1KV1A

P38 map kinase in complex with inhibitor 1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
348
structure length
331
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords p38 MAP kinase
publication title Inhibition of p38 MAP kinase by utilizing a novel allosteric binding site.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 331
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2002-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1kv1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1kv1A01
2Y4PA 4AT4A 4EK8A 3Q5ZA 3PPKA 3R8MA 3GQLA 3RKBA 2OIDA 5L2SA 2Z60A 2QOLA 5E8XA 4HW7A 5CEOA 3REPA 2OIQA 3K5UA 4KWPA 2YWVA 2H6DA 4QP8A 2IVVA 2W1GA 4USDA 5CALA 2PE2A 4IADA 3Q9ZA 5CZIA 3TT0A 2QOQA 2VWXA 3P7BA 4ZJIA 3DXNA 5AFVA 5HU3A 1YWNA 3ZRMA 4BDDA 3L9NA 5JZJA 4HZSA 1XHAA 4BDJA 2XNBA 2BILB 2C3KA 3AC3A 2G1TA 3UNJA 4E5BA 4E6QA 3BQRA 5EDPA 4S2ZA 2WU6A 3IO7A 4AW5A 4CKJA 5FEDA 3V5QA 2DYLA 4F08A 3FZ1A 3VC4A 1WBWA 3EWHA 5C26A 2XK4A 4IDTA 1H28A 4FNXA 2X0GA 4FF8A 3I6UA 2A4LA 4PRJA 4BTFA 1YDTE 3E92A 4XG4A 2YEXA 4DT8A 4DLJA 4EH7A 5CU6A 5E8VA 2BKZA 4GUBA 4RVLA 1DAWA 4PUZA 2IW9A 1H1QA 2WMAA 4KS8A 4M8TA 3UJGA 2JDOA 3MJ1A 4QMPA 5I0BA 3ZO2A 3HAVA 2UZDA 5AM6A 3VUKA 3L9PA 2C47A 4JL9A 1G8SA 5HO7A 3OCGA 5HKMA 3UMWA 4CVAA 4FE2A 4FTMA 4LRJA 1FPUA 4YP8A 4R1VA 1KE7A 1OL7A 3F5GA 5HTIA 2XKFA 1B38A 3NX8A 3DDQA 3MB6A 4IXPA 4BCKA 4DFLA 4XRJA 4I6QA 1AGWA 5IU2A 3CJFA 1OVEA 5AR2A 3V51A 5CAVA 1GZ8A 2I0EA 5FXSA 5HE2A 4UWBA 3OUKA 4NCTC 3K2LA 5DG5A 3DLSA 5DR9A 5CLPA 4EBVA 4C36A 4ZSJA 4O0VA 3AC4A 5ANOA 3KKVA 4JDKA 3UYTA 2WMBA 4GKHA 4RLLA 5EYMA 1Y91A 3HZTA 3QC9A 3V5JA 4CZTA 4YZ9A 5M06A 4O6EA 4QQ5A 3F5PA 1CTPE 3G9NA 2B0QA 4NKSA 3OTUA 3IDCA 3MFUA 2YCFA 4L00A 3H10A 3R83A 2UW5A 3QAME 1WBVA 4GCJA 4LUDA 2OF4A 4J71A 2QHMA 3LFSA 4EKLA 4F1OA 2J0JA 3K3JA 1PJKA 4PNIA 4DGOA 3KXNA 3WZJA 1FBNA 3HKOA 3CC6A 5G1XA 4EOJA 2IN6A 3ET7A 4EQCA 4DEEA 5IA0A 3PTGA 4AX8A 3DBDA 3HECA 4M69B 2WGJA 3U4WA 5AR4A 3IW6A 4IAAA 3BLRA 1VR2A 4YO6A 3G90X 3SLSA 4DBXA 3RHKA 1YW2A 4WIHA 5CAUA 2WTCA 3MWUA 3CIKA 1JOWB 2R3KA 4GFGA 4DH3A 3GCPA 2E9OA 3PPZA 3CEKA 2Z7LA 4PQNA 3CSVA 1PKGA 1XO2B 4Y46A 3HMOA 4ZY4A 4JOAA 4MXCA 5JQ5A 1SYKA 2ZAZA 2YZAA 5AAFA 4AT3A 5GIOE 3MFRA 4RIWA 4D9TA 1UU3A 4DGNA 4M84A 4R3RA 3TIYA 5FDXA 3QTQA 3FMNA 3QRUA 3TN8A 3ELJA 4O7SA 2OK1A 2UW8A 5DRBA 4BBFA 4MBJA 1FMOE 3QCYA 5FP5A 4RC3A 4FV7A 5GJFA 3U9CA 4WG3A 3COIA 5CSHA 4XS2A 1WBPA 2BR1A 4AGCA 3NEWA 3VN9A 4ZTHA 4JQEA 1XBAA 2VV9A 2XM9A 1YOMA 1I44A 3PY1A 3GI3A 3LXKA 4G6OA 4RVKA 4I4EA 1BL6A 3TKUA 1R39A 3AD4A 5FTQA 4NT4A 3FLNC 4GU9A 3I7BA 3VS3A 4O0UA 3OXZA 4CFUA 4QMZA 5I9XA 2ETKA 2I0VA 4PMMA 1BLXA 4KABA 4CRLA 4IAIA 5L8JA 5IQEA 4IWOA 1Y57A 4FIIA 4FZ6A 4WO5A 3TUDA 2V0DA 1KE6A 4UYNA 2X7OA 3I79A 3R7EA 3D7ZA 1BYGA 4HCUA 4ZS4A 3HP2A 3O23A 5EDQA 4G3GA 5E91A 5HO8A 3SRVB 2W1FA 3OBGA 4JBPA 1PF8A 3LVPA 5CTPA 1OPLA 3LMHA 3OHTA 3BLQA 5AM7A 2Y8OA 4FSMA 4BDIA 3Q9YA 3O8UA 4OW8A 5H3QA 3AXWA 4BYJA 4O0WA 4QP6A 3EB0A 1S9IA 3UNKA 4R3PA 4FGRA 3MH2A 5ETCA 4YO4A 4ARKA 1YRPA 2H9VA 2YISA 4DC2A 5HIBA 4FV3A 1YOLA 3UIUA 4ALUA 4C34A 2GTMA 3Q4CA 1GNGA 2CJMA 3NSZA 2UZWE 3V8SA 3COKA 4U79A 4FA2A 2BVAA 4FKWA 3NR9A 3ORLA 4GVAA 5CF8A 5B2LA 2BDJA 1KSWA 3E7VA 4RQKA 2WNTA 4RJ6A 4RJ4A 4C4JA 3GENA 2W9ZB 2X2MA 5IA5A 5HZNA 2FUMA 4JQ7A 3JPVA 3KFAA 3QUPA 4I5HA 4MQ1A 3TEIA 1YWVA 4Z55A 5L8KA 4CD0A 1KE5A 3W2PA 1REJA 2JEDA 2OU7A 4F1TA 4FEWA 4K6ZA 2CLQA 4FV0A 2OJ9A 4LL0A 2WOUA 4X3FA 2JFMA 5GZ9A 5CEMA 4AZEA 5AJQA 3SV0A 4G5PA 3U4UA 4EEVA 2XB7A 3Q5IA 4U42A 4BGGA 3PZHA 1XBCA 3GUBA 4RG0A 5JRSA 3O50A 3BE9A 3B8RA 2JKKA 3BPRA 4GIHA 4D4YA 2Y6MA 4QMUA 2C6IA 1PXPA 4R7IA 4CFXA 2IW8A 3V01A 2PMIA 1UVRA 4GT5A 4JLCA 3DGKA 3FDNA 2YACA 4FTAA 3EFJA 4ONAA 2FSTX 5HG7A 2XK3A 3FZRA 4ZJVA 1S9JA 4M0YA 4OAUC 3HNGA 2XYNA 1BUHA 3MI9A 3FKLA 3TZ9A 4RT7A 3QQKA 5KX8A 2WAJA 4D5HA 2PMLX 4LQMA 5CU2A 5F20A 3CTHA 5IMXA 2J9MA 3AOXA 3QD3A 2W06A 2R3OA 4QTEA 4IAYA 5A4CA 2O2UA 4CYIA 2BZIB 4YZMA 1YDRE 3QTWA 4AA0A 3OXIA 4J96A 1FINA 4BZDA 4ITIA 3B8QA 4BKZA 4RWJA 5BUJA 2VRXA 3QQUA 1OMWA 3I5NA 4NL0A 3H30A 3ZU7A 4FEXA 2XIZA 3Q53A 3LHJA 4FKRA 4GFOA 2VO3A 4DFUA 5HCXA 3D5VA 4CNHA 4EK6A 3D4QA 4IM3A 2Z02A 3FXWA 4QMYA 3OXTA 2I0HA 3ANQA 4NYEA 5FTOA 3F2NA 2IZSA 3OY1A 2LAVA 5JGAA 5T3QA 2VWUA 3GQIA 4PY1A 3UTOA 4WG5A 2I6LA 4IMYA 3RZFA 3Q4UA 5BVEA 3SX9A 3ZXTA 1LP4A 4YU2A 3GT8A 4C35A 1H4LA 3LLTA 3EL7A 5ANJA 3TZ8A 2I0YA 3PVWA 4ZZMA 5FQDC 4GK4A 4RJ3A 2Y6OA 1GIIA 1R0PA 3PG3A 3GNIB 1XH5A 3R9RA 3LFFA 3R7YA 3MPTA 1FQ1B 3SXSA 3VJNA 1WCCA 4FIHA 5I9YA 4OR5A 5IF1A 2ERKA 3R2BA 3Q2MA 3W1FA 5ITAA 1UA2A 3HV7A 4DF3A 4QTDA 3E8DA 3F3WA 2BUJA 3EN7A 2UW4A 4O0SA 4XUFA 3VUMA 2WPAA 2VWZA 2X7GA 4WUAA 3C4EA 3DZQA 4ZLOA 4F0GA 4FZAB 5KHXA 5LXMA 4ZIMA 3UIBA 4O0YA 1MP8A 2WMVA 3KVXA 2QVSE 3NAYA 3OW3A 4OTDA 2XJ2A 4RIYA 5FP6A 3CTQA 4M13A 3R7VA 4GYGA 4EWHA 3QTIA 4LFIA 4MNFA 4DE4A 1F3MC 2WMUA 5BVKA 3F2AA 4M97A 4RVTA 1DM2A 1KWPA 4QPMA 5DE2A 3ZEWA 3F5UA 2WQMA 4QNAA 3QTZA 2HAKA 2KULA 2X8EA 3VNTA 3UQFA 4FTQA 3PXYA 4TNBA 4P5ZA 4YTHA 5C27A 5JK3A 2P0CA 3SD0A 5AWMA 1J91A 4AE6A 3VS0A 2QOHA 2IVSA 3A7GA 3F5XA 3D2IA 3UIXA 4CQEA 2ETRA 1XH7A 2VTNA 3CXWA 1VZOA 3LFQA 3PLSA 3MN3A 4RIWB 5CSVA 3LQ3A 4NIFB 3HAMA 4LI5A 2JAMA 2E9VA 2B55A 4AW2A 5IQCA 5ETIA 3BRBA 4PNKA 3ATSA 4OBQA 3T3VA 5IQHA 3F9NA 3HRBA 2W1IA 2CCHA 5BPYA 4BCGA 5M51A 4YC6A 3AG9A 4FV2A 3UP2A 3O2MA 4P90A 3VS4A 5L3AA 3QZFA 2B53A 2ITYA 2YAKA 3NUYA 1ZLTA 3OY3A 3ZFYA 5K5XA 2VX0A 3Q52A 4BDHA 1OECA 2F7EE 3CBLA 3H0YA 3LFEA 4NWMA 1FVVA 5IMEA 3R28A 2PULA 5HGIA 3MB7A 2OXYA 3SG9A 2W17A 4BF2A 3P5KA 4CLIA 3SW7A 3DBFA 4LV5A 4RBLA 2ZV7A 4O7ZA 1Y6BA 3QFVA 5H9BA 5CF6A 4AS0A 4YNEA 3RAIA 3PLAE 4J53A 1FMKA 2XUUA 2J0MB 2JDSA 4WBBB 4TL0A 3MH3A 4KIOA 3EIDA 3NUUA 3SA0A 3B2TA 4GJ2A 1CKPA 4H3PA 5DHJA 3NUAA 4YR8A 4H1JA 2JDTA 5AR7A 3NDMA 2PUIA 1J7IA 1Q24A 2VTAA 3OCTA 3ZLYA 4FEUA 4KAOA 4FKQA 4DCAA 5CAOA 4OTPA 4PX6A 4RX7A 3QF9A 2UZUE 2BRGA 3A7FA 3QGYA 4EH2A 4BCOA 2BDFA 3FLWA 3MPAA 3LXNA 4NM3A 2ITNA 2FYSA 2YM7A 3GCSA 4ALWA 4DH8A 2H8HA 4G6NA 3QKMA 1G5SA 3E3PA 2IWIA 4YTIA 5AV0A 4BCPA 1OITA 4YHJA 4Z7GA 4I94A 3P4KA 3HLLA 3QQHA 4XEYA 3ZMMA 2W1EA 4FIGA 2XH5A 3QU0A 2X9EA 4X3FB 4MHAA 2DQ7X 1WBNA 3AD6A 3UOJA 2HWOA 4JDIA 3FE3A 4O0XA 4MH7A 3KRWA 3SGCA 4NH1A 5F4NA 1ZOHA 2Z7SA 3UP7A 3D7TB 5HORA 4R8QA 3EQPA 3VW6A 5M07A 4NFNA 3JXWA 4JBVA 4FSZA 4O2PA 3WI6A 3OZ6A 3E3BX 4JIAA 4D2RA 1HCKA 3L8XA 3HV3A 3NUNA 4EK5A 5ANGA 4PL4A 4QMWA 5K3YA 3FKNA 4X2KA 4C2VA 3W2QA 5CEIA 3WILA 2C0TA 4XG2A 1GY3A 4OTIA 2WFYA 1SNXA 4PDPA 4WNPA 3PXZA 1BI7A 4LG4A 4F9CA 2B9JA 1NVSA 2R3JA 1YKRA 4NTSA 4RZWA 5LVPA 5EQYA 4I23A 2WTIA 4E6CA 4L7FA 4AFJA 5I4NA 4L68A 4MBLA 2QOOA 3DFAA 1UU7A 4IAFA 3QWKA 2YJRA 3UIMA 2XKEA 5A4LA 3DZOA 2WXVA 4AGDA 4KNBA 4TYHB 3CE3A 1CDKA 4X6QC 5D7AA 5BYZA 4ANQA 5JSMA 2R3RA 4DT9A 1WVXA 3KRXA 3JVRA 1V0OA 3R04A 4AU8A 2WQBA 3H4JA 3MH1A 2BIKB 2PVKA 3LM0A 3RGFA 4GU6A 4HPUE 4B7TA 4BCJA 4II5A 2J2IB 3EFWA 1FOTA 1K3AA 3S95A 4G5JA 3NS9A 2P4IA 1ZY5A 2F9GA 3BBTB 2WIHA 1CMKE 3E62A 3LXLA 4XP3A 4U45A 4B0GA 3EN4A 2C6TA 4QQCA 2V55A 4MXOA 4O2ZA 4HYHA 2QOCA 5JH6A 4DG2E 1F5QA 2OFVA 4QMOA 2AUHA 3POZA 4FUXA 5AP5A 4AGWA 3G6GA 3C1XA 3VUHA 3W33A 2P3GX 2FA2A 4ZTQA 2ZOQA 3VBWA 2YLEA 3P1AA 4OTFA 3ULZA 3F66A 4YC8A 2REIA 5AR5A 4O84A 2YJSA 5EOBA 1M7QA 2AC3A 4MXAA 3RAHA 3QA0A 4FVQA 2IVUA 3A61A 5HNIX 2Y0AA 2HY0A 4BDCA 4HGSA 4C59A 3R7GA 4FOBA 4PP7A 4C61A 4FL1A 1YXUA 3DDPA 4BC6A 3UE4A 2VTHA 2UZOA 3CJGA 2O3PA 1A06A 2V5QA 2QOKA 3A62A 5HEZA 4C2WA 4XYFA 1XBBA 3QYWA 3NW6A 5IDNA 1QPCA 1VYWA 3NMUF 5J9LA 3EZVA 4D2WA 5LMKA 2V22A 3PFQA 3HP5A 3LCSA 5IISA 4AZSA 2ITXA 3C0GA 4PTEA 1SMHA 3SXRA 4FX3A 4ACGA 5FXQA 4J97A 3WF8A 3FI4A 4DH5A 4XP0A 3C0HA 5HIDA 2QODA 4V05A 3BWJA 2VWVA 2XJ0A 3DB8A 1MQBA 4HGTA 4M69A 4TYIA 3BGQA 2BRMA 5D7VA 3TKIA 5CENA 1OBDA 4EHZA 5LOHA 4NJ3A 4BTJA 3WARA 1ZYCA 4C0TA 4ZMEA 5IDPA 4EJNA 2YM5A 3D94A 4GFMA 4EZ3A 4NZWB 4YJVA 2VTJA 2BFXA 5FEEA 1BKXA 4EWQA 4O22A 2YA9A 5EQPA 4HCTA 2ZV9A 4LRKA 3EMGA 3LQ8A 1R78A 4HZRA 3FHRA 2BRHA 4DFBA 4GH2A 4YHTA 5J9ZA 2YDKA 3RTPA 1JKTA 4ASZA 5IQIA 4CQGA 4BTKA 4UMUA 4UXQA 2GNJA 3I0OA 3ORPA 4AACA 3QD2B 5BMSA 4WOVA 1WBTA 4BVUA 2HCKA 1Q8ZA 1J3HA 4ZZOA 3DY7A 5EG3A 3IDPA 2FSLX 1EH4A 3TL8A 1ZRZA 3N4UA 4QPSA 4D1ZA 3LMGA 5E9EA 1UWJA 4FSNA 4AGUA 5KKRB 2HZIA 3VWAA 3TZMA 3FKOA 4XV3A 3FPQA 1Q3WA 2GHGA 4JG8A 3VS6A 1OM1A 3E87A 2Q0BA 5AUVA 4WA9A 3WZKA 4OBPA 1ZY4A 2XNPA 3OCSA 4RJ5A 4DH7A 1JAMA 3OBJA 4FTLA 3TG1A 5AA9A 4FVPA 4HVIA 3TM0A 1ERKA 3UOHA 3Q2JA 3FQEA 1PXMA 1H24A 4YZCA 2QOIA 4ERWA 4FI1A 2VAGA 4D2VA 3RAWA 1A48A 4Q9SA 2B9IA 2X2LA 4FG9A 3R9NA 2QO2A 5LJJA 2HZ4A 3S3IA 5JKGA 1JKKA 4U41A 4B9DA 3SRVA 4A9RA 3UVPA 3ZLXA 5JFVA 3QTSA 4FTKA 2GTNA 3G51A 4D4VA 4F7LA 4A9UA 4F0FA 4L45A 5I9VA 5EHYA 4RX9A 3KB7A 5LQFA 2X8DA 4MF1A 4I6BA 1OPKA 3W8QA 5CU4A 2GCDA 4AA4A 2R3IA 4CFVA 2CLXA 2UVXA 3QQGA 4CKRA 4C4GA 4AW1A 3EYGA 2V7OA 3C4WA 4MF0A 2RG6A 2W96B 5K5NA 3GOKA 3KMWA 2WZJA 4I0SA 3WZUA 1O6LA 3F6XA 1OBGA 4UZHA 3JVSA 5FGKA 2RFDA 2BHEA 4ANSA 4D4SA 4D0WA 4EOIA 3VRYA 3EQFA 3ZSIA 2HY81 4FV8A 4E4NA 3FL4A 5DYJA 5AUXA 4RPVA 3BEAA 1U54B 5K4IA 2ETMA 4L46A 3K54A 3LW0A 4CEGA 3A60A 1OPJA 4X3JA 3VIDA 2GFSA 3R30A 4BKYA 2XMYA 3MBLA 3BYOA 4USFA 3TI1A 2B52A 3R02A 4FSRA 2XP2A 3B2WA 4I6HA 4LOQA 5GHVA 3RK7A 3T9TA 3UZTA 1JPAA 2PU8A 3SXFA 5FD2A 4BCFA 4G9RA 4BCQA 3PP0A 2A0CX 3F82A 2F7ZE 5A9UA 5I9WA 1Q8TA 4FV9A 3KREA 3MA3A 3E8EA 3VBTA 3VS2A 1XJDA 3FC1X 5AP0A 4S32A 1OL6A 2G2IA 3NVMB 5AX9A 4C4IA 3AT4A 4IM0A 3NAXA 4H39A 5CANA 3KY2A 3TDWA 3BQCA 4Y72A 3NRMA 2IZRA 5E8ZA 5HQ0A 3MIYA 5C01A 3LZBA 2ZM3A 3R9HA 4K77A 5TOZA 2C6EA 5A4EA 2W4OA 2XK6A 3FYJX 2RF9A 1RJBA 3EQCA 4XG8A 2PWLA 4FTOA 4XH6A 4FNYA 4A7CA 2PE1A 4OTGA 2OJFE 3MDYA 3QLFA 3ZSHA 2QKWB 2XM8A 1TKIA 2HELA 4A4XA 5C8NA 3OMVA 2VX1A 5IKWA 2C0OA 1OKZA 5EM5A 5EOLA 5TKDA 4Y73A 3UGCA 5KMMA 3HV6A 4R7BA 3L8PA 5BUIA 2OSCA 4JAJA 5M08A 4UMTA 3O8TA 4APCA 4A9YA 3A7JA 3TV7A 4F6UA 4ACDA 4ACCA 1IA9A 2QR7A 2W7XA 3ORKA 5J7HA 4ZK5A 1CM8A 1H26A 5ANDA 1UWHA 1YVJA 2VD5A 3BHVA 4FIJA 4X21A 5FBNC 3GP0A 4CXAA 5HVYA 1KE8A 5D9HA 3QZGA 2G2HA 3ZBFA 3RAKA 2ERZE 5DN3A 3TZ7A 4XV1A 4GG7A 2NPQA 1IR3A 4DEHA 4TYGA 2JGZA 3GU8A 3OWLA 2R3LA 4IFCA 4QMLA 4G2FA 4RJ7A 5KMNA 4OT6A 5CT7A 2C6OA 3BZ3A 3RNIA 2BPMA 3G33A 4Y83A 1A9UA 5CF4A 5EFQA 3CPCA 4TWOA 4BDFA 1Q61A 2QHNA 3DOGA 4BIEA 5LVNA 4F99A 4DEAA 2E2BA 3R1SA 5HBEA 4XOZA 4Y8DA 4AG8A 1Q62A 4O7VA 4EQUA 5DI1A 2J51A 1IAHA 4Q2AA 4FSYA 2WMWA 3AC2A 2E9PA 4P2KA 2YM8A 5AUYA 2RFNA 2SRCA 4RC4A 1H0WA 1TQIA 2P55A 4FSTA 5CXHA 4QRCA 4AZTA 3K3IA 5EI6A 3V6RA 4HYSA 5EI8A 2OBJA 4L53A 2W1CA 1W7HA 4IVCA 4J99A 2CHLA 2B9HA 1W83A 2ITZA 3GU5A 4DEBA 4DGGA 4F7SA 3UODA 4L52A 2YIRA 3V5TA 4EQMA 2PZ5A 3POOA 4N6ZA 1ZZLA 5KMLA 5K0KA 3FLZA 4KRCA 5IH4A 4IFGA 4C33A 5ANKA 3S1HA 5BVWA 4E5WA 4AWIA 1SVEA 2JIIA 4UYAA 3UQGA 3GGFA 4I4FA 4FTIA 4GL9A 2PUUA 3QUDA 4NIFA 2XK7A 4XHKB 4DFZE 1W8CA 4QO9A 1MUOA 2VTTA 4N6YA 4HVSA 3VUGA 5LMKC 2GQSA 3KGAA 2BHHA 4KRDA 4R6VA 1AQ1A 3QKLA 3U87A 2QLUA 4I93A 2WTVA 4GT4A 3RP9A 3MVHA 5ACBC 2BROA 4E4MA 3AD5A 4E20A 4K2RA 5IUHA 4QD6A 3K5VA 4YPSA 4DITA 4EK3A 4I92A 2LGCA 4RWLA 5EHOA 2WTJA 3S4QA 3FMHA 2WMTA 2VO6A 2UZEA 2ITQA 4CFWA 2OFUA 3G0EA 4FV1A 5KMOA 2B1PA 3PPJA 3DS6A 2C6KA 2UW9A 3IW7A 3A99A 1O9UA 4YJUA 2PHKA 4FYNA 3A7IA 4G16A 1RDQE 4JNWA 1Q8UA 2OI4X 3ZOSA 3RK5A 4FL3A 2QO7A 4BGQA 3BU5A 4Z9LA 4CSVA 4Y5QA 5KHWA 2QU5A 2WMSA 3F7WA 2VWWA 3ORNA 3PJ3A 2OLCA 2OF2A 1LUFA 4CKIA 2R0IA 2NRUA 1MRUA 1PMVA 4AP7A 1WZYA 3ORIA 5L6WL 4A4OA 4XCUA 4K8AA 3DJ6A 4AN9A 5HNBA 3BCEA 3OW4A 4Q5EA 2XVDA 1YOJA 1OGUA 4NM5A 5EM8A 3PSDA 3MW1A 4O1PA 1QCFA 4IBMA 1PRYA 4EOLA 4AXAA 4XBRA 3UG2A 1OKVA 1UKHA 3QQFA 5AIKA 3IW4A 3QLGA 1OZ1A 3P86A 4RA4A 4WUNA 3NUSA 2F49A 3MPMA 4U6RA 2UVYA 3DK6A 3FMDA 4IHPA 4OUCA 1H1SA 3D0EA 3I4BA 4IIRA 2PVRA 4DBNA 3VHKA 3FLYA 4TNDA 5AAGA 4D2PA 2WMXA 5ANEA 3F61A 4RVMA 1Q8YA 2CGVA 2OXDA 2PTKA 4O21A 3TNHA 4R5YA 5IQFA 3CQUA 3PWYA 5HE3A 3CR0A 2Z7RA 3D15A 4O81A 2WTDA 2W1DA 4LL5A 1OUKA 5J7BA 2ONLC 5CVHA 1XH9A 2CNUA 1OL1A 3WF6A 4FZ7A 2GHMA 2W5AA 2WQOA 3AC1A 4DGMA 4C3FA 4IW0A 4EL9A 5BVNA 5LCJA 4W4YA 4TXCA 4RSSA 3QTUA 1CKIA 4HGEA 3ZZEA 4F4PA 2YDIA 4NJDA 2Z8CA 3BELA 3SG8A 2HXQA 2JC6A 3D7TA 3IGOA 4BCNA 2R3NA 3P79A 4ZJJA 3RI1A 2YCQA 3H3CA 2E9NA 2PY3A 2B9FA 4YGAA 4ID7A 2DS1A 2ZV8A 3E93A 2OJGA 3NGAA 4AA5A 4MNEA 1V0PA 5HD4A 3VJOA 3THBA 3CLYA 4FV5A 4TYEA 3M1SA 4L3PA 3PA3A 3OT3A 2CKPA 5HTCA 1UNGA 3Q6UA 3FZTA 3MIAA 1H0VA 2BIYA 3GCVA 4ASXA 3PVBA 5CZHA 5L2QA 3RWPA 3NNWA 1TQPA 4OTQA 5HHWA 4UN0C 4XNEA 3GEQA 5BVOA 3E64A 3V5WA 4BKJA 1U5RA 2F2UA 2UW6A 3E63A 4HJOA 5FWKK 3QXPA 1BI8A 5EK7A 1B6CB 2XBJA 3R01A 3R9DA 4OGRA 3N4VA 4D28A 4TYHA 1URWA 4EOPA 5CYIA 4JBOA 2IZUA 2BMCA 4DGLC 3KRJA 3GC9A 4MXZA 4OTRA 1KOBA 2VWBA 3BX5A 4YJRA 2VX3A 5AUWA 5B2KA 4BHZA 4S30A 4KIQA 4DCEA 4F7JA 5DGZA 2YIXA 3CQWA 4CMUA 3EL8A 3NPCA 2XEYA 3ULIA 3PWDA 3EQRA 3JUHA 3LFCA 4ENYA 4EYJA 3AGMA 3HGKA 2W4JA 5L2TA 1HOWA 5E1EA 3DBCA 1STCE 3Q96A 3I81A 4IACA 4M3QA 4QP1A 3MH0A 3SHEA 1Q3DA 3QUEA 5KCVA 1WBOA 4BBEA 4IX3A 2C5OA 3HEGA 4FEQA 4R7HA 2GQRA 3L9LA 3UO6A 3OEZA 4YUQA 3FPMA 3R9OA 3TUCA 1Q97A 4FTNA 4J1RA 4E26A 3DXPA 4JVGA 4AZWA 3UMXA 3UNZA 3ZZWA 3OTVA 4U97A 4AUAA 4LYNA 3O17A 4XLIA 2X1NA 4QT1A 2XIKA 2QG7A 2OW3A 4WBOA 1ZYDA 2RKUA 4D5KA 2VU3A 1ZYSA 4L01A 4WHZA 3RMFA 3UZPA 3MVJA 4D58A 2R0UA 5FUTA 3E7OA 2J4ZA 3V8TA 3ZM9A 2UW3A 1UNLA 1YXTA 5HCZA 3D14A 1JWHA 2B4SB 4YJOA 3NW7A 4O27B 4IWPA 5AV3A 4C02A 5ANIA 2GPHA 1SVGA 3QTRA 1QPDA 2WMQA 3BGZA 3M11A 4J52A 5H8BA 5HBHA 3W10A 5GZ8A 4I5MA 4N57A 2VTPA 3Q4ZA 2BDWA 3QC4A 4DA5A 2P2IA 2C3IB 3OWKA 2EXCX 1WVYA 3OWJA 2HYYA 2BTSA 5LCKA 4FT0A 2XYUA 4BGHA 5KBRA 2NNWB 3V6SA 4QNYA 3L8VA 5DR6A 4NUSA 1XH6A 4O7WA 4QMMA 3M42A 1H8FA 3A7HA 4EOQA 5H2UA 3JY9A 4Y95A 5GZAA 3QCXA 1QMZA 4FNZA 2EXMA 2XA4A 5CU3A 5DH3A 4O0RA 4H3BA 3S2PA 5BVFA 2I7QA 3LLAA 3WF9A 1NA7A 3BV3A 4AZVA 4TPTA 2R7IA 5IPJA 4BI0A 3DKFA 3L9MA 4S31A 4FTRA 5AP1A 5HG8A 4L67A 5HE1A 1XH8A 3R7IA 4EI4A 4KD1A 4OLIA 4WSQA 3HMNA 5JFWA 5IUGA 2G01A 3A2CA 4BDKA 5M44A 4O7YA 3EH9A 3MY0A 2I40A 5CNNA 2QC6A 4DAWA 5C1QB 2UW7A 4JR7A 4DEDA 3ZFMA 4DTBA 2WIPA 4CTBA 4EKKA 2VTIA 4BCMA 2GNHA 4D55A 5HVKA 1XH4A 4ZSEA 4I0TA 4RGJA 3HDNA 1M2QA 5HD7A 4ZSLA 5A3XA 2GS7A 5KZ0A 3UC4A 2UW0A 1IEPA 3PYYA 4OTHA 4EHVA 5C8KA 4EZ7A 5E92A 1GOLA 3VS1A 2C4GA 3W2CA 4NU1A 1E1VA 4GT3A 4A9TA 2OWBA 2ZB1A 5GINE 4WNKA 5BNJA 1Z9XA 3BLHA 3PY0A 4RWIA 2C69A 2F2CB 2C0IA 2WKMA 3MYGA 3OC1A 3TCPA 3SOAA 3N4TA 5IUIA 3QX4A 5E8SA 4U0IA 1NXKA 1PMEA 3QX2A 4DYMA 2BALA 3HA6A 3NYXA 4D2TA 3ZO1A 2IJMA 3RK9A 2UZBA 2W0JA 4BHNA 4W4WA 4N0SA 3D5XA 5L6PA 2IVTA 3FZOA 4W8DA 3MY5A 4F9WA 4B4LA 3HUBA 2VGPA 3SOCA 4YBJA 5F1ZA 3EYHA 5IQAA 3R21A 3CTJA 4AT5A 4TW9A 2PVYA 4FIEA 4CZUA 4ZLYA 4YTCA 3OG7A 3U8WA 3ZLWA 2OH4A 2WQNA 4G31A 4FK6A 3KRLA 2PMOX 3R22A 3O51A 4ITJA 4WNMA 2RGPA 2ACXA 4I22A 3Q9WA 1PHKA 4IX4A 4D9UA 4EH8A 5GJDA 1SNUA 4DG0E 3DPKA 4MYGA 2XIRA 3EQBA 5HLWA 3OWPA 2CNQA 1L3RE 2R3QA 2EB2A 3C9WA 1M17A 4YJPA 3ZUVA 5BUEA 3PIZA 3GCQA 2XK8A 4CTCA 5L2WA 4IEBA 1SM2A 2ITUA 4TZRA 5AMNA 4IB5A 1PMNA 5CEKA 2JKQA 3L1SA 5KNJA 3FL5A 2B54A 1ZARA 3LPBA 3NWWA 5AR8A 5F95A 2BZKB 4APPA 4CG9A 2JDVA 3VUTA 3II5A 3BV2A 4RIXB 1OB3A 5B0XA 4BTMA 4MNEB 3MV5A 2XNNA 4EZ5A 4HNIA 3W55A 4EYMA 3C51A 3LQ5A 1U54A 1IAJA 3UOLA 4C3PA 2ZM4A 3ZO3A 1ATPE 2PSQA 1B39A 3AGLA 4FKPA 3NNVA 2X4ZA 4QOXA 3G6HA 3KXXA 3TTJA 3VW8A 5H8GA 4KIKB 5EKOA 3V5LA 3D2KA 4HYUA 4TN6A 2ITOA 5HE0A 5AUTA 3VBYA 5HX6A 4A4LA 5CI6A 4KBCA 3ZLSA 4YSMA 4U8ZA 2GNFA 3AMAA 2GU8A 3H9FA 2QKRA 3IDBA 4RIOA 4YMJA 3SKCA 4O82A 3DK3A 2C5NA 4V0GB 4QP2A 2R3MA 4BZNA 1YXXA 1ZMUA 2WOTA 3I1AA 3IGGA 3FUPA 5A46A 4X3FC 3C5IA 4G3DA 4I5PA 1GIHA 2HZ0A 3F3TA 4K18A 5I5ZA 4UWYA 3FMMA 4MXYA 3FQHA 4F64A 1OKWA 3IKAA 5FLFA 3VHEA 4U5JA 4ENXA 4MD8E 1OIYA 4GV1A 3LJ0A 4QQTA 4QMQA 5HIEA 3LMIA 3HUCA 2WEVA 4IC8A 2R7BA 1P14A 5CI7A 5CSPA 1XR1A 2R3GA 5LARA 4U80A 5KO1A 3C4XA 2HOGA 3PG1A 3IPHA 4BRXA 3JYAA 4FKJA 2WO6A 3IS5A 3KXHA 2C68A 3F7ZA 1KE9A 3GC0A 1X8BA 4GRBA 5J5SA 2OO8X 3PIXA 3Q04A 3SW4A 3OCBA 4FKOA 3RZBA 2X8IA 1DI9A 3A4PA 3ACKA 3E5AA 4KKHA 5A6OA 4FKIA 2C5VA 4GKIA 3R8ZA 3FHIA 3Q60A 3WYYA 5HCYA 4BZOA 4CFFA 4HNFA 4KA3A 2ITTA 3W18A 4NM0A 3PVUA 5G6VA 4EORA 3FWQA 4UMPA 3LXPA 3MJ2A 1PXOA 1T46A 4PDOA 4U3ZA 5KMJA 2C1BA 4PTGA 4QTBA 5JFSA 4PMPA 3TUBA 1NVQA 4B8MA 3LFNA 4I3ZA 2A1AB 4M67A 4DG3E 3R1NA 3C4FA 3HYHA 5L2IA 4JAIA 4O6LA 5E8TA 3RPVA 5IA3A 5L8LA 3EN9A 4XG9A 3U54A 2Y4IB 5EW9A 4G1WA 3G15A 4G9CA 4KINA 3QXOA 3MTFA 3AT2A 3RJCA 3KXGA 4ANMA 3ENHA 3MGYA 4ZTLA 4JIKA 1M52A 2XNGA 3DCVA 3PXFA 5L4QA 4AE9A 4E3CA 4QP4A 2RSVA 3BWFA 1WFCA 5CASA 5AUUA 4ZOGA 3BEGA 4FKTA 4JRVA 5TR6A 5HI2A 3OOMA 3JY0A 3PJ8A 4FNWA 2X39A 4FK3A 4O7LA 4B8LA 1ZOGA 2R2PA 4FKUA 5E90A 4YZBA 4QPAA 4PDSA 1YXSA 1WMKA 3N9XA 3WE4A 4I20A 4XP2A 4PL3A 1U46A 2BAJA 3HMIA 4GMYA 4C4EA 4ZSAA 3PXRA 3RPSA 4BDAA 3ZUTA 1QPEA 4FT3A 3VUDA 5JEBA 4W9WA 2XNMA 2PE0A 3AMYA 4J8NA 4L9IA 3PSBA 1M14A 3MVLA 4IH8A 1GZNA 1OKYA 2WD1A 4EOOA 2R64A 1H27A 2DWBA 3MFSA 2QLQA 4DHFA 1ZYLA 4YTFA 3R7UA 2CKQA 2Z2WA 2QOFA 4IX5A 3CPBA 4E6AA 3NYVA 3PIYA 5C8MA 4I41A 5IEYA 4O83A 5LVOA 1W84A 3PDTA 2HW7A 1KUTA 5HLNA 2WTKB 2JBOA 2PVJA 2X2KA 2XIXA 5CF5A 1BL7A 4L7SA 5BX0A 3VBQA 1UNHA 5ETAA 3FBVA 4F9BA 5KZIA 4YC3A 4NSTA 3VULA 4KUJA 4YNOA 4RZVA 4W8EA 4IAZA 4RX8A 2W1HA 5TE0A 5LVMA 3GVUA 3ROCA 2FGIA 3T9IA 4EOSA 2QU6A 3DNEA 5CY3A 5J9YA 4J98A 3QKKA 5E7RA 2VWIA 5FBOA 1YHSA 4EHEA 4ZTRA 3F3ZA 5GIPE 1JSVA 4L42A 4M0ZA 4FMQA 4FSUA 2G9XA 2Y9QA 4H58A 4QMVA 5M57A 5CVFA 4M12A 2XKDA 3U51A 4BR3A 4E1ZA 5IH6A 3V5PA 3NUXA 4P4CA 2VUWA 3KL8A 4XG6A 4EUUA 2P33A 4C3RA 3P08A 4BN1A 5F9EA 5HBJA 4ZTMA 1OUYA 1OI9A 2Z7QA 3C13A 4G6LA 3F88A 5FRIA 5HNGA 1PXJA 4X2FA 4V04A 4O0TA 5AAEA 4OAVB 4X0MA 2GFCA 3QL8A 4FZFB 4WRGA 2VTRA 3R1YA 3LM5A 2XIYA 5FM2A 1XWSA 1T45A 1ZAOA 3O71A 3U6HA 1YI4A 2J90A 4OTWA 3D5WA 3ITZA 4GYIA 3VF8A 5KKRC 2JITA 2AYPA 3PJ1A 2O65A 4IB3A 5TO8A 3FY2A 2YZLA 3RALA 5AV4A 5C4KA 2OJJA 4IB0A 2CMWA 4AN3A 3UZRA 4LV8A 3IOKA 2C3LA 4U40A 4F63A 2R3FA 3OD6X 3EKNA 1UKIA 4X2JA 5L6OA 3I5ZA 4O91A 4MXXA 5M55A 3EFLA 3U6IA 2YITA 3PA4A 1VEBA 3ORZA 2YLFA 3DAKA 3EFKA 4E93A 3FI2A 1H07A 2EB3A 3QZHA 4FZDB 4N70A 2RIOA 2BFYA 3BBWA 4MBIA 3UDBA 3VVHA 3LOKA 4M7IA 3RNYA 4EK4A 5IA4A 4I5CA 2F4JA 1MQ4A 3W2OA 3KCKA 2CCIA 1IA8A 3PY3A 5JGBA 4OBOA 3ZSGA 2XBAA 1FVRA 1HCLA 4XJ0A 1XKKA 2GNLA 2YCRA 4UBAA 1YHWA 4JG7A 2C6LA 4C62A 1RW8A 1U4DA 2NO3A 4IM2A 5E8YA 3QHWA 4W4VA 3UPXA 4ZEGA 5CAQA 2PYWA 1E9HA 1O6YA 3BGPA 4NTTA 1CSNA 2JKMA 2W1ZA 5EDRA 4IVBA 5C03A 1H01A 1JVPP 2ITWA 4EH9A 4IWDA 1VJYA 2WU7A 2YCSA 4NKAA 4G3CA 5D10A 2CGUA 4CFNA 4LOPA 3T8OA 5AADA 2QO9A 4QMNA 2PZYA 4B6LA 3IECA 3QD4A 4C8BA 3CGOA 4IZYA 1K9AA 4FTTA 4HPTE 5JZNA 1Y6AA 4IJ9A 3IW8A 3BYUA 4TWCA 1NW1A 3BHHA 3Q32A 3SQQA 4QMTA 4DH1A 4EH6A 2W99B 3SAYA 1TVOA 1SZMA 4BIDA 2YM3A 2PVHA 4UZDA 2OIBA 4O86A 1NT2A 5D1JA 4PV0A 2ZMDA 3PVGA 4RJ8A 4E73A 2CPKE 4LMUA 4UX9A 4ASEA 5CX9A 4XV9A 2Q83A 2OICA 4M14A 2EVAA 4CGAA 1QPJA 4ALVA 3VBVA 2WELA 4HVHA 4XLVA 4ZP5A 1J7LA 4UWCA 2FH9A 4PDYA 5JQ8A 2PL0A 3V04A 1PXIA 3COHA 4EUTA 3QZIA 1JKSA 2GS6A 3ALNA 2YWPA 4KB8A 4NW6A 2XNOA 4QTAA 5DMZA 2W05A 3FEGA 2JAVA 3QRJA 5M4IA 4UY9A 4AOJA 5DIAA 4NM7A 3DJ7A 2AC5A 3O7LB 2BAQA 3G5DA 2CN8A 2EWAA 3Q6WA 4AZFA 4O7RA 4MCVA 1LEWA 4FOCA 4PWNA 1MRVA 3QA8A 4QYEA 3EJ1A 2C30A 3A8WA 1GZOA 5J5TA 4EBWA 4K0YA 3LFAA 2J5EA 3P9JA 4YLLA 4DLIA 2F7XE 2OH0E 4BWPA 3WF7A 3DT1A 4GS6A 4LMNA 5I9ZA 3BU6A 3IONA 1Y8YA 5CS6A 5GNKA 4GUEA 3NNXA 4RLKA 3NUPA 4AN2A 2C6MA 1QL6A 4J95A 4KSPA 4JDHA 3OF0A 4GK3A 3F3UA 1ZZ2A 1W82A 4BFMA 2XCHA 3HL7A 4X6RA 2QNJA 4D0XA 3RWQA 3BU3A 3VUIA 4PP9A 2JD5A 2J0LA 3EOCA 4R5SA 5BQ0A 2EU9A 1R0EA 3HA8A 4MWHA 3O0GA 2C1AA 4RQVA 3ZDUA 1M7NA 1GAGA 2C5XA 4AFEA 3ENMA 2GNGA 4H1MA 2HXLA 2BZHB 3UOKA 4UB7A 3GFEA 4IWQA 4PPCA 3KCFA 2VO7A 3WIKA 5DLSA 2FVDA 3BYMA 3C4ZA 4M68A 4NEUA 4FVRA 4R1YA 4Y85A 4FBXA 3WBLA 4IZ5A 5I3RA 4BI2A 3D9VA 3FMEA 4FTUA 3QWJA 3LFBA 1K2PA 4IJPA 3DTCA 5AP2A 4IVDA 3DJ5A 1P4OA 3GBZA 4PMTA 2PZIA 5B7VA 5FXRA 3UG1A 1Y8GA 5HG5A 5FG8A 3G0FA 5HOAA 3I6WA 3KXMA 4RMZA 2BCJA 5IEVA 4C38A 3NCGA 2GMXA 3LCTA 4IAKA 1IG1A 4C57A 5IQBA 3ETAA 3DBQA 3C5UA 3SDJA 1H1WA 4U9AA 4D4RA 2FSOX 3OFMA 4JI9A 4UMRA 1BMKA 3CD8A 4EJ7A 4BBMA 4K1BA 2PVMA 1PMUA 3TV6A 3UVRA 5K4JA 3H9RA 3LKMA 2PVFA 4XRLA 4ZAUA 2QG5A 3QBNA 2VNYA 5A6NA 4U7ZA 1ND4A 3KMMA 3VO3A 3GB2A 3CQEA 3LIJA 3OROA 4M15A 4Q5HA 5J95A 2CGWA 2HK5A 3NNUA 3NW5A 5CEPA 5CEQA 4JXFA 3A8XA 2A19B 3ZTXA 3PZEA 2J7TA 4ACHA 4PPAA 3DAEA 4O1OA 5EM7A 2Y7JA 2ITVA 3HMPA 3P7AA 4R77A 4CZYB 1YI3A 4P5QA 4DFXE 3VQHA 3HV4A 3WZDA 2WQEA 4I24A 4Z3VA 3C4CA 4DFNA 3VBXA 2O63A 4LM5A 4EC9A 3EZRA 4O7TA 1ZMWA 2JIUA 3D5UA 1NVRA 1JKLA 1PXLA 4JS8A 2R5TA 1LEZA 3MVMA 4IC7A 4O96A 4WNOA 3TTIA 1PYEA 3OT8A 3O96A 3EQGA 5I9UA 3TDVA 4WG4A 4GK2A 3QD0A 4TWPA 4U3YA 4E5AX 2OKRA 4Z7HA 3R8PA 3FXXA 5CSWA 3GC8A 3VRZA 2B7AA 2G15A 2RG5A 3ZONA 3ZH8A 2CN5A 2GDOA 2CKOA 3ZXZA 2PUPA 4QP3A 4S34A 3QYZA 5HVJA 3DA6A 5D12A 4Y5HA 3UO4A 4KBKA 4CMTA 4TT7A 4NW5A 3E8CA 3I7CA 4L43A 3KRRA 3U9NA 2YM6A 3ZM4A 3BHTA 2GS2A 4YPDA 3GU4A 5EW8A 3ZBXA 4CYJA 2X6DA 4ACMA 4DTKA 4WT6A 3FXZA 4B99A 1NY3A 3TJDA 4RIXA 3IW5A 3RINA 3EN6A 1R3CA 3L8SA 1WVWA 3PXQA 3UVQA 5AIRA 3FJQE 3DU8A 2JIVA 1P4FA 4YBKA 1REKA 5GJGA 4FODA 5EM6A 3DB6A 5AV1A 5E8WA 4EH5A 4YZNA 3BHYA 2C6DA 3KULA 3PE2A 5KE0A 1URCA 4FGBA 4IANA 4KIKA 2XK9A 3FLSA 1R1WA 4CT2A 2FB8A 3TNIA 1KV2A 3TIZA 3LCKA 2O5KA 4UXLA 3R8VA 5JRQA 2YIQA 2XZSA 4QYHA 5ICPA 3NCZA 4HOKA 5TF9A 5EQEA 4ORKA 4V01A 2RL5A 2QI8A 2YN8A 3S00A 3T3UA 3BKBA 4HVGA 4V0GA 3MY1A 4WD5A 2BKKA 5JN2A 3DAJA 3PRFA 3AQVA 4CRSA 1H00A 5CNOA 5DEYA 3VAPA 5KUPA 3TACA 2OZAA 4TTHB 4FUYA 5M56A 4UALA 1Z57A 3AC8A 3PA5A 3MFTA 1VYZA 2E9UA 4G34A 4DN5A 3ZRKA 4L8MA 4ZY5A 4EC8A 2O8YA 4MX9A 3LJ2A 3O7LD 4PMSA 5LWNA 3GOPA 4R3CA 2W9FB 3IK3A 4WRSA 4KKGA 4GEOA 2J0KA 3PJCA 2XCKA 3N51A 4L44A 5CWZA 5M53A 3GCUA 3F3VA 1UV5A 4NFMA 3TKHA 3F69A 2X4FA 4TYJA 4IZAA 4MK0A 5AEPA 2X9FA 3CY3A 3ANRA 4I6FA 3QRIA 4XV2A 3CS9A 3O8PA 4J8MA 3ZRLA 3RPOA 2PPQA 5A4QA 4A07A 2J50A 5M4FA 1FVTA 2IW6A 5AR3A 2YFXA 3NZ0A 2IO6A 5KMIA 4FKSA 5DNRA 3E88A 2R3PA 3ZDIA 3KK9A 2YHVA 3RPRA 4F9YA 4RFYA 3IOPA 4BWKA 4FL2A 4JDJA 4MD7E 2OG8A 2C3JA 4Q9ZA 1JQHA 4F6SA 5J87A 1GZKA 4K9YA 5HICA 3KVWA 1KV1A 4BDBA 3WF5A 3Q4TA 4FSWA 4FT9A 1PXNA 2J0IA 4YJSA 5ETFA 3PSCA 1OIRA 3BHUA 4I0RA 4RFMA 5DT4A 2PZPA 5BYYA 3PJ2A 4CG8A 1P5EA 3ZHPC 4ZS0A 3ZUUA 3ALOA 4FKVA 3VQUA 2PVNA 4F70A 3C0IA 4FKGA 1O6KA 3R0TA 4IDVA 2RFSA 2ZJWA 3MSSA 5HO6A 2JDRA 2DUVA 4ZY6A 4CFMA 4FV4A 1JSTA 5E1SA 3KN5A 4W9XA 5EHLA 2UZVA 2EXEA 2OZOA 1PKDA 3EQIA 5BMMA 3FSFA 3LJ1A 1U5QA 4K33A 4FG7A 2RFEA 4QP9A 5CT0A 3FZPA 2QD9A 3NYOA 4FICA 4GSBA 3EN5A 3AT3A 4FT7A 5FTGA 4A06A 4GVJA 4ZLZA 5EYCA 3W16A 4I21A 3R63A 3ZCLA 5CVGA 2CGXA 5D41A 4IX6A 5CU0A 4WSYA 4C4HA 2PMNX 2Q0NA 5IEXA 1DI8A 1IRKA 1JNKA 4ZMFA 1H1RA 2FO0A 2J5FA 4CCUA 2W4KA 3G2FA 1ZMVA 3LAUA 4QMXA 2OGVA 4QYFA 5DBXA 3R00A 3Q9XA 5FDPA 2X7FA 1Z5MA 4FR4A 5C9CA 4C37A 5JMSA 2UZLA 2XKCA 4FTJA 3JR1A 2P2HA 4H36A 2XNEA 3U6JA 4EH4A 2ZVAA 5E4HA 5DPVA 2IPXA 1Q4LA 2XS0A 1V1KA 3NIEA 3DXQA 2VNWA 4FYOA 3P23A 4MKCA 4BIBA 2YIWA 1DAYA 5K0XA 5FEQA 4ANLA 4G3EA 5K9IA 4MWIA 1I09A 2W5BA 5CQUA 3C7QA 4HVDA 4J7BA 3PE1A 3FZSA 3BYVA 4F1MA 3C50A 4JQ8A 2VO0A 4JX3A 1UU9A 2UZTA 3QCQA 4NK9A 3ODZX 2YABA 3RBWA 1WAKA 3IG7A 3KF4A 1JSUA 4PTCA 4TKSA 3KXZA 3I60A 2H96A 3CKWA 4MVFA 1YQJA 2GNIA 4C7TA 4I1ZA 3H0ZA 4E7WA 3DKCA 3ORTA 2BAKA 1YHVA 3DNDA 3CGFA 4GIIA 2GHLA 2QOBA 3KK8A 3PRIA 5KMKA 5I3OA 2PUNA 2O64A 2X6EA 1YI6A 3CCNA 3HV5A 3AMBA 3NIZA 4GG5A 2HW6A 2EUFB 3ZO4A 4CT1A 3GFWA 1MRYA 3MA6A 4ERKA 4ITHA 2XJ1A 4XX9A 5AUZA 1H25A 3OOGA 3R1QA 4YSJA 3LE6A 2GQGA 5T68A 1M2PA 2KTYA 5DEWA 2A27A 3G9LX 3QQJA 4IB1A 4LGDA 3ZYAA 2VTSA 3GXLA 3CKXA 4GJ3A 4U43A 3OEFX 5M4CA 3QRKA 3D83A 2QURA 2VTMA 4EONA 5IQGA 1AD5A 3OS3A 3FC2A 5IG1A 3AC5A 4IE9A 2VTQA 4PL5A 3W8LA 3UO5A 5DVRA 5DA3A 3ACJA 3ID6C 5CAPA 4USEA 4JBQA 2BRBA 4BCIA 2PZRA 5ACKA 5M4UA 3HX4A 3DFCB 3COMA 3R6XA 4RWKA 4UEUA 4UMQA 5J8IA 2UZNA 3KULB 4ANNA 5IQDA 4JR3A 1ZYJA 4QTCA 3M2WA 2JLDA 4AQCA 3HVCA 4HYIA 3R7OA 1WBSA 2PVLA 2VTOA 2BTRA 4QP7A 5HG9A 3MTLA 3R73A 4N4SA 4FC0A 3F2RA 3FSKA 1Q8WA 3H9OA 3UYSA 2VWYA 4M66A 4X2GA 4E4LA 3KMUA 2WMRA 4L6QA 3NYNA 3CY2A 3LFDA 5AP7A 3ZFXA 4LGGA 4YJNA 4CMOA 2NP8A 2V62A 1IASA 3FMKA 3EKKA 3P7CA 4DFYA 2F57A 4FSQA 4TY1A 2OZAB 5IA1A 4ZTNA 4R78A 4AOIA 3WE8A 3P0MA 5LVLA 2WTWA 4JX7A 4O7NA 5HESA 1OL5A 2VN9A 3CP9A 4BYIA 4ZTSA 5J79A 4PPBA 1H08A 1TQMA 2WHBA 2GSFA 2ZMCA 4WKQA 5AV2A 4TRLA 4BI1A 4E8AA 4JG6A 3UC3A 5A54A 3FV8A 4KKEA 3RHXA 1RQQA 4HGLA 3KC3A 4O38A 3BE2A 5IA2A 4NCTA 4EHGA 4XG7A 4RX5A 3PP1A 5CQWA 2QONA 4QYYA 2R4BA 3A4OX 3VF9A 4CV9A 4ZZNA 4CLJA 4MTAA 3RM7A 5HTBA 2PK9A 1J1BA 1Q99A 4QMSA 5BVDA 4DTAA 5EYKA 1H1PA 4C58A 5J1WA 1OIUA 3GU7A 3I0QA 3Q3BA 3OVVA 2UV2A 4G3FA 3UPZA 4KS7A 5EI2A 3RPYA 4QQJA 4FTCA 5E8UA 4GW8A 3S0OA 1RE8A 3DQXA 4LGHA 4H3QA 4DEIA 4L3LA 4H05A 5AP4A 1YDSE 4XOYA 1E1XA 4X2NA 4MEDA 4F9AA 3ZC5A 4FV6A 3EQHA 2ITPA 2YDJA 3PXKA 3QTXA 4G17A 4MAOA 3DKGA 3TNQB 4YLJA 4D2SA 2ZM1A 4BWXA 2YAAA 3W2RA 5HU9A 2HIWA 4YURA 3DKOA 4YHFA 2OXXA 3BYSA 5JFXA 1P2AA 3KF7A 4IQ6A 5DR2A 3P78A 3KN6A 3ORMA 1GIJA 5DOSA 3RVGA 2ESMA 3FI3A 2ZDUA 4BICA 2ZDTA 3JS2A 3WOWA 4P7EA 4ASDA 4UV0A 4CCBA 5JGDA 2IZTA 5LWMA 2HENA 2J6MA 3HMMA 5DWRA 4JJRA 4AF3A 3SVVA 2W5HA 5B2MA 3TNPC 2C5YA 3ERKA 4BB4A 4U44A 2H34A 4LUEA 2NRYA 2BZJA 3DTWA 3EQDA 5AX3A 5EKNA 4BL1A 5IZFA 3FI8A 3MS9A 5D11A 4RIYB 2I1MA 3LCOA 3EHAA 4E4XA 2OJIA 3V8WA 2QQ7A 5DFPA 5C4LA 4RC2A 4S33A 5AP3A 3QGWA 2VGOA 3DQWA 3KU2A 2YERA 3ZC6A 4FEVA 3NVKI 1KOAA 1LR4A 1YWRA 4JRNA 3WZEA 1JBPE 4X7QA 4C4FA 2QR8A 5EYDA 3R8UA 5H8EA 3W32A 1J7UA 1ZWSA 2X81A 3GC7A 3BI6A 1APME 4MD9E 3RCDA 4FKLA 2IG7A 3TXOA 4MQ2A 4ZXTA 4AW0A 2XEZA 4AAAA 1F0QA 3QQLA 4F0IA 2A2AA 2ZV2A 2JFLA 3KA0A 2Y4IC 5HX8A 2R3HA 5M09A 1U59A 3FMJA 2FSMX 3VS5A 3FY0A 1PXKA 2CKEA 2YIYA 3QHRA 4A9SA 1CKJA 2CDZA 2YM4A 4YLKA 4EOKA 4YJTA 1V0BA 3KQ7A 2HZNA 1GJOA 5LMAA 4U81A 2O0UA 2XRWA 1ZXEA 1YXVA 3E8NA 4L3JA 5TT7A 4RA5A 3RM6A 5A4TA 1Q41A 5IH5A 3DLZA 4K11A 4BY9E 1OL2A 4D1SA 5A14A 5EH0A 3IQ7A 4QYGA 4EOMA 2CSNA 2UUEA 3NLBA 1OIQA 4ANBA 2CNVA 1PY5A 3WYXA 3FQSA 4TWNA 2UVZA 4OT5A 3KEXA 2R9SA 4YJQA 4AOTA 2WB8A 5LMBA 1FGIA 1SVHA 3DBEA 4PF4A 3FMLA 3OP5A 3R8LA 3QCSA 4Z16A 3ODYX 3ZEPA 3BIZA 3HDMA 3GU6A 2XRUA 5DRDA 4BDGA 3R2YA 3ATTA 3RCJA 1J1CA 3TJCA 3VS7A 4F7NA 3MESA 1LPUA 4D1XA 2VZ6A 3FYKX 3TWJA 2WEIA 3UBDA 4LOOA 2WTKC 3HRFA 5BYLA 1PW2A 3DK7A 4ZSGA 4F6WA 1UU8A 1BX6A 1Q5KA 2V7AA 4IZ7A 4XMOA 3TV4A 2G2FA 3ORXA 4RRVA 2ZB0A 4DINA 1DS5A 2ONLA 3ZS5A 2VTLA 4JT3A 4FG8A 4BCHA 4KIPA 3V3VA 4BDEA 1JLUE 5HLPA 3CD3A 3ROYA 5AP6A 3QALE 4F65A 5EW3A 4E6DA 3FAAA 4HCVA 4XBUA 1W0XC 4FT5A 4W4XA 4XG3A 4RFZA 3W2SA 3LCDA 1ZOEA 5T6KA 3SC1A 3TNWA 1L8TA 4FIFA 1FGKA 5FM3A 3OUNB 1W98A 3WIGA 4CV8A 3HRCA 4YZDA 2JBPA 1M2RA 3UQCA 2ZYBA 4F09A 3DV3A 4KSQA 2HWPA 2QCSA 3FLQA 1XQZA 5KBQA 4EH3A 4ANOA 5CSXA 4DEGA 2BRNA 3QRTA 4IVAA 5F94A 3PUPA 2XF0A 5JT2A 3R71A 5DT0A 5J1VA 5AA8A 4LRMA 5DT3A 1PYXA 5CXZA 1G8AA 3U55A 1G3NA 2JKOA 4KBAA
chains in the Genus database with same CATH superfamily
2Y4PA 4AT4A 4EK8A 3Q5ZA 3PPKA 3R8MA 3GQLA 3RKBA 2OIDA 5L2SA 2Z60A 2QOLA 5E8XA 4HW7A 5CEOA 3REPA 2OIQA 3K5UA 4KWPA 2YWVA 2H6DA 4QP8A 2IVVA 2W1GA 4USDA 5CALA 2PE2A 4IADA 3Q9ZA 5CZIA 3TT0A 2QOQA 2VWXA 3P7BA 4ZJIA 3DXNA 5AFVA 5HU3A 1YWNA 3ZRMA 4BDDA 3L9NA 5JZJA 4HZSA 1XHAA 4BDJA 1G8JA 4I6LA 2XNBA 2BILB 2C3KA 3AC3A 2G1TA 3UNJA 4E5BA 4E6QA 3BQRA 5EDPA 4S2ZA 2WU6A 3IO7A 4AW5A 4CKJA 5FEDA 3V5QA 2DYLA 4F08A 3FZ1A 3VC4A 1WBWA 3EWHA 5C26A 2XK4A 4IDTA 1H28A 4FNXA 2X0GA 4FF8A 3I6UA 2A4LA 4PRJA 4BTFA 1YDTE 3E92A 4XG4A 2YEXA 4DT8A 4DLJA 4EH7A 5CU6A 5E8VA 2BKZA 4GUBA 4RVLA 1DAWA 4PUZA 2IW9A 1H1QA 2WMAA 4KS8A 4M8TA 3UJGA 2JDOA 3MJ1A 4QMPA 5I0BA 3ZO2A 3HAVA 2UZDA 5AM6A 3VUKA 3L9PA 2C47A 4JL9A 1G8SA 5HO7A 3OCGA 5HKMA 3UMWA 4FRFA 4CVAA 4FE2A 4FTMA 4LRJA 1FPUA 4O4DA 4R1VA 4YP8A 1KE7A 1OL7A 3F5GA 5HTIA 2XKFA 1B38A 3NX8A 3DDQA 3MB6A 4IXPA 4BCKA 4DFLA 1OGYA 4XRJA 4I6QA 1AGWA 5IU2A 3CJFA 1OVEA 5AR2A 3V51A 5CAVA 1GZ8A 2I0EA 5FXSA 5HE2A 4UWBA 3OUKA 4NCTC 3K2LA 5DG5A 3DLSA 5DR9A 5CLPA 4EBVA 4C36A 4ZSJA 4O0VA 3AC4A 5ANOA 3KKVA 4JDKA 3UYTA 2WMBA 4GKHA 4RLLA 5EYMA 1Y91A 3HZTA 3QC9A 3V5JA 4CZTA 4YZ9A 5M06A 4O6EA 4QQ5A 3F5PA 1CTPE 3G9NA 2B0QA 4NKSA 3OTUA 3IDCA 3MFUA 2YCFA 4L00A 3H10A 3R83A 2UW5A 3QAME 1WBVA 4GCJA 4LUDA 2OF4A 4J71A 2QHMA 3LFSA 4EKLA 4F1OA 2J0JA 3K3JA 1PJKA 4PNIA 4DGOA 3KXNA 3WZJA 1FBNA 3HKOA 3CC6A 5G1XA 4EOJA 2IN6A 3AKKA 3ET7A 4EQCA 4DEEA 5IA0A 3PTGA 4AX8A 3DBDA 3HECA 4M69B 2WGJA 3U4WA 5AR4A 3IW6A 4IAAA 3BLRA 4QEBA 1VR2A 4YO6A 3G90X 3SLSA 4DBXA 3RHKA 3KIOC 1YW2A 4WIHA 5CAUA 2WTCA 3MWUA 3CIKA 1JOWB 2R3KA 4GFGA 4DH3A 3GCPA 2E9OA 3PPZA 3CEKA 2Z7LA 4PQNA 3CSVA 1PKGA 1XO2B 4Y46A 3HMOA 4ZY4A 4JOAA 4MXCA 5JQ5A 1SYKA 2ZAZA 2YZAA 5AAFA 4AT3A 5GIOE 3MFRA 4RIWA 4D9TA 1UU3A 4DGNA 4M84A 4R3RA 3TIYA 5FDXA 3QTQA 3FMNA 3QRUA 3TN8A 3ELJA 4O7SA 2OK1A 2UW8A 5DRBA 4BBFA 4MBJA 1FMOE 3QCYA 5FP5A 4RC3A 4FV7A 5GJFA 3U9CA 4WG3A 3COIA 5CSHA 4XS2A 1WBPA 2BR1A 4AGCA 3NEWA 3VN9A 4BJJA 4ZTHA 4JQEA 1XBAA 2VV9A 2XM9A 1YOMA 1I44A 3PY1A 3GI3A 3LXKA 4G6OA 4RVKA 4I4EA 1BL6A 3TKUA 1R39A 3AD4A 5FTQA 4NT4A 3FLNC 4GU9A 3I7BA 3VS3A 4O0UA 3OXZA 4CFUA 4QMZA 5I9XA 2ETKA 2IF8A 2I0VA 4PMMA 1BLXA 4KABA 4CRLA 4IAIA 5L8JA 5IQEA 4IWOA 1Y57A 4FIIA 4FZ6A 4WO5A 3TUDA 2V0DA 1KE6A 4UYNA 2X7OA 3I79A 3R7EA 3D7ZA 1BYGA 4HCUA 4ZS4A 3HP2A 3O23A 5EDQA 4G3GA 5E91A 5HO8A 3SRVB 2W1FA 3OBGA 4JBPA 1PF8A 3LVPA 5CTPA 1OPLA 3LMHA 3OHTA 3BLQA 5AM7A 2Y8OA 4FSMA 4BDIA 3Q9YA 3O8UA 4OW8A 5H3QA 3AXWA 4BYJA 4O0WA 4QP6A 3EB0A 1S9IA 3UNKA 4R3PA 4FGRA 3MH2A 5ETCA 4YO4A 4ARKA 4AXDA 1YRPA 2H9VA 2YISA 4DC2A 5HIBA 4FV3A 1YOLA 3UIUA 4ALUA 4C34A 2GTMA 3Q4CA 1GNGA 2CJMA 3NSZA 2UZWE 3V8SA 3COKA 4U79A 4FA2A 2BVAA 4FKWA 3NR9A 3ORLA 4GVAA 5CF8A 5B2LA 2BDJA 1KSWA 3E7VA 4RQKA 2WNTA 4RJ6A 4RJ4A 4C4JA 3GENA 2W9ZB 2X2MA 5IA5A 5HZNA 2FUMA 4JQ7A 3JPVA 4AXEA 3KFAA 3QUPA 4I5HA 4MQ1A 3TEIA 1YWVA 4Z55A 5L8KA 4CD0A 1KE5A 3W2PA 1REJA 2JEDA 2OU7A 4F1TA 4FEWA 4K6ZA 2CLQA 4FV0A 2OJ9A 4LL0A 2WOUA 4X3FA 2JFMA 5GZ9A 5CEMA 4AZEA 5AJQA 3SV0A 4G5PA 3U4UA 4EEVA 2XB7A 3Q5IA 4U42A 4BGGA 3PZHA 1XBCA 3GUBA 4RG0A 5JRSA 3O50A 3BE9A 3B8RA 2JKKA 3BPRA 4GIHA 4D4YA 2Y6MA 4QMUA 2C6IA 2ZFYA 1PXPA 4R7IA 4CFXA 2IW8A 3V01A 2PMIA 1UVRA 4GT5A 4JLCA 3DGKA 3FDNA 2YACA 4FTAA 3EFJA 4ONAA 2FSTX 5HG7A 2XK3A 3FZRA 4ZJVA 1S9JA 4M0YA 4OAUC 3HNGA 2XYNA 1BUHA 3MI9A 3FKLA 3TZ9A 4RT7A 3QQKA 5KX8A 2WAJA 4D5HA 2PMLX 4LQMA 4DHZA 5CU2A 5F20A 3CTHA 5IMXA 2J9MA 3AOXA 3QD3A 2W06A 2R3OA 4QTEA 4IAYA 5A4CA 2O2UA 4CYIA 2BZIB 4YZMA 1YDRE 3QTWA 4AA0A 3OXIA 4J96A 1FINA 4BZDA 4ITIA 3B8QA 4BKZA 4RWJA 5BUJA 2VRXA 3QQUA 1OMWA 3I5NA 4NL0A 3H30A 3ZU7A 4FEXA 2XIZA 3Q53A 3LHJA 4FKRA 4GFOA 2VO3A 4DFUA 5HCXA 3D5VA 4CNHA 4EK6A 3D4QA 4IM3A 2Z02A 3FXWA 4QMYA 3OXTA 2I0HA 3ANQA 4NYEA 5FTOA 3F2NA 2IZSA 3OY1A 2LAVA 5JGAA 3NFFB 5T3QA 2VWUA 3GQIA 4PY1A 3UTOA 4WG5A 2I6LA 4IMYA 3RZFA 3Q4UA 5BVEA 3SX9A 3ZXTA 4AXCA 1LP4A 4YU2A 3GT8A 4C35A 1H4LA 1W2FA 3LLTA 3EL7A 5ANJA 3TZ8A 2I0YA 3PVWA 4ZZMA 5FQDC 4GK4A 4RJ3A 2Y6OA 1GIIA 1R0PA 3PG3A 3GNIB 1XH5A 3R9RA 3LFFA 3R7YA 3MPTA 1FQ1B 3SXSA 3VJNA 1WCCA 4FIHA 5I9YA 4OR5A 5IF1A 2ERKA 3R2BA 3Q2MA 3W1FA 5ITAA 1UA2A 3HV7A 4DF3A 4QTDA 3E8DA 3F3WA 2BUJA 3EN7A 2UW4A 4O0SA 4XUFA 3VUMA 2WPAA 2VWZA 2X7GA 4WUAA 3C4EA 3DZQA 4ZLOA 4F0GA 4FZAB 5KHXA 5LXMA 4ZIMA 3UIBA 4O0YA 1MP8A 2WMVA 3KVXA 2QVSE 3NAYA 3OW3A 4OTDA 2XJ2A 4RIYA 5FP6A 3CTQA 4M13A 3R7VA 4GYGA 4EWHA 4AQKA 3QTIA 4LFIA 4JMQA 4MNFA 4DE4A 1F3MC 2WMUA 5BVKA 3F2AA 4M97A 4RVTA 1DM2A 1KWPA 4QPMA 5DE2A 3ZEWA 3F5UA 2WQMA 4QNAA 3QTZA 2HAKA 2KULA 2X8EA 3VNTA 3UQFA 4FTQA 3PXYA 4TNBA 4P5ZA 4YTHA 5C27A 5JK3A 2P0CA 3SD0A 5AWMA 1J91A 4AE6A 3VS0A 2QOHA 2IVSA 3A7GA 3F5XA 3D2IA 3UIXA 4CQEA 2ETRA 1XH7A 2VTNA 1VZOA 3CXWA 3LFQA 3PLSA 3MN3A 4RIWB 5CSVA 3LQ3A 4NIFB 3HAMA 4LI5A 2JAMA 2E9VA 2B55A 4AW2A 5IQCA 5ETIA 3BRBA 4PNKA 3ATSA 4OBQA 3T3VA 5IQHA 3F9NA 3HRBA 4BJJB 2W1IA 2CCHA 5BPYA 4BCGA 5M51A 4YC6A 3AG9A 4FV2A 3UP2A 3O2MA 4P90A 3VS4A 5L3AA 3QZFA 2B53A 2ITYA 2YAKA 3NUYA 1ZLTA 3OY3A 3ZFYA 5K5XA 2VX0A 3Q52A 4BDHA 1OECA 2F7EE 3CBLA 3H0YA 3LFEA 4NWMA 1FVVA 5IMEA 3R28A 2PULA 5HGIA 3MB7A 2OXYA 3SG9A 2W17A 4BF2A 3P5KA 4CLIA 3SW7A 3DBFA 4LV5A 4RBLA 2ZV7A 4O7ZA 1Y6BA 3QFVA 5H9BA 5CF6A 4AS0A 4YNEA 3RAIA 3PLAE 4J53A 1FMKA 2XUUA 2J0MB 2JDSA 4WBBB 5BV3A 4TL0A 3MH3A 4KIOA 3EIDA 3NUUA 3SA0A 3B2TA 4GJ2A 1CKPA 4H3PA 5DHJA 3NUAA 4YR8A 4H1JA 2JDTA 5AR7A 3NDMA 2PUIA 1J7IA 1Q24A 2VTAA 3OCTA 3ZLYA 4FEUA 4KAOA 4FKQA 4DCAA 5CAOA 4OTPA 4PX6A 4RX7A 3QF9A 2UZUE 2BRGA 3A7FA 3QGYA 4EH2A 4BCOA 2BDFA 3FLWA 3MPAA 3LXNA 4NM3A 2ITNA 2FYSA 2YM7A 3GCSA 4ALWA 4DH8A 2H8HA 4G6NA 3QKMA 1G5SA 3E3PA 2IWIA 4YTIA 5AV0A 4BCPA 1OITA 4YHJA 4Z7GA 4I94A 3P4KA 3HLLA 3QQHA 4XEYA 3ZMMA 2W1EA 4FIGA 2XH5A 3QU0A 2X9EA 4X3FB 4MHAA 2DQ7X 1WBNA 3AD6A 3UOJA 2HWOA 4JDIA 3FE3A 4O0XA 4MH7A 3KRWA 3SGCA 4NH1A 5F4NA 1ZOHA 3UDTA 2Z7SA 3UP7A 3D7TB 5HORA 4R8QA 3EQPA 3VW6A 5M07A 4NFNA 3JXWA 4JBVA 4FSZA 4O2PA 3WI6A 3OZ6A 3E3BX 4JIAA 4D2RA 1HCKA 3L8XA 3HV3A 3NUNA 4EK5A 5ANGA 4PL4A 4QMWA 5K3YA 3FKNA 4X2KA 4C2VA 3W2QA 5CEIA 3WILA 2C0TA 4XG2A 1GY3A 4OTIA 2WFYA 1SNXA 4PDPA 4WNPA 3PXZA 1BI7A 4LG4A 4F9CA 2B9JA 1NVSA 2R3JA 1YKRA 4NTSA 4RZWA 5LVPA 5EQYA 4I23A 2WTIA 4E6CA 4L7FA 4AFJA 5I4NA 4L68A 4MBLA 2QOOA 3DFAA 1UU7A 4IAFA 3QWKA 2YJRA 3UIMA 2XKEA 5A4LA 3DZOA 2WXVA 4AGDA 4KNBA 4TYHB 3CE3A 1CDKA 4X6QC 5D7AA 5BYZA 4ANQA 5JSMA 2R3RA 4DT9A 1WVXA 3KRXA 3JVRA 1V0OA 3R04A 4AU8A 2WQBA 3H4JA 3MH1A 2BIKB 2PVKA 3LM0A 1TZDA 4GU6A 4HPUE 3RGFA 4B7TA 4II5A 2J2IB 3EFWA 4BCJA 1FOTA 1K3AA 3S95A 4G5JA 3NS9A 2P4IA 1ZY5A 2F9GA 3BBTB 2WIHA 1CMKE 3E62A 3LXLA 4XP3A 4U45A 4B0GA 3EN4A 2C6TA 4QQCA 2V55A 4MXOA 4O2ZA 4HYHA 2QOCA 5JH6A 4DG2E 1F5QA 2OFVA 4QMOA 2AUHA 3POZA 4FUXA 5AP5A 4AGWA 3G6GA 3C1XA 3VUHA 3W33A 2P3GX 2FA2A 4ZTQA 2ZOQA 3VBWA 2YLEA 3P1AA 4OTFA 3ULZA 3F66A 4YC8A 2REIA 5AR5A 4O84A 2YJSA 5EOBA 1M7QA 2AC3A 4MXAA 3RAHA 3QA0A 4FVQA 2IVUA 3A61A 5HNIX 2Y0AA 2HY0A 4BDCA 4HGSA 4C59A 3R7GA 4FOBA 4PP7A 4C61A 4FL1A 1YXUA 3DDPA 4BC6A 3UE4A 2VTHA 4AXFA 2UZOA 3CJGA 2O3PA 1A06A 2V5QA 2QOKA 3A62A 5HEZA 4C2WA 4XYFA 1XBBA 3QYWA 3NW6A 5IDNA 1QPCA 1VYWA 3NMUF 5J9LA 3EZVA 4D2WA 5LMKA 2V22A 3PFQA 3HP5A 3LCSA 5IISA 4AZSA 2ITXA 3C0GA 4PTEA 1SMHA 3SXRA 4FX3A 4ACGA 5FXQA 4J97A 3WF8A 3FI4A 4DH5A 4XP0A 3C0HA 5HIDA 2QODA 4V05A 3BWJA 2VWVA 2XJ0A 3DB8A 1MQBA 4HGTA 4M69A 4TYIA 3BGQA 2BRMA 5D7VA 3TKIA 5CENA 1OBDA 4EHZA 5LOHA 4NJ3A 4BTJA 3WARA 1ZYCA 4C0TA 4ZMEA 5IDPA 4EJNA 2YM5A 3D94A 4GFMA 4EZ3A 4NZWB 4YJVA 2VTJA 2BFXA 5FEEA 1BKXA 4EWQA 4O22A 2YA9A 5EQPA 4HCTA 2ZV9A 4LRKA 3EMGA 3LQ8A 1R78A 4HZRA 3FHRA 2BRHA 4DFBA 4GH2A 4YHTA 5J9ZA 2YDKA 3RTPA 1JKTA 4ASZA 5IQIA 4CQGA 4BTKA 4UMUA 4UXQA 2GNJA 3I0OA 3ORPA 4AACA 4LV7A 3QD2B 5BMSA 4WOVA 1WBTA 4BVUA 2HCKA 1Q8ZA 1J3HA 4ZZOA 3DY7A 5EG3A 3IDPA 2FSLX 1EH4A 3TL8A 1ZRZA 3N4UA 4QPSA 4D1ZA 3LMGA 5E9EA 1UWJA 4FSNA 4AGUA 5KKRB 2HZIA 3VWAA 3TZMA 3FKOA 4XV3A 3FPQA 1Q3WA 2GHGA 4JG8A 3VS6A 1OM1A 3E87A 2Q0BA 5AUVA 4WA9A 3WZKA 4OBPA 1ZY4A 2XNPA 3OCSA 4RJ5A 4DH7A 1JAMA 3OBJA 4FTLA 3TG1A 5AA9A 4FVPA 4HVIA 3TM0A 1ERKA 3UOHA 3Q2JA 3FQEA 1PXMA 1H24A 4YZCA 1XMMA 2QOIA 4ERWA 4FI1A 2VAGA 4D2VA 3RAWA 1A48A 4Q9SA 3W0MA 2B9IA 2X2LA 4FG9A 3R9NA 2QO2A 5LJJA 2HZ4A 3S3IA 5JKGA 1JKKA 4U41A 4B9DA 3SRVA 4A9RA 3BL9A 3UVPA 3ZLXA 5JFVA 3QTSA 4FTKA 2GTNA 3G51A 4D4VA 4F7LA 4A9UA 3VONA 4F0FA 4L45A 5I9VA 5EHYA 4RX9A 3KB7A 5LQFA 2X8DA 4MF1A 4I6BA 1OPKA 3W8QA 5CU4A 2GCDA 4AA4A 2R3IA 4CFVA 2CLXA 2UVXA 3QQGA 4CKRA 4C4GA 4AW1A 3EYGA 2V7OA 3C4WA 4MF0A 2RG6A 2W96B 5K5NA 3GOKA 3KMWA 2WZJA 4I0SA 3WZUA 1O6LA 3F6XA 1OBGA 4UZHA 3JVSA 5FGKA 2RFDA 2BHEA 4ANSA 4D4SA 4D0WA 4EOIA 3VRYA 3EQFA 3ZSIA 2HY81 4FV8A 4E4NA 3FL4A 5DYJA 5AUXA 4RPVA 3BEAA 1U54B 5K4IA 2ETMA 4L46A 3K54A 3LW0A 4CEGA 3A60A 1OPJA 4X3JA 4DHIB 3VIDA 2GFSA 3R30A 4BKYA 2XMYA 3MBLA 3BYOA 4USFA 3TI1A 2B52A 3R02A 4FSRA 2XP2A 3B2WA 4I6HA 4LOQA 5GHVA 3RK7A 3T9TA 3UZTA 1JPAA 2PU8A 3SXFA 5FD2A 4BCFA 4G9RA 4BCQA 3PP0A 2A0CX 3F82A 2F7ZE 5A9UA 5I9WA 1Q8TA 4FV9A 3KREA 3MA3A 3E8EA 3VBTA 3VS2A 1XJDA 3FC1X 5AP0A 4S32A 1OL6A 2G2IA 3NVMB 5AX9A 4C4IA 3AT4A 4IM0A 3NAXA 4H39A 5CANA 3KY2A 3TDWA 3BQCA 4Y72A 3NRMA 2IZRA 5E8ZA 5HQ0A 3MIYA 5C01A 3LZBA 2ZM3A 3R9HA 4K77A 5TOZA 2C6EA 5A4EA 2W4OA 2XK6A 3FYJX 2RF9A 1RJBA 3EQCA 4XG8A 2PWLA 4FTOA 4XH6A 4FNYA 4A7CA 2PE1A 4OTGA 2OJFE 3MDYA 3QLFA 3ZSHA 2QKWB 2XM8A 1TKIA 2HELA 4A4XA 5C8NA 3OMVA 2VX1A 5IKWA 2C0OA 1OKZA 5EM5A 5EOLA 5TKDA 4Y73A 3UGCA 5KMMA 3HV6A 4R7BA 3L8PA 5BUIA 4DDIA 2OSCA 4JAJA 5M08A 4UMTA 3O8TA 4APCA 4A9YA 3A7JA 3TV7A 4F6UA 4ACDA 4ACCA 1IA9A 2QR7A 2W7XA 3ORKA 5J7HA 4ZK5A 1CM8A 1H26A 5ANDA 1UWHA 1YVJA 2VD5A 3BHVA 4FIJA 4X21A 5FBNC 3GP0A 4CXAA 5HVYA 1KE8A 5D9HA 3QZGA 2G2HA 3ZBFA 3RAKA 2ERZE 5DN3A 3TZ7A 4XV1A 4GG7A 2NPQA 1IR3A 4DEHA 4TYGA 2JGZA 3GU8A 3OWLA 2R3LA 4IFCA 4QMLA 4G2FA 4RJ7A 5KMNA 4OT6A 5CT7A 2C6OA 3BZ3A 4O4FA 3RNIA 2BPMA 3G33A 4Y83A 1A9UA 5CF4A 5EFQA 3CPCA 4TWOA 4BDFA 1Q61A 2QHNA 3DOGA 4BIEA 5LVNA 4F99A 4DEAA 2E2BA 3R1SA 5HBEA 4XOZA 4Y8DA 4AG8A 1Q62A 4O7VA 4EQUA 5DI1A 2J51A 1IAHA 4Q2AA 4FSYA 2WMWA 3AC2A 2E9PA 4P2KA 2YM8A 5AUYA 2RFNA 2SRCA 4RC4A 1H0WA 1TQIA 2P55A 4FSTA 5CXHA 4QRCA 4AZTA 3K3IA 5EI6A 3V6RA 4HYSA 5EI8A 2OBJA 4L53A 2W1CA 1W7HA 4IVCA 4J99A 2CHLA 2B9HA 1W83A 2ITZA 3GU5A 4DEBA 4DGGA 4F7SA 3UODA 4L52A 2YIRA 3V5TA 4EQMA 2PZ5A 3POOA 4N6ZA 1ZZLA 5KMLA 5K0KA 3FLZA 4KRCA 5IH4A 4IFGA 4C33A 5ANKA 3S1HA 5BVWA 4E5WA 4AWIA 1SVEA 2JIIA 4UYAA 3UQGA 3GGFA 4I4FA 4FTIA 4GL9A 2PUUA 3QUDA 4NIFA 2XK7A 4XHKB 4DFZE 1W8CA 4QO9A 1MUOA 2VTTA 4N6YA 4HVSA 3VUGA 5LMKC 2GQSA 3KGAA 2BHHA 4KRDA 4R6VA 1AQ1A 3QKLA 3U87A 2QLUA 4I93A 2WTVA 4GT4A 3RP9A 3MVHA 5ACBC 2BROA 4E4MA 3AD5A 4E20A 4K2RA 5IUHA 4QD6A 3K5VA 4YPSA 4DITA 4EK3A 4I92A 2LGCA 4RWLA 5EHOA 2WTJA 3S4QA 3FMHA 2WMTA 2VO6A 2UZEA 2ITQA 4CFWA 2OFUA 3G0EA 4FV1A 5KMOA 2B1PA 3PPJA 3DS6A 2C6KA 2UW9A 3IW7A 3A99A 1O9UA 4YJUA 2PHKA 4FYNA 3A7IA 4G16A 1RDQE 4JNWA 1Q8UA 2OI4X 3ZOSA 3RK5A 4FL3A 2QO7A 4BGQA 3BU5A 4Z9LA 4CSVA 4Y5QA 5KHWA 2QU5A 2WMSA 3F7WA 2VWWA 3ORNA 3PJ3A 2OLCA 2OF2A 1LUFA 4CKIA 2R0IA 2NRUA 1MRUA 1PMVA 4AP7A 1WZYA 3ORIA 5L6WL 4A4OA 4XCUA 4K8AA 3DJ6A 4AN9A 5HNBA 3BCEA 3OW4A 4Q5EA 2XVDA 1YOJA 1OGUA 4NM5A 5EM8A 3PSDA 3MW1A 4O1PA 1QCFA 4IBMA 1PRYA 4EOLA 4AXAA 4XBRA 3UG2A 1OKVA 1UKHA 3QQFA 5AIKA 3IW4A 3QLGA 1OZ1A 3P86A 4RA4A 4WUNA 3NUSA 2F49A 2AQXA 3MPMA 4U6RA 2UVYA 3DK6A 3FMDA 4IHPA 4OUCA 1H1SA 3D0EA 3I4BA 4IIRA 2PVRA 4DBNA 3VHKA 3FLYA 4TNDA 5AAGA 4D2PA 2WMXA 5ANEA 3F61A 4RVMA 1Q8YA 2CGVA 2OXDA 2PTKA 4O21A 3TNHA 4R5YA 5IQFA 3CQUA 3PWYA 5HE3A 3CR0A 2Z7RA 3D15A 4O81A 2WTDA 2W1DA 4DHJA 4LL5A 1OUKA 5J7BA 2ONLC 5CVHA 1XH9A 2CNUA 1OL1A 3WF6A 4FZ7A 2GHMA 2W5AA 2WQOA 3AC1A 4DGMA 4C3FA 4IW0A 4EL9A 5BVNA 5LCJA 4W4YA 4TXCA 4RSSA 3QTUA 1CKIA 4HGEA 3ZZEA 4F4PA 2YDIA 4NJDA 2Z8CA 3BELA 3SG8A 2HXQA 2JC6A 3D7TA 3IGOA 4BCNA 2R3NA 3P79A 4ZJJA 3RI1A 2YCQA 3H3CA 2E9NA 2PY3A 2B9FA 4YGAA 4ID7A 2DS1A 2ZV8A 3E93A 2OJGA 3NGAA 4AA5A 4MNEA 1V0PA 5HD4A 3VJOA 3THBA 3BL7A 3CLYA 4FV5A 4TYEA 3M1SA 4L3PA 3PA3A 3OT3A 2CKPA 5HTCA 1UNGA 3Q6UA 3FZTA 3MIAA 1H0VA 2BIYA 3GCVA 4ASXA 3PVBA 5CZHA 5L2QA 3RWPA 3NNWA 1TQPA 4OTQA 5HHWA 4UN0C 4XNEA 3GEQA 5BVOA 3E64A 3V5WA 4BKJA 1U5RA 2F2UA 2UW6A 3E63A 4HJOA 5FWKK 3QXPA 1BI8A 5EK7A 1B6CB 2XBJA 3R01A 3R9DA 4OGRA 3N4VA 4D28A 4TYHA 1URWA 4EOPA 5CYIA 4JBOA 2IZUA 2BMCA 4DGLC 3KRJA 3GC9A 4MXZA 4OTRA 1KOBA 2VWBA 3BX5A 4YJRA 2VX3A 5AUWA 5B2KA 4BHZA 4S30A 4KIQA 4DCEA 4F7JA 5DGZA 2YIXA 3CQWA 4CMUA 3EL8A 3NPCA 2XEYA 3ULIA 3PWDA 3EQRA 3JUHA 3LFCA 4ENYA 4EYJA 3AGMA 3HGKA 2W4JA 5L2TA 1HOWA 5E1EA 3DBCA 1STCE 3Q96A 3I81A 4IACA 4M3QA 4QP1A 3MH0A 3SHEA 1Q3DA 3QUEA 5KCVA 1WBOA 4BBEA 4IX3A 2C5OA 3HEGA 4FEQA 4R7HA 2GQRA 3L9LA 3UO6A 3OEZA 4YUQA 3FPMA 3R9OA 3TUCA 1Q97A 4FTNA 4J1RA 4E26A 3DXPA 4JVGA 4AZWA 3UMXA 3UNZA 3ZZWA 3OTVA 4U97A 4AUAA 4LYNA 3O17A 4XLIA 2X1NA 4QT1A 2XIKA 2QG7A 2OW3A 4WBOA 1ZYDA 2RKUA 4D5KA 2VU3A 1ZYSA 4L01A 4WHZA 3RMFA 3UZPA 3MVJA 4D58A 2R0UA 5FUTA 3E7OA 2J4ZA 3V8TA 3ZM9A 2UW3A 1UNLA 1YXTA 5HCZA 3D14A 1JWHA 2B4SB 4YJOA 3NW7A 4O27B 4IWPA 5AV3A 4C02A 5ANIA 2GPHA 1SVGA 3QTRA 1QPDA 2WMQA 3BGZA 3M11A 4J52A 5H8BA 5HBHA 3W10A 5GZ8A 4I5MA 4N57A 2VTPA 3Q4ZA 2BDWA 3QC4A 4DA5A 2P2IA 2C3IB 3OWKA 2EXCX 1WVYA 3OWJA 2HYYA 2BTSA 5LCKA 4FT0A 2XYUA 4BGHA 5KBRA 2NNWB 3V6SA 4QNYA 3L8VA 5DR6A 4NUSA 1XH6A 4O7WA 4QMMA 3M42A 1H8FA 3A7HA 4EOQA 5H2UA 3JY9A 4Y95A 5GZAA 3QCXA 1QMZA 4FNZA 2EXMA 2XA4A 5CU3A 5DH3A 4O0RA 4H3BA 3S2PA 5BVFA 2I7QA 3LLAA 3WF9A 1NA7A 3BV3A 4AZVA 4TPTA 2R7IA 5IPJA 4BI0A 3DKFA 3L9MA 4S31A 4FTRA 5AP1A 5HG8A 4L67A 5HE1A 1XH8A 3R7IA 4EI4A 4KD1A 4OLIA 4WSQA 3HMNA 5JFWA 5IUGA 2G01A 3A2CA 4BDKA 5M44A 4O7YA 3EH9A 3MY0A 2I40A 5CNNA 2QC6A 4DAWA 5C1QB 2UW7A