2GFSA

P38 kinase crystal structure in complex with ro3201195
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
344
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-Activated Protein Kinase 14
publication title Discovery of S-[5-Amino-1-(4-fluorophenyl)-1H-pyrazol-4-yl]-[3-(2,3-dihydroxypropoxy)phenyl]-methanone (RO3201195), and Orally Bioavailable and Highly Selective Inhibitor of p38 Map Kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 111
structure length 344
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2gfsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2gfsA01
5CY3A 5KMJA 1G3NA 3OS3A 4ERWA 5EKNA 3R6XA 1B6CB 4DFZE 3EFLA 4KABA 4ALUA 2R3HA 5LWNA 3BBTB 4M14A 4RQVA 5AV3A 4WNOA 3HRFA 4DH1A 2VTAA 4EWQA 4I6HA 4IB1A 2CDZA 2JBPA 2VO3A 5E90A 3UNZA 1OUYA 2X8DA 4RC4A 2H9VA 4IANA 2YAKA 2QC6A 4TWNA 3N4VA 3FXWA 1T46A 3TXOA 2PPQA 4QTDA 2W0JA 4DG0E 2VZ6A 3I6UA 4PV0A 4I6QA 1OKYA 4XP0A 3QD0A 3F3UA 1YHVA 4K1BA 3OMVA 4MBIA 4QP7A 3ITZA 3QTSA 4LMNA 4IM2A 5AV1A 3W10A 4BTMA 5FP5A 3R7EA 1ZAOA 2C69A 3POZA 4BICA 4EOIA 2YJSA 2IW9A 1YHSA 3FKNA 3NAYA 3PA4A 2UZDA 2RFNA 4ARKA 3K3JA 4FUYA 4NFNA 4WIHA 3PY1A 5EHLA 3PWYA 3V6SA 3L1SA 3OF0A 4DLJA 4GU6A 4YMJA 3H30A 4D2VA 5J9YA 4ENXA 3MH2A 4YPSA 3RPVA 3VUDA 3SG8A 5IQDA 4IWOA 3UIBA 1S9IA 3GI3A 5FDPA 2W1GA 5IDPA 5CASA 1PXJA 3E62A 4NIFA 4QYGA 4ZSEA 3I5NA 2R7BA 2VTJA 5J1VA 2ZYBA 3BHYA 4CFMA 5FDXA 2R3OA 5CQUA 2WTWA 3VF9A 1R39A 3MH3A 4TYGA 1FVRA 3MI9A 4AOTA 4UMUA 4F0FA 4F9BA 4TYIA 5DH3A 1H1WA 2JIUA 2XMYA 4UMRA 2XS0A 3Q5ZA 4C4EA 3TNIA 4CCBA 1NW1A 1IR3A 3KRJA 4G16A 2VNYA 4F0GA 5IUHA 3LLTA 3DU8A 3MPAA 4RX7A 5J5TA 3QFVA 4CKRA 4DT8A 4RIWB 3ORTA 4USFA 3ELJA 1YDRE 4RWJA 5LVMA 3H3CA 2O2UA 4XP2A 4UMTA 5A3XA 3GENA 2JKOA 2R3LA 4WNPA 1XWSA 4BDEA 5AA8A 4CZYB 5KMLA 4FV8A 3U54A 2YZLA 2GTNA 3GC0A 4YJTA 4L68A 4FNXA 1YI4A 2ETKA 3SXSA 1IEPA 3DTCA 3U8WA 5ITAA 3IDPA 2ITXA 2QKWB 3KU2A 4GL9A 4MBLA 3R8MA 4DEAA 2WTKC 5E91A 5HEZA 4R3PA 5DLSA 5J87A 2FUMA 3R7VA 4APCA 4BIDA 2ITTA 3R0TA 4O7RA 1OPJA 1ZRZA 4Y5QA 5CU6A 1PXKA 3DK6A 5F20A 3RNIA 1ZXEA 2F57A 3COKA 3I60A 4QMXA 5B2MA 4QMSA 4K6ZA 4EONA 2J51A 2C30A 3QHRA 4XNEA 2PY3A 4FT7A 3ZO4A 2BFXA 2CKOA 2RG6A 3Q96A 5CAUA 1PY5A 4Q2AA 5H2UA 1LEWA 4O0UA 4AQCA 3V5JA 2PZPA 3FQSA 3R2YA 3PSDA 2BIKB 2ETMA 3HKOA 4EOQA 4TL0A 4FTLA 2B9FA 3IDCA 4LI5A 3OT3A 2BPMA 4C61A 4DBXA 3FZ1A 4XYFA 2OJIA 3I0OA 4I0TA 3CSVA 3UG1A 5L4QA 4IWPA 3GC8A 4ZZMA 4A9RA 5GZAA 1J7IA 4ZLZA 4MK0A 4OAVB 2XYNA 4A07A 1PXLA 2OW3A 5E8WA 2ZDTA 4R6VA 4PMTA 2IW8A 1OKZA 4FYNA 4R1YA 3DDQA 3MYGA 4GYGA 4OT5A 4V0GB 2KTYA 2VWYA 1ZYCA 1JOWB 4RIXA 2ETRA 2ITNA 5LWMA 4J98A 3IQ7A 3JPVA 3LCDA 4FSQA 4I1ZA 4ZP5A 3RHKA 2XK7A 3P9JA 4KNBA 3GCPA 3BWFA 2G01A 3ZFMA 5IQGA 3DCVA 3QQKA 4MXYA 1ZZLA 4CG8A 3D4QA 2WMTA 4CFUA 4FEWA 4CFWA 2OJFE 1REJA 4L43A 3CQEA 3PXQA 2PVKA 5HO7A 4FEVA 1AQ1A 1CM8A 2VO0A 1OIQA 2YA9A 2UW4A 2YCQA 3DJ7A 3QBNA 1GY3A 4O7WA 2IVUA 3Q4UA 3QKKA 4PPBA 5EH0A 1V0PA 3BU5A 1AD5A 3WZDA 3OUKA 3EQFA 4PF4A 2EB2A 2IZSA 2QO2A 4ZY5A 1E1VA 5AX9A 3VO3A 4ASXA 4F6WA 2O5KA 3AMBA 3UIMA 5HI2A 3G6HA 3K54A 4J96A 4MWIA 4YBJA 3V8TA 3QX4A 3VN9A 3W2RA 3ZONA 2XVDA 3IW8A 3VBYA 3BQCA 5K5NA 4LGGA 5CU4A 3Q52A 2I0HA 3MB7A 4WUNA 2GQGA 5FM2A 3VNTA 5HGIA 5ANJA 2BUJA 1UU3A 2X9EA 4V05A 4H58A 1YWNA 2JIVA 4NM5A 1OPKA 4PMMA 4Y83A 3WOWA 3OC1A 3KRWA 3MA3A 3F2AA 2OJJA 5L2SA 4QTCA 3CKWA 1IASA 2W7XA 3G33A 4AF3A 3DB6A 5FM3A 4ACDA 4I21A 2R3MA 5B2KA 4FE2A 5HG5A 3UQFA 3DY7A 4YLJA 3Q6WA 5AUTA 3ACKA 3LMGA 5A4TA 2F49A 2ITWA 2Y6MA 5KMKA 1SNUA 5GHVA 3RAHA 1ZY5A 3LJ0A 4BWKA 4BDJA 3FMLA 3HDNA 4HPUE 4BDIA 1KUTA 2CN5A 4AN9A 3KA0A 3UZPA 4I5PA 4KINA 4LV8A 3DOGA 3KVWA 5M08A 3TWJA 3O8UA 5CT0A 4QTBA 3HLLA 5AV0A 1ERKA 3DLSA 4FKQA 2YCFA 3NR9A 2WMXA 4FC0A 5FQDC 3QAME 3HECA 3E8EA 2B55A 1ZLTA 2XYUA 2REIA 5DWRA 1OIUA 3DZOA 3LFBA 3RPYA 3EL7A 3JYAA 3WIKA 2RFEA 4FBXA 4M97A 2A27A 3QZIA 2WKMA 3KB7A 4KIQA 4ZTQA 4MH7A 4MYGA 5AEPA 3GQLA 1YW2A 2XK4A 4JNWA 2R3GA 3JY0A 2ITUA 4O83A 4X2KA 3PG1A 2VWWA 4E4MA 2W5AA 3BEAA 2OFUA 2WTIA 3Q32A 3FKLA 2ZJWA 1W0XC 4KSQA 3THBA 4C4FA 4G3EA 3KMWA 3MJ1A 3FMMA 4YSJA 4DFXE 3QKMA 2LGCA 3CGOA 3HV7A 4FI1A 4JS8A 5ETAA 3LIJA 1Q4LA 3JVRA 3VRZA 4CZTA 5TT7A 4ITIA 5I9YA 2ZV8A 4MCVA 3I0QA 3PSCA 3F3ZA 4BBFA 3D5WA 4L67A 4FKWA 2WMQA 5K0XA 3MIAA 3MDYA 3RKBA 3ZRLA 4QP8A 4CMOA 3UPZA 4X3JA 3BRBA 2OXYA 3MN3A 3BU3A 3R8LA 4F1TA 4QNAA 1PKGA 3EQHA 4FTKA 5D12A 2VO7A 3KK8A 5F95A 5CAOA 2UW0A 2QU5A 5LVLA 4NK9A 4RSSA 4IBMA 5HLWA 4U40A 3ATSA 3R2BA 3ZSIA 4E4XA 4R5YA 3FV8A 4DEGA 4BCMA 3FI8A 4K2RA 4U0IA 2VTOA 4BZNA 4DBNA 4W9XA 4IAKA 4CKIA 3PE2A 2WMBA 1J1BA 3PVGA 2WMUA 1YDTE 3DJ5A 5EM6A 3PJ2A 1W8CA 3PUPA 3DKGA 4PDOA 3R7IA 4RJ7A 2ERKA 1J1CA 4M0ZA 2IZRA 4QTAA 3U4WA 4HVIA 4EQUA 3PIXA 1ND4A 4OGRA 4WHZA 3C50A 4FSWA 3WYXA 2WTDA 2BAQA 5FRIA 1PMNA 4C2VA 4CLJA 1XH9A 1Q41A 4YSMA 4YC8A 1VYZA 4CSVA 3CKXA 3HYHA 4QO9A 2R0UA 2VO6A 3Q6UA 4A7CA 3NUYA 4LRJA 2VNWA 2YLEA 3H0ZA 3QLFA 3LVPA 4BDKA 4O7TA 1TQPA 2ESMA 2NRUA 3QTZA 5CNNA 3BE9A 4ERKA 2VD5A 4FA2A 4CV9A 3AC5A 3QYZA 5KKRB 2XIYA 1XO2B 3Q2JA 1U4DA 2G1TA 2PHKA 3MY0A 4PTGA 5DVRA 5JRSA 3KMUA 3LJ1A 5DE2A 4J1RA 4G17A 4ZSGA 2QLQA 3ZUTA 4IX6A 5HG9A 4O84A 2BZJA 3CCNA 3DBQA 5HE3A 2WZJA 3R1YA 3ZCLA 2ZV9A 2BFYA 3PSBA 1QPJA 2OIBA 3EQDA 2NP8A 3NNWA 3PA5A 5AIRA 3FMJA 5DRDA 2UZUE 3EMGA 3LXPA 3P5KA 5A6OA 4DGNA 5IEXA 5BMSA 5HU3A 5KHXA 5ACKA 5FEQA 5EW3A 4NTTA 5HCXA 4C62A 3BLRA 4I6BA 1BX6A 5T3QA 2Z7RA 4XHKB 4IDTA 5E1EA 2R3NA 4W4YA 3F5UA 5FP6A 2XA4A 2UUEA 4ZTLA 3V3VA 5AP2A 3TG1A 1PRYA 3QU0A 1H1SA 4RLKA 5M56A 2WIHA 5EOBA 3NLBA 3TUCA 5CU2A 3CD8A 2C6LA 4D0WA 4BBMA 2WIPA 3LCOA 3IONA 3GP0A 4A9YA 3DB8A 4ANNA 4BCGA 1NVSA 5HD4A 3TIYA 2P3GX 2XIZA 4RG0A 4L9IA 2C1AA 5L2TA 3HMOA 2FSMX 4FTIA 3JS2A 2YLFA 5AP5A 3ZZWA 5I9VA 4PQNA 2UV2A 4BCQA 4UZDA 3CS9A 4CCUA 3N9XA 1OBGA 5AV4A 4O7VA 4E3CA 2GMXA 5H3QA 5AUUA 3NMUF 2HXLA 3KRLA 3EKKA 3BGZA 4ACHA 4KIKA 3R9DA 1VYWA 3ZBXA 5JSMA 1V1KA 2QODA 4BN1A 4IX3A 5CU3A 4O2ZA 5J1WA 5E8UA 1TKIA 2C0IA 2DYLA 1Q8WA 3W8LA 3ZZEA 1R78A 4H05A 4O7YA 3FC2A 3Q2MA 2BZIB 3C51A 4XRJA 4XV3A 4EH2A 3TKHA 5HVKA 5AM7A 1FVVA 4LGHA 2JDSA 2P2HA 4O0WA 5DG5A 3QC9A 4II5A 4ANQA 4F6UA 4JR3A 4D5HA 2WU6A 5C9CA 4N6ZA 2G2HA 4OAUC 3OUNB 3BYSA 2I0EA 4DFLA 3DNEA 2WXVA 4GS6A 4XG9A 3QZFA 3R8ZA 3ULZA 4ENYA 4EEVA 4QMVA 2J5EA 4ZXTA 2QO7A 4DYMA 2BR1A 3QD2B 2QNJA 5HIEA 3OT8A 3FL4A 3ZU7A 4FYOA 5LVPA 1UNLA 4JG6A 1RJBA 5ANIA 5CSVA 2OJGA 1OIYA 5AP0A 3QCQA 2IZTA 5L6WL 3V6RA 5DEWA 2VGOA 3SA0A 4QQ5A 5CI6A 4XG4A 3VS6A 4I92A 4EOOA 3OXZA 1JKLA 4FUXA 2J0MB 3E8CA 3AC2A 3N4TA 2GNIA 3C0HA 1KSWA 3G51A 3LCKA 5FXRA 1WMKA 2J6MA 4D0XA 4DH7A 4IJPA 3IGOA 2ZDUA 3ZUVA 4CV8A 2R3RA 4ZK5A 4JIKA 4PNKA 4DA5A 1FMKA 3I6WA 3VULA 4GK4A 2YWPA 1IAHA 5L6PA 2VN9A 2QCSA 4GT4A 3AT2A 4IFGA 4U7ZA 4MD9E 3R73A 4G9CA 4AT5A 4MF0A 4IVDA 1KWPA 3Q9XA 4BC6A 4FSMA 5DGZA 5DNRA 4QMNA 3EHAA 3TCPA 2PZYA 5FD2A 2VWIA 3FSKA 1JSVA 2C3LA 2YIYA 5M53A 3CP9A 4U80A 4B8LA 3LFQA 3QTUA 3CR0A 4D58A 4FV4A 4C36A 3FLQA 3RJCA 3TI1A 4FTMA 4EJNA 4DGMA 2OJ9A 1OECA 3MFUA 1MRYA 4LL0A 3VBXA 2YEXA 5IMXA 1IA8A 1OGUA 2Z7SA 4ORKA 2A19B 1YRPA 3M2WA 4NCTC 2DS1A 5GJDA 5EQEA 3QZHA 4GIIA 3I1AA 2IO6A 2WMSA 3FZTA 3P7AA 4TYHB 3FWQA 5TO8A 4Z9LA 4A9SA 4RIOA 4X7QA 1H0VA 2NPQA 2QLUA 3ROYA 2XP2A 3AMYA 4F08A 4WG3A 2BALA 1IAJA 2IVTA 4C0TA 4MWHA 2GS7A 4OBOA 4BTJA 1F0QA 2UW8A 3DFCB 5FXQA 4YNOA 3FI3A 3R8PA 5G1XA 2X2KA 1YDSE 2ITPA 3IOKA 3R9HA 4YLLA 5A14A 5H8BA 4N4SA 4IM3A 2BKZA 1ZMVA 4NW6A 4IW0A 4OTDA 3U51A 4YUQA 4D28A 4O7NA 4GUEA 3DBEA 1H01A 2C68A 4RA4A 4WNKA 3NVMB 5CVHA 2CNQA 4LG4A 3F66A 5KMOA 4ASDA 3MH0A 4FZFB 4JRNA 3CY2A 4LMUA 2VX1A 1XR1A 2B4SB 2XNNA 2BTRA 2XNGA 4DAWA 3HV5A 4XG7A 5AM6A 5A4QA 4RJ8A 4ZY6A 3UVRA 2G2FA 3QQUA 4MAOA 2HELA 2YHVA 2CMWA 4C3RA 3MH1A 3FHIA 4NW5A 4P90A 1R1WA 1G5SA 3OWLA 3GGFA 5CEOA 1RE8A 2RKUA 3B8RA 4JX3A 2P55A 3FPMA 4N70A 5GJFA 4NZWB 5L6OA 4O7LA 1HCLA 4ANBA 4IQ6A 4I41A 3VUIA 5IA0A 3ERKA 4KSPA 1JPAA 2XK9A 3A8WA 5AAGA 4M13A 4HZSA 5CSPA 4HGEA 4M69B 2B9HA 2X39A 4CTCA 5B7VA 2XZSA 5D41A 3ENMA 4FZAB 4ZLYA 4W4XA 1GNGA 1IG1A 4FG9A 4CYIA 3R63A 3BHUA 4EZ7A 2C3KA 3FHRA 3QRTA 3LJ2A 3A4OX 3ACJA 4BTKA 1MQBA 2CN8A 3P86A 3D7TA 2VTLA 3VF8A 3QX2A 3UC3A 5EKOA 2ITYA 3QCXA 4WOVA 3G15A 3E7OA 4BCNA 2EUFB 3TIZA 2GFCA 3HP5A 4L46A 4OLIA 3UZTA 4EOJA 2R3PA 3PZHA 4YBKA 1PKDA 3TEIA 4FZ6A 3FE3A 1JQHA 4IXPA 3FPQA 3EN9A 4F4PA 4B8MA 3BE2A 3A62A 3MY5A 4QYHA 4C3PA 5HVYA 4O86A 4O81A 3COHA 3HMMA 5HBEA 4N0SA 5CEIA 3V5TA 4DTBA 3LM0A 3F2NA 4EORA 2PE0A 3NEWA 3R00A 4IAIA 4LYNA 3O7LB 4MHAA 5KHWA 1H26A 5M4FA 3GT8A 3R04A 4U44A 3CTQA 5EI6A 1Q8YA 5DHJA 5JZNA 4X2GA 3OOMA 3UMXA 4ZY4A 5EFQA 1G8AA 5GINE 4O0SA 1SM2A 3IKAA 3M42A 1U54A 2O0UA 4W8DA 2JEDA 3AT4A 5AUZA 4AT4A 3S1HA 2B9IA 3VJOA 1H24A 2QG5A 2CNVA 3RTPA 3AQVA 3MJ2A 4S34A 3BYOA 2WMVA 3NAXA 4PWNA 3ZXTA 5M4IA 4DG2E 3W2SA 4PDPA 3L8XA 3NIEA 5IUIA 3R9RA 2BRMA 3FLYA 3Q9ZA 2V7AA 4OTQA 3PVWA 5HG8A 3F2RA 3O71A 3ZSGA 2XBJA 1E1XA 4O7ZA 1CKPA 2BDFA 4YJSA 5JGDA 3UP7A 4YURA 3BLQA 5AUVA 1XH4A 2C6KA 2FA2A 4BCPA 4OT6A 3IECA 2YM4A 3PE1A 2QU6A 3GC9A 3KC3A 1P5EA 3SX9A 2R0IA 2VX0A 3FC1X 4G3DA 5CQWA 1XJDA 3KXXA 2C0TA 3TV7A 3BI6A 1L3RE 4F6SA 3ZO1A 2GQRA 5ANGA 2E9PA 2BROA 1PJKA 3QLGA 3FLNC 5DR6A 4JIAA 4DN5A 3R71A 2XJ2A 2XNOA 3MW1A 4GCJA 4UMQA 4XCUA 2O63A 3FLSA 4IH8A 1ZYLA 4M8TA 3IOPA 2UVZA 3K5UA 3PXYA 4O6EA 4YC3A 4YTHA 4YJVA 1BYGA 3ANQA 1LP4A 3R83A 2YZAA 2X7OA 4A4LA 3BX5A 2W1ZA 2V22A 3ZMMA 4BI0A 3ORMA 3C1XA 3BHVA 3PP1A 4DEIA 5IQFA 1WBTA 3VS0A 4OUCA 5JN2A 4IACA 3G0EA 5LMKC 1UU7A 4G5PA 2CCIA 4K18A 3U6JA 4TWCA 2J0LA 3EQIA 5DOSA 4BGHA 4UZHA 3R8VA 4K8AA 4A9UA 1H1QA 5LMBA 2BRNA 3TDWA 1O6KA 3D9VA 2IN6A 1YHWA 4RVLA 3L8SA 3UE4A 4QD6A 2YN8A 3ULIA 5CEMA 4PPAA 2XIKA 3PVBA 4EHZA 4RWKA 2WTCA 1M14A 2AC3A 2HWOA 4CXAA 4Y5HA 2JFMA 3ZYAA 3HVCA 3LFEA 5CXZA 2J0JA 4FGBA 1WVXA 4HCVA 1H8FA 4JRVA 5CANA 3PA3A 2XNPA 4R78A 4QMOA 4TY1A 4AN3A 2UW6A 2J0KA 3NNXA 3WF6A 3JUHA 5BPYA 1ZOHA 2EU9A 2UW7A 3HUCA 3KULA 3OG7A 4JT3A 5DA3A 3ALNA 2VU3A 3RAIA 3KREA 4KAOA 4FSRA 2GNLA 2VWXA 4C59A 5HX8A 5IEYA 4AA0A 5JFWA 4FNWA 4MNFA 4FNZA 4ID7A 3ZLSA 4D4YA 3ZO2A 2XK8A 3QTRA 2UVYA 1UA2A 2C1BA 5LJJA 3ZTXA 4OTWA 2Q0NA 3AD5A 3LAUA 3FXZA 4D2TA 5BUJA 4R3CA 4WD5A 2YCSA 5HX6A 4RX5A 4N57A 3S2PA 5ANEA 3OEFX 1UWJA 4IB5A 3DGKA 3SAYA 3A99A 1ZARA 2WPAA 2VAGA 5H9BA 3P08A 2XKDA 3QKLA 2C3JA 4MNEA 4K11A 2W4OA 4C33A 1PXIA 1XKKA 3UOHA 2WQNA 2GS2A 3ORLA 4PL4A 2JDVA 5E8ZA 3W2CA 1MUOA 4MTAA 2A0CX 4WG4A 2AC5A 4AS0A 5CENA 3PDTA 3V5WA 2JAVA 1CDKA 4NJDA 3ZOSA 3EZVA 3EQGA 1CKIA 4CQGA 3KL8A 2Z02A 4U43A 2HW7A 4X3FC 2VTPA 1BLXA 5FGKA 3PP0A 4WO5A 5C4LA 3NGAA 3KXNA 5HOAA 2QOKA 5HIBA 4I22A 3LQ8A 4AU8A 4USEA 5EI8A 2OXDA 3NPCA 4IVBA 4O0VA 3KK9A 4TTHB 4L44A 3R28A 4BI1A 4QQTA 2JKKA 2XIXA 2FVDA 1H1PA 2FO0A 4O1PA 1MRUA 2OK1A 5I9WA 2UZEA 1QCFA 3BYUA 3OXIA 2GS6A 5KCVA 1NXKA 3C4FA 4I6FA 2UZTA 3COMA 5I0BA 4ZSAA 3C5IA 3UTOA 2JGZA 2CLXA 2VWUA 5HESA 2OG8A 5CEPA 5J9ZA 5LVNA 4E73A 4XG8A 1J91A 3PVUA 3EKNA 4B0GA 3G0FA 4PMPA 3ZFXA 1Z57A 1Q3WA 3HRBA 2F7EE 1W83A 3EQCA 3GXLA 2R4BA 1PF8A 1M17A 2BILB 3C5UA 4QQCA 2XNMA 3RPSA 4FKOA 2BDJA 4BKYA 5LQFA 2QONA 2YDIA 2QOQA 3RZFA 2H8HA 2VTRA 3QL8A 4PNIA 4U97A 2IG7A 3T9IA 4BL1A 4UV0A 5TE0A 3WBLA 1M2PA 4I5MA 3OHTA 4AW2A 2ONLA 3CPCA 3F5XA 3SC1A 3UGCA 4JJRA 3TV6A 4PTCA 4XJ0A 1ZY4A 3V51A 4FZDB 5JT2A 2GHMA 4C4IA 1ZZ2A 5KZ0A 4D2WA 3BKBA 4PMSA 4I93A 3QA8A 2YISA 2OZAA 3P79A 3OCBA 2P0CA 2NO3A 4EHEA 4UYAA 3D83A 3T3UA 1PXNA 1XH8A 1ATPE 5EHOA 5JGAA 1XQZA 1OB3A 3PLAE 2WEVA 4J99A 2XNBA 5DR9A 5J79A 3RBWA 4P4CA 4ASEA 2X4ZA 4FGRA 3B2TA 4I94A 4FG7A 4GG7A 1JSTA 2H34A 2GTMA 3PJ3A 3OY1A 3F82A 4FIGA 4W4VA 3E63A 5HIDA 1O6LA 4BY9E 3GOKA 4APPA 4FZ7A 2OF4A 5HCZA 2GNJA 2CNUA 4DH3A 3FZSA 3P7BA 4RIXB 5DI1A 3BCEA 3RP9A 3NYVA 4IC8A 3EYHA 4TWPA 4Y72A 4DEHA 1BL7A 4F7JA 3PZEA 3RM7A 2J0IA 1WZYA 5I9ZA 4FTJA 2UZOA 4MVFA 2WFYA 4H1MA 3R7UA 4BVUA 5HG7A 4JQ7A 2W9ZB 1JKTA 2R3IA 1KOAA 2HWPA 3FZPA 3R9OA 3SDJA 4U6RA 5JGBA 4F63A 3QRIA 4J52A 3Q4ZA 4ONAA 2ZVAA 4D1SA 5L8LA 2XEYA 3W8QA 1GZNA 3HV4A 3QQJA 5JFXA 4M12A 3FZRA 4O0XA 1W84A 4XG2A 4FL3A 1OI9A 4I0SA 4EOMA 3E8NA 3OBGA 3F5GA 1ZMUA 3R22A 5HZNA 3FAAA 4AE6A 4JVGA 3FKOA 3P4KA 1PW2A 2E9NA 4WSYA 2OIDA 4QRCA 3OW3A 3H4JA 5HCYA 3D5XA 1H4LA 1UVRA 2Y4IC 4R7IA 2QOHA 5KNJA 4ZSLA 1KE6A 3BWJA 4RQKA 4F9YA 2H96A 3W18A 4F9AA 4QTEA 3TTJA 4I5HA 4C4HA 1U59A 1PXMA 5CEKA 4YNEA 3UYSA 1WVWA 4U8ZA 5AP6A 1SZMA 1OMWA 4O0YA 4GT5A 4TWOA 5KMNA 4IX5A 5FLFA 4CRSA 1XH7A 3RCDA 3UPXA 2QR8A 3DK7A 4AW5A 3BBWA 3ENHA 2FSLX 2XNEA 3RALA 2W1DA 2PK9A 2W4JA 4XOZA 5HTCA 4EH9A 3S3IA 2YWVA 5AP1A 5AR2A 3CIKA 4FV5A 4D2SA 3G6GA 5LARA 2GQSA 2IZUA 2QQ7A 4O22A 1J7LA 2R64A 4YO4A 4FNYA 4IB0A 4K0YA 5KX8A 4HGSA 4LOPA 4HZRA 4DFUA 2W17A 4FVPA 1PYXA 2ZV7A 4J95A 1DAYA 4H39A 2FSTX 3F88A 3TZMA 3ZC5A 4CMUA 4JAIA 4EZ5A 4YTFA 5GIPE 5DT4A 3HNGA 3LHJA 4HYSA 3OWJA 3ID6C 4IZYA 4JAJA 2YITA 5JFVA 4NYEA 3BZ3A 5IA2A 4RVKA 1OUKA 3NUNA 2J4ZA 1RQQA 3LFSA 3P23A 2HAKA 4CLIA 1Y57A 4UXQA 4CYJA 4BKJA 2HW6A 2C3IB 4FV3A 4IZ5A 3GOPA 2OU7A 3UDBA 5KMIA 5BYYA 5EQYA 5CVGA 4M7IA 3NZ0A 4NT4A 2OH0E 4CRLA 3W16A 4XG3A 2J50A 1R0PA 5HKMA 4FVRA 4YTCA 4FEUA 2WQMA 1TQMA 4D2PA 3ORNA 2WEIA 4UX9A 3RZBA 3IG7A 5HO8A 3RK5A 4YP8A 1LPUA 5TKDA 4M67A 3MVMA 3T3VA 3WZKA 1WBWA 3E3BX 2YAAA 3CBLA 3TUDA 4J53A 1OIRA 2HZNA 2X2LA 3VW6A 2W06A 3LFFA 1NA7A 5HE2A 1H27A 4MXOA 4L45A 5A4LA 4TXCA 5JEBA 3NW5A 3NUXA 1VZOA 3FLWA 4JR7A 4WRGA 4R77A 3LW0A 2QOBA 4E20A 4DLIA 5JH6A 4RT7A 2IW6A 1YXTA 1ZWSA 3FMKA 4HNIA 3NX8A 5E9EA 4CEGA 1YOMA 4JDKA 5ANKA 4DC2A 4IAAA 1HCKA 2PMLX 2QG7A 1UNGA 3MTFA 3VQUA 3LXLA 4OTRA 3JY9A 2ERZE 4ZIMA 3DXPA 2R5TA 4Q5HA 4YO6A 2QI8A 5EW8A 4I0RA 4HVDA 4L52A 3VBVA 2YABA 3QTIA 5AV2A 5CSHA 3BGQA 4BI2A 5KO1A 3C4ZA 3R02A 2F9GA 4EL9A 1URWA 3P0MA 3MWUA 5C8KA 3H9OA 1FGKA 1ZOGA 3CXWA 5CWZA 4QMUA 5DT3A 2YIRA 3SHEA 4C4JA 4F65A 5IA1A 5E4HA 4TN6A 1PXPA 4U9AA 4NKAA 3PLSA 1G8SA 4GEOA 2ITQA 3Q60A 3CTJA 2Z7LA 4O91A 5CF5A 3ZO3A 4GVJA 3EQRA 3ORZA 5A6NA 3WIGA 1ZMWA 3EOCA 3NW7A 5GZ8A 4XP3A 4IWDA 4HVGA 4QMZA 4GRBA 4M3QA 4FF8A 5EYDA 3UO5A 4OTGA 2P2IA 4FIHA 1K2PA 4B4LA 5IQHA 3C0GA 4EBVA 4V01A 4DE4A 3KRXA 4BWXA 3U6IA 4FTTA 5CS6A 5DBXA 5EW9A 5LMAA 5AP4A 5IA5A 1IA9A 3EH9A 2GNFA 4G5JA 3PJCA 4QP4A 3UG2A 1F5QA 4FL1A 2HCKA 3DBDA 2F4JA 2JFLA 5L3AA 3KGAA 4CKJA 4B9DA 3WF9A 4S33A 4JG8A 4KWPA 4E5WA 5BVFA 4RGJA 4D2RA 4OBPA 4EYMA 5HNIX 3GFEA 4EQMA 1PMVA 4XG6A 5T6KA 5LCKA 3AOXA 3F6XA 5HBJA 5KMMA 2VTNA 4JBOA 3OY3A 4DFBA 3FJQE 4X2JA 1XH5A 5I3RA 4FKJA 5DYJA 4DTKA 4QYEA 4MXAA 3DKCA 4W8EA 2ONLC 2YM7A 3FY2A 4CT2A 1LUFA 4RZWA 4ZSJA 3KEXA 1XH6A 4MQ1A 4C4GA 3R7OA 3CEKA 3IO7A 2UVXA 3QQLA 4FV7A 5IQIA 4LUEA 3NRMA 1Q24A 3NSZA 4C02A 2EWAA 2JAMA 2XEZA 2OXXA 3GBZA 3M11A 4FEQA 4RBLA 5CVFA 5DIAA 3ORKA 4X21A 3TUBA 3RHXA 5KZIA 4L7SA 2UW3A 3ZRKA 2IVVA 4FTUA 4D4VA 1B38A 1YXSA 2ZM3A 1ZOEA 3ORIA 4AT3A 1YWVA 4BYIA 4GW8A 4BTFA 2QKRA 4IWQA 5DRBA 3C4CA 4ZS4A 2ZMCA 4HNFA 4L3JA 5FXSA 4EHVA 5A4EA 5M09A 3AD4A 5A9UA 2O8YA 3KXGA 3GQIA 3SLSA 4EWHA 1NT2A 5K3YA 3LFNA 4S31A 5BVEA 3U9NA 2WELA 2X6EA 5CF6A 3FDNA 5AA9A 4KIKB 5I9UA 2PE1A 2DUVA 4OR5A 4FICA 4FTRA 5AAFA 1REKA 3E5AA 5HD7A 4U81A 3KRRA 3QA0A 4RJ5A 1R3CA 4OBQA 3MPMA 2P4IA 3EZRA 2WTVA 3SVVA 4PDYA 4NH1A 4FTAA 4RPVA 5ANDA 4A4XA 2C6OA 2RF9A 3A61A 4M0YA 4KUJA 4O82A 5AMNA 4C34A 4FV6A 4EI4A 2PVHA 1JAMA 3FI4A 1LR4A 2PVRA 3RK9A 5FEEA 5M55A 5CALA 2G15A 4FKLA 3UIUA 4E5BA 4DF3A 5JFSA 3ZC6A 5CT7A 4EK4A 1SYKA 3OVVA 4I24A 4YHJA 2C5YA 3GU8A 2J7TA 3E8DA 3H10A 3ORPA 3Q53A 3PXKA 2O3PA 5FTOA 3NIZA 2UW5A 3CY3A 4XUFA 3GB2A 2J90A 1CTPE 4KIOA 4R3RA 4KS8A 3NUAA 2I6LA 3CE3A 3F3VA 4JL9A 4AX8A 4ZOGA 4C58A 2W4KA 4U5JA 4V04A 4ALWA 2W1EA 4DH8A 3SG9A 4DITA 3CD3A 4TKSA 4MXXA 3S95A 5BVNA 3V5PA 2CKPA 2R3QA 5CU0A 1L8TA 1VJYA 3QC4A 4H3BA 2QOOA 3W2PA 2C6EA 3TJDA 2QOFA 4XEYA 4U3YA 3EB0A 2EXCX 3CC6A 1UU9A 2HXQA 4F1MA 3NDMA 2CLQA 2OO8X 4B7TA 4KBKA 4BCHA 3GU7A 4PP9A 5FWKK 3KMMA 3VAPA 2OFVA 3ZLXA 3DT1A 4D9UA 4Z55A 5IISA 5M07A 4QMLA 1FINA 2ZB1A 2WHBA 2VV9A 4O6LA 2JBOA 4NM0A 5M44A 3HAVA 3OCGA 5ACBC 1JKSA 4JDIA 3SXFA 5BX0A 4F99A 2Y8OA 4DEEA 1M7NA 3LXNA 3U9CA 4TW9A 3DPKA 2B53A 3EL8A 2X1NA 1OITA 1SVGA 5B2LA 4DEDA 1FMOE 3UQGA 2W1FA 5C27A 3DK3A 1XBBA 3N51A 4O27B 4RZVA 2JDRA 4ZTSA 3R30A 4PRJA 3KY2A 5EYKA 4BGGA 2BTSA 2R3FA 3DNDA 3LMIA 3UZRA 4H3PA 5E8SA 4P5QA 5D7VA 3QQGA 4BWPA 1DS5A 4K77A 4X3FB 3HUBA 2JIIA 4DGGA 3GVUA 4ACGA 3PRFA 5CNOA 3MBLA 3ZS5A 2VTQA 4G6OA 4XV9A 4X2NA 1YI6A 4KRCA 1CKJA 5TF9A 5LXMA 2IPXA 4IX4A 4QP1A 3W1FA 4BBEA 5BVDA 3FQEA 4MXCA 2UW9A 4UALA 4CFVA 4KA3A 5ICPA 4YZ9A 5JQ5A 2OSCA 4ANSA 2VX3A 5A4CA 3DJ6A 5D11A 1GIHA 4UB7A 3QTQA 2EVAA 2QURA 2UZNA 4PUZA 4ZS0A 3EJ1A 4RFZA 4MBJA 3RMFA 3K5VA 3I5ZA 3LPBA 4L3PA 4DINA 2JITA 4G9RA 1JSUA 2XM9A 1H00A 5CZIA 3NUPA 5DT0A 4ALVA 2DQ7X 3QHWA 2QO9A 4FKIA 5IH5A 4HJOA 2GCDA 2PZIA 4EH8A 1VR2A 3IW6A 4QYFA 4PX6A 4DTAA 1YXVA 4AP7A 4NKSA 2GFSA 2XUUA 4QPAA 4ITJA 5HNGA 5CAQA 3H9RA 3BHHA 3UO6A 3E92A 2PYWA 5M06A 3Q4CA 4Q9SA 3PXFA 4QOXA 4F1OA 5T68A 4AZFA 4PL5A 1OKVA 4EOSA 4RIYB 2CPKE 5CTPA 3SOCA 3R1NA 1R0EA 3L8PA 4XV1A 3ZDIA 2XRWA 3EN4A 2PUUA 3KN5A 3D7ZA 1WAKA 4PY1A 2CGXA 3VS7A 4G3GA 3S0OA 2EXEA 3U55A 3A7FA 3ZDUA 4EK8A 5M51A 4WBBB 3SRVA 3K2LA 4G31A 4GJ2A 4PPCA 4CFFA 3Q04A 3PJ1A 4IHPA 1DI8A 4ITHA 3G90X 5KUPA 3NYXA 2FGIA 4IMYA 1M2QA 3D7TB 4QP3A 2E9UA 5AUXA 1OPLA 4LUDA 3GCVA 4WUAA 4AGDA 3W2QA 2XJ0A 1XBCA 2ITVA 3DBFA 5HO6A 2GNHA 4CGAA 2YM6A 3VUKA 2PUIA 5D7AA 4RA5A 3L9LA 2H6DA 1Q5KA 5DEYA 3QUPA 3FMEA 2W5HA 4EH6A 4CT1A 1PYEA 4NTSA 4OTFA 4P7EA 3L8VA 4BCKA 1NVRA 3SXRA 4RC2A 4E6AA 2XJ1A 2XK6A 4FSZA 4BDCA 4EJ7A 3DV3A 4F70A 3I7CA 4ZJJA 1OL5A 5E1SA 3LLAA 4HYIA 4XLIA 3QCYA 3MESA 3RPOA 3REPA 5C8MA 3OROA 4YPDA 1UKIA 1GAGA 3WZJA 1I09A 2FB8A 2RFDA 4IM0A 2HIWA 3PXZA 4B6LA 3QRKA 5JMSA 4ZMFA 3KXZA 3D2KA 4FKUA 1U54B 3DA6A 3V8SA 3RWPA 3IK3A 2XKFA 4Y46A 4WG5A 4U41A 5L2IA 1T45A 2CSNA 2BDWA 3KCKA 3P1AA 4GUBA 4ZLOA 1XHAA 4OTHA 2YERA 4AW1A 3BGPA 4AZSA 4P5ZA 3QRJA 4BDDA 3DS6A 4NUSA 3TJCA 3QGYA 3C7QA 4IAYA 3PXRA 5C8NA 1MQ4A 4RJ4A 3DQXA 2Y4IB 1WFCA 3B8QA 3PY3A 4RFYA 5AAEA 3FMHA 5IA3A 4CQEA 3NNVA 4ZZNA 4QMWA 2I0VA 2R2PA 3O96A 3MSSA 5AADA 2WOUA 1QMZA 5F4NA 1GOLA 1P4OA 3V8WA 4EK3A 2YCRA 2J2IB 4FR4A 3HL7A 4FIEA 4C2WA 3MIYA 3DFAA 2Y9QA 4JQ8A 1YWRA 3R1QA 4KKGA 4C57A 4FL2A 2Z8CA 4FT5A 3PTGA 2PUNA 4U42A 4Z3VA 3O50A 4A4OA 3VHEA 5HBHA 4ZAUA 5L8KA 3KFAA 4XS2A 2PUPA 2VTTA 5D9HA 4RFMA 4WT6A 4EUUA 5EQPA 2W99B 2JKQA 2AYPA 2W1IA 4UBAA 4M84A 3TKUA 3II5A 4BDFA 1Q8UA 2R3KA 2QHNA 2Y0AA 4I5CA 1KE8A 5AR7A 3DLZA 3ZLWA 2BZHB 3VUGA 1OL7A 3VW8A 3ODZX 2JKMA 2OH4A 3SD0A 2ZM4A 2CHLA 4E1ZA 4FG8A 4FIIA 2Q0BA 3C4XA 4QYYA 4R7BA 4FIJA 1KV2A 4LV5A 3OW4A 1Y8YA 4JG7A 4L01A 3COIA 3GU6A 1JWHA 4RC3A 3F3TA 4NJ3A 5KBRA 4EK6A 3AD6A 1A06A 1OZ1A 4X2FA 3TNWA 4A06A 4XH6A 1WCCA 5I3OA 4RRVA 3NVKI 4YZCA 4AACA 4C8BA 1GZKA 2BAJA 3AC4A 3TNHA 3QQFA 2WD1A 2OF2A 4FSNA 5FG8A 4EYJA 1STCE 1Y6BA 4AW0A 4F9CA 5CX9A 4RJ6A 1JVPP 4BZOA 5J5SA 4E6QA 5CI7A 5FEDA 4G3CA 3LOKA 4L53A 3L9NA 4KIPA 4UN0C 3KULB 5GIOE 3PPZA 4YZNA 3BYVA 3ET7A 3QCSA 4CVAA 3EN6A 4FKVA 4EC9A 3WF7A 3OTUA 5CF4A 5K4JA 4NIFB 2HOGA 4M68A 4PDSA 4F7NA 4L7FA 3FQHA 5IMEA 5JKGA 4E26A 2X7FA 1DI9A 3CQUA 3DDPA 2C47A 4NM3A 3BU6A 3DKOA 4O96A 2W96B 2Q83A 2BKKA 3R7GA 4FT0A 4O7SA 3V04A 4RIWA 2V62A 1ZYDA 3F61A 4ACCA 5IU2A 1OKWA 3BELA 4L42A 3FYKX 3HMIA 3O0GA 4BHZA 3TNQB 3BPRA 4U3ZA 2RIOA 3NWWA 2ZB0A 3OWPA 3R8UA 3GCSA 2QR7A 3BEGA 2OBJA 5E8TA 4ACMA 3NCZA 4GIHA 2BIYA 2A1AB 4Q5EA 3MY1A 1S9JA 5EHYA 3WF5A 5IQEA 4OTPA 4BIEA 2XH5A 4MNEB 4DT9A 1WBSA 4GFGA 1V0BA 3Q5IA 2P33A 4O2PA 2X6DA 4O0RA 5J7HA 3AC3A 3MFSA 5C03A 2C6DA 2HY81 3C9WA 4CFXA 2GSFA 4DCEA 3UNKA 4N6YA 2X0GA 1K3AA 5BYZA 5EI2A 3IS5A 4D1XA 5BQ0A 3EFWA 3LFCA 3PFQA 3O8PA 5EYCA 2PMOX 4AXAA 1AGWA 4E7WA 2CGVA 4M66A 2XBAA 4R8QA 2CGWA 3QALE 3IDBA 4LRKA 4YJPA 3EN5A 4RVTA 2BRHA 4LL5A 3L9MA 4AFJA 1FOTA 3C4WA 3ZHPC 1OBDA 4I23A 3LXKA 1BUHA 4TPTA 4EH7A 2W9FB 1MP8A 1RW8A 2W1CA 3AGMA 4JLCA 2C6TA 1ZYJA 5EYMA 4E5AX 4P2KA 4UWBA 3MFTA 5AP3A 3VWAA 1W82A 3HGKA 3HA6A 5IA4A 4DFYA 3CTHA 5J7BA 3OWKA 4B99A 4KKEA 2WTJA 5EDRA 4AGUA 3FBVA 3O17A 4F7SA 2OLCA 4HCUA 3E87A 2Z2WA 4FKPA 1W7HA 3CPBA 4XRLA 4IE9A 4J7BA 4J97A 4LOQA 1FBNA 5K5XA 4X6RA 2ZOQA 3WYYA 2PVFA 1Q3DA 3I81A 4O1OA 2WQOA 3AT3A 2HYYA 3D0EA 3P7CA 4V0GA 2VTHA 4WA9A 3A7JA 3U6HA 5G6VA 1SNXA 2WQBA 2PULA 2YM3A 2XM8A 3D5UA 3MS9A 1SMHA 1Z5MA 3UYTA 4IIRA 4QPSA 1H25A 2YIQA 4BDAA 2XKCA 1YXXA 3ORXA 4HYUA 4JDJA 4YZBA 2C4GA 2F7ZE 2B52A 2PVLA 2X9FA 3O23A 2BRGA 3BLHA 4RWLA 4EKKA 4FK6A 5HU9A 5BUEA 3SQQA 3FL5A 3RINA 1M7QA 2V0DA 3QTXA 5HNBA 5JQ8A 3DXQA 4MF1A 2UZLA 5ETFA 2OZAB 4ZTHA 5BMMA 5HLNA 4BCIA 4XX9A 3FEGA 1GJOA 4FOBA 1P4FA 3ZRMA 3RGFA 3UNJA 4QMTA 4RWIA 3DTWA 5TOZA 3AGLA 3POOA 4LM5A 3ZUUA 5H8EA 3QYWA 3HAMA 4HCTA 4IZAA 3QWKA 3D15A 3I79A 3O2MA 3VS5A 1O6YA 5KBQA 2FH9A 1Z9XA 5H8GA 2VWVA 4AFEA 4AAAA 4BDBA 2VWBA 3ZM4A 2YFXA 3UIXA 4ANLA 4DEBA 4ANMA 2X4FA 2VUWA 5GJGA 2BCJA 4IC7A 5EK7A 3UMWA 4ZTMA 4AZTA 4Y73A 1FPUA 4JX7A 4LFIA 4BDHA 4QMMA 3HV6A 4H1JA 5TR6A 5AFVA 4GJ3A 5IKWA 3HMPA 4G34A 4NFMA 4AGWA 4C3FA 1Q61A 4YLKA 4QT1A 4U79A 2PVMA 4Y85A 5AR3A 3RCJA 3WE4A 4BDGA 1U5QA 4YZMA 4Y95A 2YDKA 5CZHA 1U46A 2YACA 3MA6A 4LQMA 3IW5A 2WMRA 3NNUA 4YJRA 4FOCA 3HZTA 4S32A 4Z7HA 3DKFA 2BHHA 5AR4A 3QXPA 2Y4PA 3VBWA 3R01A 1I44A 3G9NA 2A2AA 3G5DA 4G3FA 3A2CA 5C26A 3A4PA 2GHGA 4K9YA 3UOKA 4C7TA 3GCQA 2JC6A 5K9IA 2F7XE 3SV0A 2ITZA 3KKVA 4FTCA 4L6QA 4BHNA 3RK7A 4I4FA 4HW7A 2XF0A 4QMPA 3TT0A 3NS9A 1W98A 3W55A 4C35A 3FYJX 2C6IA 2PMIA 1P2AA 3EQBA 5AIKA 5LCJA 3U87A 5EM7A 3PPKA 4UY9A 2VRXA 3TKIA 5LOHA 4PP7A 5M4CA 3VHKA 4E4NA 5HQ0A 2B9JA 3JVSA 3MVJA 4QPMA 5HICA 2V5QA 4NWMA 3ZEPA 4RLLA 4BKZA 2GNGA 2ACXA 4FTQA 4E6DA 4EOLA 3O8TA 4MX9A 4IVCA 5E8YA 3A8XA 3TACA 1KE5A 3BHTA 3GU5A 1Q8ZA 3HEGA 4FKRA 5KE0A 5I4NA 4MD7E 4X6QC 3RPRA 5F9EA 4J8MA 3VBTA 2PU8A 2XRUA 3MFRA 4LGDA 3OOGA 3U4UA 1Q97A 3RI1A 1SVHA 4IAZA 1J3HA 2RGPA 1V0OA 3S00A 1WVYA 3H0YA 2WOTA 2OZOA 3FXXA 3PG3A 5K0KA 2W1HA 2YIWA 5E7RA 5HORA 1JBPE 3PWDA 4IDVA 2PVNA 4KB8A 3E93A 4FVQA 3NUSA 3RVGA 3VS2A 2ZV2A 4ASZA 4YC6A 2WMAA 4NSTA 3OP5A 5A46A 1UKHA 1H07A 2JD5A 4NCTA 3KN6A 5E92A 5IEVA 4GK2A 3LZBA 3EN7A 4BB4A 4GKHA 4TZRA 4IEBA 1KE9A 3E64A 4FMQA 3RAWA 1PMUA 4L8MA 4KKHA 2OI4X 4IZ7A 3WZEA 3N4UA 3QQHA 3AG9A 4W9WA 5HLPA 3QXOA 4EH5A 3S4QA 3V5LA 1NVQA 1QPCA 2Y6OA 3BV2A 4JDHA 4UEUA 4WNMA 4MD8E 2O64A 3VJNA 4BCOA 2G9XA 5DPVA 3KQ7A 4W4WA 2CKEA 4EBWA 1GZ8A 2C5NA 3GFWA 2IVSA 3IW7A 2HK5A 3Q3BA 5IDNA 3HP2A 3KXMA 3MVHA 4JXFA 2ZM1A 4AZWA 4G2FA 2PVJA 3KF7A 4HGLA 4TYJA 4D4SA 4FSTA 4AN2A 3D94A 5IH6A 5AUYA 1SVEA 1ZYSA 4TT7A 1WBOA 3OFMA 3WI6A 2YJRA 3CJFA 3ZH8A 3D5VA 3EIDA 3A7GA 3CGFA 3NW6A 2QD9A 4KS7A 4F09A 4YU2A 3UQCA 4BR3A 2DWBA 3HX4A 1KOBA 4D4RA 3WE8A 4F64A 3SKCA 4BZDA 4EZ3A 4CG9A 1PHKA 2A4LA 1RDQE 2HY0A 4UWYA 3EYGA 2WO6A 5F1ZA 5AR8A 4L00A 1A9UA 2IWIA 3ATTA 2GDOA 1U5RA 2EB3A 4XMOA 2BRBA 1BKXA 5IPJA 5BNJA 4ZJIA 3WZUA 1J7UA 5FUTA 2WQEA 4FTNA 2BVAA 2Z60A 2RL5A 1YI3A 2F2UA 5FBNC 4FX3A 5HVJA 2VTIA 3QRUA 3AXWA 3NUUA 4AE9A 5CAVA 1MRVA 1BI7A 3FMDA 5EG3A 3EQPA 4WSQA 3BV3A 4YZDA 4DH5A 3RM6A 3G9LX 5ETCA 1H1RA 3TNPC 4XLVA 5BYLA 3MV5A 4DFNA 5AJQA 1JLUE 3KVXA 4GK3A 4RX9A 1BL6A 4GU9A 3CJGA 4FKGA 5F94A 3F7WA 3GU4A 5AP7A 3F7ZA 2B54A 1JKKA 4HVHA 5ANOA 2R7IA 3OCTA 1EH4A 4XBUA 5EM8A 2CCHA 1OL2A 5IH4A 1FQ1B 3ANRA 3GEQA 4MQ2A 5BUIA 4FV9A 2V55A 3GC7A 1X8BA 4GH2A 2HZ4A 3W32A 4NL0A 3K3IA 2GU8A 2J9MA 2WU7A 4XBRA 4YTIA 4ZZOA 4CZUA 4CFNA 4F9WA 2C0OA 4WRSA 4BF2A 1KE7A 2BMCA 5DMZA 3ODYX 4NEUA 2C6MA 3F5PA 3PYYA 3UP2A 3TDVA 2KULA 1GIIA 5AUWA 5CEQA 4IB3A 3JR1A 1Q8TA 4ZEGA 2HZ0A 4E8AA 3BYMA 1UNHA 4J71A 3ZBFA 3QZGA 2PTKA 4QMYA 3IGGA 3TM0A 4BCFA 5E8VA 3A60A 5J9LA 4ZMEA 2B7AA 2VWZA 4NU1A 2ZAZA 5EDQA 1WBPA 2Y7JA 4FT3A 4GYIA 3VUTA 2UZWE 3HA8A 3WARA 2X8IA 2R3JA 4H36A 4Y8DA 1H08A 4KBCA 3ZM9A 4QP6A 5GZ9A 4E4LA 4UWCA 1Y91A 3VUMA 3EFJA 3LQ5A 3FSFA 4H3QA 3VS1A 5IZFA 4FKSA 5K4IA 2PWLA 3LE6A 4S2ZA 3LMHA 3E88A 4YR8A 3V5QA 3AC1A 3DZQA 2X7GA 3TTIA 1QPDA 2IJMA 2R9SA 2V7OA 1F3MC 5I5ZA 3L9PA 4DHFA 4FTOA 4HGTA 2E9VA 1Y8GA 2UZBA 4JI9A 4MXZA 3ZLYA 2C5OA 3RAKA 4FV2A 3OXTA 3HMNA 4F7LA 5IG1A 3LM5A 1H0WA 4ANOA 4BRXA 4JQEA 4DGLC 4GKIA 4IVAA 4C38A 4DG3E 4AOJA 5CF8A 3PJ8A 3ZEWA 4GG5A 3OEZA 4L3LA 4QP9A 3ZSHA 3F3WA 5HE0A 3C13A 4AA4A 4S30A 3E7VA 1O9UA 2WGJA 4YJUA 4BCJA 5LMKA 4AWIA 3R21A 2VTSA 3EFKA 4R1VA 2Z7QA 2YM8A 4G6NA 4YJOA 3CLYA 1M52A 4YHTA 2XK3A 4QNYA 3QTWA 2CGUA 4TRLA 3Q9WA 5FTQA 4O21A 3ETAA 4F0IA 4D1ZA 4E6CA 4GMYA 3QUEA 1TVOA 5L8JA 4TNBA 3B2WA 1YKRA 4CNHA 2I0YA 5DN3A 2ZMDA 4YJQA 1M2RA 2QVSE 2X81A 2GHLA 4HYHA 3UC4A 3H9FA 3G2FA 4FV1A 1Q99A 3FMNA 4AUAA 3SOAA 2X8EA 4AA5A 5CAPA 1QPEA 5BVKA 4CMTA 5IQBA 2YM5A 1PMEA 4D5KA 3MGYA 4EQCA 5BVOA 5M57A 2B0QA 1P14A 1YOJA 2WAJA 4GV1A 5L2QA 3I4BA 2VTMA 5IQCA 4FIFA 4ZTNA 3TZ8A 4LOOA 2C5XA 2QOIA 3MVLA 4GSBA 5J8IA 5DR2A 4O38A 2CKQA 3NYOA 4QP2A 5ETIA 5J95A 5AX3A 2OICA 3TL8A 1K9AA 2QOLA 1LEZA 3FUPA 4GT3A 4JBQA 4K33A 3NYNA 5I9XA 3PY0A 3IW4A 3A7IA 4TYHA 1Q62A 4XOYA 3O51A 2W05A 1TQIA 4R5SA 2EXMA 4PTEA 3WF8A 4QMQA 3DAJA 5HHWA 3F9NA 4WBOA 2NRYA 4YGAA 4FODA 2J5FA 2I40A 4LRMA 4WKQA 2WNTA 2OIQA 3R1SA 1OVEA 5AR5A 2FSOX 3VBQA 2CJMA 4EHGA 2W5BA 3W2OA 5M4UA 4NM7A 3BQRA 3R7YA 4FSUA 3E3PA 3RWQA 3TZ7A 2PL0A 5IF1A 4ZJVA 2I1MA 2RSVA 3MTLA 3UO4A 4AOIA 4TNDA 4EOPA 5C4KA 3VS3A 2XCHA 3PRIA 4IADA 4X3FA 5EDPA 3LKMA 4FEXA 4HOKA 4FT9A 4EH4A 3IPHA 3FI2A 3QWJA 3PPJA 2F2CB 1CMKE 1JNKA 4PL3A 2FYSA 2G2IA 3C4EA 3T9TA 5D10A 1Y6AA 2ITOA 4QQJA 1YVJA 2HENA 4YHFA 1OL6A 2OGVA 1UWHA 3MB6A 1BMKA 3FY0A 5L2WA 2GPHA 3LCTA 4I3ZA 3QGWA 3T8OA 4OTIA 5IQAA 4CTBA 4KRDA 5B0XA 1DM2A 2C5VA 3LFDA 3LFAA 4AGCA 2LAVA 4AZEA 3VRYA 3Q9YA 5EOLA 3LCSA 4TYEA 3JXWA 3VS4A 3DBCA 4C37A 2PMNX 3HDMA 3HV3A 4M15A 4RJ3A 3TN8A 4E93A 4BIBA 4AG8A 4M69A 4IFCA 3NCGA 2JLDA 4UXLA 3EWHA 4UMPA 4DGOA 2PE2A 1WBVA 3D14A 5CSXA 4CD0A 3OTVA 3UOJA 4R7HA 1OM1A 3DAKA 3QD4A 3P78A 4DCAA 4YJNA 2WTKB 2UZVA 4KD1A 3W33A 2PVYA 3KXHA 3VUHA 2XCKA 4IJ9A 2OWBA 4MEDA 3ALOA 3QUDA 4IAFA 3SW4A 1BI8A 4RIYA 3R9NA 4Q9ZA 4FK3A 3V01A 5HTIA 4EC8A 5EM5A 5C01A 5KKRC 3O7LD 2AUHA 5IUGA 2WMWA 5AWMA 1UU8A 3UJGA 3KF4A 5A54A 2B1PA 1FVTA 4HPTE 3QD3A 1E9HA 3TV4A 1HOWA 3DXNA 3FLZA 1KV1A 4FKTA 5JK3A 4AZVA 4O0TA 3D2IA 3GCUA 1UV5A 2PZ5A 3OCSA 5CSWA 5BVWA 2VGPA 3AC8A 3FZOA 5D1JA 3C0IA 3VQHA 2E2BA 4UYNA 5JZJA 4RVMA 3A7HA 3UODA 5C1QB 5GNKA 3VC4A 4D55A 1B39A 4JBVA 3QF9A 3SRVB 1FGIA 3GUBA 4U45A 1XBAA 1YXUA 2OKRA 1CSNA 1URCA 4EOKA 1A48A 2PSQA 3ZXZA 2PZRA 5DFPA 1YQJA 4I20A 4A9TA 3ZFYA 2I7QA 4JBPA 5HTBA 5LVOA 2BAKA 3HRCA 1WBNA 3DAEA 2JDOA 3MPTA 4KBAA 3KCFA 4FV0A 4USDA 4RX8A 1DAWA 4D9TA 3SGCA 4EKLA 2JDTA 4GFOA 2RG5A 3F69A 4J8NA 4BGQA 4BYJA 1GZOA 1PXOA 1APME 2E9OA 3OZ6A 5CYIA 3RNYA 2HZIA 2QHMA 3WILA 3ROCA 4X0MA 3UVPA 2WB8A 3LQ3A 2SRCA 3AMAA 5JRQA 2X2MA 1YOLA 3VIDA 5CXHA 3UOLA 3TZ9A 4JOAA 4ZTRA 4GVAA 2NNWB 3SW7A 4EUTA 4OW8A 2BZKB 2XKEA 2BHEA 4MKCA 3OBJA 4BFMA 3OD6X 3BIZA 3UBDA 4EK5A 3I7BA 1QL6A 5E8XA 2YDJA 1OL1A 2QOCA 4FSYA 1H28A 4XV2A 4Z16A 4HVSA 5CLPA 2RFSA 3CQWA 3DQWA 3PIYA 1VEBA 2O65A 2YIXA 3PIZA 3Q4TA 3M1SA 1NY3A 4Z7GA 1GIJA 3UVQA 2XIRA 4EH3A 4GFMA 4G1WA 4G6LA 5FBOA 5HE1A 2XB7A 5FTGA 3GNIB 4RMZA 1IRKA 3VVHA 4I4EA
chains in the Genus database with same CATH superfamily
5CY3A 5KMJA 1G3NA 3OS3A 4ERWA 5EKNA 3R6XA 1B6CB 4DFZE 3EFLA 4KABA 4ALUA 2R3HA 5LWNA 3BBTB 4M14A 4RQVA 5AV3A 4WNOA 3HRFA 4DH1A 2VTAA 4EWQA 3UDTA 4I6HA 4O4BB 4IB1A 2CDZA 2JBPA 2VO3A 5E90A 3UNZA 1OUYA 2X8DA 4RC4A 2H9VA 4IANA 2YAKA 2QC6A 4TWNA 3N4VA 3FXWA 1T46A 3TXOA 2PPQA 4QTDA 2W0JA 4DG0E 2VZ6A 3I6UA 4PV0A 4I6QA 1OKYA 4XP0A 3QD0A 3F3UA 1YHVA 4K1BA 3OMVA 4MBIA 4QP7A 3ITZA 3QTSA 4LMNA 4IM2A 5AV1A 3W10A 4BTMA 5FP5A 3R7EA 1ZAOA 2C69A 3POZA 4BICA 4EOIA 3AKKA 2YJSA 2IW9A 1YHSA 3FKNA 3NAYA 3PA4A 2UZDA 2RFNA 4ARKA 3K3JA 4FUYA 4NFNA 4WIHA 3PY1A 5EHLA 3PWYA 3V6SA 1W2CA 3L1SA 3OF0A 4GU6A 4DLJA 3H30A 4YMJA 4D2VA 5J9YA 4ENXA 3MH2A 4YPSA 3RPVA 3VUDA 3SG8A 5IQDA 4IWOA 3UIBA 1S9IA 3GI3A 5FDPA 2W1GA 5IDPA 5CASA 1PXJA 3E62A 4NIFA 4QYGA 4ZSEA 3I5NA 2R7BA 2VTJA 5J1VA 2ZYBA 3BHYA 4CFMA 5FDXA 2R3OA 5CQUA 2WTWA 3VF9A 1R39A 3MH3A 4TYGA 1FVRA 3MI9A 4AOTA 4UMUA 4F0FA 4F9BA 4TYIA 5DH3A 1H1WA 2JIUA 2XMYA 4UMRA 2XS0A 3Q5ZA 4C4EA 3TNIA 4CCBA 1NW1A 1IR3A 3KRJA 4G16A 2VNYA 4F0GA 5IUHA 3LLTA 3DU8A 3MPAA 4RX7A 5J5TA 3W0PA 3QFVA 4CKRA 4DT8A 4RIWB 3ORTA 4USFA 3ELJA 1YDRE 4RWJA 5LVMA 3H3CA 2O2UA 4XP2A 4UMTA 5A3XA 3GENA 2JKOA 2R3LA 4WNPA 1XWSA 4BDEA 5AA8A 4CZYB 5KMLA 4FV8A 2IF8A 3U54A 2YZLA 2GTNA 3GC0A 4YJTA 4L68A 4FNXA 1YI4A 2ETKA 3SXSA 1IEPA 3DTCA 3U8WA 5ITAA 3IDPA 2ITXA 2QKWB 3KU2A 4GL9A 4MBLA 3R8MA 4DEAA 2WTKC 5E91A 5HEZA 4R3PA 5DLSA 5J87A 2FUMA 3R7VA 4APCA 4BIDA 2ITTA 3R0TA 4O7RA 1OPJA 1ZRZA 4Y5QA 5CU6A 1PXKA 3DK6A 5F20A 3RNIA 1ZXEA 2F57A 3COKA 3I60A 4QMXA 5B2MA 4QMSA 3UDZA 4K6ZA 4EONA 2J51A 2C30A 3QHRA 4XNEA 2PY3A 4FT7A 3ZO4A 4AXCA 2BFXA 2CKOA 2RG6A 3Q96A 5CAUA 1PY5A 4Q2AA 5H2UA 4LDTA 1LEWA 4O0UA 4AQCA 3V5JA 2PZPA 2XARA 3FQSA 3R2YA 3PSDA 2BIKB 2ETMA 3HKOA 4EOQA 4TL0A 4FTLA 2B9FA 3IDCA 4LI5A 3OT3A 2BPMA 4C61A 4DBXA 3FZ1A 4XYFA 2OJIA 3I0OA 4I0TA 3CSVA 3UG1A 5L4QA 4IWPA 3GC8A 4ZZMA 4A9RA 5GZAA 1J7IA 4ZLZA 4O4CA 4MK0A 4OAVB 2XYNA 4A07A 1PXLA 2OW3A 5E8WA 2ZDTA 4R6VA 4PMTA 2IW8A 1OKZA 4FYNA 4R1YA 3W0MA 3DDQA 3MYGA 4GYGA 4OT5A 4V0GB 2KTYA 2VWYA 1ZYCA 1JOWB 4RIXA 2ETRA 2ITNA 5LWMA 4J98A 3IQ7A 3JPVA 3LCDA 4FSQA 4I1ZA 4ZP5A 3RHKA 2XK7A 3P9JA 4KNBA 3GCPA 3BWFA 2G01A 3ZFMA 5IQGA 3DCVA 3QQKA 4MXYA 1ZZLA 4CG8A 3D4QA 2WMTA 4CFUA 4FEWA 4CFWA 2OJFE 1REJA 4L43A 3CQEA 3PXQA 2PVKA 5HO7A 4FEVA 1AQ1A 1CM8A 2VO0A 1OIQA 2YA9A 2UW4A 2YCQA 3DJ7A 3QBNA 1GY3A 4O7WA 2IVUA 3Q4UA 3QKKA 4PPBA 5EH0A 1V0PA 3BU5A 1AD5A 3WZDA 3OUKA 3EQFA 4PF4A 2EB2A 2IZSA 2QO2A 4ZY5A 1E1VA 5AX9A 3VO3A 4ASXA 4F6WA 2O5KA 3AMBA 3UIMA 5HI2A 3G6HA 3K54A 4J96A 4MWIA 4YBJA 3V8TA 3QX4A 3VN9A 3W2RA 3ZONA 2XVDA 3IW8A 3VBYA 3BQCA 5K5NA 4DDIA 4LGGA 5CU4A 3Q52A 2I0HA 3MB7A 4WUNA 2GQGA 5FM2A 3VNTA 5HGIA 5ANJA 2BUJA 1UU3A 2X9EA 4V05A 4H58A 1YWNA 2JIVA 4NM5A 1OPKA 4PMMA 4Y83A 3WOWA 3OC1A 3KRWA 3MA3A 3F2AA 2OJJA 5L2SA 4QTCA 3CKWA 1IASA 2W7XA 3G33A 4AF3A 3DB6A 5FM3A 4ACDA 4I21A 2R3MA 5B2KA 4FE2A 5HG5A 3UQFA 3DY7A 4YLJA 3Q6WA 5AUTA 3ACKA 3LMGA 5A4TA 2F49A 2ITWA 2Y6MA 5KMKA 1SNUA 5GHVA 3RAHA 1ZY5A 3LJ0A 4BWKA 4BDJA 3FMLA 3HDNA 4HPUE 4BDIA 1KUTA 2CN5A 4AN9A 3KA0A 3UZPA 4I5PA 4KINA 4LV8A 3DOGA 3KVWA 5M08A 3TWJA 3O8UA 5CT0A 4QTBA 3HLLA 5AV0A 1ERKA 3DLSA 4FKQA 2YCFA 3NR9A 2WMXA 4FC0A 4JMQA 5FQDC 3QAME 3HECA 3E8EA 2B55A 1ZLTA 2XYUA 2REIA 5DWRA 1OIUA 1ST0A 3DZOA 3LFBA 3RPYA 3EL7A 3JYAA 3WIKA 2RFEA 4FBXA 4M97A 2A27A 3QZIA 2WKMA 3KB7A 4KIQA 4ZTQA 2AQXA 4MH7A 4MYGA 5AEPA 3GQLA 1YW2A 2XK4A 4JNWA 2R3GA 3JY0A 2ITUA 4O83A 4X2KA 3PG1A 2VWWA 4E4MA 2W5AA 3BEAA 2OFUA 2WTIA 3Q32A 3FKLA 2ZJWA 1W0XC 4KSQA 3THBA 4C4FA 4G3EA 3KMWA 3MJ1A 3FMMA 4YSJA 1G8KA 4DFXE 3QKMA 2LGCA 3CGOA 3HV7A 4FI1A 4JS8A 5ETAA 3LIJA 1Q4LA 3JVRA 3VRZA 4CZTA 5TT7A 4ITIA 5I9YA 2ZV8A 4MCVA 3I0QA 3PSCA 3F3ZA 4BBFA 3D5WA 4L67A 4FKWA 2WMQA 5K0XA 3MIAA 1XMMA 3MDYA 3RKBA 3ZRLA 4QP8A 4CMOA 3UPZA 4X3JA 3BRBA 2OXYA 3MN3A 3BU3A 3R8LA 4F1TA 4QNAA 1PKGA 3EQHA 4FTKA 5D12A 2VO7A 3KK8A 5F95A 5CAOA 2UW0A 2QU5A 5LVLA 4NK9A 4RSSA 4IBMA 5HLWA 4U40A 3ATSA 3R2BA 3ZSIA 4E4XA 4R5YA 3FV8A 4DEGA 4BCMA 3FI8A 4K2RA 4U0IA 2VTOA 4BZNA 4DBNA 4W9XA 4IAKA 4CKIA 3PE2A 3W0NA 2WMBA 1J1BA 3PVGA 2WMUA 1YDTE 3DJ5A 5EM6A 3PJ2A 1W8CA 3PUPA 3DKGA 4PDOA 3R7IA 4RJ7A 2ERKA 1J1CA 4M0ZA 2IZRA 4QTAA 3U4WA 4HVIA 4EQUA 3PIXA 1ND4A 3PFYA 4OGRA 4WHZA 3C50A 1TFFA 4FSWA 3WYXA 2WTDA 2BAQA 5FRIA 1PMNA 4C2VA 4CLJA 1XH9A 1Q41A 4YSMA 4YC8A 1VYZA 4CSVA 3CKXA 3HYHA 4QO9A 2R0UA 2VO6A 3Q6UA 4A7CA 3NUYA 4LRJA 2VNWA 2YLEA 3H0ZA 3QLFA 3LVPA 4BDKA 4O7TA 1TQPA 2ESMA 2NRUA 3QTZA 5CNNA 3BE9A 4ERKA 2VD5A 4FA2A 4CV9A 3AC5A 3QYZA 5KKRB 2XIYA 1XO2B 3Q2JA 1U4DA 2G1TA 2PHKA 3MY0A 4PTGA 5DVRA 5JRSA 3KMUA 3LJ1A 5DE2A 4J1RA 4G17A 4ZSGA 2QLQA 3ZUTA 4IX6A 5HG9A 4O84A 2BZJA 3CCNA 3DBQA 5HE3A 2WZJA 3R1YA 3ZCLA 2ZV9A 2BFYA 3PSBA 1QPJA 2OIBA 3EQDA 2NP8A 3NNWA 3PA5A 5AIRA 3FMJA 5DRDA 2UZUE 3EMGA 3LXPA 3P5KA 5A6OA 4DGNA 5IEXA 5BMSA 5HU3A 5KHXA 5ACKA 5FEQA 5EW3A 4NTTA 1TZDA 5HCXA 4C62A 3BLRA 4I6BA 1BX6A 5T3QA 2Z7RA 4XHKB 4IDTA 5E1EA 2R3NA 4W4YA 3F5UA 5FP6A 2XA4A 2UUEA 4ZTLA 3V3VA 5AP2A 3TG1A 1PRYA 3QU0A 1H1SA 4RLKA 5M56A 2WIHA 5EOBA 3NLBA 3TUCA 5CU2A 3CD8A 2C6LA 4D0WA 4BBMA 2WIPA 3LCOA 3IONA 3GP0A 4A9YA 3DB8A 4ANNA 4BCGA 1NVSA 5HD4A 3TIYA 3AKJA 2P3GX 2XIZA 4RG0A 4L9IA 2C1AA 5L2TA 3HMOA 2FSMX 4FTIA 3JS2A 2YLFA 5AP5A 3ZZWA 5I9VA 4PQNA 2UV2A 4BCQA 4UZDA 3CS9A 4CCUA 3N9XA 1OBGA 5AV4A 4O7VA 4E3CA 2GMXA 5H3QA 5AUUA 3NMUF 2HXLA 3KRLA 3EKKA 3BGZA 4ACHA 4KIKA 3R9DA 1VYWA 3ZBXA 5JSMA 1V1KA 2QODA 4BN1A 4IX3A 5CU3A 4O2ZA 5J1WA 5E8UA 1TKIA 2C0IA 2DYLA 1Q8WA 3W8LA 3ZZEA 1R78A 4H05A 4O7YA 3FC2A 3Q2MA 2BZIB 3C51A 4XRJA 4XV3A 4EH2A 3TKHA 5HVKA 5AM7A 1FVVA 4LGHA 2JDSA 2P2HA 4O0WA 5DG5A 4AXFA 3QC9A 4II5A 4ANQA 4F6UA 4JR3A 4D5HA 2WU6A 5C9CA 4N6ZA 2G2HA 4OAUC 3OUNB 3BYSA 2I0EA 4DFLA 3DNEA 2WXVA 4GS6A 4XG9A 3QZFA 3R8ZA 3ULZA 4ENYA 4EEVA 4QMVA 2J5EA 4ZXTA 2QO7A 4DYMA 2BR1A 3QD2B 2QNJA 5HIEA 3OT8A 3FL4A 3ZU7A 4FYOA 3BLAA 5LVPA 1UNLA 4JG6A 1RJBA 5ANIA 5CSVA 2OJGA 1OIYA 5AP0A 3QCQA 2IZTA 5L6WL 3V6RA 5DEWA 2VGOA 3SA0A 4QQ5A 5CI6A 4XG4A 3VS6A 4I92A 4EOOA 3OXZA 1JKLA 4FUXA 2J0MB 3E8CA 3AC2A 3N4TA 2GNIA 3C0HA 1KSWA 3G51A 3LCKA 5FXRA 1WMKA 2J6MA 4D0XA 4DH7A 4IJPA 3IGOA 2ZDUA 3ZUVA 4CV8A 2R3RA 4ZK5A 4JIKA 4PNKA 4DA5A 1FMKA 3I6WA 3VULA 4GK4A 2YWPA 1IAHA 5L6PA 2VN9A 2QCSA 4GT4A 3AT2A 4IFGA 4U7ZA 4MD9E 3R73A 4G9CA 4AT5A 4MF0A 4IVDA 1KWPA 3Q9XA 4BC6A 4FSMA 5DGZA 5DNRA 4QMNA 3EHAA 3TCPA 2PZYA 5FD2A 2VWIA 3FSKA 1JSVA 2C3LA 2YIYA 5M53A 3CP9A 4U80A 4B8LA 3LFQA 3QTUA 3CR0A 4D58A 4FV4A 4C36A 3FLQA 3RJCA 3TI1A 4FTMA 4EJNA 4DGMA 2OJ9A 1OECA 3MFUA 1MRYA 4LL0A 3VBXA 2YEXA 5IMXA 1IA8A 1OGUA 2Z7SA 4ORKA 2A19B 1YRPA 3M2WA 4NCTC 2DS1A 5GJDA 5EQEA 3QZHA 4GIIA 3I1AA 2IO6A 2WMSA 3FZTA 3P7AA 4TYHB 3FWQA 5TO8A 4Z9LA 4A9SA 4RIOA 4X7QA 1H0VA 2NPQA 2QLUA 3ROYA 2XP2A 3AMYA 4F08A 4WG3A 2BALA 1IAJA 2IVTA 4C0TA 4MWHA 2GS7A 4OBOA 4BTJA 1F0QA 2UW8A 3DFCB 5FXQA 4YNOA 3FI3A 3R8PA 5G1XA 2X2KA 1YDSE 2ITPA 3IOKA 3R9HA 4YLLA 5A14A 5H8BA 4N4SA 4IM3A 2BKZA 1ZMVA 4NW6A 4IW0A 4OTDA 3U51A 4YUQA 4D28A 4O7NA 4GUEA 3DBEA 1H01A 2C68A 4RA4A 4WNKA 3NVMB 5CVHA 2CNQA 4LG4A 3F66A 5KMOA 4ASDA 3MH0A 4FZFB 4JRNA 3CY2A 4LMUA 2VX1A 1XR1A 2B4SB 2XNNA 2BTRA 2XNGA 4DAWA 3HV5A 4XG7A 5AM6A 5A4QA 4RJ8A 4ZY6A 3UVRA 2G2FA 3QQUA 4MAOA 2X0PA 2HELA 2YHVA 2CMWA 4C3RA 3MH1A 3FHIA 4NW5A 4P90A 1R1WA 1G5SA 3OWLA 3GGFA 5CEOA 1RE8A 2RKUA 3B8RA 4JX3A 2P55A 3FPMA 4N70A 5GJFA 4NZWB 5L6OA 4O7LA 1HCLA 4ANBA 4IQ6A 4I41A 3VUIA 5IA0A 3ERKA 4KSPA 1JPAA 2XK9A 3A8WA 5AAGA 4M13A 4HZSA 5CSPA 4HGEA 4M69B 2B9HA 2X39A 4CTCA 5B7VA 2XZSA 5D41A 3ENMA 4FZAB 4ZLYA 4W4XA 1GNGA 1IG1A 4FG9A 4CYIA 3R63A 3BHUA 4EZ7A 2C3KA 3FHRA 3QRTA 3LJ2A 3A4OX 3ACJA 4BTKA 1MQBA 2CN8A 3P86A 3D7TA 2VTLA 3VF8A 3QX2A 3UC3A 5EKOA 2ITYA 3QCXA 4WOVA 3G15A 3E7OA 4BCNA 2EUFB 3TIZA 2GFCA 3HP5A 4L46A 4OLIA 3UZTA 4EOJA 2R3PA 3PZHA 4YBKA 1PKDA 3TEIA 4DHZA 4FZ6A 3FE3A 1JQHA 4IXPA 3FPQA 3EN9A 4F4PA 4B8MA 3BE2A 3A62A 3MY5A 4QYHA 4C3PA 5HVYA 4O86A 4O81A 3COHA 3HMMA 3W0SA 5HBEA 4N0SA 5CEIA 3V5TA 4DTBA 4QDVA 3LM0A 3F2NA 2IEWA 2PE0A 3NEWA 3R00A 4IAIA 4LYNA 3O7LB 4MHAA 4EORA 1H26A 5KHWA 5M4FA 3GT8A 3R04A 4U44A 3CTQA 5EI6A 1Q8YA 5DHJA 5JZNA 4X2GA 3OOMA 3UMXA 4ZY4A 5EFQA 1G8AA 5GINE 4O0SA 1SM2A 3IKAA 3M42A 1U54A 2O0UA 4W8DA 3KIOC 2JEDA 3AT4A 5AUZA 4AT4A 3S1HA 2B9IA 3VJOA 1H24A 2QG5A 2CNVA 3RTPA 3AQVA 3MJ2A 4S34A 3BYOA 2WMVA 3NAXA 4PWNA 3ZXTA 5M4IA 4DG2E 3W2SA 4PDPA 4LV7A 3L8XA 3NIEA 5IUIA 3R9RA 2BRMA 3FLYA 3Q9ZA 2V7AA 4OTQA 3PVWA 5HG8A 3F2RA 3O71A 3ZSGA 2XBJA 1E1XA 4O7ZA 1CKPA 2BDFA 4YJSA 5JGDA 3UP7A 4YURA 3BLQA 5AUVA 1XH4A 2C6KA 2FA2A 4BCPA 4OT6A 3IECA 2YM4A 3PE1A 2QU6A 3GC9A 3KC3A 1P5EA 3SX9A 2R0IA 2VX0A 3FC1X 4G3DA 5CQWA 1XJDA 3KXXA 2C0TA 3TV7A 3BI6A 1L3RE 4F6SA 3ZO1A 2GQRA 5ANGA 2E9PA 2BROA 1PJKA 3QLGA 3FLNC 5DR6A 4JIAA 4DN5A 3R71A 2XJ2A 2XNOA 3MW1A 4GCJA 4UMQA 4XCUA 2O63A 3FLSA 4IH8A 1ZYLA 4M8TA 3IOPA 2UVZA 3K5UA 3PXYA 4O6EA 4YC3A 4YTHA 4YJVA 1BYGA 3ANQA 1LP4A 3R83A 2YZAA 2X7OA 4A4LA 3BX5A 2W1ZA 2V22A 3ZMMA 4BI0A 3ORMA 3C1XA 3BHVA 3PP1A 4DEIA 5IQFA 1WBTA 3VS0A 4OUCA 5JN2A 4IACA 3G0EA 5LMKC 1UU7A 4G5PA 2CCIA 4K18A 3U6JA 4TWCA 2J0LA 3EQIA 5DOSA 4BGHA 4UZHA 3R8VA 4K8AA 4A9UA 1H1QA 5LMBA 2BRNA 3TDWA 1O6KA 3D9VA 2IN6A 1YHWA 4RVLA 3L8SA 3UE4A 4QD6A 2YN8A 3ULIA 5CEMA 4PPAA 2XIKA 3PVBA 4EHZA 4RWKA 2WTCA 1M14A 2AC3A 2HWOA 4CXAA 4Y5HA 2JFMA 2A98A 3ZYAA 3HVCA 3LFEA 5CXZA 2J0JA 4FGBA 1WVXA 4HCVA 1H8FA 4JRVA 5CANA 3PA3A 2XNPA 4R78A 4QMOA 4TY1A 4AN3A 2UW6A 2J0KA 3NNXA 3WF6A 3JUHA 5BPYA 1ZOHA 2EU9A 2UW7A 3HUCA 3KULA 3OG7A 4JT3A 5DA3A 3ALNA 2VU3A 3RAIA 3KREA 4KAOA 4FSRA 2GNLA 2VWXA 4C59A 5HX8A 5IEYA 4AA0A 5JFWA 4FNWA 4MNFA 4FNZA 4ID7A 3ZLSA 4D4YA 3ZO2A 2XAOA 2XK8A 3QTRA 2UVYA 1UA2A 2C1BA 5LJJA 3ZTXA 4OTWA 2Q0NA 3AD5A 3LAUA 3FXZA 4D2TA 5BUJA 4R3CA 4WD5A 2YCSA 5HX6A 4RX5A 4N57A 3S2PA 5ANEA 3OEFX 1UWJA 4IB5A 3DGKA 3SAYA 3A99A 1ZARA 2WPAA 2VAGA 5H9BA 3P08A 2XKDA 3QKLA 2C3JA 4MNEA 4K11A 2W4OA 4C33A 1PXIA 1XKKA 3UOHA 2WQNA 2GS2A 3ORLA 4PL4A 2JDVA 5E8ZA 3W2CA 1MUOA 4MTAA 2A0CX 4WG4A 2AC5A 4AS0A 5CENA 3PDTA 3V5WA 2JAVA 1CDKA 4NJDA 3ZOSA 3EZVA 3EQGA 1CKIA 4CQGA 3KL8A 2Z02A 4U43A 2HW7A 4X3FC 2VTPA 1BLXA 5FGKA 3PP0A 4WO5A 5C4LA 3NGAA 3KXNA 5HOAA 2QOKA 5HIBA 4I22A 3LQ8A 4AU8A 4USEA 5EI8A 2OXDA 3NPCA 4IVBA 4O0VA 3KK9A 4TTHB 4L44A 3R28A 4BI1A 4QQTA 2JKKA 4F78A 2XIXA 2FVDA 1H1PA 2FO0A 4O1PA 4I6LA 1MRUA 2OK1A 5I9WA 2UZEA 1QCFA 3BYUA 3OXIA 2GS6A 5KCVA 1NXKA 3C4FA 4I6FA 2UZTA 3COMA 5I0BA 4ZSAA 3C5IA 3UTOA 2JGZA 2CLXA 2VWUA 5HESA 2OG8A 5CEPA 5J9ZA 5LVNA 4E73A 4XG8A 1J91A 3PVUA 3EKNA 4B0GA 3G0FA 4PMPA 3ZFXA 1Z57A 1Q3WA 3HRBA 2F7EE 1W83A 3EQCA 3GXLA 2R4BA 1PF8A 1M17A 2BILB 3C5UA 4QQCA 2XNMA 3RPSA 4FKOA 2BDJA 4BKYA 5LQFA 2QONA 2YDIA 2QOQA 3RZFA 2H8HA 2VTRA 3QL8A 4PNIA 4U97A 2IG7A 3T9IA 4BL1A 4UV0A 5TE0A 3WBLA 1M2PA 4I5MA 3OHTA 4AW2A 2ONLA 3CPCA 3F5XA 3SC1A 3UGCA 4JJRA 3TV6A 4PTCA 4XJ0A 1ZY4A 3V51A 4FZDB 5JT2A 2GHMA 4C4IA 1ZZ2A 5KZ0A 4D2WA 3BKBA 4PMSA 4I93A 3QA8A 2YISA 2OZAA 3P79A 3OCBA 2P0CA 2NO3A 4EHEA 4UYAA 3D83A 3T3UA 1PXNA 1XH8A 1ATPE 5EHOA 5JGAA 1XQZA 1OB3A 3PLAE 2WEVA 4J99A 2XNBA 5DR9A 5J79A 3RBWA 4P4CA 4ASEA 2X4ZA 4FGRA 3B2TA 4I94A 4FG7A 4GG7A 1JSTA 2H34A 2GTMA 3PJ3A 3OY1A 3F82A 4FIGA 4W4VA 3E63A 5HIDA 1O6LA 4BY9E 3GOKA 4APPA 4FZ7A 2OF4A 5HCZA 2GNJA 2CNUA 4DH3A 3FZSA 3P7BA 4RIXB 5DI1A 3BCEA 3RP9A 3NYVA 4IC8A 3EYHA 4TWPA 4Y72A 4DEHA 1BL7A 4F7JA 3PZEA 3RM7A 2J0IA 1WZYA 5I9ZA 4FTJA 2UZOA 4MVFA 2WFYA 4H1MA 3R7UA 4BVUA 5HG7A 4JQ7A 2W9ZB 1JKTA 2R3IA 1KOAA 2HWPA 3FZPA 3R9OA 3SDJA 4U6RA 5JGBA 4F63A 3QRIA 4J52A 3W0RA 3Q4ZA 4ONAA 2ZVAA 4D1SA 5L8LA 2XEYA 3W8QA 1GZNA 3HV4A 3QQJA 5JFXA 4M12A 3W0OA 3FZRA 4O0XA 1W84A 4XG2A 4FL3A 1OI9A 2X0OA 4I0SA 4EOMA 3E8NA 3OBGA 3F5GA 1ZMUA 3R22A 5HZNA 3FAAA 4AE6A 4JVGA 3FKOA 3P4KA 1PW2A 2E9NA 4WSYA 2OIDA 4QRCA 3OW3A 3H4JA 5HCYA 3D5XA 1H4LA 1UVRA 2Y4IC 4R7IA 2QOHA 5KNJA 4ZSLA 1KE6A 3BWJA 4RQKA 4F9YA 2H96A 3W18A 4F9AA 4QTEA 3TTJA 4I5HA 4C4HA 1U59A 1PXMA 5CEKA 4YNEA 3UYSA 1WVWA 4U8ZA 5AP6A 1SZMA 1OMWA 4O0YA 4GT5A 4TWOA 5KMNA 4IX5A 5FLFA 4CRSA 1XH7A 3RCDA 3UPXA 2QR8A 3DK7A 4AW5A 3BBWA 3ENHA 2FSLX 2XNEA 3RALA 4BJJA 2W1DA 2PK9A 2W4JA 4XOZA 5HTCA 4EH9A 3S3IA 2YWVA 5AP1A 5AR2A 3CIKA 4FV5A 4D2SA 3G6GA 5LARA 2GQSA 2IZUA 2QQ7A 4O22A 1J7LA 2R64A 4YO4A 4FNYA 4IB0A 4K0YA 5KX8A 4HGSA 4LOPA 4HZRA 4DFUA 2W17A 4FVPA 1PYXA 2ZV7A 4J95A 1DAYA 4H39A 2FSTX 3F88A 3TZMA 3ZC5A 4CMUA 4JAIA 4EZ5A 4YTFA 5GIPE 5DT4A 3HNGA 3LHJA 4HYSA 3OWJA 3ID6C 4IZYA 4JAJA 2YITA 5JFVA 4NYEA 3BZ3A 5IA2A 4RVKA 1OUKA 3NUNA 2J4ZA 1RQQA 3LFSA 3P23A 2HAKA 4CLIA 1Y57A 4UXQA 4CYJA 4BKJA 2HW6A 2C3IB 4FV3A 4IZ5A 3GOPA 2OU7A 3UDBA 5KMIA 5BYYA 5EQYA 5CVGA 4M7IA 3NZ0A 4NT4A 2OH0E 4CRLA 3W16A 4XG3A 2J50A 1R0PA 5HKMA 4FVRA 4YTCA 4FEUA 2WQMA 1TQMA 4D2PA 3ORNA 2WEIA 4UX9A 3RZBA 3IG7A 5HO8A 3RK5A 4YP8A 1LPUA 5TKDA 4M67A 3MVMA 3T3VA 3WZKA 4AAYA 1WBWA 3E3BX 2YAAA 3CBLA 3TUDA 4J53A 1OIRA 2HZNA 2X2LA 3VW6A 2W06A 3LFFA 1NA7A 5HE2A 1H27A 4MXOA 4L45A 5A4LA 4TXCA 5JEBA 3NW5A 3NUXA 1VZOA 3FLWA 4JR7A 4WRGA 4R77A 3LW0A 2QOBA 4E20A 4DLIA 5JH6A 4RT7A 2IW6A 1YXTA 1ZWSA 3FMKA 4HNIA 3NX8A 5E9EA 4CEGA 1YOMA 4JDKA 5ANKA 4DC2A 4IAAA 1HCKA 2PMLX 2QG7A 1UNGA 3MTFA 3VQUA 3LXLA 4OTRA 3JY9A 2ERZE 4ZIMA 3DXPA 2R5TA 4Q5HA 4YO6A 2QI8A 5EW8A 4I0RA 4HVDA 4L52A 3VBVA 2YABA 3QTIA 5AV2A 5CSHA 3BGQA 4BI2A 5KO1A 3C4ZA 3R02A 2F9GA 4EL9A 1URWA 3P0MA 3MWUA 5C8KA 3H9OA 1FGKA 1ZOGA 3CXWA 5CWZA 4QMUA 5DT3A 2YIRA 3SHEA 4C4JA 4F65A 5IA1A 5E4HA 4TN6A 1PXPA 4U9AA 4NKAA 3PLSA 1G8SA 4GEOA 2ITQA 3Q60A 3CTJA 3TMOA 2Z7LA 4O91A 5CF5A 3ZO3A 4GVJA 3EQRA 3ORZA 5A6NA 3WIGA 1ZMWA 3EOCA 3NW7A 5GZ8A 4XP3A 4IWDA 4HVGA 4QMZA 4GRBA 4M3QA 4FF8A 5EYDA 3UO5A 4OTGA 2P2IA 4FIHA 1K2PA 4B4LA 5IQHA 3C0GA 4EBVA 4V01A 4DE4A 3KRXA 4BWXA 3U6IA 4FTTA