5HU9A

Crystal structure of abl1 in complex with chmfl-074
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
275
structure length
266
Chain Sequence
AMGSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and characterization of a novel potent type II native and mutant BCR-ABL inhibitor (CHMFL-074) for Chronic Myeloid Leukemia (CML)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ABL1
total genus 86
structure length 266
sequence length 275
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hu9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hu9A01
4NL0A 3R0TA 2V62A 2YISA 4MBIA 1JAMA 4FSMA 3TN8A 1W7HA 2JDSA 3K3IA 3KRLA 3ZRLA 4YPDA 3EZVA 4D58A 1SNUA 5TKDA 3WZEA 2DS1A 3Q4ZA 4HYUA 4U80A 5JGDA 5KHXA 4YZBA 2C69A 4FV6A 5CX9A 5DOSA 5T6KA 1Q8UA 2PPQA 1O6YA 2XNOA 4CXAA 5IA0A 5DT4A 1U5QA 4LRKA 2J50A 3FPQA 4X3FC 2OG8A 2IZRA 3S1HA 2H6DA 2EWAA 2JBPA 4O96A 5E8YA 1WBNA 2HW6A 3PXRA 3QCSA 3BU3A 3RTPA 3D2IA 3V04A 4LI5A 4AE9A 5JFXA 3FI2A 2OZOA 4TW9A 4DFUA 1NXKA 2A1AB 2OU7A 2G01A 2I6LA 2XCHA 3KK8A 5TF9A 1NW1A 4FOCA 5IQAA 3NSZA 3R8LA 4GIIA 4L3LA 3TV6A 4I21A 4BI0A 4TL0A 1PHKA 3FAAA 2X8EA 4K18A 4Q9ZA 5HBEA 2ITXA 2J0KA 4GT5A 2FA2A 2WFYA 2YAKA 4P4CA 4XV2A 4FNYA 2EVAA 4GH2A 4IWQA 3KRXA 1SVGA 3QRTA 1JLUE 5L2SA 4HGLA 2W1HA 3MPAA 3KXHA 3FKLA 3MPTA 4IM2A 1APME 4O6LA 4OGRA 4O1PA 4RX7A 3ZSGA 4BDKA 2HENA 4WNMA 3E3BX 5C8KA 2VAGA 3HMMA 4TWPA 3LLTA 1OI9A 3RK9A 5LVNA 5IQEA 3EN5A 3GCQA 3O8TA 3S4QA 4A9UA 3E5AA 4BDGA 1M14A 5CAVA 3UZTA 5CEQA 5E8VA 3U9NA 2A0CX 3VO3A 4ANLA 4V05A 2YIXA 3LPBA 4F0FA 4O7YA 2A27A 2OSCA 1SMHA 2ITTA 4PDPA 5CQUA 5AV1A 4AOTA 3PRFA 4PX6A 2BFXA 4U79A 3ATTA 2UW3A 3BQRA 4ZSLA 5LQFA 4X2KA 4ANQA 1KSWA 3FMKA 4Y95A 3TL8A 1GIJA 2BRNA 3DBDA 1W98A 4C4JA 4KSPA 3W10A 1IEPA 4J71A 1ZAOA 5AV3A 4BL1A 4FVPA 4KD1A 5KKRB 1REJA 2JC6A 3QQHA 4LQMA 1FOTA 3W2RA 2ITQA 4MNEA 4PDSA 4FKGA 3IG7A 4XEYA 3CSVA 5IQIA 4FV1A 1OIQA 5FM2A 2C6TA 3TV7A 4G31A 4MBJA 1JBPE 2OBJA 3Q3BA 3V5LA 2O63A 2XF0A 3DFAA 4BGHA 5M4IA 4OTDA 4L7FA 3CJGA 2ZV8A 4QQ5A 5CYIA 3PPJA 4YHTA 3GCSA 2J6MA 2VO0A 4KKGA 3UQFA 2PVYA 2Z2WA 3OXTA 4TXCA 1R39A 3EFKA 5AR3A 5GJDA 4YU2A 5JFSA 2YITA 1JQHA 3TZ7A 3PXQA 4NW5A 4TYHA 5LVLA 2HIWA 2G2IA 4FKTA 4G3CA 3VHKA 4U40A 3IQ7A 3CXWA 3QCQA 4I4FA 2BPMA 3SC1A 2BMCA 4WA9A 4QD6A 3VJOA 2XNBA 2HXLA 2PZYA 3RCDA 4AX8A 4EOJA 4D2TA 3L9NA 5J8IA 5IA4A 3K54A 3QC9A 1XHAA 3BHYA 5DGZA 4CYIA 2WMUA 3D5VA 5I9ZA 5AP3A 2CCIA 4AWIA 4E7WA 3EHAA 1QCFA 5IQBA 4GG5A 5L8JA 3GQIA 5HE1A 3RVGA 4RIXB 5D9HA 1A9UA 3V6RA 3ZONA 5CLPA 1JKTA 4EK6A 4LYNA 4EYMA 1BL7A 4IJ9A 3AGMA 4EOKA 3DZQA 2CNUA 3ANRA 4JDKA 1UU7A 4MCVA 4YTFA 5IH5A 4K11A 2WMWA 3I4BA 4FUXA 3BGQA 3QKKA 2XKDA 3O8UA 5D41A 3R9HA 1JKKA 4DT8A 2VN9A 3DK6A 4UMUA 2IN6A 2H96A 3LZBA 4DFNA 4YTCA 5C8NA 3MIAA 1M7QA 2JKMA 4L67A 5IUIA 3LFSA 4ITHA 2QHMA 1Q62A 3OCTA 4FOBA 3PE1A 4QRCA 5M56A 2RKUA 3R7OA 4HOKA 2PUPA 1XR1A 4QQJA 4WG4A 1AD5A 2R5TA 3TT0A 1U46A 5IEXA 4QMTA 3SKCA 5M4FA 3MVJA 4EOPA 3WF5A 1ZARA 3KL8A 2X4FA 3FUPA 4LGGA 2DQ7X 2YCQA 2WOUA 3NZ0A 5ANOA 4XJ0A 4IC7A 2ESMA 4TWOA 1OUYA 4LG4A 3FL5A 4EYJA 2PULA 5A54A 3F88A 4E93A 2BILB 2X8DA 2OJJA 4DGMA 1J7IA 5IQFA 1F0QA 5L2QA 4JX3A 3UO6A 4E8AA 4HGSA 3Q53A 4DBXA 2YCFA 3BHVA 3FC2A 2Y8OA 4UWYA 3FC1X 1Y8GA 2C5NA 3W32A 2XYUA 4X0MA 4CRSA 3BYUA 3GFWA 4Y8DA 2V7AA 4BFMA 3Q52A 3GU8A 3AQVA 3NUPA 4AP7A 1QMZA 2RL5A 4EH4A 4FV9A 1IAHA 3UZRA 4KBCA 5KZ0A 4LRMA 2I1MA 2XJ1A 4QMZA 3FQSA 3I0OA 5AIRA 2XBJA 4FT0A 2B9HA 2DUVA 5A3XA 3D9VA 3NW5A 3HNGA 4MXXA 4ZK5A 4ANSA 3LJ0A 3LOKA 4NM5A 1M17A 4MQ1A 2GHGA 5AP5A 5AX9A 3AC8A 3N4UA 2XNEA 1YWVA 4NT4A 2OGVA 4O91A 2XUUA 4XX9A 4BTKA 1ZMVA 3MH3A 1NVRA 4BBEA 5D11A 1PXLA 3DBEA 3DDQA 3UJGA 4FC0A 5BVFA 1GNGA 4EZ7A 2Z7SA 3F7WA 4U43A 1H1QA 4EOQA 3RWPA 3VUHA 4EHVA 1O6KA 4E3CA 2WMSA 1MRUA 2WNTA 2WU6A 5EI6A 3IDBA 3QWJA 2F57A 4XV1A 4C62A 1H25A 4CEGA 4YTHA 2O64A 2PVRA 3BHTA 3ODZX 5F94A 4TKSA 4RWIA 3GUBA 2NO3A 3I81A 4BCHA 4U42A 2GS7A 3R73A 1KV1A 3U6JA 3GC9A 2R3LA 4AZTA 3W2CA 2JFLA 3PXKA 5GJFA 4FTRA 5A4EA 4IB5A 3V5JA 3D83A 4C2VA 4YZDA 4WSYA 4CFWA 5EQPA 2XH5A 2CCHA 2XVDA 3MBLA 3OD6X 4FSRA 3HUBA 5L2TA 1W82A 2W96B 2XP2A 4HZSA 4TTHB 2CKEA 3BU5A 2G15A 5EYCA 4MHAA 3ROYA 2ETRA 4RZWA 4CD0A 3BKBA 4USFA 3GC0A 4IAZA 3HLLA 4QQTA 4Z3VA 2CKOA 2PVMA 4WNKA 3PVWA 3CBLA 4YZCA 1GJOA 4L45A 4PTEA 3KULA 3ORZA 3ORPA 4TZRA 4WD5A 3F5UA 3PA5A 4EQMA 1T46A 2PTKA 1PXNA 4V01A 2XRUA 3QRUA 5DH3A 5DI1A 4GV1A 1YI4A 4P5ZA 3PZEA 4GVJA 4APCA 4IWPA 4M14A 4NM3A 3BELA 5M57A 4FIHA 4B9DA 2EUFB 3ORLA 4FT7A 1XH5A 3GOPA 3P4KA 5IA5A 4BVUA 1M7NA 4AT4A 3Q9XA 4M84A 1V0OA 2HK5A 4C2WA 4A07A 5DR2A 4O22A 4I4EA 4QNYA 4GIHA 2XIXA 1Q4LA 4DEHA 4M8TA 4EH9A 4F70A 4FEVA 4FK6A 2OXDA 2XJ2A 4B8LA 3SOCA 3QXOA 2EXEA 5DBXA 3CTJA 3QAME 3DS6A 4AS0A 1Q99A 1JPAA 4C58A 1WMKA 3R02A 4AGWA 4YC8A 4C36A 3MW1A 4FUYA 2WQEA 4I0TA 2JKOA 1QPCA 3W16A 3VAPA 3A99A 3FZPA 4PMSA 2YM4A 2XKFA 4OLIA 5IMEA 5J7BA 4I5PA 3F82A 4F7NA 5HVKA 5AADA 3WYYA 3L8VA 4C61A 2V55A 4G5PA 2WMXA 4EHZA 3WZJA 2QODA 3O51A 5IQHA 2EB2A 2OIDA 2QHNA 1FBNA 4GJ2A 5CANA 4APPA 4OAUC 2FH9A 4IWOA 4YJVA 2VTJA 3PDTA 3F3UA 3COMA 2BRGA 2PZRA 4ZMFA 5FM3A 3W8QA 4HPUE 4CG9A 2BHEA 4G3GA 3R8PA 5AA9A 2FSLX 5F1ZA 3QCYA 1JSUA 4GFGA 3TV4A 5AUUA 4EZ3A 3WE8A 3ZTXA 4CKIA 2C47A 5AWMA 4LOQA 1YHWA 5AMNA 4WOVA 5C4LA 3DK7A 1J1CA 1UWHA 2ZM4A 3ETAA 3MN3A 3MY0A 4FTOA 4ZSEA 4AZWA 2O0UA 4Z16A 5CALA 3AMBA 2J0JA 1Z9XA 1H26A 3O17A 3R7VA 4FTAA 4GRBA 4V04A 4RMZA 4D5KA 5I0BA 2PYWA 2HWOA 3QZGA 4RWLA 3DTWA 2FB8A 4O21A 3QTQA 1J3HA 4NIFA 3CP9A 4QTDA 3VHEA 2Y9QA 2XK7A 2OICA 3F7ZA 5E8WA 5DE2A 3O8PA 3RPOA 5FP5A 2C0IA 2OJ9A 5AP7A 3A7FA 4BCMA 5E8SA 5J7HA 5JZNA 2IVSA 4L3JA 3UIBA 3RWQA 2XMYA 3QRIA 4JS8A 4ACGA 4CV8A 5AAEA 4IANA 3TUBA 1XKKA 4ZTSA 3K2LA 5HE2A 2QOKA 2OW3A 5CF8A 2GQSA 4X6RA 4YJSA 4D1ZA 3LKMA 1UNGA 1Q8YA 3FKNA 3V5PA 1U54B 2C30A 3KXNA 2JIIA 4RWJA 2YIYA 3FEGA 4AZFA 3P7BA 3L9PA 3OF0A 3O7LD 3FI4A 3G9NA 2BVAA 4FKOA 4H1MA 4C4HA 3IGOA 2CJMA 4E6AA 2IZSA 3GU5A 4GS6A 4JIKA 3HMOA 3TKUA 3VUKA 5KMLA 2X0GA 5ACKA 3ZS5A 4RLLA 4D9UA 4CMOA 4C59A 4XH6A 4CV9A 2W7XA 3AD5A 3TZMA 5KO1A 1P4FA 4G34A 2ITWA 4V0GB 1OKYA 3BLRA 5JK3A 4NK9A 2OFUA 4RJ5A 5A14A 3KREA 1R78A 3HMPA 4FVQA 4B6LA 3G6GA 2C3JA 4DEEA 4MK0A 1BI7A 3ULIA 2R3MA 3FZTA 4H05A 3N9XA 3LCSA 5J9LA 4I92A 4OTIA 4Y73A 3RAKA 5A6NA 4I5CA 2FO0A 1ZY5A 4IXPA 1K9AA 2KTYA 3BX5A 2B0QA 3IPHA 3GVUA 2DWBA 3OY1A 4JBOA 1CM8A 5HIEA 5L8KA 1LP4A 4KS7A 1MUOA 2J0MB 1WZYA 3EN9A 3NEWA 5LMBA 1OL5A 2I40A 4UEUA 2NPQA 2G2FA 3E3PA 3EB0A 3VVHA 1H0WA 2CDZA 4FTIA 4O2ZA 3WZKA 5LARA 2UZOA 2UZDA 3DNDA 3EYHA 4XLIA 2BZHB 4AFJA 5TO8A 2P2HA 3P0MA 4F7LA 2XBAA 2PE0A 4ZS0A 3AT4A 5C1QB 4AUAA 2PE1A 2ZDUA 3ERKA 4D1SA 1OBDA 3C4ZA 3QL8A 4NTSA 5HGIA 5AIKA 4MVFA 3MFRA 2YLFA 4QMYA 3GT8A 4FV5A 4L00A 4MBLA 4NKSA 4EH3A 5GZAA 4DCEA 5J5SA 1CKJA 4F09A 4DG0E 3MS9A 4ACDA 1PYXA 2JKKA 1SNXA 4V0GA 4CSVA 4UYAA 5HIBA 3B2TA 4IZAA 4U7ZA 3UIUA 3QRKA 3CQWA 2XK6A 5F9EA 3JUHA 2ONLA 3EQCA 4RA5A 3R8VA 4K77A 5BVKA 3RM6A 3PJ2A 5ETIA 4UYNA 2XA4A 3PLSA 1WCCA 5L4QA 2UW4A 2JAMA 5F95A 4FICA 1JNKA 5HG5A 3FWQA 4ACCA 2ZYBA 2WMAA 3RNIA 2VZ6A 2QVSE 3F9NA 5B2MA 3OEZA 4FTCA 5BX0A 1OECA 5CSHA 5BNJA 2ZDTA 4ZMEA 4QPSA 4H3QA 3CR0A 5C9CA 5DT3A 5HNGA 1JSTA 3G5DA 3NAXA 4S34A 4RQVA 4JI9A 4RFYA 1BI8A 2XNNA 3BGZA 1ATPE 1X8BA 2WMRA 1WBVA 4QTEA 3IK3A 2YM8A 5KMOA 2PZ5A 2HZ4A 1KOBA 3QXPA 2ZB0A 4KNBA 3FMMA 4ZTRA 4AN2A 2QO7A 4RX5A 4CFXA 3SG8A 4BR3A 2R3RA 1XBCA 4BIDA 3KN5A 5EM8A 4QPAA 1RW8A 1W84A 3QD2B 2B53A 3DLSA 5EM5A 1Z5MA 5CAUA 4IZYA 3U54A 3OW3A 2OXXA 4ZXTA 2BKZA 4IZ7A 1UU3A 2XEZA 3ZMMA 3UQCA 3NMUF 4WG3A 3D2KA 5T3QA 5C01A 3QUDA 4TT7A 4X2JA 3TUDA 2XK4A 4D9TA 3RPVA 5I9XA 4MAOA 2JAVA 1XH6A 3GB2A 5AP1A 4BDEA 3TIZA 2XEYA 1ZZ2A 3B8QA 3DBQA 3VQHA 2CN5A 1VYWA 5IA3A 3UC4A 1SVHA 3PWYA 5I9UA 3SXRA 4C3FA 2BIYA 3KEXA 3VUDA 2OF4A 2YJRA 3KXMA 4J95A 1IA8A 4JLCA 1CSNA 5ETCA 4WNPA 5EYDA 5M51A 3AC5A 3OVVA 2C5YA 2P2IA 4PMMA 5CF6A 2QOBA 3OEFX 5HI2A 2VV9A 3F5XA 4FEXA 4AA0A 1PW2A 4F6UA 2CKQA 3FLWA 3D0EA 3QZIA 2H8HA 3OCGA 3VS5A 3KULB 4FSNA 4EQUA 4ZAUA 4KRDA 1OB3A 5J87A 4QMPA 3F5PA 5JEBA 2XM9A 2F49A 4ANNA 1WVYA 3EQPA 4D4VA 3PJ8A 1H28A 2QOFA 3NWWA 4A7CA 5JFWA 4AE6A 2WTVA 5EHLA 4M69B 4QMVA 4U41A 4IWDA 3ULZA 3A7JA 2J0IA 3PJCA 5E7RA 3VULA 3UYSA 5FWKK 3OFMA 2VO3A 5CEIA 1VZOA 2UZUE 2WQMA 3NUUA 3WARA 1OPLA 2JBOA 4Y46A 4BYIA 4CMTA 4X3FB 1W83A 4CFFA 5H3QA 2IVUA 3KC3A 4NFNA 4R3RA 4DYMA 1Q8TA 5E90A 3ZLWA 4ZSGA 4C7TA 4ZJVA 2XCKA 5FGKA 1DI8A 4DLIA 5E1SA 4I23A 2ITNA 3ORTA 5HCZA 2WELA 3UVRA 1JVPP 4U45A 5K0KA 2PMLX 2CKPA 3HAMA 4PPAA 4WRSA 3UO5A 2YIRA 3NPCA 3R7EA 5BUEA 5IUHA 3V8WA 4GU6A 3F66A 4IQ6A 4JRNA 4OUCA 5FEQA 1O6LA 5HO6A 4G1WA 4BWKA 3QUEA 4X6QC 3GENA 4KIQA 4FV0A 4BDJA 1WBWA 3V51A 5FG8A 4BWXA 3A7GA 4BGGA 2PY3A 4ZLYA 3WZUA 3R9RA 2F4JA 1XO2B 3FZSA 2W9ZB 4RC4A 4Y72A 5LVMA 3UVQA 4QP3A 3AC2A 3RM7A 4EEVA 4GL9A 3NUAA 4FK3A 2PZIA 3GBZA 2BDFA 2HY81 3QGYA 2VTSA 4FTUA 4O84A 4I1ZA 5J1VA 2J2IB 2LAVA 4DH3A 1R3CA 2UW7A 4DH5A 3Q4TA 4DFLA 5HO7A 2O3PA 2CHLA 5HVJA 2G9XA 3MA3A 4AAAA 2RIOA 1ZRZA 4OBOA 3GGFA 3ROCA 4FR4A 1Y91A 2IPXA 4Z7GA 3HYHA 4MD9E 4RVLA 4F1TA 3DV3A 2B9IA 4DE4A 4CNHA 1OZ1A 1IASA 4DGNA 5J5TA 4NJ3A 5HBJA 5JGBA 4USDA 4I24A 5JGAA 3IO7A 3QTUA 1PXIA 4IC8A 1BL6A 4NTTA 5HICA 3ZU7A 2A19B 5BYYA 4FEUA 2PSQA 1ZYDA 2PZPA 3Q6WA 3W8LA 5KKRC 3BYOA 3POZA 3EH9A 3NUSA 4S2ZA 4UMTA 4XOZA 4CCUA 4EHGA 4W8DA 3Q2MA 1E9HA 5CQWA 4U5JA 2WTWA 2W4OA 3NW6A 4RVMA 3W2SA 4BDAA 3HEGA 4EI4A 4QMSA 5DVRA 4AT5A 1REKA 2YJSA 4W8EA 3DJ7A 3NAYA 2VTTA 4C34A 2YZLA 3C9WA 3PPKA 1YQJA 3ODYX 2NRYA 3OUKA 5CEMA 3E64A 3NNUA 1KE7A 5KE0A 4Z7HA 2VX1A 3OBGA 4FV3A 3W2PA 2ITOA 5HTCA 2SRCA 4QMXA 3RHKA 1OIRA 4XUFA 4TYJA 3WF7A 2XK8A 5H8EA 5LOHA 1GIHA 4MF1A 4LOOA 2QCSA 4IACA 1M2QA 4L46A 3FLSA 4PRJA 3TTJA 1GZOA 4NWMA 1M2PA 4ZZNA 5K5NA 4WKQA 3ZEPA 3MGYA 3UE4A 5TR6A 2VWWA 3VS7A 1H4LA 4FSZA 3VN9A 1U4DA 4BCGA 5HLNA 5EOBA 5K5XA 2W06A 5ANJA 3WE4A 1HCLA 3KN6A 4PY1A 4R1YA 3C13A 3AD6A 4ALVA 2XS0A 3BIZA 1SYKA 5K0XA 4PDOA 4BTJA 3MV5A 4ZTMA 4YHFA 3RPYA 3BEAA 1NT2A 3D14A 4N0SA 2F9GA 2YIQA 3TNHA 2VWUA 4F9WA 4CZTA 5IKWA 4C57A 2QKRA 4QTBA 5DEYA 4CFMA 2PMIA 2QR7A 4DGGA 3TG1A 3S95A 1P2AA 3ZBFA 2QOIA 2IO6A 2UW9A 1PMVA 3MVHA 4J7BA 4E26A 5FXQA 4R7BA 2A2AA 3II5A 2JITA 2X1NA 3OW4A 3ZO3A 3KCKA 3G0FA 2WZJA 3A8WA 4UMPA 4ZJJA 2YDIA 3C0GA 1Y6BA 4F08A 3QQUA 4BDFA 4UZHA 2CGXA 1OITA 4R6VA 2WB8A 3COIA 4UX9A 1H00A 2BDJA 4PTCA 4S30A 4FT9A 4UMQA 4AF3A 2W4JA 5CASA 4DAWA 4AOJA 4O27B 5CY3A 3M2WA 4IVDA 4XG7A 2GFCA 1O9UA 3C5UA 2GHLA 4GCJA 3F2NA 3IECA 3PY1A 4X3JA 2IW6A 1BUHA 2RFEA 4YZMA 3ZDIA 1OPKA 4WO5A 5AUWA 5G1XA 3PRIA 3PUPA 5AR5A 3BEGA 3QTZA 4GYIA 4IJPA 2O65A 2V22A 1IG1A 4UV0A 4I5HA 5BUJA 1UV5A 4GUEA 5E9EA 3TCPA 3F6XA 2XKEA 5EYMA 4G6OA 5A4CA 4DEAA 3N4VA 3DDPA 3A4PA 2V5QA 3VWAA 4Z55A 3PG3A 3TIYA 3GCVA 4N4SA 4AW0A 4G6NA 4BICA 4FV8A 1YHSA 2OFVA 4QO9A 2YACA 3DCVA 2RFNA 4X2FA 5DIAA 3RZBA 2ITVA 3NCGA 1J7LA 3KVWA 5IEVA 3G0EA 4HYIA 1DI9A 2ZJWA 3PE2A 3NVKI 2W17A 3LFDA 4CTCA 4EWQA 2C6DA 2QOCA 2OK1A 4DG3E 2YZAA 5J95A 3HV6A 2VTLA 5GHVA 4GFMA 4ZEGA 3WIGA 5FQDC 2GU8A 3R6XA 4L9IA 5EFQA 2B55A 2ETKA 2HCKA 2VTQA 2WHBA 3DK3A 4IDTA 3R9OA 3LE6A 4QP7A 4QMNA 1WFCA 5I9VA 3E8NA 2J90A 3LFFA 4KBKA 1PJKA 3CD8A 4FTTA 2QNJA 3VC4A 2O2UA 4MEDA 3VS1A 4NM0A 4HW7A 4BC6A 5BVDA 1PRYA 2BTSA 3QQFA 2C3KA 3A60A 4YJNA 3GOKA 3CQEA 4UZDA 2LGCA 5DNRA 3NRMA 4G2FA 4ZY5A 3M11A 2JKQA 5AUXA 4IFCA 4QP6A 1GZ8A 2WIPA 5DYJA 1PXJA 2XM8A 3LVPA 4MNFA 3WBLA 3TKHA 3AGLA 3CTQA 4FX3A 4I0RA 2JLDA 4KIOA 4N6ZA 5B0XA 1ZY4A 3MH1A 4FL1A 4YO6A 1KOAA 2P4IA 3DXPA 4ZS4A 3CD3A 5DHJA 3SQQA 3ZM4A 3E93A 3Q9YA 4XBRA 3GU7A 5EW8A 3NYNA 3UTOA 4DH8A 3C1XA 4FODA 1PXOA 3EQGA 4RJ7A 2Z60A 4QPMA 4WG5A 4AOIA 3TEIA 2C5VA 4BZDA 3QTSA 4AZEA 5IZFA 2UVZA 4IAKA 5E1EA 5M4UA 3ZUVA 2BZIB 3KF4A 5FD2A 2R2PA 2XYNA 4JVGA 3HAVA 1JWHA 1FGKA 3PJ3A 2C3LA 1H8FA 2YDKA 2WQOA 3ZC5A 5IPJA 3CJFA 2QQ7A 3OY3A 3S2PA 2HZIA 2WMVA 5BUIA 3P86A 2ZV2A 4OTGA 5AR4A 2UZLA 1JKLA 3FZ1A 5L6WL 3QX4A 2Z8CA 3KXZA 2I0YA 2WPAA 3U51A 2XNPA 4IW0A 2E9OA 5C26A 5I5ZA 4EBVA 1ZMWA 3BHHA 4L52A 3PP0A 1IRKA 3F3VA 3GQLA 2BHHA 4XG8A 4ARKA 1FQ1B 4DN5A 5CEPA 1ND4A 4R3CA 5IISA 2X6EA 2I0EA 2PL0A 3Q60A 5A9UA 1TKIA 1ZYJA 1AGWA 4YO4A 4O7ZA 3KMMA 2UW5A 3TM0A 3R1QA 4JOAA 5HD7A 4HVIA 2WTKC 3DPKA 4PDYA 3ZM9A 1MP8A 4ANMA 1Q97A 4EL9A 3R21A 4YR8A 3RPRA 4D0WA 2VNWA 4JDHA 4QYGA 4FKLA 3D5XA 3F3WA 2WD1A 2QLQA 3VIDA 2XJ0A 3BE9A 2GQRA 5GZ9A 2IW9A 2ZAZA 4B7TA 4DG2E 4RX8A 3UG2A 3D5UA 4FT3A 3OUNB 1GIIA 3EFWA 4W9XA 3MDYA 3A8XA 4UMRA 4HCTA 5G6VA 5IMXA 4AW5A 4C02A 3VS0A 2OO8X 3MH2A 4JR7A 4S32A 3ZLSA 4I6BA 3OG7A 5CT7A 2WTDA 3CCNA 5L2IA 3CTHA 4E73A 4F0GA 4Q2AA 3ZFXA 3EKNA 2JDOA 1M52A 3AC1A 4PMPA 4DTAA 1PF8A 3V8TA 4WT6A 5IH6A 1URWA 3FL4A 1UNLA 5EK7A 4RJ6A 3LM5A 2JIUA 4HVHA 4YNEA 2XIYA 4IE9A 5LJJA 3ZCLA 3KB7A 5JMSA 1ZLTA 4F65A 5EDQA 3H3CA 1Q3WA 2QKWB 4YP8A 2GSFA 5CU2A 4F63A 1YI6A 4DFYA 4HGEA 5C27A 3EQFA 3DXQA 1J1BA 3S3IA 3OHTA 4R1VA 5J79A 1I09A 3P9JA 4I94A 4MD8E 4B8MA 3E8CA 4C3RA 4G9RA 5D7VA 4O0UA 4HCUA 4W4YA 3ZLXA 4XG9A 3DXNA 3OT8A 4YJTA 4PP9A 3SLSA 3K5VA 2X6DA 3IW7A 3HRCA 3HV3A 2GNIA 4GYGA 5CVGA 2W4KA 3R01A 4Y85A 4ZSJA 4QOXA 4TY1A 4KWPA 2BZKB 3FZOA 4MXZA 4EORA 3EQDA 4W4VA 1K2PA 4JRVA 4YHJA 4I6HA 1KUTA 2EXCX 2OIQA 3FXZA 4FIEA 3K3JA 2HXQA 4PPCA 4BKJA 5CAQA 5F4NA 5J9ZA 5HVYA 5K4IA 3L8XA 5CSVA 2WTJA 4CQEA 1UWJA 3CEKA 1OPJA 3VBWA 3R1SA 4C3PA 5E4HA 5LXMA 3LJ1A 4G5JA 4RGJA 3UQGA 3PA4A 4QMWA 2C6LA 3AC4A 4HGTA 4MWHA 4DINA 2RGPA 1E1XA 3GC7A 3IOKA 3DJ5A 3C4EA 3R2YA 4C0TA 3FQEA 3ZC6A 4DCAA 4YURA 3ZUTA 2CMWA 2CGWA 3QZFA 4H3BA 4BCFA 2ZMCA 2IZUA 3NYXA 3PLAE 4EHEA 3DFCB 4QT1A 4G16A 3MTFA 3RMFA 1H27A 5AR2A 4D2PA 2P33A 3E8DA 3UP7A 1RDQE 5LWMA 3PXYA 4FNZA 5JSMA 3ZYAA 3EQRA 2VWVA 2OIBA 5JQ5A 3PA3A 5BMSA 4JX7A 3ZBXA 5CSPA 3SRVA 3FMDA 4RZVA 5AP2A 2H34A 4CFUA 3OCSA 2PU8A 1L3RE 3FY0A 3HL7A 4ZTHA 5LMKA 1U59A 4FTMA 3BZ3A 3NVMB 4ITJA 4DTBA 2X81A 3P08A 2YERA 4RFZA 1M2RA 2VWIA 3ZO2A 5EHOA 4O0TA 1ZYLA 4AG8A 3KFAA 4B0GA 3A62A 4CCBA 2PMOX 3GI3A 4L7SA 1WVWA 4DBNA 4OW8A 5EM6A 4BDBA 4WHZA 2UW6A 3VS3A 4EC9A 3QKMA 4DEIA 3FJQE 4G6LA 4O38A 3LCOA 4O0WA 1H01A 4JJRA 1DAWA 2X7GA 3CKXA 4BTFA 1UKIA 3U8WA 4ZLZA 4OTPA 5D12A 4U81A 2RF9A 5AP4A 4MX9A 3AT2A 3R30A 4FKPA 4G3FA 2YM7A 5EW3A 3UNKA 3KGAA 4I22A 2BRHA 4RVTA 3VBYA 4JL9A 4D4YA 2UZNA 5K4JA 2X9EA 3TNIA 1GAGA 3E62A 1CDKA 4FEQA 2B9FA 2IG7A 4O7TA 3NUXA 1KE9A 4WSQA 4O0RA 3CS9A 5CU0A 4O81A 4JT3A 4FKQA 1QL6A 2IJMA 5CNNA 1NVSA 4QP4A 2R3JA 3G51A 4YTIA 3SDJA 3ZRMA 3I5ZA 3NCZA 5TOZA 1SZMA 2VWXA 4TWNA 1PXKA 3PPZA 3RAIA 3VRYA 5HLPA 3IW5A 3VW6A 2YAAA 3NUNA 3EYGA 1MQBA 3I6WA 4U0IA 4NH1A 2J0LA 3L8PA 2V0DA 5HORA 2GNGA 2W05A 1VR2A 4CYJA 4J53A 3JXWA 5AAFA 5CENA 3O2MA 4F6SA 3PJ1A 4ZZMA 4DHFA 4IEBA 2XIZA 3K5UA 4RIYB 4ANOA 3CY3A 1IA9A 2JDTA 2CNVA 4PP7A 3DNEA 3PY3A 5HU3A 3H30A 3W18A 3LFNA 2QC6A 3H0ZA 4GJ3A 3GU4A 4X2NA 1YHVA 4FTKA 4AXAA 3PSDA 4FG9A 4LL5A 4ANBA 4ZY6A 5HU9A 3G90X 5A6OA 3O0GA 4IMYA 2BAKA 3R8UA 4M0YA 4ERWA 4PL5A 4M12A 4F1MA 3BBTB 3MH0A 4F1OA 2VTPA 4GKIA 5AR7A 2IVTA 2YFXA 4RG0A 4R78A 2CN8A 3POOA 4ZTQA 3RALA 2RSVA 4U8ZA 1WBPA 3CGFA 3L1SA 4FGBA 2BFYA 5C8MA 3KRJA 3QTRA 5J9YA 2BAJA 1PMUA 4QYYA 2PE2A 4AW1A 3CGOA 1UU9A 5H8BA 3DB6A 5CU4A 3ZSHA 2BIKB 3V5TA 2BDWA 4AW2A 3NYVA 1YXVA 3Q5IA 4BCJA 2JEDA 5BPYA 5KMNA 2VO6A 3G33A 3ZZWA 4XYFA 4QYHA 1XH7A 3U4WA 4JXFA 4QMLA 3R00A 2QO2A 5FLFA 4NEUA 4MXYA 3MTLA 2C6MA 2C0OA 4H39A 4LMNA 4U3YA 4YLLA 3IKAA 5HNBA 5HNIX 3PXZA 3EOCA 4FKUA 4JG6A 4BF2A 5CEKA 1OKZA 2E9UA 5GNKA 3GFEA 5K3YA 3GC8A 3MY1A 3Q4CA 4GK4A 4XP0A 4Z9LA 2C4GA 5EI2A 4IX3A 2V7OA 4G9CA 4N70A 4E6CA 5FDPA 3HV5A 3SD0A 2ETMA 3FQHA 3F3TA 5I9YA 1JOWB 1YOLA 3LCTA 4X3FA 2WQBA 5CAPA 4CLJA 2B7AA 4JAJA 3DAEA 3JR1A 4RA4A 3EFJA 3COHA 2J5FA 3CKWA 1YI3A 2R3GA 1LEWA 3E8EA 2GS6A 4AN9A 4FL3A 4Q5HA 2JGZA 4C38A 4AGUA 3HGKA 3V3VA 4PWNA 2BAQA 2E9VA 3CY2A 3QF9A 4BB4A 2J5EA 2B1PA 4O7WA 3ALOA 3D4QA 4FSQA 3TNPC 4BN1A 3I7BA 3RJCA 5I3OA 4DEGA 5DRDA 3R04A 4QQCA 4EONA 4GFOA 1G8SA 4CLIA 3TJCA 1GY3A 4KA3A 2OJGA 3LXKA 1ERKA 2GCDA 1PKGA 2R3KA 2FGIA 1WAKA 2Y4IC 4FKIA 4ID7A 2QI8A 4QP9A 3SV0A 4H58A 4ALUA 5AUTA 2R7BA 4HJOA 5A4TA 5CAOA 4IAFA 5HCXA 3DBFA 1U5RA 4RJ4A 3SRVB 3WF8A 2ITZA 3NS9A 5JT2A 4AT3A 4EOMA 1FGIA 4HZRA 5E8XA 1XH4A 5HD4A 5HE3A 2WTKB 4H36A 3R7UA 2ZM3A 4ENYA 5AFVA 3VUGA 1YXXA 5BVNA 3JY0A 2EB3A 2GS2A 4J96A 4M13A 4ZIMA 5HX8A 4MNEB 3Q5ZA 3W55A 1TQPA 4OAVB 1DM2A 4CKRA 3N51A 3Q9WA 2C1BA 5HZNA 3HECA 2UZTA 2BUJA 3Q9ZA 1CMKE 2EXMA 4HYHA 2W1CA 3ITZA 1U54A 2ACXA 4U44A 1Y6AA 1UU8A 3LAUA 4FI1A 5DRBA 3FPMA 5FTOA 3RPSA 2YEXA 3R83A 5IU2A 2REIA 5GIOE 1YXSA 3RZFA 3PWDA 3H0YA 2VTMA 4YMJA 3B8RA 1BMKA 1STCE 3ALNA 3QYZA 3R9DA 5AA8A 5FTQA 2ITYA 3FYJX 3VBTA 4BHNA 4EKLA 2C1AA 4D2WA 3VW8A 2QLUA 5A4LA 3LW0A 3BLQA 2FYSA 2YA9A 4TYIA 3DY7A 3FXXA 3V8SA 4O7RA 4YPSA 1PXMA 5HBHA 3LQ5A 1Y8YA 2F7EE 5E92A 3LXLA 1YOJA 3LQ3A 1VEBA 4XOYA 3F61A 3TZ8A 4GEOA 4FKRA 4J98A 3F5GA 3QTWA 4F6WA 4KAOA 3Q6UA 5IDNA 5HTBA 3QWKA 4I0SA 2HZNA 3HA6A 3DZOA 3SW7A 4E6DA 4F4PA 1XBBA 1ZYSA 2AC5A 3MJ2A 4UY9A 2PVKA 4IAIA 2YM3A 3OS3A 5IQGA 4RVKA 4M3QA 3BWJA 4U3ZA 3U6HA 1MRVA 1YWRA 2W1DA 5DG5A 3RINA 2XK9A 3MESA 3EN6A 4G3EA 3ORKA 2NNWB 3AG9A 5FXSA 1W0XC 3KMUA 2XKCA 5IA1A 3FSKA 4Y83A 4L6QA 5DEWA 5JN2A 5L6PA 4RIOA 3NR9A 5A46A 1UVRA 4RQKA 5JRSA 2GTNA 3ENHA 4ZTNA 3U55A 4L3PA 1PMNA 5DPVA 3BI6A 3R7IA 4BCKA 1V0PA 4B99A 4BDCA 3FMJA 4FIJA 4IX4A 4RIYA 4CMUA 2VNYA 3MFUA 4R77A 4KIPA 2X7OA 4FV2A 4PNKA 3AC3A 3UIMA 4ORKA 4NIFB 4EC8A 3MA6A 4FF8A 3UBDA 4EUTA 5H8GA 2UW0A 5HX6A 1H08A 5AUYA 3VBVA 2E9PA 3O50A 3NLBA 3NNXA 3P23A 4NKAA 4QP2A 3QHWA 4YJQA 3HX4A 5IQDA 3KY2A 1Q3DA 5FEDA 3TUCA 2YIWA 3R8MA 4HVGA 3C50A 3FLYA 3RK5A 4DGLC 4QNAA 1H07A 2ITPA 2HYYA 1PMEA 1K3AA 2X4ZA 3HKOA 3JS2A 4TNDA 3CC6A 4YJRA 3LJ2A 3BCEA 5ETAA 2OXYA 3UYTA 2XK3A 3ENMA 5FRIA 4FBXA 4M0ZA 3T8OA 5KMKA 3PVUA 3ZUUA 2Z02A 3JVSA 5I3RA 3EKKA 4X7QA 4WBBB 3U87A 2QURA 1G3NA 4FMQA 4ASDA 2R3OA 2Y6MA 5D10A 4CZYB 3FMLA 4PMTA 3RAWA 2CGUA 4FZDB 4TN6A 4E4NA 1FMOE 4GU9A 3DQWA 4WNOA 4BRXA 4L53A 2Z7RA 2E2BA 2I0HA 1HOWA 2YM6A 4XLVA 4YJPA 3SHEA 4P2KA 2X2LA 5LWNA 2BALA 1XWSA 3UG1A 4KB8A 3M42A 3UVPA 4AFEA 1PXPA 3DT1A 1VJYA 4O86A 4LL0A 1YVJA 3C4XA 1WVXA 1OGUA 1ZOEA 2VU3A 4FV4A 2NP8A 1B39A 4FYOA 4L01A 4Y5HA 2EU9A 1Q8WA 3UODA 5J1WA 5KBRA 5CU3A 4EK5A 2XB7A 1TQMA 5CT0A 3SG9A 1Q5KA 3OC1A 4C4IA 4DC2A 5EH0A 1QPDA 1T45A 3RGFA 4Y5QA 3RAHA 2OI4X 4FIFA 3HDNA 4RIXA 3ZLYA 4O7NA 2B9JA 4CT2A 3CPCA 4QMOA 3ATSA 4RJ8A 2QOLA 1UNHA 2C6KA 3TDWA 4ASXA 3ZO1A 3ZXTA 4HNIA 4FG7A 3W1FA 4GSBA 5CU6A 3RP9A 4TRLA 3D15A 4D4RA 1A06A 1B38A 3KKVA 3R63A 2GNFA 4M7IA 1YDSE 3BYMA 4FTQA 2OF2A 3DBCA 4NFMA 2W1ZA 4D2VA 3OWJA 5EKOA 4YUQA 4FSTA 1DS5A 3AMYA 4JBQA 3SW4A 2R64A 5JZJA 4EBWA 2C6EA 2PMNX 4QP1A 4E4MA 4CQGA 3U4UA 3LFEA 1SM2A 4JIAA 3OTVA 5KMMA 1YXTA 3JVRA 4EH7A 4EKKA 5M44A 2FSMX 1GZKA 4AGDA 1SVEA 5M4CA 2Q0NA 2O8YA 1P14A 2CSNA 1HCKA 3IW6A 1LEZA 4M15A 4NZWB 4HYSA 2UW8A 5B2KA 2W1EA 4FT5A 1YDRE 2B52A 4WUNA 5DA3A 3TTIA 3ORIA 3KXGA 4P90A 3VBQA 5M08A 1ZYCA 3ZXZA 5CF5A 4DA5A 4HNFA 2VO7A 4BCPA 5KHWA 2XNGA 3A61A 3AT3A 3C4CA 3FE3A 3KCFA 4RIWB 4ZZOA 4O0YA 3VBXA 4A4XA 1Z57A 3CIKA 3I79A 4R5SA 2I0VA 3EQIA 2YN8A 4IFGA 3QD3A 4OR5A 4S33A 4FZ6A 4OT5A 3UOJA 3FY2A 4RPVA 4DGOA 5KUPA 3C0IA 2NRUA 4O0VA 4O0SA 4Q5EA 2VUWA 2YDJA 4L8MA 5TE0A 3UMWA 1JSVA 4XV3A 4AQCA 3HRBA 3TNQB 4A06A 3EMGA 1UKHA 3MFSA 4W9WA 4H3PA 2VTHA 2YCRA 2RFDA 1G8AA 5F20A 2VGPA 5ITAA 5KZIA 4LMUA 5AEPA 4AA5A 3ZZEA 3MFTA 4E4LA 4OTQA 1MRYA 3EL8A 5B7VA 5E8ZA 4MXCA 5HG8A 3LQ8A 5BVWA 3DAKA 3QGWA 3JPVA 3PFQA 2OZAA 5EKNA 5IDPA 4ALWA 1OIYA 4LFIA 1RQQA 1BLXA 3IW8A 3REPA 4YGAA 2HAKA 2WQNA 4D55A 4E1ZA 4F9AA 5AP6A 4R7IA 4F9BA 5AR8A 5HIDA 5AV4A 3C51A 4QMUA 2JIVA 2X2KA 3TZ9A 4KUJA 3EQHA 4JG8A 2G2HA 2J9MA 3VS4A 3AOXA 3ELJA 5ANEA 4ASEA 2WMQA 4I3ZA 5JH6A 3L9LA 3R7YA 2W1IA 3RNYA 3KQ7A 4AZVA 4EOLA 3FBVA 2JD5A 2F7ZE 2XIRA 5CSXA 5ACBC 2QOHA 4FVRA 4D4SA 4YNOA 3MPMA 3PP1A 5CZHA 3UO4A 2VTAA 3ORMA 3W33A 5L3AA 3PVBA 4BKYA 3QA0A 2QOOA 2YLEA 3GCPA 5KMIA 2X7FA 2ZOQA 3VRZA 4BI2A 4Q9SA 4XRLA 5FXRA 3TXOA 2IZTA 2P3GX 3MI9A 4IB0A 3C4WA 3LMHA 3E7OA 1GOLA 2QD9A 3EFLA 3HV7A 4PQNA 4JQEA 2OLCA 3ORNA 4IX6A 4CGAA 2RG6A 3IW4A 5KMJA 3AMAA 4FKSA 2BRMA 3S00A 3SXSA 3AXWA 4YC3A 5HLWA 2IW8A 2OZAB 3KRWA 2HZ0A 2PVNA 4ZJIA 3BYSA 4QMMA 3VUMA 4YJUA 2XZSA 1R1WA 2GTMA 2GDOA 3IDCA 4IVBA 4IX5A 4MF0A 3THBA 5JKGA 1G5SA 2BTRA 4YBKA 3HDMA 5HG9A 3IDPA 3C4FA 2W1GA 4FV7A 5M07A 4NCTA 3HMNA 4GT3A 4ZOGA 2W1FA 1H1SA 4YC6A 1LR4A 4UXLA 3IGGA 4PL3A 2WIHA 3UGCA 2JDRA 4UWCA 1CKIA 4BWPA 4N57A 3CPBA 4GK3A 3QKLA 1OL7A 2R0IA 4C4EA 4A4OA 4MXOA 5EG3A 5DT0A 3QTIA 4FKVA 5ANIA 3E88A 3DKFA 3DU8A 3OT3A 3T9IA 3QLFA 4AU8A 5CVHA 2CGVA 3Q96A 5HKMA 3QYWA 3QD4A 3LM0A 4KABA 2QO9A 3BBWA 3LIJA 4KSQA 1XH8A 2R3PA 4WBOA 5E8UA 4C8BA 2Y6OA 4O7LA 5KBQA 2OJIA 5M06A 3LHJA 3QU0A 1JKSA 2UZVA 4XNEA 3UZPA 4FNWA 3R8ZA 1OKVA 1L8TA 4BZOA 1YOMA 4ENXA 3Q2JA 2XIKA 2XNMA 3F3ZA 3KF7A 3O71A 3KMWA 1OM1A 3MIYA 2KULA 3D5WA 3IS5A 4EH6A 4EH5A 2PWLA 4BZNA 3OTUA 3DB8A 3ZDUA 3NGAA 4AN3A 2X39A 4RLKA 4FGRA 4C4GA 2R3NA 2C6IA 2UUEA 4TPTA 4II5A 1BX6A 4FTLA 5EOLA 4F9CA 4OTHA 4EOOA 4XS2A 3G15A 4OT6A 3V5QA 5CXZA 5ANGA 5ANKA 3OBJA 5GIPE 3LXPA 1ZOHA 4BDDA 1Q24A 3TJDA 2WTCA 4EJNA 4C33A 4HCVA 3ET7A 4DTKA 1XJDA 2VWZA 4FA2A 4KIKA 1DAYA 4XMOA 5EQYA 3HV4A 4EOSA 1H1WA 4XRJA 2J7TA 2F2UA 2VTNA 3HP2A 3MYGA 4D0XA 3QCXA 4NJDA 4HVSA 5CF4A 4JNWA 2J4ZA 4FTJA 3KA0A 1PYEA 3VS2A 5E8TA 1S9IA 2OH0E 4EZ5A 4O82A 3OP5A 2A4LA 4ITIA 3GXLA 2PHKA 4JDIA 1FPUA 3R22A 3A2CA 3GEQA 4C35A 1J7UA 4FE2A 4PV0A 4I6FA 1XH9A 5CSWA 4OTWA 4UXQA 3SOAA 5IEYA 5JRQA 3GNIB 4YZNA 3OXIA 5B2LA 5IG1A 5M55A 4RRVA 2Y7JA 3LFBA 4J8NA 1LPUA 1WBTA 3EIDA 5C03A 3RK7A 4FSWA 4GG7A 3S0OA 4XP2A 5DR9A 3I7CA 3UOHA 5KX8A 2Z7QA 4U97A 3R71A 2PVLA 2ERKA 3FLQA 1WBOA 3P78A 2OJFE 3BRBA 4KKEA 3PY0A 3FZRA 3OZ6A 4KKHA 3MWUA 2Q83A 4NYEA 4LV8A 4KBAA 4D5HA 4PF4A 3SX9A 5HHWA 4B4LA 1VYZA 2ITUA 2ONLC 1KWPA 4K6ZA 4KIKB 2OWBA 1I44A 2JDVA 4RWKA 5LCJA 3PYYA 3MB7A 3SVVA 4FIIA 4PTGA 4U9AA 4UBAA 4USEA 2P0CA 3SA0A 2WXVA 3ZOSA 4NCTC 4IM0A 4BBMA 5H2UA 2VD5A 3A4OX 1XQZA 2UVXA 1TQIA 1YW2A 3NDMA 3OCBA 1Q61A 3DKGA 4HPTE 4J97A 4PUZA 2WOTA 3UIXA 4CFVA 3WOWA 4I6QA 2YM5A 4DT9A 3QQGA 5AP0A 4EK4A 3O23A 3O96A 4ZY4A 3OOGA 3QD0A 4EH8A 2PUNA 3C5IA 3FI3A 5BVEA 3H9FA 2QG5A 4YBJA 4BCOA 2YHVA 3V01A 4XP3A 4JAIA 2WU7A 3E92A 3I0QA 4HVDA 2WAJA 1YKRA 2H9VA 3EN7A 1YWNA 3UPXA 2BRBA 3UOKA 2HY0A 4RSSA 3F69A 5HG7A 1OBGA 3QQJA 3NNVA 3PSBA 4PL4A 1J91A 2VTRA 1F3MC 2VWYA 1RJBA 3NW7A 3R9NA 5FUTA 4OTFA 4LUDA 2ZMDA 4BTMA 4CT1A 3I1AA 4E5AX 5K9IA 4GUBA 4XG3A 3ZFMA 3TWJA 1E1VA 1IR3A 4M97A 4DFZE 4TYEA 1OVEA 3ZRKA 3BE2A 5AAGA 4J1RA 3EWHA 3W2QA 3PTGA 5FDXA 3VF9A 2WKMA 3Q04A 4LOPA 5HCYA 5GINE 1Y57A 4IH8A 3RBWA 4DITA 3ID6C 1H1PA 4CKJA 3H9OA 2QU6A 2GNJA 4KS8A 4F7SA 4A4LA 4E5WA 3FXWA 3RKBA 3DJ6A 5C4KA 3ACJA 2UVYA 3A7IA 5LVOA 5EHYA 2HW7A 5M53A 4FIGA 5TT7A 4J8MA 3UDBA 3V5WA 1OL1A 2C6OA 5DN3A 3FHRA 4P7EA 2W9FB 2GMXA 4BCQA 4BI1A 4NW6A 1FMKA 4W4XA 4K1BA 4YZ9A 5CS6A 1BKXA 2YCSA 4LGDA 5M09A 5DR6A 1Q41A 4FTNA 4FSYA 5CI7A 4WRGA 5FBOA 3UC3A 3ZSIA 2PK9A 5CXHA 3KU2A 5FEEA 1FVTA 3BU6A 2UZWE 3NIEA 4FSUA 1P5EA 2Y0AA 3BHUA 1ZXEA 3MB6A 4IBMA 3FMNA 4IIRA 2P55A 3UPZA 1V0BA 4R8QA 5GJGA 3NUYA 3P79A 2VTIA 4QTCA 5HESA 1A48A 1ZZLA 1Q8ZA 3VS6A 5HEZA 3HP5A 2C0TA 2QU5A 2WMBA 4M68A 3W2OA 5DFPA 4YSJA 1FVVA 4G3DA 3T3UA 2VWBA 3TACA 4DH1A 3GP0A 3EL7A 3NIZA 3P1AA 3L9MA 3IONA 3PSCA 4K2RA 3ZH8A 3AD4A 4MYGA 2ZM1A 4BIBA 1FVRA 3BV2A 4M66A 2CLQA 2QG7A 3WYXA 4RBLA 3QA8A 1WBSA 3OWKA 4MWIA 4IB1A 4RC2A 5EDRA 2JFMA 1OL2A 4EWHA 5D7AA 2O5KA 4DFBA 2FUMA 3PG1A 3UNZA 2F7XE 4IADA 4DFXE 1LUFA 3G9LX 2Y4IB 4DEBA 4FKWA 5FTGA 3PXFA 5LCKA 4GT4A 4RT7A 3OOMA 2Q0BA 2WO6A 2UV2A 3WZDA 4QTAA 4E20A 2X2MA 3QFVA 4O7SA 2VTOA 4JG7A 2B4SB 3CLYA 4LUEA 2WGJA 4XV9A 2RG5A 4RJ3A 1QPJA 5AV2A 3UOLA 5T68A 5CNOA 2X8IA 3CQUA 3PIYA 4LRJA 5EYKA 2GNLA 4EOIA 5E91A 5H9BA 4L68A 3TDVA 4IHPA 2FVDA 2BR1A 1TVOA 4ZTLA 4KINA 4E4XA 5L8LA 2BCJA 3R1YA 4LM5A 3NYOA 3OMVA 3FMEA 3HUCA 4AZSA 4IVAA 4H1JA 3DOGA 5EM7A 3FDNA 3GCUA 3C7QA 4IM3A 1EH4A 3KXXA 5KNJA 4M69A 3BYVA 4IVCA 4TYHB 4F0IA 4F64A 3WI6A 3QZHA 3H9RA 5KCVA 1H1RA 1PY5A 4O6EA 5BVOA 1ZOGA 1MQ4A 3O7LB 3BWFA 3RI1A 3E7VA 3FYKX 3Q32A 4F99A 2X9FA 2VRXA 3DKOA 2FSOX 2BKKA 3ACKA 3BPRA 3I5NA 3FI8A 4DH7A 5CEOA 5JFVA 3T3VA 1RE8A 2J51A 5LMAA 3DAJA 3WF9A 5CI6A 3VNTA 1F5QA 3HVCA 3PVGA 4K8AA 5AV0A 4C4FA 5ICPA 4ASZA 2CNQA 3LXNA 4QYFA 3D7TA 4XCUA 2ZVAA 3P7AA 4JR3A 3Q4UA 4FZFB 4BIEA 4I41A 5A4QA 3HRFA 3FMHA 3R7GA 2R4BA 2IWIA 5IA2A 4RC3A 5EQEA 3EQBA 3R1NA 3EZRA 3ZHPC 5HO8A 4P5QA 4IZ5A 1ZMUA 3BV3A 3LMGA 3ORXA 2R3QA 3E63A 4R7HA 5FP6A 3T9TA 4K0YA 4BCNA 4A9SA 2Y4PA 4G17A 4BDIA 4CVAA 5IF1A 3UP2A 4W4WA 3QX2A 1OIUA 4A9TA 3SAYA 2QR8A 4AACA 5HQ0A 2IVVA 4IDVA 3U6IA 4GW8A 2WMTA 3NNWA 4M67A 4AA4A 2W5HA 4DEDA 4EJ7A 5GZ8A 2AUHA 2W5AA 3DKCA 4PNIA 2R9SA 5CVFA 1XBAA 1PKDA 3QBNA 5CZIA 3HZTA 5AM7A 1KE8A 3DTCA 4D28A 4F7JA 3PZHA 1OUKA 4FZAB 3QC4A 5EDPA 1B6CB 5ETFA 2CPKE 2UZEA 4U6RA 4QMQA 2R0UA 4NSTA 5BYLA 4WIHA 4NUSA 3VJNA 4WUAA 2WTIA 3WILA 2C5OA 4N6YA 3UNJA 4S31A 3MJ1A 3FLNC 5DLSA 3EJ1A 4J99A 4MD7E 3MY5A 1FINA 2R7IA 2C3IB 1KE5A 2WEIA 3D7TB 3DQXA 3I60A 3FSFA 1OL6A 4JBVA 4MQ2A 2W0JA 3SXFA 5LVPA 1OKWA 2HOGA 3ANQA 1V1KA 5LMKC 5IUGA 2WEVA 4OBQA 4O0XA 3A7HA 3RHXA 5JQ8A 3VQUA 3BGPA 4I93A 4LGHA 4LV5A 4R3PA 4X21A 1H0VA 3P7CA 4UWBA 3NX8A 1URCA 3C0HA 3OXZA 4FKJA 3R28A 4YJOA 4A9YA 4ONAA 3IOPA 4BYJA 3FV8A 2VGOA 3LFCA 3QRJA 4XHKB 5DWRA 3SGCA 1GZNA 1H24A 2UZBA 4OTRA 3UMXA 3QTXA 4O7VA 4TWCA 2YABA 4BBFA 2OH4A 3JY9A 2GNHA 3HA8A 4ACMA 5EW9A 5BYZA 3CE3A 4L43A 2VX0A 4NM7A 5EI8A 2AC3A 4UALA 3V6SA 4D2SA 3WIKA 5FBNC 2ZV7A 4GK2A 4F9YA 4DF3A 3TNWA 3LCDA 3F2AA 4TNBA 3DGKA 2F2CB 2C5XA 2ERZE 1ZWSA 1R0EA 3GU6A 4YSMA 1KE6A 1NY3A 2W5BA 3OWLA 4R5YA 5L2WA 4JDJA 4MXAA 3P5KA 3R2BA 4I20A 4OBPA 4MH7A 4DLJA 4O83A 5IH4A 5CTPA 1R0PA 3B2WA 3N4TA 1AQ1A 3EN4A 4ZSAA 2PVJA 3F2RA 1W8CA 4L44A 2HELA 4QYEA 3MVLA 5AJQA 2RFSA 3M1SA 4TYGA 3H4JA 1S9JA 3KK9A 2PUIA 3JYAA 2GPHA 4CFNA 5AM6A 4CZUA 2B54A 4E5BA 3G6HA 4J52A 4FNXA 3QHRA 4GVAA 4YLKA 1QPEA 4RX9A 3BQCA 3KRRA 3QLGA 4XG4A 4YLJA 4O1OA 3E87A 2ZB1A 5BQ0A 2GFSA 4D2RA 1CKPA 2XRWA 4BDHA 4MTAA 2GQGA 1IAJA 1UA2A 3FHIA 4FZ7A 3D7ZA 5AUZA 2QOQA 2HWPA 4EUUA 5AUVA 5AX3A 4BKZA 4KRCA 2YWVA 3WF6A 4XG2A 3ZFYA 1YRPA 3LCKA 3PIXA 1BYGA 2AYPA 2R3IA 3D94A 3ZO4A 2FSTX 2PVHA 4IAAA 3ZEWA 2C68A 3QQKA 4ZP5A 4UN0C 3DLZA 3FKOA 4JBPA 4RIWA 1YXUA 4QP8A 2QONA 2ZV9A 4E6QA 3VUTA 3FLZA 4BGQA 4MKCA 3U9CA 2DYLA 3LMIA 2G1TA 4BCIA 4ERKA 4NU1A 5HE0A 4A9RA 3DA6A 2OKRA 3I6UA 2W99B 3QUPA 2Z7LA 4IAYA 4XBUA 5DMZA 4C37A 1CTPE 2BZJA 3OWPA 4GKHA 4FEWA 4FYNA 4IB3A 4XG6A 3TI1A 5IQCA 4FL2A 4D1XA 2CLXA 1YDTE 3VF8A 2GHMA 4AGCA 4CRLA 4I5MA 3LLAA 4CG8A 2YWPA 4JQ8A 4X2GA 3LFQA 1P4OA 4O2PA 4BY9E 3G2FA 3RCJA 5I4NA 1OMWA 1NVQA 3HMIA 2VX3A 4K9YA 5HTIA 3TKIA 3H10A 2E9NA 5L6OA 4EH2A 3OROA 4BHZA 3VUIA 4CTBA 3MVMA 4K33A 4EK3A 4EK8A 4L42A 3LFAA 4UB7A 2R3HA 5D1JA 1NA7A 2I7QA 2BROA 3BLHA 1KV2A 4FG8A 5HOAA 4EQCA 2R3FA 3QQLA 3KVXA 4GMYA 2PVFA 2PUUA 3L8SA 4PPBA 4ZLOA 5I9WA 4RFMA 5CWZA 5BMMA 3COKA 3PIZA 4JQ7A 3MSSA 3QALE 5ANDA 4ACHA
chains in the Genus database with same CATH superfamily
4NL0A 3R0TA 2IF8A 2V62A 2YISA 4MBIA 1JAMA 4FSMA 3TN8A 1W7HA 2JDSA 3K3IA 3KRLA 3ZRLA 4YPDA 3EZVA 4D58A 1SNUA 5TKDA 3WZEA 2DS1A 3Q4ZA 4HYUA 4U80A 5JGDA 5KHXA 4YZBA 2C69A 4FV6A 5CX9A 5DOSA 5T6KA 1Q8UA 2PPQA 1O6YA 2XNOA 4CXAA 5IA0A 5DT4A 1U5QA 4LRKA 2J50A 3FPQA 4X3FC 2OG8A 2IZRA 3KIOC 3S1HA 2H6DA 2EWAA 2JBPA 4O96A 5E8YA 1WBNA 2HW6A 3PXRA 3QCSA 3BU3A 3RTPA 3D2IA 3V04A 4LI5A 4AE9A 5JFXA 3FI2A 2OZOA 4TW9A 4DFUA 1NXKA 4FRFA 2A1AB 2OU7A 2G01A 2I6LA 2XCHA 3KK8A 5TF9A 1NW1A 4FOCA 5IQAA 3NSZA 3R8LA 4GIIA 4L3LA 3TV6A 4I21A 4BI0A 4TL0A 1PHKA 3FAAA 2X8EA 4K18A 4Q9ZA 5HBEA 2ITXA 2J0KA 4GT5A 2FA2A 2WFYA 2YAKA 4P4CA 4XV2A 4FNYA 2EVAA 4GH2A 4IWQA 3KRXA 1SVGA 3QRTA 1JLUE 5L2SA 4HGLA 2W1HA 3MPAA 3KXHA 3FKLA 3MPTA 4IM2A 1APME 4O6LA 4OGRA 4O1PA 4RX7A 3ZSGA 4BDKA 2HENA 4WNMA 3E3BX 5C8KA 2VAGA 3HMMA 4TWPA 3LLTA 1OI9A 3RK9A 5LVNA 5IQEA 3EN5A 3GCQA 3O8TA 3S4QA 4A9UA 3E5AA 4BDGA 1M14A 5CAVA 3UZTA 5CEQA 5E8VA 3U9NA 2A0CX 3VO3A 4ANLA 4V05A 2YIXA 3LPBA 4F0FA 4O7YA 2A27A 2OSCA 1SMHA 2ITTA 4PDPA 5CQUA 5AV1A 4AOTA 3PRFA 4PX6A 2BFXA 4U79A 3ATTA 2UW3A 3BQRA 4ZSLA 5LQFA 4X2KA 4ANQA 1KSWA 3FMKA 4Y95A 3TL8A 1GIJA 2BRNA 3DBDA 1W98A 4C4JA 4KSPA 3W10A 1IEPA 4J71A 1ZAOA 5AV3A 3W0MA 4BL1A 4FVPA 1XMLA 4KD1A 3W0NA 5KKRB 1REJA 2JC6A 3QQHA 4LQMA 1FOTA 3W2RA 2ITQA 4MNEA 4PDSA 4FKGA 3IG7A 4XEYA 3CSVA 5IQIA 3TMOA 4FV1A 1OIQA 5FM2A 2C6TA 3TV7A 4G31A 4MBJA 1JBPE 2OBJA 3Q3BA 3V5LA 2O63A 2XF0A 3DFAA 4BGHA 5M4IA 4OTDA 4L7FA 3CJGA 2ZV8A 4QQ5A 5CYIA 3PPJA 4YHTA 3GCSA 2J6MA 2VO0A 4KKGA 3UQFA 2PVYA 2Z2WA 3OXTA 4TXCA 1R39A 3EFKA 5AR3A 5GJDA 4YU2A 5JFSA 2YITA 1JQHA 3TZ7A 3PXQA 4NW5A 4TYHA 5LVLA 2HIWA 2G2IA 4FKTA 4G3CA 3VHKA 4U40A 3IQ7A 3CXWA 3QCQA 4I4FA 2BPMA 3SC1A 2BMCA 4WA9A 4QD6A 3VJOA 2XNBA 2HXLA 2PZYA 3RCDA 4AX8A 4EOJA 3O5AA 4D2TA 3L9NA 5J8IA 5IA4A 3K54A 3QC9A 1XHAA 3BHYA 5DGZA 4CYIA 2WMUA 3D5VA 5I9ZA 5AP3A 2CCIA 4AWIA 4E7WA 3EHAA 1QCFA 5IQBA 4GG5A 5L8JA 3GQIA 5HE1A 3RVGA 4RIXB 5D9HA 1A9UA 3V6RA 3ZONA 5CLPA 1JKTA 4EK6A 4LYNA 4EYMA 1BL7A 4IJ9A 3AGMA 4EOKA 3DZQA 2CNUA 3ANRA 4JDKA 1UU7A 4MCVA 4YTFA 5IH5A 4K11A 2WMWA 3I4BA 4FUXA 3BGQA 3QKKA 2XKDA 3O8UA 5D41A 3R9HA 1JKKA 4DT8A 2VN9A 3DK6A 4UMUA 2IN6A 2H96A 3LZBA 4DFNA 4YTCA 5C8NA 3MIAA 1M7QA 2JKMA 4L67A 5IUIA 3LFSA 4ITHA 2QHMA 1Q62A 3OCTA 4FOBA 3PE1A 4QRCA 5M56A 2RKUA 3R7OA 4HOKA 2PUPA 1XR1A 4QQJA 4WG4A 1AD5A 2R5TA 3TT0A 1U46A 5IEXA 4QMTA 3SKCA 5M4FA 3MVJA 4EOPA 3WF5A 1ZARA 1ST0A 3KL8A 2X4FA 3FUPA 4LGGA 2DQ7X 2YCQA 2WOUA 3NZ0A 5ANOA 4XJ0A 4IC7A 2ESMA 4TWOA 1OUYA 4LG4A 3FL5A 4EYJA 2PULA 5A54A 3F88A 4E93A 2BILB 2X8DA 2OJJA 4DGMA 1J7IA 5IQFA 1F0QA 5L2QA 4JX3A 3UO6A 4E8AA 4HGSA 3Q53A 4DBXA 2YCFA 3BHVA 3FC2A 2Y8OA 4UWYA 3FC1X 1Y8GA 2C5NA 3W32A 2XYUA 4X0MA 4CRSA 3BYUA 3GFWA 4Y8DA 2V7AA 4BFMA 1W2CA 3Q52A 3GU8A 3AQVA 3NUPA 4AP7A 1QMZA 2RL5A 4EH4A 4FV9A 1IAHA 3AKLA 4KBCA 5KZ0A 4LRMA 2I1MA 2XJ1A 4QMZA 3FQSA 3I0OA 5AIRA 2XBJA 4FT0A 2B9HA 2DUVA 5A3XA 3D9VA 3NW5A 3HNGA 4MXXA 4ZK5A 4ANSA 3LJ0A 3LOKA 4NM5A 1M17A 4MQ1A 2GHGA 5AP5A 5AX9A 3AC8A 3N4UA 2XNEA 1YWVA 4NT4A 2OGVA 4O91A 2XUUA 4XX9A 4BTKA 1ZMVA 3MH3A 1NVRA 4BBEA 5D11A 1PXLA 3DBEA 3DDQA 3UJGA 1TZDA 2AQXA 4FC0A 5BVFA 1GNGA 4EZ7A 2Z7SA 3F7WA 4U43A 1H1QA 4EOQA 3RWPA 4O4EA 3VUHA 1O6KA 4EHVA 4E3CA 2WMSA 3UDTA 1MRUA 2WNTA 2WU6A 5EI6A 3IDBA 3QWJA 2F57A 4XV1A 4C62A 1H25A 4CEGA 4YTHA 2O64A 2PVRA 3BHTA 3ODZX 5F94A 4TKSA 4RWIA 3GUBA 2NO3A 3I81A 4BCHA 4U42A 2GS7A 3R73A 1KV1A 3U6JA 3GC9A 2R3LA 4AZTA 3W2CA 2JFLA 3PXKA 5GJFA 4FTRA 5A4EA 4IB5A 3V5JA 3D83A 4C2VA 4YZDA 4WSYA 4CFWA 4F78A 5EQPA 2XH5A 2CCHA 2XVDA 3MBLA 3OD6X 4FSRA 3HUBA 5L2TA 1W82A 2W96B 2XP2A 4HZSA 4TTHB 2CKEA 3BU5A 2G15A 5EYCA 4MHAA 3ROYA 2ETRA 4RZWA 4CD0A 3BKBA 4USFA 3GC0A 4IAZA 3HLLA 4QQTA 4Z3VA 2CKOA 2PVMA 4WNKA 3PVWA 3CBLA 4YZCA 1GJOA 4L45A 4PTEA 3KULA 3ORZA 3ORPA 4TZRA 4WD5A 3F5UA 3PA5A 4EQMA 1T46A 2PTKA 1PXNA 4V01A 2XRUA 3QRUA 5DH3A 5DI1A 4GV1A 1YI4A 4P5ZA 3PZEA 4GVJA 4APCA 4IWPA 4M14A 4NM3A 3BELA 5M57A 4FIHA 4B9DA 2EUFB 3ORLA 4FT7A 1XH5A 3GOPA 3P4KA 5IA5A 4BVUA 1M7NA 4AT4A 3Q9XA 4M84A 1G8JA 1V0OA 2HK5A 4C2WA 4A07A 5DR2A 4O22A 4I4EA 4QNYA 4GIHA 2XIXA 1Q4LA 4DEHA 4M8TA 4EH9A 4F70A 4FEVA 4FK6A 2OXDA 2XJ2A 4B8LA 3SOCA 3QXOA 2EXEA 5DBXA 3CTJA 3W0RA 3QAME 3DS6A 4AS0A 1Q99A 1JPAA 4C58A 1WMKA 3R02A 4AGWA 4YC8A 4C36A 3MW1A 4FUYA 2WQEA 4DHJA 4I0TA 2JKOA 1QPCA 3W16A 3VAPA 3A99A 3FZPA 4PMSA 2YM4A 2XKFA 4OLIA 5IMEA 5J7BA 4I5PA 3F82A 4F7NA 5HVKA 5AADA 3WYYA 3L8VA 4C61A 2V55A 4G5PA 2WMXA 4EHZA 3WZJA 2QODA 3O51A 5IQHA 2EB2A 2OIDA 2QHNA 1FBNA 4GJ2A 5CANA 4APPA 4OAUC 2FH9A 4IWOA 4YJVA 2VTJA 3PDTA 3F3UA 3COMA 2BRGA 2PZRA 4ZMFA 5BV3A 5FM3A 3W8QA 4HPUE 4CG9A 2BHEA 4G3GA 3R8PA 5AA9A 2FSLX 5F1ZA 3QCYA 1JSUA 4GFGA 3TV4A 5AUUA 4EZ3A 3WE8A 3ZTXA 4CKIA 2C47A 5AWMA 4LOQA 1YHWA 5AMNA 4WOVA 5C4LA 3DK7A 1J1CA 1UWHA 2ZM4A 3ETAA 3MN3A 3MY0A 4FTOA 4ZSEA 4AZWA 2O0UA 4Z16A 5CALA 3AMBA 2J0JA 1Z9XA 1H26A 3O17A 3R7VA 4FTAA 4GRBA 4V04A 4RMZA 4D5KA 5I0BA 2PYWA 2HWOA 3QZGA 4RWLA 3DTWA 2FB8A 4O21A 3QTQA 1J3HA 4NIFA 3CP9A 4QTDA 3VHEA 2Y9QA 2XK7A 2OICA 3F7ZA 5E8WA 5DE2A 3O8PA 3RPOA 5FP5A 2C0IA 2OJ9A 5AP7A 3A7FA 4BCMA 5E8SA 5J7HA 5JZNA 2IVSA 4L3JA 3UIBA 3RWQA 2XMYA 3UDZA 3QRIA 4JS8A 4ACGA 4CV8A 5AAEA 4IANA 3TUBA 1XKKA 4ZTSA 3K2LA 5HE2A 2QOKA 2OW3A 5CF8A 2GQSA 4X6RA 4YJSA 4D1ZA 3LKMA 1UNGA 1Q8YA 3FKNA 3V5PA 1U54B 2C30A 3KXNA 2JIIA 4RWJA 2YIYA 3FEGA 4AZFA 3P7BA 3L9PA 3OF0A 3O7LD 3FI4A 3G9NA 2BVAA 4FKOA 4H1MA 4C4HA 3IGOA 2CJMA 4E6AA 2IZSA 3GU5A 4GS6A 4JIKA 3HMOA 3TKUA 3VUKA 5KMLA 2IEWA 2X0GA 5ACKA 3ZS5A 4RLLA 4D9UA 4CMOA 4C59A 4XH6A 4CV9A 2W7XA 3AD5A 3TZMA 5KO1A 1P4FA 4G34A 2ITWA 4V0GB 1OKYA 3BLRA 5JK3A 4NK9A 2OFUA 4RJ5A 5A14A 3KREA 1R78A 3HMPA 4FVQA 4B6LA 3G6GA 2C3JA 4DEEA 4MK0A 1BI7A 3ULIA 2R3MA 3FZTA 4H05A 3N9XA 3LCSA 5J9LA 4I92A 4OTIA 4Y73A 3RAKA 5A6NA 4I5CA 2FO0A 1ZY5A 4IXPA 1K9AA 2KTYA 3BX5A 2B0QA 3IPHA 3GVUA 2DWBA 3OY1A 4JBOA 1CM8A 5HIEA 5L8KA 1LP4A 4KS7A 1MUOA 2J0MB 1WZYA 3EN9A 3NEWA 5LMBA 1OL5A 2I40A 4UEUA 2NPQA 2G2FA 3E3PA 3EB0A 3VVHA 1H0WA 2CDZA 4FTIA 4O2ZA 3WZKA 5LARA 2UZOA 2UZDA 3DNDA 3EYHA 4XLIA 2BZHB 4AFJA 5TO8A 2P2HA 3P0MA 4F7LA 2XBAA 2PE0A 4ZS0A 3AT4A 5C1QB 4AUAA 2PE1A 2ZDUA 3ERKA 4D1SA 1OBDA 3C4ZA 3QL8A 4NTSA 5HGIA 5AIKA 4MVFA 3MFRA 2YLFA 4QMYA 3GT8A 4FV5A 4L00A 4MBLA 4NKSA 4EH3A 5GZAA 4DCEA 5J5SA 1CKJA 4F09A 4DG0E 3MS9A 4ACDA 1PYXA 2JKKA 1SNXA 4V0GA 4CSVA 4UYAA 5HIBA 3B2TA 4IZAA 4U7ZA 3UIUA 3QRKA 3CQWA 2XK6A 5F9EA 3JUHA 2ONLA 3EQCA 4RA5A 3R8VA 4K77A 5BVKA 3RM6A 3PJ2A 5ETIA 4UYNA 2XA4A 3PLSA 1WCCA 5L4QA 2UW4A 2JAMA 5F95A 4FICA 1JNKA 5HG5A 4I6LA 3FWQA 4MUQA 4ACCA 2ZYBA 2WMAA 3RNIA 2VZ6A 2QVSE 3F9NA 5B2MA 3OEZA 4FTCA 5BX0A 1OECA 5CSHA 5BNJA 2ZDTA 4ZMEA 4QPSA 4H3QA 3CR0A 5C9CA 5DT3A 5HNGA 1JSTA 3G5DA 3NAXA 4S34A 4RQVA 4JI9A 4RFYA 1BI8A 2XNNA 3BGZA 1ATPE 1X8BA 2WMRA 1WBVA 4QTEA 3IK3A 2YM8A 5KMOA 2PZ5A 2HZ4A 1KOBA 3QXPA 2ZB0A 4KNBA 3FMMA 4ZTRA 4AN2A 4AAYA 2QO7A 4RX5A 4CFXA 3SG8A 4BR3A 2R3RA 1XBCA 4BIDA 3KN5A 5EM8A 4QPAA 1RW8A 1W84A 3QD2B 2B53A 3DLSA 5EM5A 1Z5MA 5CAUA 4IZYA 3U54A 3OW3A 2OXXA 4ZXTA 2BKZA 4IZ7A 1UU3A 2XEZA 3ZMMA 3UQCA 3NMUF 4WG3A 3D2KA 5T3QA 5C01A 3QUDA 4TT7A 4X2JA 3TUDA 2XK4A 3P5JC 4D9TA 3RPVA 5I9XA 4MAOA 2JAVA 1XH6A 3GB2A 5AP1A 4BDEA 3TIZA 2XEYA 1ZZ2A 3B8QA 3DBQA 3VQHA 2CN5A 1VYWA 5IA3A 3UC4A 1SVHA 3PWYA 5I9UA 3SXRA 4C3FA 2BIYA 3KEXA 3VUDA 2OF4A 2YJRA 3KXMA 4J95A 1IA8A 4JLCA 1CSNA 5ETCA 4WNPA 5EYDA 5M51A 3AC5A 3OVVA 2C5YA 2P2IA 4PMMA 5CF6A 2QOBA 3OEFX 5HI2A 2VV9A 3F5XA 4FEXA 4AA0A 1PW2A 4F6UA 2CKQA 3FLWA 3D0EA 3QZIA 2H8HA 3OCGA 3VS5A 3KULB 4FSNA 4EQUA 4ZAUA 4KRDA 1OB3A 5J87A 4QMPA 3F5PA 5JEBA 2XM9A 2F49A 4ANNA 1WVYA 3EQPA 4D4VA 3PJ8A 1H28A 2QOFA 3NWWA 4A7CA 5JFWA 4AE6A 2WTVA 5EHLA 4M69B 4QMVA 4U41A 4IWDA 3ULZA 3A7JA 2J0IA 3PJCA 5E7RA 3VULA 3UYSA 5FWKK 3OFMA 2VO3A 5CEIA 1VZOA 2UZUE 2WQMA 3NUUA 3WARA 1OPLA 2JBOA 4Y46A 4BYIA 4CMTA 4X3FB 1W83A 4CFFA 5H3QA 2IVUA 3KC3A 4NFNA 4R3RA 4DYMA 1Q8TA 5E90A 3ZLWA 4ZSGA 4C7TA 4ZJVA 2XCKA 5FGKA 1DI8A 4DLIA 5E1SA 4I23A 2ITNA 3ORTA 5HCZA 2WELA 3UVRA 1JVPP 4U45A 5K0KA 2PMLX 2CKPA 3HAMA 4PPAA 4WRSA 3UO5A 2YIRA 3NPCA 3R7EA 5BUEA 5IUHA 3V8WA 4GU6A 3F66A 4IQ6A 4JRNA 4OUCA 5FEQA 1O6LA 5HO6A 4G1WA 4BWKA 3QUEA 4X6QC 3GENA 4KIQA 4FV0A 4BDJA 1WBWA 3V51A 5FG8A 4BWXA 3A7GA 4BGGA 2PY3A 4ZLYA 3WZUA 3R9RA 2F4JA 1XO2B 3FZSA 2W9ZB 4RC4A 4Y72A 5LVMA 3UVQA 4QP3A 3AC2A 3RM7A 4EEVA 4GL9A 3NUAA 4FK3A 2PZIA 3GBZA 2BDFA 2HY81 3QGYA 2VTSA 4FTUA 4O84A 4I1ZA 5J1VA 2J2IB 2LAVA 4DH3A 1R3CA 2UW7A 4DH5A 3Q4TA 4DFLA 5HO7A 2O3PA 2CHLA 5HVJA 2G9XA 3MA3A 4AAAA 2RIOA 1ZRZA 4OBOA 3GGFA 3ROCA 4FR4A 1Y91A 2IPXA 4Z7GA 3HYHA 4MD9E 4RVLA 4F1TA 3DV3A 2B9IA 4DE4A 4CNHA 1OZ1A 1IASA 4DGNA 5J5TA 4NJ3A 5HBJA 5JGBA 4USDA 4I24A 5JGAA 3IO7A 3QTUA 1PXIA 4IC8A 1BL6A 4NTTA 5HICA 3ZU7A 2A19B 5BYYA 4FEUA 2PSQA 1ZYDA 2PZPA 3Q6WA 3W8LA 5KKRC 3BYOA 3POZA 3EH9A 3NUSA 4S2ZA 4UMTA 4XOZA 4CCUA 4EHGA 1VLRA 4W8DA 3Q2MA 1E9HA 5CQWA 4U5JA 2WTWA 2W4OA 3NW6A 4RVMA 3W2SA 4BDAA 3HEGA 4EI4A 4QMSA 5DVRA 4AT5A 1REKA 2A98A 2YJSA 4W8EA 3DJ7A 3NAYA 2VTTA 4C34A 2YZLA 3C9WA 3PPKA 1YQJA 3ODYX 2NRYA 3OUKA 5CEMA 3E64A 3NNUA 1KE7A 5KE0A 4Z7HA 2VX1A 3OBGA 4FV3A 3W2PA 2ITOA 5HTCA 2SRCA 4QMXA 3RHKA 1OIRA 4XUFA 4TYJA 3WF7A 2XK8A 5H8EA 5LOHA 1GIHA 4MF1A 4FJVA 4LOOA 2QCSA 4IACA 1M2QA 4L46A 3FLSA 2X0QA 4PRJA 1GZOA 4NWMA 1M2PA 4ZZNA 5K5NA 4WKQA 3ZEPA 3MGYA 3UE4A 5TR6A 2VWWA 3VS7A 1H4LA 4FSZA 3VN9A 1U4DA 4BCGA 5HLNA 5EOBA 5K5XA 2W06A 5ANJA 3WE4A 1HCLA 3KN6A 4PY1A 4R1YA 3C13A 3AD6A 4ALVA 2XS0A 3BIZA 1SYKA 5K0XA 4PDOA 4BTJA 3MV5A 4ZTMA 4YHFA 3RPYA 3BEAA 1NT2A 3D14A 4N0SA 2F9GA 2YIQA 3TNHA 2VWUA 4F9WA 4CZTA 5IKWA 4C57A 2QKRA 4QTBA 5DEYA 4CFMA 2PMIA 2QR7A 4DGGA 3TG1A 3S95A 1P2AA 3ZBFA 2QOIA 2IO6A 2UW9A 1PMVA 3MVHA 4J7BA 4E26A 5FXQA 4R7BA 2A2AA 3II5A 2JITA 2X1NA 3OW4A 3ZO3A 3KCKA 3G0FA 3W0PA 2WZJA 3A8WA 4UMPA 4ZJJA 2YDIA 3C0GA 1Y6BA 4F08A 3QQUA 4BDFA 4UZHA 2CGXA 1OITA 4R6VA 2WB8A 3COIA 4UX9A 1H00A 2BDJA 4PTCA 4S30A 4FT9A 4UMQA 4AF3A 2W4JA 5CASA 4DAWA 4AOJA 4O27B 5CY3A 3M2WA 4IVDA 4XG7A 2GFCA 1O9UA 3C5UA 2GHLA 4GCJA 3F2NA 3IECA 3PY1A 4X3JA 2IW6A 1BUHA 2RFEA 4YZMA 3ZDIA 1OPKA 4WO5A 5AUWA 5G1XA 3PRIA 3PUPA 5AR5A 3BEGA 3QTZA 4GYIA 4IJPA 2XANA 2O65A 2V22A 1IG1A 4UV0A 4I5HA 5BUJA 1UV5A 4GUEA 5E9EA 3TCPA 3F6XA 2XKEA 5EYMA 4G6OA 5A4CA 4DEAA 3N4VA 3DDPA 3A4PA 2V5QA 3VWAA 4Z55A 3PG3A 3TIYA 3GCVA 4N4SA 4AW0A 4G6NA 4BICA 4FV8A 1YHSA 2OFVA 4QO9A 2YACA 3DCVA 2RFNA 4X2FA 5DIAA 3RZBA 2ITVA 3NCGA 1J7LA 3KVWA 5IEVA 3G0EA 4HYIA 1DI9A 2ZJWA 3PE2A 3NVKI 2W17A 3LFDA 4CTCA 4EWQA 2C6DA 2QOCA 2OK1A 4DG3E 2YZAA 5J95A 3HV6A 2VTLA 5GHVA 4GFMA 4ZEGA 3WIGA 5FQDC 2GU8A 3R6XA 4L9IA 5EFQA 2B55A 2ETKA 2HCKA 2VTQA 2WHBA 3DK3A 4IDTA 3R9OA 3LE6A 4QP7A 4QMNA 1WFCA 5I9VA 3E8NA 2J90A 3LFFA 4KBKA 1PJKA 3CD8A 4FTTA 2QNJA 3VC4A 2O2UA 4MEDA 3VS1A 3NFFB 4NM0A 4HW7A 4BC6A 5BVDA 1PRYA 2BTSA 3QQFA 2C3KA 3A60A 4YJNA 3GOKA 3CQEA 4UZDA 2LGCA 5DNRA 3NRMA 4G2FA 4ZY5A 3M11A 2JKQA 5AUXA 4IFCA 4QP6A 1GZ8A 2WIPA 5DYJA 1PXJA 2XM8A 3LVPA 4MNFA 3WBLA 3TKHA 3AGLA 3CTQA 4FX3A 4I0RA 2JLDA 4KIOA 4N6ZA 5B0XA 1ZY4A 3MH1A 4FL1A 4YO6A 1KOAA 2P4IA 3DXPA 4ZS4A 3CD3A 5DHJA 3SQQA 3ZM4A 3E93A 3Q9YA 4XBRA 3GU7A 5EW8A 3NYNA 3UTOA 4DH8A 3C1XA 2XAOA 4FODA 1PXOA 3EQGA 4RJ7A 2Z60A 4QPMA 4WG5A 4AOIA 3TEIA 2C5VA 4BZDA 3QTSA 4AZEA 5IZFA 2UVZA 4IAKA 5E1EA 5M4UA 3ZUVA 2BZIB 3KF4A 5FD2A 2R2PA 2XYNA 4JVGA 3HAVA 3NFGB 1JWHA 1FGKA 3PJ3A 2C3LA 1H8FA 2YDKA 2WQOA 3ZC5A 5IPJA 3CJFA 2QQ7A 3OY3A 3S2PA 2HZIA 2WMVA 5BUIA 3P86A 2ZV2A 4OTGA 5AR4A 2UZLA 1JKLA 3FZ1A 5L6WL 3QX4A 2Z8CA 3KXZA 2I0YA 2WPAA 3U51A 2XNPA 4IW0A 2E9OA 5C26A 5I5ZA 4EBVA 1ZMWA 3BHHA 4L52A 3PP0A 1IRKA 3F3VA 3GQLA 2BHHA 4XG8A 4ARKA 1FQ1B 4DN5A 5CEPA 1ND4A 4R3CA 5IISA 2X6EA 2I0EA 2PL0A 3Q60A 5A9UA 1TKIA 1ZYJA 1AGWA 4YO4A 4O7ZA 3KMMA 2UW5A 3TM0A 3R1QA 4JOAA 5HD7A 4HVIA 2WTKC 3DPKA 4PDYA 3ZM9A 1MP8A 4ANMA 1Q97A 4EL9A 3R21A 4YR8A 3RPRA 4D0WA 2VNWA 4JDHA 4QYGA 4FKLA 3D5XA 3F3WA 2WD1A 2QLQA 3VIDA 2XJ0A 3BE9A 2GQRA 5GZ9A 2IW9A 2ZAZA 4B7TA 4DG2E 4RX8A 3UG2A 3D5UA 4FT3A 3OUNB 1GIIA 3EFWA 4W9XA 3MDYA 3TYKA 3A8XA 4UMRA 4HCTA 5G6VA 5IMXA 4AW5A 4C02A 3VS0A 2OO8X 3MH2A 4JR7A 4S32A 3ZLSA 4I6BA 3OG7A 5CT7A 2WTDA 3CCNA 5L2IA 3CTHA 1G8KA 4E73A 4F0GA 4Q2AA 3ZFXA 3EKNA 2JDOA 1M52A 3AC1A 4PMPA 4DTAA 1PF8A 3V8TA 4WT6A 5IH6A 1URWA 3FL4A 1UNLA 5EK7A 4RJ6A 3LM5A 2JIUA 4HVHA 4YNEA 2XIYA 4IE9A 5LJJA 3ZCLA 3KB7A 5JMSA 1ZLTA 4F65A 5EDQA 3H3CA 1Q3WA 2QKWB 4YP8A 2GSFA 5CU2A 4F63A 1YI6A 4DFYA 4HGEA 5C27A 3EQFA 3DXQA 1J1BA 3S3IA 3OHTA 4R1VA 5J79A 1I09A 3P9JA 4I94A 4MD8E 4B8MA 3E8CA 4C3RA 4G9RA 5D7VA 4O0UA 4HCUA 4W4YA 3ZLXA 4XG9A 3DXNA 3OT8A 4YJTA 4PP9A 3SLSA 3K5VA 2X6DA 3IW7A 3HRCA 3HV3A 2GNIA 4GYGA 5CVGA 2W4KA 3R01A 4Y85A 4ZSJA 4QOXA 4TY1A 4KWPA 2BZKB 3FZOA 4MXZA 4EORA 3EQDA 4W4VA 1K2PA 4JRVA 4YHJA 4I6HA 1KUTA 2EXCX 2OIQA 3FXZA 4FIEA 3K3JA 2HXQA 4PPCA 4BKJA 5CAQA 5F4NA 5J9ZA 5HVYA 5K4IA 3L8XA 5CSVA 2WTJA 4CQEA 1UWJA 3CEKA 1OPJA 3VBWA 3R1SA 4C3PA 5E4HA 5LXMA 3LJ1A 4G5JA 4RGJA 3UQGA 3PA4A 4QMWA 2C6LA 3AC4A 4HGTA 4MWHA 4DINA 2RGPA 1E1XA 3GC7A 3IOKA 3DJ5A 3C4EA 3R2YA 4C0TA 4DHIB 3FQEA 3ZC6A 4DCAA 4YURA 3ML1A 3ZUTA 2CMWA 2CGWA 3QZFA 4H3BA 4BCFA 2ZMCA 2IZUA 3NYXA 3PLAE 4EHEA 3DFCB 4QT1A 4G16A 3MTFA 3RMFA 1H27A 5AR2A 4D2PA 2P33A 3E8DA 3UP7A 1RDQE 5LWMA 3PXYA 4FNZA 5JSMA 3ZYAA 3EQRA 2VWVA 2OIBA 5JQ5A 3PA3A 5BMSA 4JX7A 3ZBXA 5CSPA 3SRVA 3FMDA 4RZVA 5AP2A 2H34A 4CFUA 3OCSA 2PU8A 1L3RE 3FY0A 3HL7A 4ZTHA 5LMKA 1U59A 4FTMA 3BZ3A 3NVMB 4ITJA 4DTBA 2X81A 3P08A 2YERA 4RFZA 1M2RA 2VWIA 3ZO2A 5EHOA 4O0TA 1ZYLA 4AG8A 3KFAA 4B0GA 3A62A 4CCBA 2PMOX 3GI3A 4L7SA 1WVWA 4DBNA 4OW8A 5EM6A 4BDBA 4WHZA 2UW6A 3VS3A 4EC9A 3QKMA 4DEIA 3FJQE 4G6LA 4O38A 3LCOA 4O0WA 1H01A 4JJRA 1DAWA 2X7GA 3CKXA 4BTFA