5HU9A

Crystal structure of abl1 in complex with chmfl-074
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
275
structure length
266
Chain Sequence
AMGSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ABL1
publication title Discovery and characterization of a novel potent type II native and mutant BCR-ABL inhibitor (CHMFL-074) for Chronic Myeloid Leukemia (CML)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 266
sequence length 275
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hu9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hu9A01
2X6EA 4CQGA 2C3LA 3TZ7A 5IEVA 4ARKA 4E73A 3DB6A 4RC3A 5HE3A 2UW6A 2P3GX 5HE1A 3SDJA 4KIKB 4C62A 4I21A 5CAUA 5TO8A 5JZJA 4LRKA 1MRVA 3Q32A 3R8PA 4O7RA 2WTDA 4JBOA 4YBJA 3UOLA 4DTBA 3LCSA 4GIHA 4FEUA 1WBPA 2XYUA 3MFUA 4RZVA 2HYYA 2YDKA 4ZTMA 4K18A 1LPUA 3TACA 5DH3A 3KCKA 4U40A 3UNKA 3FDNA 3RCJA 1F3MC 3B2WA 2X9FA 4EOKA 2VTNA 1OL2A 3C5UA 5BYZA 3IOKA 3QALE 4ZK5A 2H96A 5FTQA 3HMPA 2GNLA 3H9FA 2WTKB 2BZHB 5CEKA 3E87A 2R0IA 2PVJA 2YJSA 3QD0A 4GT4A 4IDVA 1AGWA 4DFNA 3HRCA 2QOQA 2WMUA 4M0ZA 4H3PA 5EOBA 1WBNA 4CT1A 4A9SA 4RLKA 3PVWA 3D9VA 3FLWA 3R9DA 4ANQA 5ANJA 3UJGA 2VTOA 3QA0A 4YLKA 5AV3A 5D41A 2GQSA 3R1NA 4ZZMA 5E8ZA 3MTLA 4UMRA 3AMBA 2GTNA 4DEIA 4BHNA 5K5XA 3EHAA 4RWIA 3CC6A 3MH0A 3OWKA 4HNFA 4A7CA 2R3HA 4ZTLA 5F95A 2J0MB 1K9AA 2WU7A 4DGMA 3WZUA 2X2MA 4FSNA 5BUJA 5DT4A 2R64A 4PPCA 3BEGA 4LUDA 4MQ2A 4AXAA 2R3GA 3R71A 3RP9A 1ZAOA 3RHXA 1V0BA 4ZLOA 3HLLA 3NRMA 4CGAA 4BWXA 4I20A 2CKEA 5KMMA 4XRJA 4YHTA 1DI9A 3LCOA 3R2YA 3GBZA 5CVHA 4WSYA 3DZQA 4NTTA 3F3ZA 4IZ7A 4UALA 3R8VA 4YHJA 3R9NA 2VX1A 3ZRLA 5HU9A 4DG2E 4QP9A 3C4XA 5LVMA 1R0EA 1YI3A 4XP2A 4O7LA 3A4OX 4JJRA 3UZRA 4AOTA 5A4EA 2G01A 4G6LA 1PXJA 5BVFA 4FV9A 5I9XA 2DUVA 1ZYDA 2W1IA 3VW8A 1JKLA 2ZV8A 3RALA 4D9TA 4F6WA 4QMVA 3DLSA 5BYLA 3RZBA 2IVUA 3AMYA 3MVHA 3U6HA 3EKKA 2GU8A 5LVPA 5HX8A 2B9IA 5LCJA 2HK5A 1OMWA 5DE2A 5AP0A 5IQDA 4MXYA 3ODYX 4H1JA 4OW8A 3B8RA 3ELJA 3CTQA 5KKRC 5JKGA 2E9PA 2C5OA 1WCCA 4KSPA 4DCEA 3BWJA 4EYJA 4BKJA 4XUFA 2NPQA 3Q60A 3FZPA 3LCTA 5CEQA 3KRXA 3ORLA 2PWLA 2W5HA 5L2TA 4QO9A 3I7BA 4IM2A 5L2SA 4YPDA 2JD5A 2PPQA 2CGVA 5AP1A 3Q04A 5F1ZA 3P9JA 3C50A 3HA8A 4RFZA 4ZSJA 3VHEA 2XK6A 2G2IA 2ZV7A 4TL0A 3E88A 5IKWA 5EI6A 3Q6UA 1ZOEA 3M42A 2B0QA 3LFCA 4MNEA 3FUPA 4RVLA 2WQEA 2YHVA 4Y73A 3SG8A 2VV9A 3LFNA 4FSZA 2B52A 2XIXA 5EM6A 3SRVA 2JC6A 4ACMA 4HVDA 4RWLA 4P2KA 3BI6A 1JKTA 1H1PA 3SHEA 2PZRA 2ETRA 3OY1A 4UMUA 1TVOA 5A54A 2BDWA 3VAPA 2Z7QA 2GTMA 3GGFA 1K2PA 2QOKA 4GEOA 3MA6A 2X0GA 4CKJA 5CVFA 3D2IA 3OCTA 3TUBA 5LXMA 3C7QA 2F4JA 2HIWA 4XG4A 4GW8A 1YXXA 5CU3A 5CEPA 3EFKA 2ONLC 3UP2A 2FYSA 1IG1A 2UVXA 1TKIA 1YQJA 3BU6A 5T6KA 2AYPA 4AW0A 3Q96A 3HUBA 3SG9A 4UWBA 4IQ6A 3R0TA 4KKHA 3CJFA 4AE9A 4H36A 4RX9A 3LMGA 5A4LA 3SXRA 2Y4PA 5KMLA 4FTQA 4ZSLA 3T3VA 2VO6A 4ALWA 4NKAA 5FTOA 4MTAA 3T3UA 1ND4A 3OBGA 3BLHA 1IAJA 4NM5A 4IB1A 3PLSA 4FYNA 4OTPA 5FEEA 2W0JA 3PLAE 1XH9A 3KGAA 2H9VA 4QPAA 2V5QA 5DG5A 5A6NA 2AC5A 1RJBA 4A4LA 3ZHPC 2ITZA 5LQFA 2PMLX 3DZOA 4KSQA 4L9IA 5E8WA 3K3IA 4AACA 1B39A 4XV9A 5HCYA 3VUMA 2YZLA 4PDYA 2HCKA 1VZOA 2UV2A 1B6CB 3EKNA 2A4LA 3G33A 4FGRA 2IVSA 4O7VA 3LCDA 4JNWA 3TCPA 3ET7A 1YXUA 2J2IB 4MWIA 3RAHA 4F7JA 4NCTC 4BGGA 3LMIA 1SYKA 2X8EA 3H4JA 1R78A 3NUYA 2C5XA 2IO6A 2WOTA 4DG3E 2PE2A 1S9IA 2ACXA 4UN0C 4DEHA 4C4HA 3PPKA 5HU3A 5CEMA 2ZDUA 4ACGA 1U4DA 3QWJA 5IA0A 3LLAA 2O63A 1CKJA 5KHWA 1G5SA 5L2WA 4C34A 2XK8A 3DLZA 3QX2A 3W1FA 3ZLWA 4S30A 4CG8A 4AT5A 5TE0A 5AX9A 3A7HA 3M1SA 2YIYA 3D94A 5KBQA 3QQGA 3R9RA 4BCJA 3E8NA 3EFLA 3QU0A 1AQ1A 4O0SA 1PXPA 4CQEA 2JKKA 1VYZA 2R3FA 5FM2A 2JBOA 5LJJA 3UMXA 3PG1A 3COIA 2R3KA 1P4FA 2XUUA 3ERKA 4XV1A 2VTPA 4ACDA 4YUQA 5IA4A 3ZZEA 4GS6A 3EL7A 4FV2A 4L6QA 1OUYA 4FT9A 4OBOA 1DS5A 4JRVA 2DS1A 3HUCA 4BYIA 4HOKA 3S95A 2WMBA 3EIDA 4KIOA 3PXKA 5D12A 3CTJA 2XM8A 3A8WA 3P7AA 5DGZA 3WE4A 4ZAUA 2GFSA 4FIGA 4FTRA 4JS8A 4KIQA 2W9FB 2XM9A 3CCNA 4UYAA 3FXWA 4O0YA 4BZOA 4EHZA 3NUSA 2CMWA 3PSCA 3ULIA 1Q99A 1OM1A 4I6BA 4JT3A 4HCVA 3RAWA 2A19B 3ZUVA 4DGGA 3L9MA 4CFUA 4YSJA 4U9AA 3DOGA 3ORIA 3DAJA 3IK3A 3V5JA 5CYIA 4TYHA 4KKGA 1VR2A 3IGGA 4GFGA 4IM0A 3MESA 4BKZA 5LMKC 4J52A 4IIRA 1A48A 4CZUA 4ZLYA 3O7LB 4QMXA 3DXQA 3VJNA 4BWKA 4EZ5A 3NVKI 4FVQA 4S31A 5AP7A 1LEZA 2A2AA 2B1PA 3F61A 3PJ3A 4YJNA 5GJGA 4EKKA 1V0PA 2W7XA 2X1NA 3KULA 3FAAA 2KULA 4KS8A 3DFCB 4JOAA 2R4BA 4XP3A 4JX3A 4DEDA 4YO4A 3CBLA 2Q83A 4FIHA 3V01A 4C36A 4L7FA 4DEEA 4IX6A 5AEPA 5CSPA 4E5AX 1ZMWA 2REIA 2P55A 1ZWSA 3DU8A 4IM3A 4O0VA 4DT8A 4NSTA 4D4RA 5GJDA 5CF6A 4EH8A 2ETKA 3KCFA 1XH5A 2YCQA 3PE1A 4YJSA 3TKUA 3D83A 1XBAA 3BE2A 3F6XA 2P4IA 3V04A 5FXQA 4BWPA 5AV1A 4NM0A 4M84A 3U54A 4NTSA 2R3OA 4RWKA 4IBMA 3WF9A 4BF2A 3QTXA 3NWWA 3UGCA 3SAYA 4ACHA 4WNKA 3S4QA 3NYXA 4QYGA 4E6QA 2B9FA 5K9IA 3ANQA 2OI4X 3MYGA 3OOGA 2IW6A 4PMPA 4AE6A 3VVHA 2VGOA 2BZKB 2XBAA 4IXPA 5GZ9A 3TJCA 4C0TA 2HZNA 2JDTA 5G1XA 3PA5A 1OL6A 2BRNA 3UC3A 5IQAA 2IZSA 2VWBA 3CPBA 3UTOA 4MNFA 2UZUE 4TWCA 5C9CA 1W98A 3FL5A 1FINA 3LM0A 4YJUA 1U5RA 3Q9YA 1Q3WA 3QZGA 4HYHA 4IVDA 4MCVA 4EWHA 5E92A 5BYYA 4FT5A 4FEWA 3CD8A 3N9XA 4LRMA 3VBXA 4A07A 5ANKA 2B55A 2W17A 3B2TA 5HG7A 3BQCA 4GVJA 2OIQA 5HE2A 2R3LA 3BYUA 3OG7A 4XS2A 4RQVA 4RIYB 5EDPA 2QO7A 2OSCA 2OO8X 2QLUA 4EBWA 2ITTA 4LL5A 4NT4A 4LMUA 2PSQA 4CKRA 3TTJA 1U46A 3NYOA 5F20A 4EZ3A 5CU2A 4U45A 2VX0A 4CLJA 1KE6A 2C6TA 3FHIA 1BL7A 5FDPA 3NMUF 3FV8A 4PDPA 3TNQB 3W55A 2BDFA 3OP5A 5AUUA 2EB3A 2B7AA 4FL2A 4JQ8A 4GU6A 2CKPA 3U9NA 2PU8A 1XQZA 2VTJA 5B2KA 5G6VA 4M97A 2O5KA 3A61A 4O0TA 3F88A 5AR3A 4DFZE 1Y8YA 3AD4A 3O17A 3FI4A 1Q5KA 3V6SA 3WZDA 2BAKA 2Z7SA 1YXVA 2BROA 3R28A 4AFEA 4F7LA 3MN3A 3QQLA 4XG9A 1Y6AA 4YP8A 4F64A 3EB0A 4DYMA 4I6HA 4I23A 3BYSA 2WXVA 2I40A 3UIXA 5AIRA 3AC3A 2CNVA 1H1QA 3W8LA 3ATSA 4BTJA 1DI8A 1H4LA 2VNWA 1BX6A 4K2RA 3ZONA 5JGBA 1V1KA 4BL1A 2CCIA 2Q0BA 5ANEA 5LVLA 5DEWA 4DGOA 3EYGA 3ODZX 3LQ8A 4G17A 4TTHB 4RX8A 4TZRA 5IQGA 2OKRA 4S34A 5LCKA 4DH5A 5J5TA 3HECA 5HVYA 5CNOA 2CKOA 4AGWA 3MSSA 2GNIA 1YI6A 4GCJA 1CTPE 2J51A 1NY3A 3F3UA 4PY1A 4A06A 3UODA 5JEBA 2QOLA 2PUUA 4J95A 4CSVA 4X6QC 3TZ8A 4UMQA 2ERZE 2VWIA 2P2HA 3VN9A 4O0XA 3SA0A 1Q8WA 2QKRA 3AC2A 3ZO2A 2OH0E 4F6SA 5J7BA 5DBXA 1LR4A 4FEVA 5CANA 4E4MA 3POOA 5I9ZA 3R30A 4AZVA 3ZSGA 1PXIA 3HDNA 3I4BA 1NVQA 4G3DA 1Z57A 2WFYA 3L8PA 4MD7E 3F2RA 4LI5A 2CJMA 3HV5A 4FZDB 4LL0A 4RRVA 4YPSA 5AUZA 4MYGA 4AN9A 3DDQA 3UBDA 2UZNA 3VUDA 4CRLA 5HKMA 2WTVA 3PP1A 3JR1A 3IG7A 3A2CA 4IVBA 1PKGA 1WBSA 4GG7A 3BWFA 3QTUA 1UNGA 1URWA 3FSKA 1KV2A 4PX6A 5ETIA 4DH1A 2PVRA 4RFYA 4OTDA 4FMQA 5J5SA 4F0FA 2UW8A 1OI9A 4USEA 3VQUA 3DTCA 3GVUA 4LGDA 3NUUA 4JDHA 4AF3A 2OFVA 3FQSA 2BKZA 5CAPA 3RVGA 1H1SA 3DXPA 4R78A 3BHYA 3KC3A 3I0QA 3HP5A 4RIWB 2CGUA 3UVQA 5AAEA 2J0IA 1BL6A 3PRIA 4FNZA 4QYEA 3G9NA 4GMYA 4K77A 4ITHA 4KBAA 4M3QA 3HV6A 5EHOA 4AA5A 1I44A 3ZFXA 3R7OA 4Y95A 3A62A 3WF5A 4AGUA 3VWAA 5CU6A 1U54A 3MDYA 4GVAA 4A9UA 3TIZA 1B38A 4FI1A 3KMUA 3NW6A 1Q41A 2RGPA 4EOSA 5ETCA 3O7LD 2WMVA 2QQ7A 4G1WA 3QZIA 4UMPA 3NS9A 4CMTA 4AOIA 2ONLA 4PL4A 2RKUA 2X9EA 2BPMA 3CKXA 4RJ4A 3UOHA 2FSLX 1JNKA 2YISA 4K8AA 1PXLA 4AWIA 5IH5A 1YVJA 5EDQA 4RJ5A 4U3YA 4XYFA 4ASEA 2RFSA 4EUTA 4HYIA 3LFQA 3C0IA 5AP2A 3SOCA 3QHRA 4LFIA 3UVPA 2UZBA 5KZ0A 3QTSA 5L8LA 5IA1A 4AS0A 3LVPA 4FIFA 5CAQA 5FQDC 2YDJA 4FG9A 3CR0A 4FKGA 2OG8A 4LGGA 2RG6A 4OTRA 5K5NA 4CTCA 1MQ4A 4QQJA 4W4WA 5IQCA 4ANLA 5L6OA 3EWHA 3NIEA 4ZMEA 2WTWA 4IZYA 3DNDA 3NNUA 1OIRA 4X6RA 5E8UA 4B6LA 5EG3A 1ZZLA 4QMPA 4EOIA 3KXZA 3OXZA 3UOJA 3ZS5A 2OIDA 1EH4A 2B9HA 2Y6OA 3NSZA 4MHAA 4DEGA 1M7NA 3UG1A 5KUPA 2QI8A 3QKLA 3LMHA 2YIXA 1QPCA 2G2FA 4EHGA 4NCTA 1KE7A 3IQ7A 3UDBA 2Y9QA 4P7EA 3FLZA 2P2IA 4R6VA 4YLJA 2QOOA 2VTQA 3IECA 4ASXA 5IDPA 3PIZA 4DGLC 3AGMA 3FBVA 2JDOA 3QRTA 3E3PA 3TKHA 4C3PA 4RX5A 3R1SA 2CNQA 3C0HA 3FKLA 2BHHA 2IW9A 5HD4A 2QHNA 1YOMA 4D4VA 3I1AA 2BFXA 5DT0A 5EM5A 1SVGA 4O7YA 1PYXA 4I5HA 4O7SA 1YKRA 2C1AA 4QTAA 3NLBA 4D5KA 5M09A 5HOAA 5E7RA 4M67A 3GNIB 4YZ9A 4HGLA 4XHKB 1CDKA 3C4EA 4K6ZA 4XG6A 3RJCA 3ZC6A 5BVEA 4QMOA 1XO2B 1M2PA 3ACJA 3ZSIA 5GIPE 3A7GA 2BUJA 3BX5A 4PDSA 5BMMA 2ITOA 4YNOA 3THBA 3EN7A 4R3PA 3PWYA 2ZMCA 2UZOA 4FTAA 4ZS0A 3KN6A 4FZ7A 5JSMA 4D1SA 3S0OA 3W32A 3SKCA 3D14A 2PL0A 2E9NA 3GCPA 2XNEA 1T45A 3MJ2A 5HORA 2J7TA 1M2QA 4AZWA 5LOHA 4KAOA 1GZNA 1ATPE 4CRSA 2V55A 1OKWA 5CXHA 2NO3A 2C6OA 1H08A 3VS1A 3Q5ZA 5CF8A 2IN6A 4HVIA 2EVAA 3BU3A 2FO0A 2AC3A 3OTVA 3H0YA 2ZOQA 3UIMA 5TKDA 3PXZA 3LQ5A 4LQMA 2KTYA 1R0PA 2R9SA 2WGJA 4GK4A 5ETAA 5M4CA 4N57A 3C4FA 4W4VA 3F7ZA 5HCXA 3SX9A 1I09A 3UZPA 4O86A 5BVDA 5K0KA 3FQEA 5LMKA 4HNIA 5E8VA 4QPSA 4TYEA 2ITNA 4GK2A 4ALUA 4E6CA 3F3VA 3BEAA 2JKQA 5CEIA 1GNGA 3IW8A 3NW5A 3QCXA 5J87A 5CENA 2BZJA 4TPTA 2X7GA 3OW4A 2FB8A 4ZJJA 4CG9A 1UNHA 2YM5A 4CFNA 4LV8A 5J1VA 3VJOA 1FGKA 4QTDA 2WQBA 4BYJA 1VJYA 3ALNA 3FI2A 3I60A 4CFWA 2VWYA 3O71A 2EU9A 2IZUA 4GSBA 4MXXA 3QZFA 4IC7A 3R63A 2WTKC 3BBTB 3O51A 3MPMA 2XBJA 3ZRKA 4DTKA 3UO5A 2IWIA 5HZNA 3GC8A 3PJ1A 1UWJA 4MAOA 4MD9E 4V0GB 5ANOA 4YU2A 5M56A 5IQEA 4QNAA 2OJ9A 4TN6A 4MF1A 3Q4UA 5EI2A 4JBPA 1FVRA 3LFDA 2HW7A 4AZTA 4HVGA 1RE8A 4ZTNA 4H05A 4ITIA 1BUHA 3I5ZA 1FGIA 1UU7A 2RFDA 3F7WA 1WFCA 4O0RA 5DEYA 3F9NA 1G3NA 4G9CA 5JGAA 2F7EE 2CSNA 3PVGA 4CXAA 3DQWA 3RBWA 3CE3A 2W1CA 2J9MA 1H27A 3QD3A 1QPEA 4KB8A 2UZLA 4KD1A 5DRDA 4GJ2A 2RL5A 3EYHA 3FQHA 3K3JA 3D7TB 3NEWA 5M06A 4IHPA 3SGCA 2FGIA 4TKSA 3TXOA 4AX8A 4ZTQA 2C69A 4CYIA 1G8SA 4NYEA 3R1QA 5IPJA 4X21A 2PVNA 4E5BA 4L00A 2WIPA 4CV9A 2PZYA 4CKIA 3QKMA 4FIEA 3I6UA 3EQFA 1Q8UA 4KS7A 3EMGA 5C01A 3WZKA 2W4JA 3QA8A 5IG1A 4O0WA 5KMJA 5J9LA 3U8WA 4FC0A 4DG0E 4G3GA 4JG7A 4OAVB 1WBVA 5CT7A 5E91A 5I9WA 4GH2A 4JIAA 3C4WA 4BKYA 1JSVA 2P33A 2Y6MA 4H39A 4EL9A 5D10A 4UY9A 2GNGA 5C27A 3MH1A 4DLIA 3BELA 3FZOA 4E93A 4QMNA 5C8MA 1BYGA 4FSWA 3ZFYA 4FL1A 3UOKA 3C0GA 3CQUA 3LOKA 3PYYA 3DCVA 1OPJA 4OR5A 4YC6A 4FUXA 3MY1A 4FSMA 4OTIA 4W4YA 1KSWA 3UG2A 4YURA 3LFAA 4TNBA 3KQ7A 3TV7A 4A9TA 5CQWA 5JMSA 4O96A 3UNZA 5IQFA 3P79A 2PHKA 3UVRA 3NX8A 3QZHA 4I6QA 2VTRA 5FGKA 5CAVA 4GUEA 4IAFA 4TNDA 4XJ0A 5HG8A 4Z16A 4ZS4A 4FKJA 1PXKA 2A27A 2ZM4A 4ERWA 4O83A 1O6LA 1IA9A 2ITXA 4FTCA 4FIJA 3UP7A 4PNIA 1Q61A 3DPKA 4JLCA 1Y57A 2NP8A 2PMOX 4JIKA 5DNRA 4EOJA 5M08A 3W2OA 5ANGA 4RJ7A 2F2UA 4EH9A 3IW4A 4P5QA 3N4UA 2YDIA 1CM8A 1ZYLA 3C9WA 4FZ6A 1W7HA 3GUBA 2VTAA 4IE9A 3HP2A 4QQCA 4E5WA 4FSYA 5A4TA 5DMZA 2VTSA 2VRXA 4ITJA 3CEKA 3PXYA 1OPLA 5F94A 1E1VA 3UIUA 4YLLA 1XH7A 4CMUA 2BALA 2GDOA 3GU8A 4W9WA 3V8WA 4BBEA 4RBLA 5DT3A 3V3VA 2YM4A 2C3IB 1PKDA 5I3RA 4TWNA 4EQMA 4L46A 3NGAA 4L43A 5EOLA 4CFMA 4E4XA 2QD9A 4XV2A 3QFVA 4F6UA 2HOGA 4AU8A 5L6PA 3NCGA 2GFCA 3DJ5A 4LMNA 2VTTA 4RIXB 5JT2A 4BCPA 4MQ1A 4WUNA 3QD2B 5EHLA 3HEGA 2IW8A 3MBLA 3ANRA 4ALVA 4IWDA 4D4YA 4RSSA 4EH7A 4OTWA 5C4KA 3TT0A 4DFLA 3R22A 4L53A 2JLDA 2VN9A 3G2FA 4RA4A 3MVMA 4X2NA 2QOHA 4M69B 4WT6A 4L3LA 4X7QA 5HO7A 4FEQA 2YIRA 3E92A 4RMZA 5BMSA 4AQCA 4MKCA 4C3RA 3R7UA 3TV6A 5GINE 2R3PA 3QXOA 4RQKA 4AOJA 3R7VA 4I41A 2QOFA 3ALOA 5A9UA 1R39A 4FTLA 4B4LA 3EQCA 5H9BA 1W0XC 2WTIA 3ACKA 4RJ3A 4EHVA 3L9PA 4FT3A 3RPRA 1UWHA 3HVCA 5K4JA 3I81A 2YIQA 2YIWA 3RKBA 4A9RA 4F65A 2QG7A 3VBTA 3GQIA 3G6GA 3PG3A 2W5AA 4EH5A 1FMOE 3FJQE 4XH6A 5LVOA 4N0SA 4R77A 4R5YA 4MBLA 3UQFA 4F9BA 3KXNA 4H3BA 2QHMA 3UO6A 2R3QA 2VUWA 5BVNA 3F66A 3SVVA 2ZVAA 3LCKA 4UXQA 4E4LA 5BVOA 5E8YA 5L2QA 3VS2A 3PA3A 4V05A 3VS3A 3FY2A 4F63A 4NJDA 2W1ZA 3ZBFA 4O91A 2HZ4A 4R1VA 4A4XA 5GZAA 4YZNA 5BX0A 2ZB1A 4MF0A 4IX5A 3SQQA 4NIFB 4MD8E 3R83A 4RVKA 3TN8A 4NK9A 3DAEA 2ITYA 1M14A 3KXHA 4ZZNA 3VRZA 5C4LA 3D5VA 4C2VA 2YN8A 2XB7A 1JSUA 3MPAA 4XLIA 5EYMA 2GS7A 5DPVA 4BICA 4OBPA 4IH8A 2Z7RA 3OC1A 4PTCA 3ORTA 3RNYA 4FG7A 4AW1A 3CXWA 3KF7A 5EKNA 5EW8A 1STCE 3L9NA 3OCGA 4HJOA 4C38A 4YHFA 5JGDA 2PZIA 3CQEA 3LXNA 4XOYA 4I0SA 4R1YA 4DF3A 3LM5A 3ZH8A 4DAWA 1J3HA 3B8QA 4P90A 4XCUA 5FRIA 2IVTA 1YDSE 5IU2A 3VF9A 4G5PA 4B7TA 4EYMA 3R8UA 2YEXA 3R8LA 2C68A 3CLYA 5BUEA 1JSTA 2ZAZA 4GKHA 5ITAA 2OU7A 2PVHA 4YZBA 5AP5A 1UV5A 2SRCA 2WMAA 4C59A 2F7XE 1UNLA 2O64A 1OL5A 2BCJA 1T46A 4CTBA 5FTGA 3QUEA 5A3XA 3UPZA 5FWKK 2YM7A 4BR3A 4BIEA 2XF0A 3DT1A 4Z9LA 1YDRE 2BRMA 5KNJA 2YERA 3PY3A 1PHKA 3FMHA 3VIDA 3TUCA 4PP9A 4BBFA 4O7NA 2XS0A 3MIYA 3PTGA 4BCNA 2JEDA 4GUBA 5HQ0A 5TOZA 2GPHA 5EQYA 4KRCA 3G0EA 3G9LX 4FKRA 5AR8A 3F5UA 3EZRA 3AT2A 3OXTA 2QG5A 3E8DA 3E64A 3LFSA 5IMEA 4I4FA 4AFJA 5CSVA 3ZLXA 2Q0NA 4CZTA 1WMKA 3HDMA 2JITA 3QC9A 1YHSA 2E9UA 3LFEA 4S32A 3TNIA 2OZAB 5BUIA 4O1PA 2GNHA 2XK4A 3GC0A 2QCSA 4C57A 2OW3A 3OEFX 1GZ8A 2OXXA 2H34A 3Q52A 4FKSA 3RNIA 3ZMMA 3OWLA 3IW5A 2UW5A 3VULA 1ZYSA 4YZDA 3EQBA 3HAVA 3FI3A 5FP6A 4IVCA 2VD5A 1YI4A 2Y8OA 3QTIA 3KRLA 3ZCLA 4LYNA 4IMYA 5BQ0A 3GOKA 2G1TA 3QHWA 4YMJA 4RJ8A 4HCUA 1ZMUA 2VWUA 5L4QA 2W1GA 3FMNA 4JL9A 2C5YA 5ICPA 1MQBA 5C8KA 3DGKA 3V6RA 4BDBA 3QTWA 2VX3A 4KA3A 5IUIA 3EQDA 5AR7A 4KIKA 3DY7A 4FZAB 4XG7A 5CVGA 1R1WA 4O7WA 2PYWA 3PFQA 2YITA 2WPAA 3ENHA 5HHWA 3FZRA 5IA3A 3CSVA 3E3BX 1Q3DA 4R3RA 4I3ZA 4JG6A 3AC8A 2ITQA 3KXMA 2W05A 2YAKA 4V04A 3OHTA 3ZRMA 1DAYA 4FKOA 2ITVA 5J95A 4G6OA 3N51A 2BAQA 1OKVA 1REJA 3DB8A 4N6YA 3QRIA 4K1BA 4QPMA 4MXOA 3RM7A 3UNJA 1APME 3OEZA 4D2TA 3POZA 5AV4A 3ZUUA 4GV1A 4UEUA 5EW3A 2C6LA 2BMCA 4BDHA 5DIAA 3KK9A 5HICA 4ZJIA 4BDKA 4FSRA 4O0UA 3L8SA 3WZEA 4PDOA 3DAKA 3IPHA 4N4SA 4QMYA 5EI8A 3ZU7A 4GJ3A 5CQUA 2V0DA 3AQVA 3T9TA 3LFFA 3ZZWA 4YBKA 3H9RA 2PVLA 2VO3A 5EYCA 5JZNA 3ROYA 2O3PA 2WTJA 2BFYA 2XK3A 2WEIA 5HLNA 5KBRA 3E7VA 3H0ZA 5FUTA 5DR9A 2XCKA 2CLQA 3FZTA 1MUOA 2RF9A 5CASA 3LJ0A 4MVFA 4UZDA 4ASZA 4FICA 5AWMA 5A46A 1YRPA 3QLGA 4I6FA 3JYAA 3GI3A 2I6LA 3Q2JA 5HIEA 3VW6A 3F3TA 2EXEA 4N70A 5CS6A 4CNHA 3IO7A 2JIVA 4ORKA 3KY2A 2C6KA 4EBVA 3LXKA 2X81A 3PE2A 3R00A 4XNEA 4DA5A 4L67A 3KREA 3M11A 4CD0A 3NW7A 1TQPA 1Z9XA 3WF6A 3QL8A 4WNPA 1J91A 4XOZA 3GB2A 2Y4IC 3JVSA 3LE6A 2R7BA 1GIJA 2ZMDA 4CV8A 4Y85A 4CYJA 3VRYA 4U6RA 2QO2A 4G2FA 2C1BA 4M12A 3CPCA 4W8DA 4NUSA 5K3YA 4F7SA 3GENA 4FV6A 4IX4A 3UIBA 4DCAA 3NYNA 3WZJA 3OOMA 1WBOA 2F2CB 3F5PA 2WB8A 3ENMA 3D5UA 5EW9A 3WIKA 4PL5A 5M55A 3RK5A 5JN2A 3BQRA 1A9UA 5DOSA 3TM0A 3ORZA 2VO7A 5FXRA 4U97A 5EHYA 2XMYA 3W10A 3EQRA 5FXSA 2XNPA 3BHUA 4KINA 3H3CA 3EL8A 4FGBA 3U6JA 3VQHA 1XH6A 4FV8A 1XWSA 5E8XA 2QR7A 3HV3A 4XV3A 4EJ7A 1SM2A 3HGKA 3EN6A 4NWMA 2CGWA 2GS6A 4UZHA 3EN4A 5AUXA 5GHVA 3FE3A 3WF7A 3OROA 3DS6A 4P5ZA 4WBOA 1REKA 5J9YA 2PUIA 4PTGA 4S2ZA 4RX7A 3F3WA 4APPA 5CXZA 3EN5A 5I4NA 1XH4A 1QPJA 2EWAA 4O38A 5H2UA 5TT7A 3SXSA 3VHKA 5FDXA 1XH8A 3PY0A 5GZ8A 3R7EA 2J5FA 4XX9A 5HNBA 2WELA 3F2AA 3KRWA 3PWDA 4Y5HA 2UW7A 4B9DA 1A06A 1JKKA 3VS6A 3RK9A 3HV7A 4ZTSA 5DHJA 5ANIA 4J98A 4PP7A 5D7VA 1MRUA 1O6YA 4I92A 4NM3A 4BDEA 1PXMA 3EFWA 3Q4TA 4ASDA 5JRSA 5KCVA 3QRJA 4E4NA 5IF1A 3EH9A 5LWNA 3MTFA 4GIIA 2Y4IB 4BIBA 1L8TA 4FEXA 4LOOA 5EM8A 5KX8A 1YOJA 4E26A 1QMZA 1GIIA 3TG1A 3ZDIA 2EUFB 2HZ0A 1CKPA 5AIKA 1KOBA 3ATTA 1ZOHA 5B0XA 4TW9A 3O23A 4YTFA 2F49A 4AT4A 5J1WA 3RGFA 1VYWA 1PXOA 2W1EA 3HL7A 3NUPA 2H6DA 4ANNA 4HGEA 2C6MA 3IS5A 3OZ6A 4JQEA 4BVUA 2C30A 4WKQA 4TYIA 5AUYA 2CPKE 3CS9A 3BKBA 2YM6A 3FC1X 4HYUA 4S33A 3RZFA 2JKOA 4Z7HA 5L8KA 2JGZA 3E8CA 4PMTA 4FVRA 5IEXA 1Y6BA 1WZYA 1UKHA 3RPYA 4HVSA 2BTSA 3GFEA 4J8MA 5DFPA 3ZLYA 3ZXZA 4LG4A 2PVYA 3KK8A 4I5PA 3BCEA 4DINA 1ZZ2A 3QQUA 3E8EA 4X3FC 5DR6A 2UZWE 3LXLA 3C4CA 3MS9A 2BDJA 2OJGA 4IAZA 4FVPA 4K33A 2BRGA 3PPZA 1OIYA 3KU2A 2YA9A 4DFYA 3QQKA 3LPBA 4UWCA 1J1BA 5EKOA 2VWVA 3RPSA 3PY1A 2NNWB 5HGIA 3PIXA 2WZJA 2QOIA 4PV0A 4KNBA 3FLQA 5L6WL 5TR6A 2X8IA 4E1ZA 1JLUE 3TJDA 2VZ6A 4G34A 3WARA 4AG8A 3EZVA 3OTUA 3QGYA 4FV4A 4ZXTA 5HIBA 2XNBA 3NUNA 4B8MA 4RA5A 1IA8A 5D7AA 5DA3A 3SOAA 3TNPC 2QVSE 4D55A 2WAJA 1YXTA 3K5VA 3R2BA 3TUDA 3NVMB 1GZKA 3L8XA 1OUKA 2V7OA 2WD1A 4YTHA 3VBVA 2XNNA 4A4OA 4QYHA 2HENA 2X2LA 3DBCA 4L3PA 5CSXA 4I93A 1YHWA 4PNKA 3TIYA 4LRJA 2W06A 1BI8A 4E7WA 1YWRA 4IB5A 3LZBA 2QONA 4FR4A 4WG4A 1SVHA 5FEQA 3UO4A 3V5PA 5E4HA 3LFBA 4QMQA 4NKSA 4IB3A 4V01A 3SV0A 1O9UA 2JAMA 1H24A 4AUAA 3D5WA 5C1QB 5CF4A 4APCA 3IKAA 5AP6A 3UYTA 3QBNA 4WIHA 2JAVA 2VTLA 4PMSA 2JKMA 1M52A 4IW0A 4BDFA 2ITUA 4F1MA 3TKIA 1FPUA 2WMQA 3PA4A 3RINA 3P7CA 3O50A 4X3FB 4FKLA 1AD5A 5HVJA 3V5LA 5M53A 4C7TA 4FTTA 5CZIA 1P4OA 3TDVA 5LMBA 3MI9A 4U7ZA 4FTMA 1GJOA 1GAGA 1MRYA 4J99A 4F9WA 2RSVA 2YLEA 3NZ0A 3P7BA 5AAFA 5I9YA 4IB0A 1YOLA 4OT5A 1J7LA 1RW8A 3F5GA 3C5IA 5H8GA 5JRQA 4U81A 4BDCA 1ERKA 1K3AA 2B4SB 4BRXA 5HG9A 2VWZA 2WMSA 3VUHA 2PULA 3W2SA 5J79A 4PWNA 1UVRA 4QTCA 2C5VA 2I0HA 3C13A 1JQHA 3KVXA 1JKSA 4PPBA 4U5JA 4XG2A 5J8IA 4ANOA 3KFAA 3UC4A 4MNEB 3ZO4A 1FQ1B 1H25A 4HZSA 3BBWA 4M14A 4D9UA 4H1MA 4F0IA 3Q4CA 4FKIA 3VC4A 2HZIA 3SRVB 2ZM3A 2CHLA 4FNXA 4C33A 4XG3A 2HELA 4FKPA 2VTIA 4G5JA 4QQ5A 4WOVA 3MPTA 2BAJA 4CEGA 4O82A 4RVTA 4JI9A 4QP6A 4EI4A 3NUXA 4FKWA 5M44A 4DC2A 3F5XA 2UZVA 4CMOA 3TNHA 2P0CA 5EYKA 3GC7A 3U4UA 2IJMA 4IFCA 4EK6A 3VF8A 5E90A 5M57A 4DN5A 4RG0A 4QQTA 3OWJA 5D9HA 1NVSA 4GT3A 4O22A 3KRJA 3FZSA 1XJDA 1ZY4A 4H3QA 5CF5A 2UZDA 2WTCA 4BN1A 4FT0A 3DK3A 4AGDA 3AXWA 3BRBA 2IPXA 3NNXA 3QQFA 4H58A 2E2BA 2WMWA 3FZ1A 3P08A 4IVAA 4TYGA 3ORKA 3OUNB 5CU4A 4FF8A 5E8SA 3V5QA 3Q2MA 4DTAA 5T68A 1KOAA 4FTJA 3V5TA 1ZARA 4EOMA 3FMMA 3WIGA 2UVZA 5IISA 3JY0A 3P5KA 4FIIA 3E93A 5KMOA 3Q9ZA 1G8AA 2W4KA 2GHLA 1GOLA 3DBQA 1YDTE 3RAIA 4QMLA 2CKQA 4ZSGA 3P78A 4YZCA 2PMNX 2XIZA 3FHRA 3TDWA 3PDTA 5JFXA 5CY3A 3WI6A 3W8QA 4BB4A 2YCFA 4J96A 3D7ZA 3E5AA 4IWOA 1P2AA 2RFNA 4OBQA 2OF2A 2HAKA 5CT0A 3R7IA 3ZTXA 1OKYA 5T3QA 4EKLA 2XRWA 2BTRA 1P5EA 3FYJX 4HPTE 2OXDA 1KE8A 4KBCA 3ZDUA 4RC2A 4RIYA 3DK7A 1O6KA 2JBPA 3G90X 3T9IA 1QL6A 1KWPA 3NDMA 1Q4LA 4WO5A 3TL8A 5CAOA 4IWQA 3V51A 4QP1A 1E1XA 4XBUA 3DTWA 2UZEA 1PRYA 2C3KA 4W8EA 3RAKA 4P4CA 1NT2A 4IADA 1J7IA 4ANBA 1FVTA 2YAAA 4JQ7A 5AR2A 4WRGA 4ACCA 2EXCX 1ZOGA 2EB2A 4RJ6A 2RFEA 3MFRA 3QKKA 1PMNA 2OJFE 4DT9A 5JQ5A 3LAUA 5EK7A 1DM2A 5EM7A 4Q5HA 4QP2A 4D5HA 2WKMA 3CD3A 3GT8A 3QYWA 4YJRA 5EFQA 4EK5A 2WIHA 3QC4A 5I5ZA 3C4ZA 1H28A 4XP0A 2C6IA 5BNJA 4DH3A 3KEXA 4BI2A 4IJPA 3OF0A 1Q8ZA 3OD6X 5CI6A 2VGPA 1H26A 3COKA 4A9YA 3FSFA 4II5A 4QNYA 3D0EA 2X7FA 3PSBA 4FOBA 4QMSA 5FG8A 4R7BA 4FK6A 4IJ9A 2BZIB 4JVGA 2R3JA 3OY3A 3BLRA 2GMXA 3LIJA 2J6MA 4FK3A 4HGTA 4X2JA 3QCSA 5HE0A 4AW5A 4BI1A 4E3CA 3AG9A 3HV4A 3VNTA 4XBRA 2GNFA 4Q9SA 4QP8A 4OAUC 4QMMA 5DI1A 4ENXA 3MFSA 3OUKA 3O0GA 4UMTA 2WQNA 4U80A 5HESA 3BGZA 3QF9A 3OBJA 3PVUA 3QXPA 4TYHB 3VBWA 4BFMA 4D2RA 4F99A 3PUPA 3VUKA 2CLXA 2Z8CA 5EYDA 3VS7A 1F0QA 2PK9A 3R01A 4I94A 2GHMA 4U44A 3R04A 4AA0A 2FSMX 3II5A 4EQUA 3FYKX 4GKIA 2WQOA 4EHEA 1OKZA 3CP9A 4FKUA 4RIOA 2XIYA 4O7ZA 4BCOA 3T8OA 3VS4A 3IW7A 2R3RA 4WRSA 1OIQA 2Z7LA 4X0MA 5EH0A 2JDSA 4EQCA 3KULB 4IFGA 3TWJA 4E6AA 3AT4A 4BDGA 4TY1A 5E1SA 4ZY4A 3A8XA 4IZAA 3R1YA 4YNEA 3V5WA 3M2WA 4BDJA 1CMKE 4GL9A 3GQLA 4C3FA 3MV5A 4XLVA 4D0WA 3KL8A 4GFOA 1ZLTA 4NFNA 2GQRA 3GCUA 3VS5A 4MXAA 2VO0A 4AN3A 3W2PA 2YFXA 3FY0A 4C4EA 2HXLA 2QU6A 3S2PA 3A60A 3GEQA 3UPXA 2XCHA 4BY9E 2QO9A 1FVVA 3GU5A 4U0IA 3OS3A 4L44A 4L8MA 1LP4A 2LGCA 1PY5A 4JAIA 4LV5A 5KMNA 3HMNA 2XNMA 1J1CA 4MEDA 4MK0A 5K4IA 1GIHA 3GFWA 4BZNA 1IRKA 4GG5A 2PVFA 5AP3A 1Q24A 5AUTA 3RMFA 4ZZOA 4PUZA 5HO8A 2J0JA 2YM8A 3EN9A 2VAGA 4QYFA 3C1XA 3IDBA 2XJ2A 4GFMA 4R7HA 2I1MA 3FMKA 3PIYA 3G5DA 3H10A 3MIAA 5IMXA 3D15A 4YJVA 4NL0A 5IQHA 4RIWA 2VNYA 4AZSA 3D2KA 4FKQA 2W4OA 3FLSA 5HIDA 1OB3A 5KZIA 4AP7A 1OPKA 4IDTA 1WVWA 3DKFA 4K9YA 2DQ7X 4FG8A 4MH7A 2J50A 4WHZA 4EOPA 4FKVA 4XEYA 3DJ6A 3DKCA 4FODA 4D4SA 5F9EA 5J9ZA 4Q2AA 4J8NA 3RTPA 2GS2A 2A1AB 4UBAA 2CCHA 5J7HA 2X2KA 4PRJA 4NEUA 5JQ8A 4U42A 4KRDA 4FV0A 4UYNA 5IA5A 2R5TA 2CDZA 4AZEA 4J97A 4AAAA 4C61A 4U79A 4J7BA 3U9CA 4BCKA 3QQHA 5HVKA 3BYOA 4BZDA 2UVYA 3L1SA 3QAME 4FTOA 5A14A 3S3IA 3WE8A 2C47A 4RFMA 3AC5A 5C03A 4BGHA 3VBQA 3R8ZA 4DFXE 4F08A 4BTMA 2PUNA 4ERKA 2XNGA 1ZMVA 3WYYA 2B53A 4Q9ZA 4XMOA 2X4FA 4QOXA 3WILA 3VO3A 3CGFA 1Q62A 3BPRA 4WA9A 4PPAA 2XEYA 1M17A 3JY9A 3BHVA 4FV1A 3ZSHA 4BCMA 4QMZA 2C0OA 4Y72A 2GHGA 3W2RA 3P0MA 2LAVA 2I0VA 4M66A 4X3FA 3K5UA 5FEDA 4AW2A 2W96B 3ZO3A 5IDNA 4IC8A 1HCLA 2CNUA 4UWYA 1JVPP 2V62A 3QLFA 3QCQA 3RPVA 4FV5A 3QTZA 4I24A 3G0FA 3LQ3A 4JRNA 2RG5A 2QR8A 1XR1A 5HBJA 4B8LA 1OITA 2XKFA 3CQWA 2CGXA 4KKEA 2Y7JA 3GU6A 3VUTA 3KVWA 3FXXA 5B2MA 5H3QA 1RQQA 4I0RA 4YGAA 5DVRA 3GCSA 4ZLZA 4FOCA 2VTHA 3FMEA 1V0OA 3K2LA 4I4EA 3OCBA 2ITWA 3PPJA 4PMMA 3R9OA 5M4UA 3LJ2A 5HLPA 3EOCA 4C37A 2BKKA 2O65A 3P23A 1H00A 4JBVA 2FSTX 3IW6A 4O21A 3TTIA 2FH9A 1VEBA 4G3FA 4QYYA 2ZV9A 3DFAA 2H8HA 5IQBA 2QU5A 2OIBA 4MBIA 3A7IA 3FWQA 2ITPA 4Y5QA 4O2PA 5F4NA 2UZTA 3QWKA 4IWPA 5H8BA 5BPYA 4MX9A 4R3CA 3CGOA 5ANDA 4EC9A 4D28A 1JOWB 3I5NA 3JVRA 4RLLA 2G2HA 3IDPA 3PXFA 5I9UA 3HMIA 3QTQA 4ZTHA 5FBNC 2WO6A 4UX9A 5JH6A 4X2GA 4NW5A 5HTBA 4NU1A 5IZFA 4EWQA 5CX9A 4MWHA 2JFMA 5FLFA 2X8DA 3QRUA 5KKRB 3BV3A 2OICA 3HAMA 1WBTA 3E7OA 3UQGA 1WBWA 3JS2A 3ZM4A 4AN2A 3RCDA 3RK7A 4I5MA 2WMTA 4R8QA 5C26A 4BDIA 3I79A 3HMOA 4JXFA 2XKEA 1Q8TA 3V8TA 4OTGA 2QKWB 3SW7A 3R6XA 3ZEWA 3HYHA 3FXZA 2ETMA 4IZ5A 3REPA 4BDAA 3DA6A 3HRBA 4WUAA 2QOCA 3NIZA 3ZXTA 2WOUA 4Y46A 3BYMA 2PTKA 3WBLA 3FKOA 4JDJA 4QT1A 1H1RA 2BVAA 4WBBB 5CEOA 5M4FA 1OIUA 4D1ZA 2XEZA 1ZXEA 3G15A 3EJ1A 2VWWA 3AMAA 3MA3A 4NFMA 4FL3A 5CNNA 5HLWA 1OBDA 4WD5A 3Q5IA 3KMWA 4DGNA 1BI7A 4JX7A 1JBPE 3HRFA 4JDIA 1BMKA 2E9OA 3W18A 4Z55A 2FVDA 4FNYA 4EJNA 4W9XA 2YLFA 2PY3A 4FTUA 4C35A 4ZSAA 3EQIA 2WMXA 1F5QA 2QC6A 1U54B 4EORA 5EQEA 3ZC5A 5HX6A 3BZ3A 3KA0A 2OFUA 4OTHA 4WNMA 3NR9A 4ZTRA 3OFMA 4CFXA 2C4GA 3DXNA 2BIYA 3IONA 4V0GA 3ZOSA 2WQMA 5IUHA 3I6WA 4DHFA 4QRCA 4EOOA 2C0TA 2YCRA 4PL3A 4ANSA 3ZYAA 2BILB 3SC1A 2YM3A 4G9RA 2QURA 1GZOA 1OBGA 4CCBA 3GU4A 3AGLA 1XBCA 3DBEA 3GXLA 2BHEA 3MB7A 1URCA 2ZM1A 4NH1A 5HBEA 1PW2A 2XKDA 4I0TA 3D7TA 2YABA 3R9HA 3S00A 4U8ZA 4K11A 2XIKA 4PF4A 1IASA 2VTMA 3P1AA 3PZHA 3N4TA 5I0BA 3W16A 4GT5A 5AA8A 3ORNA 1Q8YA 3QYZA 5AV0A 4C4JA 1H0VA 3CKWA 3WF8A 4D2VA 4F1TA 4FTKA 2JDRA 3GU7A 3NAYA 1ZYJA 2J4ZA 4Q5EA 4B0GA 4KABA 3OW3A 4EZ7A 4OGRA 3MGYA 5A6OA 1XBBA 3MH3A 4O1OA 4TRLA 4J1RA 5HTCA 4NM7A 5KO1A 4RVMA 5AJQA 3OT3A 1OGUA 2UUEA 4FTNA 4TXCA 2ESMA 3AC1A 3QUPA 5DWRA 3CTHA 1W83A 5TF9A 4YTCA 4QMTA 3LHJA 1Y91A 2G15A 5EQPA 1LUFA 3OXIA 3R73A 3GC9A 2DYLA 4KBKA 4O6LA 1W84A 1JWHA 2R0UA 3FPQA 3QCYA 4KUJA 5AAGA 4L45A 4L7SA 1Y8GA 2W1HA 3VS0A 5M07A 4QP7A 2OK1A 1Z5MA 3AD5A 2G9XA 3P86A 2OXYA 5IUGA 5EDRA 2HWPA 5AMNA 4QMWA 4BBMA 4FSQA 3DK6A 3KB7A 5HG5A 4DEAA 3ZM9A 3BGQA 4FV3A 5JFSA 4FV7A 5ACBC 5HNIX 1BLXA 4E8AA 3W2QA 3GCVA 4F0GA 4NJ3A 5JK3A 4G3EA 2PE0A 1X8BA 4Y8DA 5M51A 4G6NA 5CI7A 3LLTA 4DE4A 1OL7A 2GNJA 3FC2A 2YCSA 2J0LA 3TEIA 3DNEA 5HTIA 5HEZA 1U59A 2V22A 4FKTA 4CZYB 4IAKA 2WHBA 4BTKA 3QTRA 4EH4A 2B9JA 2YJRA 3HKOA 2XIRA 2XP2A 4JAJA 5AX3A 1RDQE 2R3IA 4M8TA 4YC3A 3DJ7A 4Z7GA 1JPAA 1NVRA 3MFTA 4IAAA 4C58A 3H9OA 4M15A 5DN3A 3SLSA 2ZB0A 1YHVA 1QPDA 4HZRA 2I7QA 5HNGA 4RC4A 2W99B 3Q3BA 3HZTA 5GIOE 3EFJA 4L52A 5CTPA 4BI0A 2YWVA 1W8CA 4L01A 3MB6A 5JFWA 3DDPA 2CN5A 3LJ1A 4RIXA 3FKNA 3MWUA 4DBNA 3HMMA 3SW4A 4NW6A 4Y83A 4J71A 4YC8A 4BDDA 2JIUA 1UU3A 2IZRA 4U43A 5GNKA 3COMA 4F1OA 3A7FA 4IANA 4ZOGA 1M7QA 1NA7A 1P14A 2GQGA 2HXQA 3G51A 4W4XA 4LUEA 3N4VA 2CN8A 2OGVA 5IH6A 2J5EA 4JR7A 2W5BA 4M69A 5AUVA 5E9EA 4L68A 2UW3A 3NNVA 5D11A 3FMLA 2J0KA 2OZOA 4YJOA 2O8YA 2PMIA 3OWPA 3SXFA 3NUAA 2UW9A 4UV0A 4R7IA 4CT2A 1KUTA 1H0WA 4FX3A 4D58A 1TQIA 3COHA 3I0OA 3KMMA 2W1FA 4HCTA 1IAHA 4BIDA 5B7VA 1OVEA 4IAYA 1XHAA 3BGPA 4EONA 3MW1A 4LM5A 4BCFA 4D2WA 4FBXA 2Z60A 3BE9A 3Q9XA 4ENYA 2FUMA 2X7OA 4C02A 5GJFA 3FI8A 3DV3A 2IVVA 3VUIA 3U4WA 2PE1A 2YWPA 1H1WA 5AA9A 3TZMA 4TT7A 4TWPA 1SVEA 2O0UA 3ORMA 3O8PA 3OCSA 4CCUA 4DITA 4EK4A 4QTEA 3UYSA 3RM6A 3ZUTA 4AZFA 4GYGA 3A7JA 4N6ZA 4XG8A 5AM6A 4EH2A 1OECA 3R21A 4EOLA 4WG3A 5CLPA 3VBYA 2GSFA 4Z3VA 4D2SA 5FM3A 5L2IA 5E8TA 1NW1A 2XYNA 3O2MA 4NIFA 5KMKA 3R8MA 4HYSA 3FPMA 2QLQA 3MVJA 3MY0A 1UKIA 1DAWA 2W9ZB 3I7CA 3IGOA 4JG8A 4O27B 2VWXA 4FNWA 5ETFA 5AV2A 4BTFA 3HA6A 3ULZA 3VUGA 3JXWA 4FSUA 5C8NA 3P4KA 2QOBA 2C6EA 4IAIA 3UE4A 4DLJA 3BHTA 4EH6A 4AT3A 2X39A 3BYVA 2V7AA 1UU9A 3NYVA 2PVMA 5HCZA 2C3JA 5AADA 1WAKA 4O6EA 4G3CA 3ORPA 2R7IA 4QD6A 4BCGA 1XKKA 4D0XA 4F9AA 3BLQA 2IZTA 2X6DA 5ACKA 5CALA 4QTBA 4C4IA 2R3NA 2Z2WA 1KV1A 3AT3A 4OTFA 4DBXA 4F9CA 4AA4A 3O8UA 1ZRZA 4NZWB 4OTQA 4BCQA 2OF4A 1H01A 1CKIA 2JIIA 3EQPA 2UW4A 3AOXA 3DQXA 5M4IA 5HO6A 4MXZA 3QUDA 3TZ9A 1FOTA 3HNGA 4FTIA 4F7NA 2J90A 4I5CA 3NPCA 2XNOA 4M68A 5IEYA 2W1DA 4BCHA 4DFBA 3IOPA 2FA2A 2ZV2A 2QNJA 1OL1A 5CSHA 2OWBA 2XRUA 4G16A 1PXNA 2C5NA 4U41A 4L42A 3K54A 4X2KA 4ZEGA 4M0YA 4UXLA 4C2WA 4C4FA 3UQCA 2F57A 3BV2A 3O96A 3ORXA 2PZ5A 3PVBA 3R7GA 4YJTA 3C51A 3D5XA 4RZWA 5JFVA 3U6IA 1QCFA 2ZJWA 3GCQA 4ANMA 4ZMFA 4C4GA 5KHXA 2NRUA 1PYEA 2XH5A 4WG5A 2WEVA 3KXXA 3ZFMA 2ERKA 2ZDTA 5L3AA 3KKVA 4ONAA 4O81A 2PUPA 1KE5A 2F7ZE 2HY81 2XZSA 3PSDA 1R3CA 2PZPA 2XJ0A 5FBOA 1KE9A 5KMIA 5A4QA 5I9VA 3TV4A 3SD0A 3IDCA 3FMDA 2XKCA 2OZAA 1W82A 1BKXA 4WNOA 4EC8A 2DWBA 4OT6A 5FD2A 4RPVA 1SMHA 3DBFA 3KN5A 4RT7A 2JFLA 5K0XA 2I0EA 2YZAA 5CZHA 3RHKA 3LXPA 4CLIA 3AD6A 4IEBA 3U51A 2E9VA 2IG7A 4F70A 3BIZA 2XA4A 2OJJA 4GRBA 4PTEA 4M13A 1CSNA 3PJ8A 4YJQA 2PVKA 2OJIA 3U55A 3PJ2A 5AFVA 1PMUA 4MXCA 3ZBXA 5AUWA 4ZY5A 5B2LA 1PF8A 3KXGA 3OT8A 4PQNA 3F82A 5H8EA 4E20A 4YJPA 3PZEA 4ID7A 3D4QA 3ROCA 4HW7A 2R3MA 3DKOA 2WNTA 4EK8A 3ID6C 4KWPA 5HI2A 2AUHA 3RI1A 4USFA 4ZIMA 4AGCA 4QP3A 3EQGA 3RWPA 1SNUA 3UMWA 3G6HA 3JPVA 5I3OA 3QGWA 3FL4A 1ZYCA 5CSWA 4FA2A 4CFFA 3QX4A 5LVNA 2VU3A 4GYIA 4I1ZA 4X3JA 1HOWA 4ZY6A 4YTIA 2XK7A 3O8TA 3R7YA 4FT7A 1SNXA 2A0CX 3FLYA 4RGJA 3F2NA 4XRLA 4YZMA 4BGQA 4DH7A 5LWMA 1YW2A 1SZMA 4YR8A 4K0YA 3Q6WA 3PJCA 4I22A 4EUUA 3TI1A 4HVHA 1HCKA 3R02A 1FMKA 5KE0A 4ZP5A 4RWJA 1MP8A 5DR2A 2NRYA 4C8BA 4GK3A 4FE2A 1NXKA 2QODA 5D1JA 4FYOA 1IR3A 5HD7A 3RPOA 3ZO1A 4F09A 5BVKA 4DFUA 3EQHA 3HX4A 2UW0A 4MBJA 4TYJA 1H07A 4CVAA 3F69A 4LOPA 5DRBA 3GP0A 4CFVA 3S1HA 4LGHA 2XVDA 3UZTA 4OUCA 1WVYA 3BU5A 4M7IA 1LEWA 5HBHA 2BIKB 4HGSA 5LMAA 1OZ1A 5CU0A 3ZLSA 3L9LA 1TQMA 5DYJA 4OLIA 1M2RA 3RWQA 4UB7A 4YO6A 1L3RE 3PRFA 5IH4A 3LKMA 3WOWA 3JUHA 4FSTA 4D2PA 1GY3A 3A4PA 4J53A 1U5QA 3ZEPA 4JR3A 5BVWA 3LW0A 3ETAA 5IQIA 2XJ1A 4ZJVA 1WVXA 4O84A 2OH4A 4F9YA 3OVVA 3V8SA 3NAXA 2I0YA 1S9JA 1PMEA 2WU6A 4LOQA 2HW6A 2BRHA 4L3JA 3QRKA 3Q4ZA 4DH8A 3CIKA 4X2FA 4U3ZA 2R2PA 3WYXA 4F4PA 2Y0AA 2C6DA 3W2CA 4D1XA 2X4ZA 1YWNA 3Q53A 4O2ZA 4B99A 1UU8A 3OMVA 3MY5A 3H30A 4EH3A 5L8JA 3DKGA 3DBDA 4BC6A 3QD4A 4IX3A 4GU9A 5A4CA 1YWVA 1Q97A 4KIPA 3W33A 3L8VA 1E9HA 5AP4A 4TWOA 3TNWA 2B54A 5DLSA 2OBJA 1ZY5A 5AR4A 3CY2A 4O7TA 2BRBA 2ZYBA 1PJKA 2BR1A 2RIOA 2HY0A 2O2UA 3NCZA 3Q9WA 4YSMA 4QP4A 1UA2A 3FMJA 4G31A 3KF4A 1JAMA 3E62A 4IACA 5LARA 4EOQA 4HPUE 3MVLA 3NNWA 4ZSEA 2XK9A 3A99A 5AR5A 4BHZA 1FBNA 4FUYA 3ITZA 1YXSA 3CY3A 2JDVA 3MJ1A 1PMVA 4WSQA 4JBQA 3QQJA 2HWOA 2WMRA 4FZFB 5AM7A 2F9GA 3FLNC 1H8FA 1IEPA 3AC4A 2OLCA 2FSOX 3KRRA 3E63A 4EEVA 3CJGA 1J7UA 2Z02A 3PXQA 4EK3A 4USDA 3BHHA 5CWZA 3PP0A 3GOPA 3PXRA 4JDKA 5FP5A 4DEBA 2GCDA 4QMUA 2EXMA 2C0IA 2YACA 4E6DA 4R5SA 3MH2A 5E1EA 4BCIA 3U87A 5IA2A 3FEGA
chains in the Genus database with same CATH superfamily
2X6EA 4CQGA 2C3LA 3TZ7A 5IEVA 4ARKA 4E73A 3DB6A 4RC3A 5HE3A 2UW6A 2P3GX 5HE1A 3SDJA 4KIKB 4C62A 4I21A 5CAUA 5TO8A 5JZJA 4LRKA 1MRVA 3Q32A 3R8PA 4O7RA 2WTDA 4JBOA 4YBJA 3UOLA 4DTBA 3LCSA 4GIHA 4FEUA 1WBPA 2XYUA 3MFUA 4RZVA 2HYYA 2YDKA 4ZTMA 4K18A 1LPUA 3TACA 5DH3A 3KCKA 4U40A 3UNKA 3FDNA 3RCJA 1F3MC 3B2WA 2X9FA 4EOKA 2VTNA 1OL2A 3C5UA 5BYZA 3IOKA 3QALE 4ZK5A 2H96A 5FTQA 3HMPA 2GNLA 3H9FA 2WTKB 2BZHB 5CEKA 3E87A 2R0IA 2PVJA 2YJSA 3QD0A 4GT4A 4IDVA 1AGWA 4DFNA 3HRCA 2QOQA 2WMUA 4M0ZA 4H3PA 5EOBA 1WBNA 3AKLA 4CT1A 4A9SA 4RLKA 3PVWA 3D9VA 3FLWA 3R9DA 4ANQA 5ANJA 3UJGA 2VTOA 3QA0A 4YLKA 5AV3A 5D41A 2GQSA 3R1NA 4ZZMA 5E8ZA 3MTLA 4UMRA 3AMBA 2GTNA 4DEIA 4BHNA 5K5XA 3EHAA 4RWIA 3CC6A 4LV7A 3MH0A 3OWKA 4HNFA 4A7CA 2R3HA 4ZTLA 5F95A 2J0MB 1K9AA 2WU7A 4DGMA 3WZUA 2X2MA 4FSNA 5BUJA 5DT4A 2R64A 4PPCA 3BEGA 4LUDA 4MQ2A 4AXAA 2R3GA 3R71A 3RP9A 1ZAOA 3RHXA 1V0BA 4ZLOA 3HLLA 3NRMA 4CGAA 4BWXA 4I20A 2CKEA 5KMMA 4XRJA 4YHTA 1DI9A 3LCOA 3R2YA 3GBZA 5CVHA 4WSYA 3DZQA 4NTTA 3F3ZA 4IZ7A 4UALA 3R8VA 4YHJA 3R9NA 2VX1A 3ZRLA 5HU9A 4DG2E 4QP9A 3C4XA 5LVMA 1R0EA 1YI3A 4XP2A 4O7LA 3A4OX 4JJRA 3UZRA 4AOTA 5A4EA 2G01A 4G6LA 1PXJA 5BVFA 4FV9A 5I9XA 2DUVA 1ZYDA 2W1IA 3VW8A 1JKLA 2ZV8A 3RALA 4D9TA 4F6WA 4QMVA 3DLSA 5BYLA 3RZBA 2IVUA 3AMYA 3MVHA 3U6HA 3EKKA 2GU8A 5LVPA 5HX8A 2B9IA 5LCJA 2HK5A 1OMWA 5DE2A 5AP0A 5IQDA 4MXYA 3ODYX 4H1JA 4OW8A 3B8RA 3ELJA 3CTQA 5KKRC 5JKGA 2E9PA 2C5OA 1WCCA 4KSPA 4DCEA 3BWJA 4EYJA 4BKJA 4XUFA 2NPQA 3Q60A 3FZPA 3LCTA 5CEQA 2ZFYA 3KRXA 3ORLA 2PWLA 2W5HA 5L2TA 4QO9A 3I7BA 4IM2A 5L2SA 4YPDA 2JD5A 2PPQA 2CGVA 5AP1A 3Q04A 5F1ZA 3P9JA 3C50A 3HA8A 4RFZA 4ZSJA 3VHEA 2XK6A 2G2IA 2ZV7A 4TL0A 3E88A 5IKWA 5EI6A 3Q6UA 4O4FA 1ZOEA 3M42A 2B0QA 3LFCA 4MNEA 3FUPA 4RVLA 2WQEA 2YHVA 4Y73A 3SG8A 2VV9A 3LFNA 4FSZA 2B52A 2XIXA 5EM6A 3SRVA 2JC6A 4ACMA 4HVDA 4RWLA 4P2KA 3BI6A 1JKTA 1H1PA 3SHEA 2PZRA 2ETRA 3OY1A 4UMUA 1TVOA 5A54A 2BDWA 3VAPA 2Z7QA 2GTMA 3GGFA 1K2PA 2QOKA 4GEOA 3MA6A 2X0GA 4CKJA 5CVFA 3D2IA 3OCTA 3TUBA 5LXMA 3C7QA 2F4JA 2HIWA 4XG4A 4GW8A 1YXXA 5CU3A 5CEPA 3EFKA 2ONLC 3UP2A 4DDGA 2FYSA 1IG1A 2UVXA 1TKIA 1YQJA 3BU6A 5T6KA 2AYPA 4AW0A 3Q96A 3HUBA 3SG9A 4UWBA 4IQ6A 3R0TA 4KKHA 3CJFA 4AE9A 4H36A 4RX9A 3LMGA 5A4LA 3SXRA 2Y4PA 5KMLA 4FTQA 4ZSLA 3T3VA 2VO6A 4ALWA 4NKAA 5FTOA 4MTAA 3T3UA 1ND4A 3OBGA 3BLHA 1IAJA 3BL9A 4QDEA 4NM5A 4IB1A 3PLSA 4FYNA 4OTPA 5FEEA 2W0JA 3PLAE 1XH9A 3KGAA 2H9VA 4QPAA 2V5QA 5DG5A 5A6NA 2AC5A 1RJBA 4A4LA 3ZHPC 2ITZA 5LQFA 2PMLX 3DZOA 4KSQA 4L9IA 5E8WA 3K3IA 4AACA 1B39A 4XV9A 5HCYA 3VUMA 3KIOC 2YZLA 4PDYA 2HCKA 1VZOA 2UV2A 1B6CB 3EKNA 2A4LA 3G33A 4FGRA 2IVSA 4O7VA 3LCDA 4JNWA 3TCPA 3ET7A 1YXUA 2J2IB 4MWIA 3RAHA 4F7JA 4NCTC 4BGGA 3LMIA 1SYKA 2X8EA 3H4JA 1R78A 3NUYA 2C5XA 2IO6A 2WOTA 4DG3E 2PE2A 1S9IA 2ACXA 4UN0C 4DEHA 4C4HA 3PPKA 5HU3A 5CEMA 2ZDUA 4ACGA 1U4DA 3QWJA 5IA0A 3LLAA 2O63A 1CKJA 5KHWA 1G5SA 5L2WA 4C34A 2XK8A 3DLZA 3QX2A 3W1FA 3ZLWA 4S30A 4CG8A 3O5AA 4AT5A 5TE0A 5AX9A 3A7HA 3M1SA 2YIYA 3D94A 5KBQA 3QQGA 3R9RA 4BCJA 3E8NA 3EFLA 3QU0A 1AQ1A 4O0SA 1PXPA 4CQEA 2JKKA 1VYZA 2R3FA 5FM2A 2JBOA 5LJJA 3UMXA 3PG1A 3COIA 2R3KA 1P4FA 2XUUA 3ERKA 4XV1A 2VTPA 4ACDA 4YUQA 5IA4A 3ZZEA 4GS6A 3EL7A 4FV2A 4L6QA 1OUYA 4FT9A 4OBOA 1DS5A 4JRVA 2DS1A 3HUCA 4BYIA 4HOKA 3S95A 2WMBA 3EIDA 4KIOA 3PXKA 5D12A 3CTJA 2XM8A 3A8WA 3P7AA 5DGZA 3WE4A 4ZAUA 2GFSA 4FIGA 4FTRA 4JS8A 4KIQA 2W9FB 2XM9A 3CCNA 4UYAA 3FXWA 4O0YA 4BZOA 4EHZA 3NUSA 2CMWA 3PSCA 3ULIA 1Q99A 1OM1A 4I6BA 4JT3A 4HCVA 3RAWA 2A19B 3ZUVA 4DGGA 3L9MA 4CFUA 4YSJA 4U9AA 3DOGA 3ORIA 3DAJA 3IK3A 3UDSA 3V5JA 5CYIA 4TYHA 4KKGA 1VR2A 3IGGA 4GFGA 4IM0A 3MESA 4BKZA 5LMKC 4J52A 4IIRA 1A48A 4CZUA 4ZLYA 3O7LB 4QMXA 3DXQA 3VJNA 4BWKA 4EZ5A 3NVKI 4FVQA 4S31A 5AP7A 1LEZA 2A2AA 2B1PA 3F61A 3PJ3A 4YJNA 5GJGA 4EKKA 1V0PA 2W7XA 2X1NA 3KULA 3FAAA 2KULA 4KS8A 3DFCB 4JOAA 2R4BA 4XP3A 4JX3A 4DEDA 4YO4A 3CBLA 2Q83A 4FIHA 3V01A 4C36A 4L7FA 4DEEA 4IX6A 5AEPA 5CSPA 4E5AX 1ZMWA 2REIA 2P55A 1ZWSA 3DU8A 4IM3A 4O0VA 4DT8A 4NSTA 4D4RA 5GJDA 5CF6A 4EH8A 2ETKA 3KCFA 1XH5A 2YCQA 3PE1A 4YJSA 3TKUA 3D83A 1XBAA 3BE2A 3F6XA 2P4IA 3V04A 5FXQA 4BWPA 5AV1A 4NM0A 4M84A 3U54A 4NTSA 2R3OA 4RWKA 4IBMA 3WF9A 4BF2A 3QTXA 3NWWA 3UGCA 3SAYA 4ACHA 4WNKA 3S4QA 3NYXA 4QYGA 4E6QA 2B9FA 5K9IA 3ANQA 2OI4X 3MYGA 3OOGA 2IW6A 4PMPA 4AE6A 3VVHA 2VGOA 2BZKB 2XBAA 4IXPA 5GZ9A 3TJCA 4C0TA 2HZNA 2JDTA 5G1XA 3PA5A 1OL6A 2BRNA 3UC3A 5IQAA 2IZSA 2VWBA 3CPBA 3UTOA 4MNFA 2UZUE 4TWCA 5C9CA 1W98A 3FL5A 1FINA 3LM0A 4YJUA 1U5RA 3Q9YA 1Q3WA 3QZGA 4HYHA 4IVDA 4MCVA 4EWHA 5E92A 5BYYA 4AXDA 4FT5A 4FEWA 4DDIA 3CD8A 3N9XA 4LRMA 3VBXA 4A07A 5ANKA 2B55A 2W17A 3B2TA 5HG7A 3BQCA 4GVJA 2OIQA 5HE2A 2R3LA 3BYUA 3OG7A 4XS2A 4RQVA 4RIYB 5EDPA 2QO7A 2OSCA 2OO8X 2QLUA 4EBWA 2ITTA 4LL5A 4NT4A 4LMUA 2PSQA 4CKRA 3TTJA 1U46A 3NYOA 5F20A 4EZ3A 5CU2A 4U45A 2VX0A 4CLJA 1KE6A 2C6TA 3FHIA 1BL7A 5FDPA 3NMUF 3FV8A 4PDPA 3TNQB 3W55A 2BDFA 3OP5A 5AUUA 2EB3A 2B7AA 4FL2A 4JQ8A 4GU6A 2CKPA 3U9NA 2PU8A 1XQZA 2VTJA 5B2KA 5G6VA 4M97A 2O5KA 3A61A 4O0TA 3F88A 5AR3A 4DFZE 1Y8YA 3AD4A 3O17A 3FI4A 1Q5KA 3V6SA 3WZDA 2BAKA 2Z7SA 1YXVA 2BROA 3R28A 4AFEA 4F7LA 3MN3A 3QQLA 4XG9A 1Y6AA 4YP8A 4F64A 3EB0A 4DYMA 4I6HA 4I23A 3BYSA 2WXVA 2I40A 3UIXA 5AIRA 3AC3A 2CNVA 1H1QA 3W8LA 3ATSA 3PUFC 4BTJA 1DI8A 1H4LA 2VNWA 1BX6A 4K2RA 3ZONA 5JGBA 1V1KA 4BL1A 2CCIA 2Q0BA 5ANEA 5LVLA 5DEWA 4DGOA 3EYGA 3ODZX 3LQ8A 4G17A 4TTHB 4RX8A 4TZRA 5IQGA 2OKRA 4S34A 5LCKA 4DH5A 5J5TA 3HECA 5HVYA 5CNOA 2CKOA 4AGWA 3MSSA 2GNIA 1YI6A 4GCJA 1CTPE 2J51A 1NY3A 3F3UA 4PY1A 4A06A 3UODA 5JEBA 2QOLA 2PUUA 4J95A 4CSVA 4X6QC 3TZ8A 4UMQA 2ERZE 2VWIA 2P2HA 3VN9A 4O0XA 3SA0A 1Q8WA 2QKRA 3AC2A 3ZO2A 2OH0E 4F6SA 5J7BA 3TYKA 2X0PA 5DBXA 1LR4A 4FEVA 5CANA 4E4MA 3POOA 5I9ZA 3R30A 4AZVA 5BV3A 3ZSGA 1PXIA 3HDNA 3I4BA 1NVQA 4I6LA 4G3DA 1Z57A 2WFYA 1G8KA 3L8PA 4MD7E 3F2RA 4LI5A 2CJMA 3HV5A 4FZDB 4LL0A 4RRVA 4YPSA 5AUZA 4MYGA 4AN9A 3DDQA 3UBDA 2UZNA 3VUDA 4CRLA 5HKMA 2WTVA 3PP1A 3JR1A 3IG7A 3A2CA 4IVBA 1PKGA 1WBSA 4GG7A 3BWFA 3QTUA 1UNGA 1URWA 3FSKA 1KV2A 4PX6A 5ETIA 4DH1A 2PVRA 4RFYA 4OTDA 4FMQA 5J5SA 4F0FA 2UW8A 1OI9A 4USEA 3VQUA 3DTCA 3GVUA 4LGDA 3NUUA 4JDHA 4AF3A 2OFVA 3FQSA 2BKZA 5CAPA 3RVGA 1H1SA 3DXPA 4R78A 3BHYA 3KC3A 3I0QA 3HP5A 4RIWB 2CGUA 3UVQA 5AAEA 2J0IA 1BL6A 3PRIA 4FNZA 4QYEA 3G9NA 4GMYA 4K77A 4ITHA 4KBAA 4M3QA 3HV6A 5EHOA 4AA5A 1I44A 3ZFXA 3R7OA 4Y95A 3A62A 3WF5A 4AGUA 3VWAA 5CU6A 1U54A 3MDYA 4GVAA 4A9UA 3TIZA 1B38A 4FI1A 3KMUA 3NW6A 1Q41A 2RGPA 4EOSA 5ETCA 3O7LD 2WMVA 2QQ7A 4G1WA 3QZIA 4UMPA 3NS9A 4CMTA 4AOIA 2ONLA 4PL4A 2RKUA 2X9EA 2BPMA 3CKXA 4RJ4A 3UOHA 2FSLX 1JNKA 2YISA 4K8AA 1PXLA 4AWIA 5IH5A 1YVJA 5EDQA 4RJ5A 4U3YA 4XYFA 4ASEA 2RFSA 4EUTA 4HYIA 3LFQA 3C0IA 5AP2A 3SOCA 3QHRA 4LFIA 3UVPA 2UZBA 5KZ0A 3QTSA 5L8LA 5IA1A 4AS0A 4AXCA 3LVPA 4FIFA 5CAQA 4AXFA 5FQDC 2YDJA 4FG9A 3CR0A 4FKGA 2OG8A 4LGGA 2RG6A 4OTRA 5K5NA 4CTCA 1MQ4A 4QQJA 4W4WA 5IQCA 4ANLA 5L6OA 3EWHA 3NIEA 4ZMEA 2WTWA 4IZYA 3DNDA 3NNUA 1OIRA 4X6RA 5E8UA 4B6LA 5EG3A 1ZZLA 4QMPA 4EOIA 3KXZA 3OXZA 3UOJA 3ZS5A 2OIDA 1EH4A 2B9HA 2Y6OA 3NSZA 4MHAA 4DEGA 1M7NA 3UG1A 5KUPA 2QI8A 3QKLA 4FJVA 3LMHA 2YIXA 1QPCA 2G2FA 4EHGA 4NCTA 1KE7A 3IQ7A 3UDBA 2Y9QA 4P7EA 3FLZA 2P2IA 4R6VA 4YLJA 2QOOA 2VTQA 3IECA 4ASXA 5IDPA 3PIZA 4DGLC 2XAMA 3AGMA 3FBVA 2JDOA 3QRTA 3E3PA 3TKHA 4C3PA 4RX5A 3R1SA 2CNQA 3C0HA 3FKLA 2BHHA 2IW9A 5HD4A 2QHNA 1YOMA 4D4VA 3I1AA 2BFXA 5DT0A 5EM5A 1SVGA 4O7YA 1PYXA 4I5HA 4O7SA 1YKRA 2C1AA 4QTAA 3NLBA 4D5KA 5M09A 5HOAA 5E7RA 4M67A 3GNIB 4YZ9A 4HGLA 4XHKB 1CDKA 3C4EA 4K6ZA 4XG6A 3RJCA 3ZC6A 5BVEA 4QMOA 1XO2B 1M2PA 3ACJA 3ZSIA 5GIPE 3A7GA 2BUJA 3BX5A 4PDSA 5BMMA 2ITOA 4YNOA 3THBA 3EN7A 4R3PA 3PWYA 2ZMCA 2UZOA 4FTAA 4ZS0A 3KN6A 4FZ7A 5JSMA 4D1SA 3S0OA 3W32A 3SKCA 3D14A 2PL0A 2E9NA 3GCPA 2XNEA 1T45A 3MJ2A 5HORA 2J7TA 1M2QA 4AZWA 5LOHA 4KAOA 1GZNA 1ATPE 4CRSA 2V55A 1OKWA 5CXHA 2NO3A 2C6OA 1H08A 3VS1A 3Q5ZA 5CF8A 2IN6A 4HVIA 2EVAA 3BU3A 2FO0A 2AC3A 3OTVA 3H0YA 2ZOQA 3UIMA 5TKDA 3PXZA 3LQ5A 4LQMA 2KTYA 1R0PA 2R9SA 2WGJA 4GK4A 5ETAA 5M4CA 4N57A 3C4FA 4W4VA 3F7ZA 5HCXA 3SX9A 1I09A 3UZPA 4O86A 5BVDA 5K0KA 3FQEA 5LMKA 4HNIA 5E8VA 4QPSA 4TYEA 2ITNA 4GK2A 4ALUA 4E6CA 3F3VA 3BEAA 2JKQA 5CEIA 1GNGA 3IW8A 3NW5A 3QCXA 5J87A 5CENA 2BZJA 4O4CA 4TPTA 2X7GA 3OW4A 2FB8A 4ZJJA 4CG9A 1UNHA 2YM5A 4CFNA 4LV8A 5J1VA 3VJOA 1FGKA 4QTDA 2WQBA 4BYJA 1VJYA 3ALNA 3FI2A 3I60A 4CFWA 2VWYA 3O71A 2EU9A 2IZUA 4GSBA 4MXXA 3QZFA 4IC7A 3R63A 2WTKC 3BBTB 3O51A 3MPMA 2XBJA 3ZRKA 4DTKA 3UO5A 2IWIA 5HZNA 3GC8A 3PJ1A 1UWJA 4MAOA 4MD9E 4V0GB 5ANOA 4YU2A 5M56A 5IQEA 4QNAA 2OJ9A 4TN6A 4MF1A 3Q4UA 5EI2A 4JBPA 1FVRA 3LFDA 2HW7A 4AZTA 4HVGA 1RE8A 4ZTNA 4H05A 4ITIA 1BUHA 3I5ZA 1FGIA 1UU7A 2RFDA 3F7WA 1WFCA 4O0RA 5DEYA 3F9NA 1G3NA 4G9CA 5JGAA 2F7EE 2CSNA 3PVGA 4CXAA 3DQWA 4QEBA 3RBWA 3CE3A 2W1CA 2J9MA 1H27A 3QD3A 1QPEA 4KB8A 2UZLA 4KD1A 5DRDA 4GJ2A 2RL5A 3EYHA 3FQHA 3K3JA 3D7TB 3NEWA 5M06A 4IHPA 3SGCA 2FGIA 4TKSA 3TXOA 4AX8A 4ZTQA 2C69A 4CYIA 1G8SA 4NYEA 3R1QA 5IPJA 4X21A 2PVNA 4E5BA 4L00A 2WIPA 4CV9A 2PZYA 4CKIA 3QKMA 4FIEA 3I6UA 3EQFA 1Q8UA 4KS7A 3EMGA 5C01A 3WZKA 1XMMA 2W4JA 3QA8A 5IG1A 4O0WA 5KMJA 5J9LA 3U8WA 4FC0A 4DG0E 4G3GA 4JG7A 4OAVB 1WBVA 5CT7A 5E91A 5I9WA 4GH2A 4JIAA 3C4WA 4BKYA 1JSVA 2P33A 2Y6MA 4H39A 4EL9A 5D10A 4UY9A 4BJJA 2GNGA 5C27A 3MH1A 4DLIA 3BELA 3FZOA 4E93A 4QMNA 5C8MA 1BYGA 4FSWA 3ZFYA 4FL1A 3UOKA 3C0GA 3CQUA 3LOKA 3PYYA 3DCVA 1OPJA 4OR5A 4YC6A 4FUXA 3MY1A 4FSMA 4OTIA 4W4YA 1KSWA 3UG2A 4YURA 3LFAA 4TNBA 3KQ7A 3TV7A 4A9TA 5CQWA 5JMSA 4O96A 3UNZA 5IQFA 3P79A 2PHKA 3UVRA 3NX8A 3QZHA 4I6QA 2VTRA 5FGKA 5CAVA 4GUEA 4IAFA 4TNDA 4XJ0A 5HG8A 4Z16A 4ZS4A 4FKJA 1PXKA 4F78A 2A27A 2ZM4A 4ERWA 4O83A 1O6LA 1IA9A 2ITXA 4FTCA 4FIJA 3UP7A 4PNIA 1Q61A 3DPKA 4JLCA 4LDTA 1Y57A 2NP8A 2PMOX 4JIKA 5DNRA 4EOJA 5M08A 3W2OA 5ANGA 4RJ7A 2F2UA 4EH9A 3IW4A 4P5QA 3N4UA 2YDIA 1CM8A 1ZYLA 3C9WA 4FZ6A 1W7HA 3GUBA 2VTAA 4IE9A 3HP2A 4QQCA 4E5WA 4FSYA 5A4TA 5DMZA 2VTSA 2VRXA 4ITJA 3CEKA 3PXYA 1OPLA 5F94A 1E1VA 3UIUA 4YLLA 1XH7A 4CMUA 2BALA 2GDOA 3GU8A 4W9WA 3V8WA 4BBEA 4RBLA 5DT3A 3V3VA 2YM4A 2C3IB 1PKDA 5I3RA 4TWNA 4EQMA 4L46A 3NGAA 4L43A 5EOLA 4CFMA 4E4XA 2QD9A 4XV2A 3QFVA 4F6UA 2HOGA 4AU8A 5L6PA 3NCGA 2GFCA 3DJ5A 4LMNA 2VTTA 4RIXB 5JT2A 4BCPA 4MQ1A 4WUNA 3QD2B 5EHLA 3HEGA 2IW8A 3MBLA 3ANRA 4ALVA 4IWDA 4D4YA 4RSSA 4EH7A 4OTWA 5C4KA 3TT0A 4DFLA 3R22A 4L53A 2JLDA 2VN9A 3G2FA 4RA4A 3MVMA 4X2NA 2QOHA 4M69B 4WT6A 4L3LA 4X7QA 5HO7A 4FEQA 2YIRA 3E92A 4RMZA 5BMSA 4AQCA 4MKCA 4C3RA 3R7UA 3TV6A 5GINE 2R3PA 3QXOA 4RQKA 4AOJA 3R7VA 4I41A 2QOFA 3ALOA 5A9UA 1R39A 4FTLA 4B4LA 3EQCA 5H9BA 1W0XC 2WTIA 3ACKA 4RJ3A 4EHVA 3L9PA 4FT3A 3RPRA 1UWHA 3HVCA 5K4JA 3I81A 2YIQA 2YIWA 3RKBA 4A9RA 4F65A 2QG7A 3VBTA 3GQIA 3G6GA 3PG3A 2W5AA 4EH5A 1FMOE 3FJQE 4XH6A 5LVOA 4N0SA 4R77A 4R5YA 4MBLA 3UQFA 4F9BA 3KXNA 4H3BA 2QHMA 3UO6A 2R3QA 2VUWA 5BVNA 3F66A 3SVVA 2ZVAA 3LCKA 4UXQA 4E4LA 5BVOA 5E8YA 5L2QA 3VS2A 3PA3A 4V05A 3VS3A 3FY2A 4F63A 4NJDA 2W1ZA 3ZBFA 4O91A 2HZ4A 4R1VA 4A4XA 5GZAA 4YZNA 5BX0A 2ZB1A 4MF0A 4IX5A 3SQQA 4NIFB 4MD8E 3R83A 4RVKA 3TN8A 4NK9A 3DAEA 2ITYA 1M14A 3KXHA 4ZZNA 3VRZA 5C4LA 3D5VA 4C2VA 2YN8A 2XB7A 1JSUA 3MPAA 4XLIA 5EYMA 2GS7A 5DPVA 4BICA 4OBPA 4IH8A 2Z7RA 3OC1A 4PTCA 3ORTA 3RNYA 4FG7A 4AW1A 3CXWA 3KF7A 5EKNA 5EW8A 1STCE 3L9NA 3OCGA 4HJOA 4C38A 4YHFA 5JGDA 2PZIA 3CQEA 3LXNA 4XOYA 4I0SA 4R1YA 4DF3A 3LM5A 3ZH8A 4DAWA 1J3HA 3B8QA 4P90A 4XCUA 5FRIA 2IVTA 1YDSE 5IU2A 3VF9A 4G5PA 4B7TA 4EYMA 3R8UA 2YEXA 3R8LA 2C68A 3CLYA 5BUEA 1JSTA 2ZAZA 4GKHA 5ITAA 2OU7A 2PVHA 4YZBA 5AP5A 1UV5A 2SRCA 2WMAA 4C59A 2F7XE 1UNLA 2O64A 1OL5A 2BCJA 1T46A 4CTBA 5FTGA 3QUEA 5A3XA 3UPZA 5FWKK 2YM7A 4BR3A 4BIEA 2XF0A 3DT1A 4Z9LA 1YDRE 2BRMA 5KNJA 2YERA 3PY3A 1PHKA 3FMHA 3VIDA 3TUCA 4PP9A 4BBFA 4O7NA 2XS0A 3MIYA 3PTGA 4BCNA 2JEDA 4GUBA 5HQ0A 5TOZA 2GPHA 5EQYA 4KRCA 3G0EA 3G9LX 4FKRA 5AR8A 3F5UA 3EZRA 3AT2A 3OXTA 2QG5A 3E8DA 3E64A 3LFSA 5IMEA 4I4FA 4AFJA 5CSVA 3ZLXA 2Q0NA 4CZTA 1WMKA 3HDMA 2JITA 3QC9A 1YHSA 2E9UA 3LFEA 4S32A 3TNIA 2OZAB 5BUIA 1OGYA 4O1PA 2GNHA 2XK4A 3GC0A 2QCSA 4C57A 2OW3A 3OEFX 1GZ8A 2OXXA 2H34A 3Q52A 4FKSA 3RNIA 3ZMMA 3OWLA 3IW5A 2UW5A 3VULA 1ZYSA 4YZDA 3EQBA 3HAVA 3FI3A 5FP6A 4IVCA 2VD5A 1YI4A 2Y8OA 3QTIA 3KRLA 3ZCLA 4LYNA 4IMYA 5BQ0A 3GOKA 2G1TA 3QHWA 3AKJA 4YMJA 4RJ8A 4HCUA 1ZMUA 2VWUA 5L4QA 2W1GA 3FMNA 4JL9A 2C5YA 5ICPA 1MQBA 5C8KA 3DGKA 3V6RA 4BDBA 3QTWA 2VX3A 4KA3A 5IUIA 3EQDA 5AR7A 4KIKA 3DY7A 4FZAB 4XG7A 5CVGA 1R1WA 4O7WA 2PYWA 3PFQA 2YITA 2WPAA 3ENHA 5HHWA 3BL7A 3FZRA 5IA3A 3CSVA 3E3BX 1Q3DA 4R3RA 4I3ZA 4JG6A 3AC8A 2ITQA 3KXMA 2W05A 2YAKA 4V04A 3OHTA 3ZRMA 1DAYA 4FKOA 2ITVA 5J95A 4G6OA 3N51A 2BAQA 1OKVA 1REJA 3DB8A 4N6YA 3QRIA 4K1BA 4QPMA 4MXOA 3RM7A 3UNJA 1APME 3OEZA 4D2TA 3POZA 5AV4A 3ZUUA 4GV1A 4UEUA 5EW3A 2C6LA 2BMCA 4BDHA 5DIAA 3KK9A 5HICA 4ZJIA 4BDKA 4FSRA 4O0UA 3L8SA 3WZEA 1G8JA 4PDOA 3DAKA 3IPHA 4N4SA 4QMYA 5EI8A 3ZU7A 1ST0A 4GJ3A 5CQUA 2V0DA 3AQVA 3T9TA 3LFFA 3ZZWA 4YBKA 3H9RA 2PVLA 2VO3A 5EYCA 5JZNA 3ROYA 2O3PA 2WTJA 2BFYA 2XK3A 2WEIA 5HLNA 5KBRA 3E7VA 3H0ZA 5FUTA 5DR9A 2XCKA 4AAYA 2CLQA 3FZTA 1MUOA 2RF9A 5CASA 3LJ0A 4MVFA 4UZDA 4ASZA 4FICA 5AWMA 5A46A 1YRPA 3QLGA 4I6FA 3JYAA 3GI3A 2I6LA 3Q2JA 5HIEA 4JMQA 3VW6A 3F3TA 2EXEA 4N70A 5CS6A 4CNHA 3IO7A 2JIVA 4ORKA 3KY2A 2C6KA 4EBVA 3LXKA 2X81A 3PE2A 3R00A 4XNEA 4DA5A 4L67A 3KREA 3M11A 4CD0A 3NW7A 1TQPA 1Z9XA 3WF6A 2IF8A 3QL8A 4WNPA 1J91A 4XOZA 3GB2A 2Y4IC 3JVSA 3LE6A 2R7BA 1GIJA 2ZMDA 4CV8A 4Y85A 4CYJA 3VRYA 4U6RA 2QO2A 4G2FA 2C1BA 4M12A 3CPCA 4W8DA 4NUSA 5K3YA 4F7SA 3GENA 4FV6A 4IX4A 3UIBA 4DCAA 3NYNA 3WZJA 3OOMA 1WBOA 2F2CB 3F5PA 2WB8A 3ENMA 3D5UA 5EW9A 3WIKA 4PL5A 5M55A 3RK5A 5JN2A 3BQRA 1