PF4A 4GK4A 3HV7A 4YNOA 2ZV2A 3R63A 3BBTB 3RPOA 4D2SA 1YOLA 2IZUA 3UVRA 2WQEA 4NTSA 3OHTA 5CU0A 2AUHA 3HECA 4U44A 5LJJA 4ZS4A 5M55A 4IWPA 4AU8A 3A7FA 3Q9XA 3FYJX 4EOQA 3G90X 4MTAA 4QMWA 5HG8A 5HE2A 3QAME 2CN8A 3ZO1A 4DG2E 2I6LA 3QLFA 4AFEA 4QO9A 3U8WA 1QMZA 5CXHA 3NUSA 3LXKA 1J3HA 1CM8A 1YOMA 3PLSA 1H8FA 2ONLA 5KMMA 1H1SA 2B55A 2PVKA 2JC6A 3SQQA 3TZ7A 3LM0A 4EWQA 1B6CB 3R1SA 1YOJA 4F99A 2QLQA 3CGFA 4O7YA 3BE2A 3KRWA 3C50A 4PL3A 5AIKA 5DR9A 2O65A 2PY3A 4EQCA 4F9CA 2HELA 4K77A 4XOYA 1Y8GA 1MRYA 4OUCA 2WOUA 4K1BA 5HE3A 4I21A 4A9RA 4BFMA 5B2KA 5IH5A 3OG7A 3WE8A 2UW4A 5FXRA 2P2IA 2IZTA 3HLLA 1KOBA 5T68A 5KX8A 3W2QA 4M15A 3MY1A 2O0UA 2I7QA 4AUAA 4MF1A 3IG7A 2QOKA 3UODA 4E6DA 3DDQA 4FX3A 3ROCA 1UU8A 5JFVA 1R0EA 2RFSA 4JG8A 5J7HA 4JJRA 3E92A 2YCRA 3FQEA 4RQKA 5KKRB 4RJ3A 4FIHA 4IC8A 1Q5KA 4O0YA 5FXSA 4DEDA 2VTSA 4FV8A 3UP7A 4YNEA 4FTAA 2W5BA 2Y4IC 3PE1A 4GV1A 4D0XA 1H27A 2PZYA 2C6IA 3GU5A 3QQGA 3VBYA 3NAYA 5CT0A 3W2SA 4YUQA 5H8BA 3DBCA 3RM7A 2QKWB 4IADA 4DC2A 3DKFA 3ZBFA 2PVJA 5FDPA 5I9WA 2GDOA 3L8SA 2V7AA 4PTEA 1AD5A 4O0VA 4H3BA 3VS7A 3LQ3A 3COIA 2CJMA 4XLVA 3LJ1A 3MA3A 3CCNA 3PVWA 3DKGA 3UO6A 3OCTA 3L8XA 4QMMA 3W2PA 3E8CA 3EN9A 3KKVA 3BKBA 1MUOA 4EOIA 2BKZA 4CG8A 3NCGA 4PNIA 5HCZA 2VNWA 4AOJA 4D1SA 5JQ5A 2G15A 3V8WA 4B4LA 4AP7A 1J7UA 4RBLA 3C1XA 4P4CA 3PRIA 4D4SA 1PXMA 2OJGA 5ACKA 5EI6A 1B38A 4H3QA 4RX7A 5JRQA 5K4IA 3TV7A 1I44A 2CLXA 4I5PA 4IWQA 5JFWA 4BGHA 1LR4A 4MNFA 4UYNA 2DUVA 1Q8WA 3MY0A 3E63A 5JRSA 4FSZA 4V05A 5AMNA 4YPDA 4F9BA 5LCKA 2GS7A 1J7LA 4AGUA 5E7RA 4FT0A 3SD0A 3HUCA 4NKAA 5ANIA 3CS9A 5D10A 2XNMA 4DITA 1PMUA 3TT0A 3EN4A 4CTCA 5BUJA 4JDKA 3ORKA 2J0JA 1CKJA 2ITZA 5K9IA 3K5UA 1KV2A 4WA9A 4F0GA 4LQMA 3C4ZA 3K54A 4FV2A 4FYOA 4XLIA 4AT4A 3RK5A 4JQ7A 4EOOA 3O23A 2V22A 3M2WA 4BTFA 1OUKA 2QOFA 3FC2A 4AFJA 3GVUA 4EH7A 2EB3A 4F6UA 3UYSA 4ORKA 2YAKA 1YDTE 1JAMA 1GAGA 4DHFA 5M09A 5E8SA 1NXKA 4NWMA 5DT4A 4DF3A 3NWWA 3FMMA 4RQVA 4F9YA 5FD2A 5LXMA 3NVKI 4MBJA 3E62A 1EH4A 1WBTA 3PY3A 2X4FA 4PP7A 4UWYA 4DGNA 2UVZA 4IDVA 4W4XA 2OXYA 4GT4A 1BLXA 5AP3A 4MQ2A 4DTBA 3OWLA 2F2UA 4RVLA 4B9DA 4E8AA 5KMIA 4EBVA 5CAQA 2B54A 1XWSA 1JOWB 4KINA 3PTGA 4OGRA 4QRCA 5BNJA 5G6VA 2X7OA 3QQUA 2OJIA 4I4FA 4G9CA 4ONAA 5HD7A 4AOIA 3P9JA 4O7ZA 3Q4UA 4FKTA 2CLQA 1ZRZA 3LZBA 3VUKA 5KBQA 2GNJA 3HZTA 5JFXA 4O7WA 3ZC6A 3U4UA 1F3MC 3FI4A 3U9CA 3C7QA 4FICA 4FKSA 1BL6A 2ZM3A 4AACA 5EKOA 4MXXA 3ZYAA 4OTQA 4X21A 1YWVA 3EN5A 2R3NA 3NW7A 2JKOA 4BCOA 3NLBA 1Y6BA 4J71A 3KK9A 3NS9A 4U3ZA 5FM2A 2WMXA 2VWUA 3QQKA 1FVTA 5HEZA 4FSNA 2BRNA 3E7VA 2XA4A 4IVAA 3EN6A 2PK9A 5ANKA 3SVVA 5FEEA 1LP4A 3RVGA 3F5XA 4EH5A 4FZAB 4FTJA 3FQHA 1OL1A 3Q53A 5GNKA 3F88A 3VBQA 3U55A 2C6OA 4YC3A 5DNRA 2B0QA 3UMWA 3ERKA 1G8AA 4DFXE 3D5VA 5CEIA 2OSCA 1AGWA 4IAZA 4YJNA 4R3CA 4TT7A 4Z9LA 4MCVA 1A9UA 2XK6A 2WGJA 4IM0A 1OPKA 4O0RA 4WG5A 5AUWA 4NM5A 4RVTA 3V5JA 3G5DA 4FKWA 3TDVA 2VWBA 3EL8A 4FT3A 2ZV8A 4KBKA 4S34A 3U9NA 4BDCA 4M97A 4G3EA 2X81A 4NJ3A 4Y46A 4YURA 2Z7QA 3DKCA 3WILA 3MW1A 3F5UA 3FXWA 2ERKA 2ERZE 1L3RE 3HV3A 1UNHA 4QMZA 2E9PA 4RLKA 2C6TA 3UQGA 5AADA 2UW5A 3JS2A 3HNGA 4W8EA 3MFRA 4HNIA 5CTPA 1DM2A 3FL5A 4FTRA 5FTQA 1U5RA 1JKKA 3MY5A 5K0KA 4EQUA 5HVKA 3DAEA 2X2KA 5M06A 1WVWA 4O1PA 5CAOA 5DRBA 4NZWB 2BDJA 2CN5A 4W9XA 3ZFXA 4JDJA 5CU2A 4PTCA 4YU2A 4GIHA 5IEYA 5HOAA 4M67A 4EOKA 3GCUA 4HVDA 4BTKA 5KNJA 3ID6C 5M44A 2YITA 3DFAA 3MSSA 2X8EA 5H2UA 2R0IA 3A7GA 3T9IA 3O50A 1W84A 3L8VA 5HNIX 4BCGA 5M4IA 4O86A 4HYSA 5ANDA 3FY2A 1KE5A 3RKBA 4FIFA 2JITA 1P14A 2YHVA 3QTXA 3ZU7A 2J7TA 4CV8A 3NGAA 1OKVA 3R22A 3O7LD 4YHFA 4RIYA 3CGOA 2IW6A 2HCKA 3CJGA 3ROYA 2VTOA 4WT6A 5I3RA 3HUBA 5HO7A 2QC6A 3OBGA 4PP9A 4NIFA 3GOKA 4U80A 2IW9A 3LXNA 4WUAA 4G5JA 5C8NA 1E9HA 4FSUA 4FKOA 3ZCLA 1WVXA 4BCNA 3AC5A 5H8GA 1IAJA 5B0XA 1R39A 2ZM1A 4ZEGA 5TOZA 3EJ1A 5I9ZA 2YDKA 3A7IA 3AD5A 4QMXA 2IVUA 2X0GA 5J1WA 4CMUA 2YACA 1J1CA 4BCKA 4NTTA 2HW7A 3GENA 4G5PA 2R2PA 3WF8A 2UZLA 3BZ3A 4AW1A 4LV8A 1S9JA 5A4TA 2OIBA 4BICA 5A54A 1GY3A 2J5FA 4IIRA 4O0UA 4PL5A 1H28A 1MQ4A 3KF7A 4M69A 3H9FA 4HNFA 3WI6A 2R3KA 4A4OA 2EUFB 2Z2WA 4QMYA 4MXAA 2YISA 3LPBA 4EKKA 3RAIA 3LJ0A 4FTOA 2CNUA 1OECA 3IDCA 4KS8A 4MHAA 1H26A 4C4JA 3QLGA 1Q97A 3P5KA 3E93A 5AR5A 4OTIA 3HMOA 3F2RA 5F9EA 5HVJA 2FH9A 3GXLA 3H9RA 3U4WA 2JFLA 1OBDA 3PE2A 3UPZA 5DT0A 3KMUA 3GU4A 4OBPA 3PP1A 3BX5A 3BHVA 4BR3A 3SX9A 4FL2A 2PVHA 3KXZA 4Z16A 2F7ZE 4OT6A 4DYMA 4WSQA 1HCLA 3GCVA 4PMSA 3TNQB 3VF9A 5AX3A 1PXNA 1GZOA 1SMHA 3FSKA 4USDA 4XHKB 4J8NA 4E5WA 1GIIA 4LGGA 2PZIA 3HMNA 3OY1A 4ZTLA 5JH6A 3CKXA 4A9YA 4APCA 3QUPA 3MH1A 3S4QA 2QOBA 4RA5A 3KXNA 3FLQA 3P7CA 1V0OA 4FL3A 3QUEA 3TUDA 2PVRA 3QFVA 4BDFA 3RPRA 2XK4A 1OVEA 4K6ZA 4RZVA 5J5TA 2XYNA 3EL7A 3NUUA 2BAJA 1PKGA 5IDPA 5IEXA 3GU8A 1Z57A 2W1CA 4PMPA 2BRMA 3EYGA 1PF8A 3TTIA 3R8LA 2FUMA 2ZV9A 3D15A 3SLSA 4DBXA 3NCZA 4DH3A 3PXRA 4WD5A 3TUCA 4G6OA 1ZOGA 3RHKA 2WQMA 4OTFA 1UU9A 5CVGA 3W33A 4O6EA 5HX8A 3PXFA 1JKTA 4IFCA 1GJOA 4G31A 3T3VA 5D12A 4AZWA 4G1WA 2EU9A 2J0KA 3RMFA 2WZJA 2OLCA 1Q99A 4YSJA 3BYSA 3W10A 5IISA 2FA2A 3OXTA 1LUFA 3PJ3A 4O21A 4R6VA 5FM3A 4C35A 3FEGA 5ETAA 4QMSA 2H34A 3MPAA 4YP8A 4L42A 5I3OA 5HTIA 4HZRA 2XNNA 2IVVA 5CSHA 4E6QA 3V04A 2BZHB 2P2HA 4ALWA 4RSSA 4O7RA 3D2KA 1NT2A 4CNHA 4F7LA 1SVEA 3HKOA 4PDYA 1Y57A 1JLUE 5FEDA 4CLJA 2X1NA 4R1VA 3UDBA 2CKEA 3CSVA 2UZEA 3EQRA 2CPKE 1G8SA 1UWHA 2W7XA 3R28A 4L3LA 3TEIA 4JX3A 2V0DA 2QU5A 5D7VA 1TQMA 2XKCA 3G0EA 3R73A 3DBFA 4IZAA 4U43A 1YW2A 4XG3A 2XYUA 4RC3A 4CD0A 4O0XA 3ZEWA 4BDBA 4DGLC 1PYEA 4I3ZA 4FIGA 4EWHA 2OGVA 1FGKA 3QQFA 4BIBA 5AAFA 3NPCA 3E88A 5FP6A 1ZY4A 3F3WA 3ANRA 3ZXZA 4C61A 4ZMEA 4J95A 4NIFB 4C58A 3PG1A 2J6MA 4CZTA 4YZNA 5IQIA 3I5ZA 4YTIA 2PUNA 4K2RA 2NPQA 3FMJA 3DK6A 5EM5A 5D11A 4HW7A 1KE9A 4QMQA 4LM5A 4L00A 5C4KA 5F4NA 3OZ6A 4OLIA 2ZDUA 3KXXA 1OKZA 4PDSA 4OT5A 4BDIA 4DEEA 3QXOA 3TKHA 5BVNA 2GQGA 3UMXA 2QODA 5IH4A 2W0JA 3LW0A 3F2NA 3GQIA 4YZBA 4DG0E 3BE9A 3SG8A 1Q62A 4ACCA 4K33A 3SOAA 2YIXA 4M69B 4R77A 2IZRA 3IW5A 5C8MA 5FGKA 4DH1A 4V0GA 5CI6A 5JZJA 2PULA 4QYEA 1OIUA 4JS8A 4C3RA 2V7OA 3LQ8A 3CY2A 4L3JA 2YCSA 4LRKA 5EDRA 3UBDA 5BPYA 1T46A 4FEQA 4ZLYA 3QGYA 2C5OA 3ORPA 5JSMA 2UW7A 4QMPA 4Z7HA 1YI6A 2ITOA 5EYKA 3VBTA 4A9SA 2QURA 4RWIA 3EQBA 4DG3E 3P7BA 1APME 5TF9A 3VS6A 5K5XA 4QTBA 3QXPA 4IB0A 2GMXA 4Y5HA 4UXLA 5TT7A 3W8QA 3RGFA 5IQGA 4XG6A 5CWZA 5KZ0A 5EOBA 4CFXA 3ZZWA 1CTPE 5A4LA 5AV2A 4KB8A 2XBAA 4AN2A 4K9YA 3LFAA 3MH2A 3FMDA 1NVRA 4BL1A 5E9EA 3LMGA 3T3UA 5C4LA 1JSVA 2R3MA 1M7QA 4F08A 1UKIA 3GT8A 4YBKA 3DNDA 5AV3A 4AWIA 3L1SA 4P7EA 3DA6A 3HAMA 2EXMA 2CMWA 4DTAA 5J9LA 4G2FA 2Y4IB 5C27A 2GS6A 4FV5A 2X39A 4FTQA 2HAKA 3PSBA 3SAYA 4BI1A 4F70A 5LVNA 4JBVA 5E8VA 4BBEA 4P90A 1OL2A 2Y9QA 5CASA 3GGFA 2YN8A 3KCKA 4GRBA 3H4JA 4JX7A 3AMBA 3PA4A 3FLWA 4DFLA 3SGCA 5J7BA 3BHYA 3OEZA 2VWIA 5DG5A 1AQ1A 4YJUA 3BEAA 3ZH8A 4QYYA 4ZJVA 3R21A 5HZNA 3D5WA 3BRBA 4AZVA 4C59A 2W1IA 4AA4A 5M4FA 3OROA 2VTQA 3LE6A 5E1EA 4WHZA 3VUHA 4HGSA 4QD6A 2HZNA 3TNPC 4ACDA 4ANLA 5IMXA 3ODZX 3TL8A 3IOPA 2YDJA 1Q3WA 2W4JA 3FPMA 3ORZA 3QALE 2QO2A 4X2GA 4O0TA 5HE0A 4KA3A 4AS0A 2J5EA 2I40A 5E8YA 2GPHA 3BYVA 3WZDA 5FBNC 4DTKA 3Q5ZA 4IHPA 3QD3A 2GU8A 1XR1A 3KN5A 1R1WA 2BTRA 5EQPA 1U54A 1FOTA 1K3AA 3DAKA 3QTZA 5HE1A 3DKOA 4ITIA 3DJ6A 5JK3A 3BI6A 4B0GA 4QYHA 4QPMA 4UMUA 4CG9A 3O96A 2ITVA 4WRGA 4FEUA 4BY9E 1VYWA 3U54A 2C68A 2W06A 5GJDA 3QU0A 4E7WA 2ZAZA 4RRVA 3COKA 4JQEA 4JR3A 4QP6A 5IA3A 4Y73A 4ZSGA 5M56A 3L9LA 4GMYA 3ZMMA 2XIKA 2IJMA 3JYAA 3QHRA 4QQCA 4C37A 4U8ZA 3UYTA 4NCTA 4BN1A 3HDMA 3MVLA 3C4CA 4QP9A 1Q8TA 5CI7A 4WBOA 4JG6A 4RVMA 4O83A 2XK7A 3PIYA 3ZS5A 2WU7A 5HCXA 3D5XA 1SNUA 2OIDA 2UZOA 2YCFA 4O7LA 4HVSA 1FGIA 3JUHA 3QCQA 1JNKA 4I23A 4PPAA 1R3CA 3REPA 4UV0A 5LMBA 4FV6A 1OIYA 3NYXA 3OW3A 3NDMA 4YZ9A 2WMUA 4AZEA 4M13A 5AUYA 2IWIA 3TV4A 2RKUA 3QKKA 1XHAA 5DT3A 2ZOQA 4ZIMA 2FSTX 4LMUA 3GCPA 4Y95A 3V8TA 5BQ0A 4AA5A 5L2TA 1YXVA 2UUEA 3PXQA 4OAUC 3CEKA 3QZFA 4AAAA 2G2FA 1OKWA 4V0GB 2WMBA 1REKA 5CAPA 2OF2A 4BCIA 5ICPA 4IFGA 3PSDA 4LGDA 3WIGA 3RNYA 5AUVA 3TKIA 3W32A 2XJ1A 2BR1A 4O27B 2GTNA 3PZEA 3FAAA 4R7IA 5L6OA 3QKMA 5AEPA 3U6HA 3T8OA 5CSPA 4EI4A 5J9ZA 4Z7GA 3AT4A 1BI7A 5FEQA 4WUNA 3W55A 2SRCA 1IR3A 2C5NA 4XBUA 5EYMA 3F5GA 3GI3A 4YZDA 2W1GA 3UIBA 2XK3A 3A8WA 4FKVA 3MA6A 1NVSA 4MD9E 3VIDA 4F9WA 4NU1A 4TPTA 4MXOA 4GW8A 3QQJA 1K2PA 4GJ2A 4J53A 4XV9A 1VR2A 4Q2AA 4IW0A 4CTBA 3OCBA 3RPSA 4F7SA 5IA1A 3K3JA 4FBXA 4FSRA 3LCOA 2WAJA 5DEYA 3SOCA 3QBNA 4E73A 4RJ5A 4QTCA 4I5CA 5I9YA 4HGEA 5HESA 4RIWB 5HORA 3AC1A 4DCEA 3CTQA 3NZ0A 5CAVA 2VTJA 4FNZA 4R8QA 1G5SA 4ZP5A 4IZ5A 1CKIA 4BWPA 4E4LA 4EZ3A 3HVCA 1H24A 4U3YA 5L8KA 2NRYA 1LPUA 1H0WA 2IZSA 3H3CA 4M3QA 4RX9A 3DBQA 3GFEA 3O0GA 5AM6A 3F82A 2CHLA 4D4YA 4IVCA 2W5HA 3P7AA 3VW6A 1W8CA 4L9IA 5CU4A 4UZDA 4XEYA 3R8UA 1URCA 3F9NA 4D1XA 5EW8A 3GNIB 3E64A 5DRDA 1BX6A 2QOLA 3FZPA 5BVOA 3ULIA 5CEKA 2UW8A 5AJQA 4H36A 4N57A 3LKMA 5J1VA 1XKKA 1JSTA 3DFCB 1PYXA 3D94A 4JIAA 4WRSA 4ZSLA 2BRHA 1MP8A 2XVDA 4I4EA 4CFNA 2WMSA 4XG7A 4FT5A 3SA0A 2FB8A 4YJOA 2V55A 3QRUA 3QA0A 3OOGA 4PV0A 3LOKA 2XNGA 3LFQA 5D1JA 2E9NA 2BIKB 3I4BA 2C5XA 1TVOA 4BKZA 4FA2A 4JDIA 4LGHA 4F1OA 1U54B 4N0SA 4MXYA 4UN0C 4TTHB 4M0YA 3EZRA 1OL5A 2O64A 2E9UA 3L8PA 4XG4A 5EOLA 3WF7A 3VQUA 4FUYA 4O7VA 5KCVA 3DS6A 2G9XA 3H0YA 4M84A 3FPQA 3SDJA 3QTUA 4O7SA 3MTLA 1HOWA 4RC4A 4BYJA 1RQQA 2R3RA 4E1ZA 4FR4A 1O6LA 2XNPA 4C38A 4FEVA 4QP2A 2PUUA 2WKMA 5M57A 4XV2A 5CY3A 1PMEA 4QTEA 3CPCA 2CKOA 2KTYA 1JKLA 2PMNX 4KRDA 4QQ5A 2XM9A 3QX4A 4MQ1A 2C3JA 4G34A 2YABA 1H1RA 2WMVA 2UW0A 4IC7A 5CQUA 1CMKE 5EYCA 5HCYA 4IVBA 1OIRA 3HRFA 1BUHA 3I6WA 3QL8A 5BVFA 1ND4A 2QLUA 2JD5A 4ARKA 5JZNA 3ZM4A 3TIYA 3MH3A 4MNEA 4I0RA 1VYZA 2WTVA 1REJA 3QCSA 4HOKA 4LUEA 5EH0A 5A6NA 2NNWB 3ZDUA 1ZWSA 3R7GA 4UWCA 3O7LB 5EW3A 1V0BA 3D14A 3UOKA 3WBLA 3QTSA 4BDDA 3GU7A 4FKGA 1VZOA 2VGPA 3FMEA 2ITUA 1WBNA 2VO7A 1V1KA 2ZYBA 4ID7A 2X2LA 3LHJA 2A1AB 2PMLX 3G9LX 4XP0A 5IA2A 4AN3A 1M2RA 1OITA 1OMWA 1O6YA 4ITHA 4ZK5A 1PXLA 4BC6A 4EKLA 3NUAA 2XNEA 4TWNA 3AOXA 2QU6A 4LL5A 4D9TA 4NK9A 3AC8A 1WFCA 5F20A 3PJ8A 4U0IA 3DU8A 3EQHA 3RPYA 4R3PA 3OS3A 5E8ZA 1VEBA 1XQZA 4HGTA 4QNYA 1OBGA 2QD9A 3I79A 3VUDA 3BCEA 4IAAA 1PMNA 3OT3A 3A4OX 1GNGA 4TN6A 4QTAA 4Y5QA 4KKHA 3QZGA 4E6AA 1LEZA 4G17A 1M17A 5L3AA 1ATPE 2WNTA 2XEZA 2ZMDA 2WOTA 3QWJA 1P2AA 3I5NA 3NYVA 3R83A 4ASDA 5CZHA 4FNWA 4XUFA 2HIWA 1WZYA 4YPSA 5EW9A 2FSOX 1O6KA 4LOOA 4C3FA 2JKQA 3D7ZA 3EKKA 3O51A 4GG5A 2JBPA 4X0MA 3M11A 2WMWA 1A06A 2YLFA 3Q96A 3R9DA 5IA4A 5KBRA 3R7UA 3MBLA 3AC4A 3GOPA 4C3PA 2VNYA 4FIJA 3OTVA 3PG3A 4H1MA 3FYKX 3R01A 4AW0A 3FMKA 3D0EA 5M07A 4FV3A 1M2PA 4M12A 5AR2A 3HMMA 3UC3A 5BVKA 1BKXA 3BU3A 2Z7LA 4FC0A 1M52A 4JNWA 3VUMA 5HLWA 4TRLA 4ZLOA 2I0YA 2OBJA 5J87A 5J95A 3S2PA 5D41A 3FUPA 3PIZA 2YERA 4QOXA 1GIHA 1ZARA 3FY0A 5BYZA 4XRJA 5K4JA 1ZY5A 5L2SA 1YVJA 5BMMA 3FI8A 1YXXA 2OJFE 5L8LA 4DLIA 3FZSA 5LVPA 5AP7A 2VUWA 1ZMWA 3OY3A 3OEFX 3PVBA 5ANGA 3TXOA 4J52A 4CFFA 4USEA 4FVQA 5I9XA 4NJDA 3UJGA 3ZLWA 2X8IA 2RL5A 5IA0A 2VWXA 3GB2A 3L9MA 1IRKA 3MVJA 2PU8A 4I6QA 3BLRA 5IZFA 1Z5MA 3QGWA 2IVSA 4TNBA 1YDRE 4IAFA 2ZB1A 2C3LA 3PPKA 4E4MA 2XRUA 1BMKA 3NSZA 4PL4A 1FVVA 2QKRA 3R8ZA 5CEMA 4FSMA 3G2FA 3SW4A 5BVWA 4AT3A 4BGQA 2OG8A 5L8JA 2GQRA 2NRUA 3KFAA 3FKNA 3Q9WA 4C4IA 4CVAA 5CNOA 3MI9A 4FSYA 2HZIA 4C02A 4C57A 4CCUA 2PMIA 2IG7A 1WBVA 3PY1A 4Q5EA 3GC9A 2PVFA 2W1FA 4EK3A 4LOQA 5AM7A 1IG1A 3RPVA 5DMZA 1A48A 3I7CA 5HTBA 4UB7A 3E8NA 4A06A 5GJGA 3PPJA 4N6YA 4I5HA 2GQSA 3TM0A 4YJPA 4J96A 3GC7A 2OZAA 3RAKA 2VWYA 2XJ0A 3OC1A 3R7IA 3LXPA 3TCPA 5ETCA 4YO6A 2QR8A 3AC2A 2BFXA 4TL0A 5LVLA 4OBQA 5AV1A 3HA6A 4HYHA 4MF0A 3RNIA 2X9EA 2HZ4A 3QYWA 5IQBA 3FKOA 2BALA 1F0QA 4MD8E 2Z7SA 4AA0A 4L44A 4HVHA 3QCYA 3FDNA 2WELA 4MKCA 3JPVA 3ZRMA 4GFGA 4KKEA 3W2OA 2HOGA 3IECA 4KWPA 4YLLA 3TJCA 4EHVA 3ZONA 3PXKA 4JR7A 4IAYA 3EKNA 4DEHA 4UEUA 4FT7A 1FBNA 3UNJA 4YJRA 3ZRKA 4GEOA 4LG4A 4ZS0A 3I0OA 1H25A 3MDYA 3MPMA 4MNEB 5ETIA 1OGUA 3VVHA 5IQFA 1UNGA 4NFNA 5CALA 5GINE 2VWWA 3EIDA 3KMWA 3UZTA 5KZIA 2WTDA 3LCDA 3IQ7A 3M1SA 4HZSA 4L67A 4R5YA 5CF6A 5EM7A 5EG3A 4PPBA 4H3PA 1JWHA 4BDHA 4JDHA 3DJ7A 1ZXEA 4DLJA 4C4EA 4DGMA 3HP5A 2A27A 2VRXA 3CIKA 3CQEA 4FK6A 5ANEA 4G3FA 2UV2A 3KK8A 2ESMA 4CRLA 2PVYA 3PZHA 2VO6A 2WU6A 4EC9A 1NW1A 3QD0A 2R9SA 2PSQA 2WTCA 5E8WA 1YWRA 2YIWA 4GS6A 3G6GA 5HBHA 3TIZA 3PJCA 4FGBA 4X6QC 2PL0A 3A7HA 5HVYA 1XH4A 2VO3A 4GG7A 4X6RA 5HNGA 4JBQA 4O7TA 3TV6A 2VX0A 4B8MA 4TYEA 5LARA 4IWOA 4AE6A 4D0WA 3LXLA 4IVDA 2VO0A 3UG1A 2XEYA 2BCJA 5AV4A 4GT3A 4FKIA 4F65A 3OUKA 4EOLA 4YJSA 3EH9A 4L6QA 3FKLA 4KNBA 3KGAA 5I9UA 3WF6A 2JIVA 3ZRLA 4OAVB 5BUEA 2BTSA 3H0ZA 3DK3A 3LFEA 4Y8DA 3OUNB 4BCFA 2C6LA 4YC6A 4C8BA 3F61A 1WCCA 3UIUA 1ZOEA 4GFMA 5IG1A 3QTQA 4I94A 2BZJA 2C0IA 2VGOA 5AV0A 3O8PA 3ZEPA 4F64A 3VS1A 3KMMA 3VHKA 2JDRA 4NCTC 4GK3A 3ODYX 5DR6A 1WBWA 3KXHA 3ORLA 1UV5A 3OWJA 5AP2A 3LFFA 4UY9A 5A6OA 3RAHA 2C47A 3NEWA 4IX6A 3AGMA 3LFDA 2ZB0A 2WQOA 2G2HA 2HY0A 3N9XA 5HG9A 3WZKA 4XV1A 2P4IA 4ZSJA 3ZZEA 2C5YA 2RIOA 3LFCA 3PUPA 1Y8YA 4X3FC 2B7AA 4ZXTA 2HY81 5CEQA 3FE3A 3PP0A 3SXFA 4BZDA 4LRJA 4Y72A 4HGLA 4QP3A 3TJDA 1DI8A 2C3KA 3CD8A 4RJ4A 4ALVA 3ZUTA 1KUTA 2PTKA 4AGCA 4IAIA 4EUTA 3JY9A 2HZ0A 2W1EA 3LLAA 2HWPA 4KSQA 2GFCA 3KULA 4NH1A 1KWPA 1PXIA 3NUXA 1RDQE 4CFVA 5BUIA 2WTIA 1JQHA 2GHLA 4TWOA 5C8KA 1YXSA 2XH5A 4FZDB 4GCJA 1KE7A 3UIXA 4CMOA 2I0VA 5LVOA 3QCXA 3CQUA 3SW7A 3NYOA 2RGPA 1UVRA 4ACMA 2YIYA 1U46A 3LCKA 4I22A 5AUTA 3IKAA 5CLPA 2A0CX 3PA3A 2UZUE 4HPUE 2VTRA 5FQDC 3GP0A 2C1BA 2VWVA 4ZTMA 2OZAB 2XIXA 3E3PA 4ZTHA 5AR7A 4UX9A 3VF8A 4CLIA 5K0XA 2EB2A 2OFVA 3UQCA 5EYDA 4J99A 3VHEA 3BLHA 3GFWA 3QQLA 4B7TA 4UMTA 4FV1A 4YSMA 4D5HA 4CFWA 4FKUA 2YA9A 3KC3A 3LFBA 3TN8A 3Q4TA 5HIDA 1IA8A 3SV0A 3AMAA 1Q4LA 4PUZA 4PX6A 4D2VA 2UVXA 4HVIA 3KRLA 5GZAA 2W05A 3QHWA 4NM0A 4FMQA 3R2YA 5C03A 3WZJA 3EQDA 4DT9A 3UVQA 5HIEA 4DA5A 3QRTA 4ZZMA 3KB7A 4GU6A 3TG1A 3PVUA 3Q6UA 4D2WA 1J91A 3MVHA 3IS5A 4R7BA 1KE8A 2PE1A 5FBOA 4QMOA 4I24A 3P4KA 1FINA 3G9NA 2ACXA 5FLFA 4RJ6A 2WIPA 2GTMA 3BLQA 3ZDIA 2C69A 3NAXA 5TO8A 5FTGA 3EZVA 4BVUA 2Y7JA 1YKRA 3EFKA 4NM7A 3W1FA 4B8LA 4RG0A 2VN9A 3GUBA 3POZA 4I20A 3KEXA 4HYUA 1OPLA 2DQ7X 1MRUA 4YLJA 2R0UA 3FXXA 3LFNA 5IUIA 5AA8A 1OI9A 3G6HA 4QP1A 2R3PA 5DIAA 3LVPA 4L45A 4AF3A 5IUHA 1FMOE 4ITJA 3DZQA 4I6FA 3BYUA 3MH0A 1Q3DA 3MFSA 4FTIA 3Q60A 4IX4A 5F95A 4B6LA 2DS1A 3VJOA 4O84A 2BROA 2GS2A 2B52A 3KXGA 4RT7A 3KF4A 3ZFMA 5IF1A 4U6RA 5HGIA 1RJBA 3VWAA 2BKKA 4F4PA 3O2MA 4E4NA 1KV1A 4HPTE 4WG4A 4XS2A 5EHOA 4F7JA 1W7HA 1YHSA 2R3GA 5A46A 1IA9A 2FGIA 2B4SB 5DOSA 3DNEA 1XH7A 3AQVA 3PFQA 4GU9A 5AR8A 2BZIB 4RWJA 4D5KA 4AW5A 4FG8A 4U7ZA 5HBEA 4KS7A 2YLEA 1W0XC 4DE4A 3RALA 5HHWA 1O9UA 3SC1A 3R7EA 3KY2A 3ZUVA 1ZLTA 3K3IA 1YHWA 3SXSA 3ZSIA 3A62A 4TYHA 3PRFA 5E90A 5B2LA 5CT7A 4NYEA 4JBOA 5AX9A 4KKGA 1QPDA 2JLDA 4FNXA 4Q5HA 3P1AA 3ZHPC 3LFSA 1STCE 3W2CA 3V5QA 5HX6A 2UZNA 2EVAA 3LLTA 2QO7A 1URWA 3ZLYA 1SNXA 1BI8A 2F9GA 3ETAA 1YQJA 3OVVA 4IJ9A 4XNEA 4OTHA 3BQCA 2Z8CA 5TKDA 1OL7A 4GUEA 4ANMA 3UVPA 3ET7A 3LM5A 4LOPA 2R3IA 1PKDA 3DXNA 1H0VA 2VTTA 5HICA 4W4VA 2J0IA 1Q8ZA 3LMHA 3CP9A 4BWKA 4YLKA 2UW9A 4JAIA 3MJ1A 4KIQA 4YJQA 2UZVA 4XJ0A 1RE8A 4RIWA 5HU9A 1QPCA 2AC3A 3KULB 4YJTA 5LOHA 4XG9A 4FV7A 3I1AA 2OK1A 5C01A 2B53A 2WHBA 3O8UA 5FTOA 3PVGA 4FOCA 2V62A 2C5VA 3EQIA 3EQCA 3MIAA 3F3UA 3UIMA 3QUDA 4YTFA 1QPJA 2RFNA 4TYIA 3QZHA 2W5AA 2QO9A 2BZKB 3HAVA
chains in the Genus database with same CATH superfamily
3IONA 1PJKA 4QQJA 3E3BX 1JSUA 4AGDA 3A7JA 4O81A 5M53A 1ZMVA 2PMOX 2OXXA 3MGYA 3F6XA 5EM6A 3D9VA 3TDWA 4MWIA 4FI1A 3G33A 5AIRA 2VTLA 2OWBA 2OZOA 4AZSA 4CCBA 3FLZA 4ZTQA 4RWKA 4TKSA 3P08A 4PDOA 4H39A 3VS3A 5HG7A 3FV8A 3TACA 4A4LA 1H4LA 3CKWA 4QMTA 3TUBA 5AA9A 3R1NA 2H8HA 2R3LA 5KMNA 3F7WA 3DQXA 3HGKA 2F4JA 3JVRA 3ORTA 4ASEA 2W1DA 5AP4A 2REIA 3SRVA 2CSNA 1UU3A 3KL8A 4GK2A 4IZYA 5E8XA 3GC0A 5IA5A 5M4UA 5IEVA 4FJVA 4E3CA 3WZEA 2ZJWA 2XNBA 4YZCA 4CEGA 3O17A 4R7HA 3W0PA 2XIZA 5I5ZA 1ERKA 4JRVA 4M66A 2J4ZA 1IASA 4MWHA 3EFLA 2AQXA 4X2NA 3ZC5A 2R3OA 3IOKA 5DA3A 5EHYA 4R1YA 4EOJA 3F7ZA 3FMNA 4PDPA 2VTIA 4G16A 4ANBA 4E93A 5BYYA 5JGDA 3WE4A 2CDZA 4M8TA 3KRRA 2J90A 2ZV7A 3E7OA 4XYFA 4I0TA 1MQBA 3QTIA 3TYKA 5EHLA 4EYJA 2QNJA 2BHHA 1OZ1A 2BIYA 2Z02A 5BX0A 3ZLXA 1BYGA 3UOLA 4E5BA 2QOHA 1GOLA 3FJQE 4NSTA 3RZBA 4KIPA 3KRJA 4FV9A 1PXKA 2FO0A 2DWBA 3C51A 4LI5A 4OTRA 4CT2A 2R64A 4NFMA 4ZY5A 5JQ8A 3G0FA 2Y6MA 4BF2A 5KMLA 2R4BA 2YDIA 3ULZA 3QTRA 4QMNA 3DJ5A 4FZ6A 3WARA 2OI4X 1NVQA 2PHKA 3BU6A 4V01A 4X3FA 1NA7A 1H1WA 3BYMA 4ENYA 4NUSA 2XF0A 4FVPA 1K9AA 4J97A 4D58A 1G3NA 5IU2A 3U51A 4IM2A 3NUNA 4ZJJA 2HYYA 4IACA 3HRCA 4YTHA 5FDXA 5CANA 4L01A 4KABA 4BIEA 5HI2A 4TYHB 4F0IA 5L6PA 3U6JA 3FXZA 4WG3A 4PTGA 2UZBA 4A4XA 4V04A 1NY3A 1UKHA 3DPKA 2WTKB 2HW6A 3NX8A 4FTLA 4H58A 4M68A 3UC4A 2VX1A 3UDTA 4FL1A 3ALOA 1W2FA 1R78A 2QCSA 4DFNA 4FTCA 3R30A 3HX4A 3Q32A 4FZ7A 3VRZA 3DXQA 2X8DA 3B2TA 3MS9A 4JL9A 5A4CA 2PPQA 3QTWA 4UZHA 2EXCX 4O7NA 3EHAA 4BYIA 3BGQA 3S95A 1WVYA 3ZLSA 4BDAA 3FLYA 4KAOA 1U4DA 4Z55A 3P23A 1YHVA 4GT5A 2XKFA 4F78A 2W4OA 4I41A 2YIQA 3DTWA 2IN6A 4QT1A 2XM8A 2B9IA 4FKQA 4BIDA 2BAKA 1OL6A 2JIUA 2QOIA 2WEVA 3R1YA 4GSBA 3B8RA 4LRMA 4W9WA 3KREA 3N4VA 3Q9ZA 2YM5A 5F1ZA 4FEWA 2RFDA 2OH4A 3CQWA 3F5PA 3PSCA 4FODA 4NM3A 4EH8A 5M4CA 2YEXA 4QYGA 2XK9A 2WIHA 3EN7A 4F1TA 3PIXA 4MEDA 3TZ9A 3MIYA 2IPXA 1MRVA 3KRXA 1SZMA 1ZMUA 3D5UA 4QDVA 3TZ8A 4E4XA 4D9UA 5ETFA 3ATTA 4TNDA 3NUYA 3Q4CA 4IMYA 2QHMA 5CX9A 5KMOA 4L43A 2QI8A 2ZM4A 2A2AA 4I6HA 4AQKA 3FHRA 2YM6A 2WTJA 4BKJA 2OW3A 3B2WA 3DT1A 4IWDA 4LFIA 3UZPA 4EH3A 4EK5A 2BHEA 3FBVA 1IAHA 4YO4A 4A9UA 4RWLA 5HKMA 1PRYA 3DBDA 4EK8A 2W4KA 4M14A 4DFBA 1PXOA 4EYMA 2ITQA 2W1ZA 4BCMA 5GHVA 3QD4A 2GNGA 2R3FA 3FLNC 4O82A 2W17A 3IW7A 4CYIA 5JMSA 4O6LA 3O5AA 1IEPA 3R04A 4P2KA 5IUGA 2O2UA 2YCQA 2OFUA 3VQHA 3W16A 2WD1A 5AR3A 4ASZA 4JQ8A 2X6DA 4EH4A 5CAUA 3EQFA 5H9BA 3AKKA 3BV2A 3HDNA 2NO3A 2HWOA 4K8AA 2GNHA 2QQ7A 4PQNA 2OJ9A 2XCHA 4S30A 4XV3A 3HV5A 3PJ1A 2VX3A 4USFA 3K2LA 5CVFA 3W2RA 2HK5A 3F2AA 3SRVB 3VULA 4F0FA 1M7NA 2HENA 2J0LA 3FHIA 2IEWA 3OXIA 1OB3A 3UO4A 5A14A 2VU3A 5EQEA 4BCPA 5L2QA 2X0PA 2YM3A 3TZMA 4DH5A 3QD2B 2JAMA 3WYYA 3VUTA 3VJNA 1I09A 1YXTA 4ZTRA 2XIYA 4L52A 2PZ5A 4EEVA 1M14A 2ITYA 3V3VA 4C36A 3NMUF 4I6BA 2X4ZA 3VNTA 3C4XA 2Y6OA 3ZFYA 3Q04A 3RWPA 4FTNA 4G9RA 5C1QB 4YGAA 4JRNA 5CU6A 3R9OA 4JVGA 5DE2A 4QPSA 2PVNA 3VUGA 4FKJA 3KA0A 3DBEA 3OCGA 3VW8A 4EK6A 5FXQA 4JOAA 1ZZLA 5M51A 3EFJA 3A60A 3COHA 4QP4A 3AGLA 4AX8A 2BUJA 3IDBA 4FIEA 5KHWA 5CQWA 4BRXA 2PVLA 3RJCA 1YI3A 4I1ZA 3E5AA 5G1XA 4DFUA 4U42A 1W98A 2JGZA 4RGJA 2PYWA 2X6EA 3RZFA 5DHJA 4X3FB 3FZTA 2OKRA 5DWRA 5EM8A 3RI1A 3AMYA 2ITNA 5KHXA 3NR9A 3BLAA 3EQPA 5CNNA 2Y0AA 5J5SA 4XRLA 5GIOE 2ZDTA 5H3QA 3MPTA 2BVAA 2OICA 4EJ7A 4CKRA 1Z9XA 4YC8A 4FSQA 1QL6A 1H01A 3H9OA 2YM4A 3BPRA 4IX5A 4FV0A 5T6KA 3N51A 4O1OA 5GJFA 4A9TA 4EOSA 3VN9A 2BDFA 4BB4A 5A3XA 4G3CA 1FPUA 4PRJA 3ANQA 3ZSGA 5EDPA 3KU2A 3FMLA 4AOTA 3VS0A 3DLZA 3E8EA 4WNPA 1Y91A 4R5SA 3MB6A 4MX9A 2JDSA 5CEOA 5L2IA 5HO6A 4O2ZA 4EHGA 3N4TA 2ETRA 2O3PA 3FZ1A 3V6RA 1UWJA 2GSFA 5HTCA 2O63A 2P55A 5DYJA 3KXMA 2HXQA 1P4OA 4RJ8A 5LVMA 1W2DA 4W4WA 2XBJA 3GEQA 4BI2A 2R3QA 5EDQA 4ZAUA 2XZSA 1E1VA 3NNVA 4BHZA 4IZ7A 4LV5A 2JAVA 3RM6A 4EHEA 2CNQA 4IH8A 3N4UA 3R9NA 3SHEA 3GC8A 2ITPA 3F3TA 4EBWA 4FYNA 4D28A 4Z3VA 3O8TA 4K18A 3UE4A 2J0MB 3PY0A 4G3GA 2IW8A 5FUTA 2LGCA 2BPMA 2QOOA 4QP7A 1Q8UA 2PZRA 3A4PA 3ZOSA 3LMIA 4BDEA 2JFMA 3HP2A 1J1BA 5LMAA 5BMSA 1YI4A 5LMKC 5JN2A 5GZ8A 4MBLA 2H6DA 4O4EA 3ZO2A 4MBIA 3FL4A 4RIOA 3UDZA 1W82A 1OIQA 1XBCA 5FG8A 2PVMA 3QRIA 4KUJA 4R3RA 1P5EA 4LMNA 5TR6A 2LAVA 2XRWA 4U41A 5EKNA 3AXWA 3PPZA 4GL9A 1XH6A 4KBAA 1P4FA 2CNVA 4L68A 3TNWA 3CD3A 3V01A 1HCKA 4ZTNA 3ZXTA 4L3PA 4IXPA 3CTJA 4TYGA 1H1QA 3Q5IA 3V5PA 5CF4A 2ETMA 2JKMA 2XMYA 3OP5A 4J1RA 1GZNA 4UYAA 3VBXA 4AN9A 1VJYA 2VWZA 1M2QA 4MUQA 4X2FA 2CGVA 2WTKC 5EI2A 3C4FA 3DY7A 4OTWA 3FC1X 5JT2A 2PUPA 4FEXA 3VAPA 5A9UA 4XG8A 2JDOA 2QVSE 1QCFA 3D7TA 3PWYA 3SKCA 4DFYA 4UMRA 1Q61A 2OU7A 3POOA 5EK7A 3C0IA 4U40A 5EI8A 4JG7A 4E6CA 4ZZOA 4M7IA 2Z7RA 3ZTXA 4AE9A 5B2MA 2W1HA 2WFYA 5DH3A 4EK4A 4CKJA 4RA4A 3RWQA 1LEWA 3OXZA 3RP9A 4CQGA 4C4GA 4U45A 4FE2A 4EZ5A 2FSMX 2XJ2A 2JBOA 3ALNA 3AD6A 3FWQA 3HV4A 1XH8A 3NNUA 4IQ6A 3EQGA 1OKYA 4CFMA 2BFYA 4DN5A 3BGZA 4HCVA 5HNBA 4I0SA 4FKRA 4FZFB 4N4SA 3A2CA 5CZIA 4AZFA 5FRIA 4C7TA 1YDSE 3KCFA 2ITTA 4RC2A 5L4QA 4ANOA 4UMQA 4YJVA 3OW4A 4FNYA 4QTDA 5DN3A 3L9PA 4AZTA 4M0ZA 5AP0A 4N6ZA 4EL9A 4FIIA 5E4HA 4UBAA 3ITZA 1KE6A 5HLNA 4DEBA 4Y85A 4FK3A 5LCJA 3R7OA 4DAWA 3D2IA 2G1TA 3R8PA 2WMRA 2B9FA 4D55A 3PUFC 3PXZA 3RBWA 4X7QA 2CKPA 3PXYA 5DLSA 3U87A 4YHJA 1PXPA 3QZIA 4C2VA 2Q83A 2ZMCA 3BHUA 4QMUA 3R7VA 4BBFA 4WBBB 1H1PA 1JVPP 2RFEA 2YAAA 1ST0A 2CGWA 3FMHA 5ANJA 2PE0A 3C0HA 2E9VA 2E2BA 2WO6A 2CGUA 4XOZA 4OTGA 2R5TA 3MN3A 2KULA 3RAWA 3VRYA 3UDSA 2X7FA 4U79A 4CMTA 3KVWA 2YM7A 3UTOA 3ATSA 2C6KA 3LIJA 4ANQA 4F6WA 3UQFA 2DYLA 1WBPA 2B1PA 3GBZA 4GVAA 2QHNA 2O8YA 4BKYA 4YR8A 5CXZA 1W83A 2XP2A 3TNIA 3MYGA 4FTTA 3FZRA 3BWJA 4WNOA 3VUIA 2QOQA 3I7BA 2OF4A 3QQHA 4ACGA 4KIOA 2FSLX 2JKKA 3IW8A 3DB8A 4RMZA 3NRMA 2W9FB 5C9CA 3DCVA 4MD7E 4FSWA 5IQAA 2BAQA 3II5A 4II5A 4BDJA 2EXEA 4CZUA 1Y6AA 3CY3A 3C4EA 3QRKA 4S32A 4YHTA 4TYJA 5FP5A 2GNLA 4ZY4A 3S3IA 4PMTA 4O0SA 1UU7A 1WMKA 3C4WA 3TTJA 1R0PA 2OO8X 5HO8A 2YM8A 3EFWA 4QNAA 4WOVA 5JGAA 2I1MA 2YWVA 1DI9A 2WEIA 4LL0A 4EJNA 1X8BA 5DEWA 3R9HA 3BIZA 4R78A 4WNMA 3DGKA 1H07A 3THBA 5I0BA 4DT8A 4CT1A 1DAWA 1FMKA 2C6MA 2R3HA 3EB0A 4RLLA 3UPXA 1H00A 1SVGA 3CXWA 4FG9A 4I5MA 5CSXA 4ZTSA 2PUIA 4JT3A 3BU5A 5ANOA 5A4QA 3MJ2A 2BRGA 3S0OA 1H08A 4HCUA 4CZYB 2JIIA 3QC9A 4U9AA 3NNWA 4HJOA 5DPVA 5KKRC 3EYHA 3DXPA 4I92A 2VD5A 3DAJA 4X2KA 5LWMA 2GHMA 4XCUA 4IEBA 4HYIA 4XP3A 4EH6A 4IM3A 2VTPA 4FTKA 5ACBC 2NP8A 5M08A 2C6EA 2XKDA 3E8DA 3W8LA 3MFUA 5HBJA 4L7SA 3QC4A 2UZDA 1Q24A 4S2ZA 4ZJIA 3P79A 4TWCA 4QEBA 3ZO3A 5CSWA 4RIXA 3HYHA 4U97A 3UO5A 5L6WL 2UVYA 3P5JC 5CF8A 3EWHA 4MYGA 4L7FA 3WIKA 2GCDA 5ITAA 4TY1A 4DH7A 3E87A 4DH8A 3UZRA 3NW5A 3DOGA 3M42A 3D7TB 3A8XA 3DB6A 4D2TA 3RK9A 3QKLA 4L53A 2WMQA 4FF8A 4ZZNA 1CKPA 4RVKA 2YZLA 5JEBA 2A19B 3CE3A 4F1MA 3UGCA 4UALA 4ERWA 2GNFA 3SG9A 5KE0A 3UNZA 2F7EE 3R7YA 4OW8A 4K0YA 4O22A 3D83A 3R2BA 5HQ0A 4RPVA 1GZ8A 3BV3A 5HLPA 4C4HA 3NVMB 2P33A 2OXDA 3F3ZA 3Q9YA 3R1QA 4O2PA 4QPAA 4TWPA 4DEAA 4HVGA 5CU3A 3QWKA 3AKLA 4CRSA 3VS4A 1XJDA 3KVXA 3BHTA 1JBPE 3GCSA 4FKLA 1ZOHA 1ZYJA 3K5VA 5H8EA 3MESA 4MXCA 3OD6X 2R7IA 4EQMA 3NFGB 5E91A 2VV9A 3QYZA 4JMQA 4GH2A 4O4DA 3RCDA 4FV4A 4MH7A 4E20A 4O96A 3PA5A 4YZMA 4ZY6A 2ZVAA 4EOMA 2QG7A 2WXVA 4XG2A 4ALUA 1SVHA 4TZRA 3IW4A 3Q4ZA 5HIBA 4D1ZA 2C1AA 3PLAE 3ORNA 1T45A 2UW6A 3PYYA 4NT4A 1XH5A 2C0OA 1XBAA 4AQCA 1FVRA 5HD4A 2CKQA 1TKIA 4YBJA 1SM2A 3AC3A 3C5UA 5D7AA 3KQ7A 1UA2A 5IKWA 4IJPA 3VONA 4BDKA 1JPAA 4DGGA 3DQWA 4JIKA 3R71A 4XP2A 3CJFA 3RINA 4DGOA 4BGGA 5CEPA 2VZ6A 3QRJA 2F57A 3QX2A 4JLCA 4BCQA 3R8VA 4UWBA 4NL0A 3Q2JA 4DFZE 4QP8A 3DLSA 3V5WA 4ANNA 5AFVA 2H9VA 4GYGA 4D4RA 4EZ7A 4GIIA 3IGOA 5J8IA 4GKHA 2AYPA 3C13A 5LMKA 3DV3A 4H1JA 1KOAA 2X9FA 5HG5A 1TQIA 3BEGA 1PMVA 4IDTA 5AAEA 5IQEA 3C9WA 3O71A 1E1XA 2CCIA 2W9ZB 4G3DA 3VC4A 3ZSHA 3WOWA 5CF5A 1UNLA 3AT3A 4KSPA 4FTUA 4CQEA 5DGZA 3PJ2A 2W99B 4YMJA 5AUUA 5EQYA 4F9AA 3IO7A 4ZLZA 2BRBA 2UZTA 4IAKA 4RIYB 2RG5A 1TQPA 2ONLC 1WAKA 3I81A 4QMVA 4QQTA 5B7VA 4F63A 3OT8A 3W18A 5C26A 3PWDA 3OF0A 2RF9A 3IGGA 3MV5A 1DAYA 3V8SA 3OCSA 2F49A 2YIRA 3Q3BA 3OMVA 3R6XA 3BGPA 4RFMA 4E5AX 2WMTA 4C34A 2VTMA 4DHIB 4ACHA 3C0GA 4AAYA 4AG8A 3ENMA 3CR0A 3F66A 3FLSA 3VS5A 4JXFA 2XCKA 3RCJA 5IQHA 4D2PA 5D9HA 5L2WA 4EOPA 3ACJA 2G01A 2YJSA 2GHGA 1OM1A 2CCHA 2RG6A 3P0MA 4GKIA 1PY5A 4FVRA 4A07A 4GJ3A 5DVRA 3NIEA 5LWNA 3ML1A 2GFSA 3FQSA 1YRPA 4FG7A 3ZM9A 2R3JA 4AGWA 4L46A 3R0TA 1PW2A 5AAGA 4G6NA 3UOHA 1RW8A 3LAUA 2VTNA 3QF9A 4EH9A 3BL7A 5TE0A 2V5QA 4PMMA 2HXLA 3HMIA 4RX8A 1Q41A 1ZZ2A 2J51A 4S33A 3MWUA 3MB7A 4WIHA 2YJRA 4LUDA 1OUYA 4IE9A 1XH9A 4RIXB 2FYSA 1S9IA 4W8DA 3ZO4A 3FZOA 4RFZA 4TXCA 3S1HA 3HRBA 2B9HA 5T3QA 4C4FA 4CYJA 3HEGA 1ZYCA 4O0WA 5IPJA 3CC6A 4RX5A 3OBJA 4KIKA 5CS6A 4C2WA 2J2IB 4FT9A 4ANSA 1GZKA 3U6IA 3TKUA 3P86A 1FQ1B 4NKSA 4DEGA 5JKGA 4D2RA 5AWMA 2P0CA 3B8QA 4UMPA 2QG5A 3OWKA 4FKPA 5AUZA 2BMCA 3Q2MA 2WTWA 3V5LA 5JGBA 4CV9A 3NNXA 2UW3A 3VS2A 3SXRA 3C5IA 3F3VA 4PY1A 4EC8A 2I0EA 4FUXA 3JY0A 4AT5A 1ZAOA 4GYIA 3Q52A 4IANA 3WF5A 4E26A 3GQLA 3P78A 3BELA 4PNKA 3ORMA 2ITWA 2J50A 1PHKA 5IMEA 3OTUA 4WSYA 3ENHA 2W96B 2QONA 3V5TA 3I6UA 3JR1A 4I93A 4BCHA 3T9TA 3V51A 2C0TA 1GIJA 3LQ5A 3A61A 3MTFA 5GIPE 4LYNA 1QPEA 2XNOA 3ACKA 1ZYDA 3NYNA 4MK0A 4RFYA 5LQFA 2C4GA 3NIZA 5E8TA 4P5QA 2XKEA 3H10A 2ETKA 3VBVA 3ORIA 4EORA 2JEDA 3ZUUA 2VTHA 5BVEA 4PWNA 2WQBA 4X2JA 2BDWA 5DBXA 5AP6A 2OJJA 3VBWA 2VTAA 4N70A 3COMA 4XMOA 2G2IA 4QMLA 4Y83A 3AT2A 3RHXA 5KMJA 3UNKA 4MXZA 5IH6A 3DZOA 2Y8OA 3NUPA 3BYOA 2X2MA 2IO6A 4K11A 1XBBA 1Q8YA 2XB7A 2Y4PA 5E1SA 5AR4A 4W4YA 4XBRA 3UP2A 4OTDA 4F09A 3CPBA 4AXAA 4XH6A 2CGXA 1PXJA 4J98A 3ORXA 4YTCA 4H05A 2EWAA 3HMPA 3CTHA 2J9MA 4TW9A 5DFPA 4DCAA 3JVSA 2YWPA 4EUUA 4F6SA 3LCTA 4OBOA 1WBOA 4BWXA 4ZOGA 1ZYSA 5K5NA 1L8TA 5AP5A 2WPAA 4IB5A 2AC5A 2C3IB 4JAJA 4DBNA 3EMGA 4C0TA 4KD1A 4EONA 4J8MA 3BBWA 4G6LA 3OWPA 4S31A 1CSNA 4FGRA 2UZWE 3DK7A 2XUUA 2F2CB 2WQNA 4C33A 5CSVA 4ZSEA 3HL7A 4U5JA 3GCQA 5AP1A 1BL7A 3GU6A 3MFTA 1JKSA 3LJ2A 3L9NA 4FTMA 3RK7A 4ERKA 5KO1A 2Q0NA 2WMAA 3DTCA 1J7IA 1SYKA 4Q9SA 3FI3A 3G15A 1CDKA 5CYIA 4CGAA 1B39A 2I0HA 4NW6A 5DR2A 3UOJA 4F7NA 1U5QA 2C6DA 3WF9A 4B99A 2PZPA 3WYXA 2RSVA 2VAGA 2R7BA 3AG9A 3D4QA 4DEIA 4GFOA 4CXAA 5DI1A 5J79A 3I0QA 3BHHA 4UXQA 2FVDA 3S00A 4IB1A 2H96A 4MAOA 2O5KA 4A7CA 4BBMA 4IX3A 4KRCA 4D4VA 4CSVA 5IDNA 5BYLA 2XK8A 3R9RA 3TNHA 4NEUA 3ZBXA 4WNKA 3V6SA 1V0PA 3IDPA 5I9VA 2BILB 2OIQA 1ZYLA 5GZ9A 4Q9ZA 1DS5A 1YXUA 2QR7A 1KSWA 4PPCA 4ENXA 4CKIA 2OH0E 3IW6A 2X7GA 3AD4A 4QYFA 4FOBA 4APPA 3UG2A 2XS0A 2ITXA 4OR5A 4O38A 4BTJA 4GVJA 2P3GX 3NW6A 4ZMFA 3RTPA 5JFSA 5EFQA 5FWKK 2WB8A 2YFXA 2IVTA 4FSTA 3JXWA 2F7XE 5HU3A 3ELJA 4J7BA 3IK3A 3R8MA 4ASXA 5F94A 3R02A 3TWJA 3MVMA 4IB3A 2Q0BA 5K3YA 4DINA 3PDTA 4BZNA 2JDTA 4P5ZA 1YWNA 3DDPA 4GUBA 4JI9A 4IBMA 5IQCA 5KUPA 3FI2A 3IPHA 4KIKB 3HV6A 5IQDA 2PE2A 4OTPA 3H30A 5AUXA 3I60A 5KMKA 4BI0A 5A4EA 4CFUA 3OOMA 3R00A 4L8MA 5E92A 2JDVA 3G51A 3TI1A 3VO3A 5CENA 3BWFA 4EH2A 4U81A 2QOCA 2Z60A 5CVHA 2A4LA 3PFYA 4KBCA 5J9YA 1U59A 4ZSAA 1OPJA 4BDGA 5BVDA 4BZOA 4RZWA 3LCSA 4O4BB 3BQRA 4MVFA 3WZUA 4XX9A 4WO5A 2YZAA 4BTMA 4X3JA 3EOCA 3CBLA 2GNIA 3OFMA 2XIRA 4JBPA 2E9OA 3F69A 1XO2B 4AW2A 4NW5A 4RJ7A 2C30A 4WKQA 4BHNA 1WBSA 3Q6WA 4EHZA 4HCTA 4BCJA 3A99A 3QA8A 4O91A 3KIOC 2B9JA 5I4NA 3FSFA 4AXEA 1F5QA 3KN6A 3CLYA 2PWLA 3HA8A 5E8UA 4C62A 4PF4A 4GK4A 3HV7A 4YNOA 2ZV2A 3R63A 3BBTB 3RPOA 4D2SA 1YOLA 2IZUA 3UVRA 2WQEA 4NTSA 3OHTA 5CU0A 2AUHA 3HECA 4U44A 5LJJA 4ZS4A 5M55A 4IWPA 4AU8A 3A7FA 3Q9XA 3FYJX 4EOQA 3G90X 4MTAA 4QMWA 5HG8A 5HE2A 3QAME 2CN8A 3ZO1A 4DG2E 2I6LA 3QLFA 4AFEA 4QO9A 3U8WA 1QMZA 5CXHA 3NUSA 3LXKA 1J3HA 1CM8A 1YOMA 3PLSA 1H8FA 2ONLA 5KMMA 1H1SA 2B55A 2PVKA 2JC6A 3SQQA 3TZ7A 3LM0A 4EWQA 1B6CB 3R1SA 1YOJA 4F99A 2QLQA 3CGFA 4O7YA 3BE2A 3KRWA 3C50A 4PL3A 5AIKA 5DR9A 2O65A 2PY3A 4EQCA 4F9CA 2HELA 4K77A 4XOYA 1Y8GA 1MRYA 4OUCA 2WOUA 4K1BA 5HE3A 4I21A 4A9RA 4BFMA 2XALA 5B2KA 5IH5A 3OG7A 3WE8A 2UW4A 5FXRA 2P2IA 2IZTA 3HLLA 1KOBA 5T68A 5KX8A 3W2QA 4M15A 3MY1A 2O0UA 2I7QA 4AUAA 4MF1A 3IG7A 2QOKA 3UODA 4E6DA 3DDQA 4FX3A 3ROCA 1UU8A 5JFVA 1R0EA 2RFSA 4JG8A 5J7HA 4JJRA 3E92A 2YCRA 3FQEA 4RQKA 5KKRB 4RJ3A 4FIHA 4IC8A 1Q5KA 4O0YA 5FXSA 4DEDA 2VTSA 2IF8A 4FV8A 4YNEA 3UP7A 4FTAA 2W5BA 2Y4IC 3PE1A 4GV1A 4D0XA 1H27A 2PZYA 2C6IA 3GU5A 3QQGA 3VBYA 3NAYA 5CT0A 3W2SA 4YUQA 5H8BA 3DBCA 3RM7A 2QKWB 4IADA 4DC2A 3DKFA 3ZBFA 2PVJA 5FDPA 5I9WA 2GDOA 3L8SA 2V7AA 4PTEA 1AD5A 4O0VA 4H3BA 3VS7A 3LQ3A 3COIA 2CJMA 4XLVA 3LJ1A 3MA3A 3CCNA 3PVWA 3DKGA 3UO6A 3OCTA 3L8XA 4QMMA 3W2PA 3E8CA 3EN9A 3KKVA 3BKBA 1MUOA 4EOIA 2BKZA 4CG8A 3NCGA 4PNIA 5HCZA 2VNWA 4AOJA 4D1SA 5JQ5A 2G15A 3V8WA 4B4LA 4AP7A 1J7UA 4RBLA 3C1XA 4P4CA 3PRIA 4D4SA 1PXMA 2OJGA 5ACKA 5EI6A 1B38A 4H3QA 4RX7A 5JRQA 5K4IA 3TV7A 1I44A 2CLXA 4I5PA 4IWQA 5JFWA 4BGHA 1LR4A 4MNFA 4UYNA 2DUVA 1Q8WA 3MY0A 3E63A 5JRSA 4FSZA 4V05A 5AMNA 4YPDA 4F9BA 5LCKA 2GS7A 1J7LA 4O4CA 4AGUA 5E7RA 4FT0A 3SD0A 3HUCA 4NKAA 5ANIA 3CS9A 5D10A 2XNMA 4DITA 1PMUA 3TT0A 3EN4A 4CTCA 5BUJA 4JDKA 3ORKA 2J0JA 1CKJA 2ITZA 5K9IA 3K5UA 1KV2A 4WA9A 4F0GA 4LQMA 3C4ZA 3K54A 4FV2A 4FYOA 4XLIA 4AT4A 3RK5A 4JQ7A 4EOOA 3O23A 2V22A 3M2WA 4BTFA 1OUKA 2QOFA 3FC2A 4AFJA 3GVUA 4EH7A 2EB3A 4F6UA 3UYSA 4ORKA 2YAKA 1YDTE 1JAMA 1GAGA 4DHFA 5M09A 5E8SA 1NXKA 4NWMA 5DT4A 4DF3A 3NWWA 3FMMA 4RQVA 4F9YA 5FD2A 5LXMA 3NVKI 4MBJA 3E62A 1EH4A 1WBTA 3PY3A 2X4FA 4PP7A 4UWYA 4DGNA 2UVZA 4IDVA 4W4XA 2OXYA 4GT4A 1BLXA 5AP3A 4MQ2A 4DTBA 3OWLA 2F2UA 4RVLA 4B9DA 4E8AA 5KMIA 4DHZA 4EBVA 5CAQA 2B54A 2XARA 1XWSA 1JOWB 4KINA 3PTGA 4OGRA 4QRCA 5BNJA 5G6VA 2X7OA 3QQUA 2OJIA 4I4FA 4G9CA 4ONAA 5HD7A 4AOIA 3P9JA 4O7ZA 3Q4UA 4FKTA 2CLQA 1ZRZA 3LZBA 3VUKA 5KBQA 2GNJA 3HZTA 5JFXA 4O7WA 3ZC6A 3U4UA 1F3MC 3FI4A 3U9CA 3C7QA 4FICA 4FKSA 1BL6A 2ZM3A 4AACA 5EKOA 4MXXA 3ZYAA 3W0OA 4OTQA 4X21A 1YWVA 3EN5A 2R3NA 3W0NA 3NW7A 2JKOA