5HU9A

Crystal structure of abl1 in complex with chmfl-074
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
275
structure length
266
Chain Sequence
AMGSSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery and characterization of a novel potent type II native and mutant BCR-ABL inhibitor (CHMFL-074) for Chronic Myeloid Leukemia (CML)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ABL1
total genus 86
structure length 266
sequence length 275
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hu9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hu9A01
2B52A 2OSCA 3KC3A 4AWIA 5HORA 3O96A 3UPXA 5KMKA 5M07A 3GI3A 4NM0A 1NY3A 2C3IB 3R28A 4LGGA 3EKKA 4FZDB 3C0GA 1ZY5A 3R1NA 2G15A 5TF9A 2UW9A 1R78A 3QHWA 3QLGA 4RA4A 2Y4IB 4FSUA 4IM2A 3TKIA 3MGYA 2XM9A 3R02A 1CTPE 3MVMA 4DGOA 1OB3A 2I40A 2RFDA 2QOHA 2XB7A 4C0TA 2WMAA 5A4QA 4GFOA 1IA8A 2C0OA 3GP0A 3ORXA 3QCQA 4AN2A 3F3ZA 5F1ZA 2ZM4A 4CMOA 1UWJA 3POOA 1GZ8A 3NW7A 3QA8A 4H3QA 1OI9A 3OHTA 4Q5EA 5CEOA 4C4FA 2VTOA 2VO6A 3P0MA 4RC4A 1YXTA 3QF9A 2BILB 3ZO2A 3OXIA 3QA0A 4XH6A 4DCEA 3OFMA 2QOOA 4IX3A 3MESA 3KMUA 3AXWA 4J98A 2OK1A 3WYYA 4EOOA 2JITA 4XG4A 5CENA 4NW5A 5BYZA 5M53A 4KIKB 4C4EA 2QU5A 4G16A 4R3RA 5KKRC 2OWBA 4D5KA 4IWDA 4L3LA 4BCMA 2VTNA 3KK9A 4NZWB 3R6XA 1UU3A 3P9JA 3NNUA 4QPAA 4O0SA 4IZ7A 4ANLA 3UPZA 4YHJA 4DEDA 2OFUA 4C57A 4B8MA 2WMSA 3HV5A 4ZSAA 4UWBA 5JFSA 3JUHA 1LEZA 4QNYA 3W2PA 4FZAB 4FNXA 3GQIA 4L01A 3CBLA 4GT4A 2GTNA 4EH2A 3QWJA 2R3MA 3QD0A 4BFMA 5KHWA 3Q9WA 4HW7A 2VD5A 1S9JA 1FMKA 3KEXA 2XKFA 4RWIA 5HNGA 4HJOA 2R2PA 4FT7A 3MY0A 4EH4A 2QHMA 3SG9A 3A61A 1VYWA 3OTUA 5DVRA 1P4OA 3PRIA 3MH0A 4RIWB 1W82A 4RWKA 4UXLA 5ETAA 1MP8A 1YWVA 4MTAA 3ULZA 2V22A 3ZLYA 2F7EE 4PF4A 3DLZA 2XK3A 4D4RA 3PE2A 4XG3A 3RPSA 1KE5A 3BGZA 4XYFA 3O23A 2QC6A 1YOMA 4DGMA 2E2BA 4OTIA 1Y91A 3UOLA 5JSMA 4K8AA 5HQ0A 4BCKA 3VW8A 4WUNA 3H9RA 4EQUA 4OAUC 4E1ZA 1FMOE 4IX5A 3UQFA 1BL6A 2R3QA 4FODA 2XA4A 4G9RA 3ERKA 3V01A 3RK7A 5EQYA 5AP4A 3FLQA 4AT3A 3NX8A 3H0ZA 4IWQA 4YNEA 3TJDA 1PXKA 4LV5A 2WO6A 1ZAOA 5E8SA 4AFJA 4P4CA 4EQMA 4BIEA 1OGUA 3AGMA 4DFLA 4HYHA 5JT2A 3HAVA 4CFNA 4IACA 2PVRA 3A4PA 3I79A 3IS5A 4EZ7A 2A2AA 4BWPA 3UTOA 3VVHA 1SVEA 2UVXA 3I81A 3FPMA 5J87A 3E8CA 1U46A 3FQEA 4ENXA 2QKRA 5BVDA 5LWNA 1O6YA 4NW6A 5HD7A 4JNWA 2OJGA 2Y7JA 4WNKA 4M97A 3WE8A 3D4QA 3B8RA 3F3TA 4XLVA 3I0OA 3TZMA 1PYXA 4I6BA 1YDRE 5HKMA 2ERZE 5HGIA 5A46A 3GBZA 5EW9A 3WF9A 5I9ZA 1YKRA 3CQEA 2V55A 3ORIA 4ITIA 4WSQA 3HAMA 2FGIA 3K5VA 3DFAA 5ACBC 3R9RA 4KB8A 4M69A 4MBLA 1LEWA 4ZY5A 4JT3A 3PXRA 4KBAA 3UO6A 2VTJA 4U43A 2R3NA 4JIKA 2WMUA 3QCXA 3QZHA 4QPSA 3V8SA 1W8CA 4ZSGA 4PNIA 3KRLA 5IA5A 4YBJA 5LVLA 4DFZE 3Q5ZA 2WQBA 5FM2A 4QMSA 5IQFA 2YA9A 4FC0A 2XBAA 1CMKE 4JQ8A 3BI6A 5I0BA 2P55A 3D5WA 3HUCA 2BRNA 4BCNA 3QGYA 1YI6A 5EQEA 4RIYA 4FTQA 3RWQA 4FEUA 3HP2A 2RG5A 2ZAZA 4UEUA 4QQTA 4YTCA 1Y6BA 5LARA 5AV4A 1WAKA 4RBLA 2WTVA 4FGRA 4PP9A 5LVOA 4DTAA 4RC2A 4KIOA 5FDXA 2BUJA 2PVYA 5JH6A 2OW3A 3F69A 3QCSA 4M15A 5K0XA 3LJ0A 5AR4A 1Q8TA 2UV2A 3S1HA 3FE3A 4XBRA 3PTGA 4TYJA 3TL8A 4B0GA 5EKOA 4DFUA 2YACA 3A62A 5IDNA 1JSUA 3ACJA 3G0EA 4J99A 3DZQA 4G6NA 4NEUA 4E73A 2A27A 4GUEA 4YUQA 4R3CA 2CCHA 4M0ZA 4QTBA 4EQCA 2XEYA 3ZEWA 3H9OA 2VWZA 4E6AA 4ZOGA 4DLIA 5HTIA 5IU2A 3Q9XA 4ZTHA 5AR5A 3LMHA 2F9GA 4DEAA 4F6UA 3RP9A 2CGUA 3TUBA 3EN4A 5ANJA 4B99A 4XOYA 3OCTA 4FTJA 3Q04A 4OT6A 2ONLA 4FKGA 3PJ1A 4GEOA 3NYVA 4E20A 1HCKA 4WT6A 4AZVA 1G8AA 2EUFB 3HV4A 1M14A 2CSNA 3IK3A 3WZKA 4C3RA 4ZJJA 4IX6A 3LW0A 4YSJA 2OXXA 4MXYA 1G8SA 4EHZA 3DBEA 1WCCA 2GS7A 2J50A 2JIVA 3FMLA 2OH4A 2NO3A 3PXKA 4UMTA 3WI6A 3Q60A 1H01A 5KHXA 4AOTA 5KMOA 5DRBA 4KSQA 1YHSA 2BRGA 2YIQA 4YJSA 4EH6A 3HRBA 4EORA 4D2TA 1Q4LA 5EHLA 3KU2A 1LR4A 4AOJA 1PRYA 4KD1A 3QX4A 4RLLA 4QT1A 4WO5A 5AP6A 3BYMA 2C5XA 3GC8A 4FL1A 5AR2A 2VGPA 4QMZA 4JBVA 2HW7A 3DU8A 2CNUA 2F7XE 5EOBA 2XMYA 3MB7A 4IVBA 1GAGA 3KN5A 3DK7A 2QO9A 3FMJA 5DEWA 4BIBA 3OF0A 2GNFA 5CAVA 3QUPA 5FXRA 5KMMA 1WBVA 4XCUA 3O7LB 2BTRA 2QNJA 4FSYA 1OZ1A 4IM0A 5FEEA 4XV3A 1UU9A 4BBMA 5K4IA 2CJMA 5K5XA 2QOFA 4G6OA 3NMUF 2C1AA 3BE9A 3LM0A 3OG7A 4W8EA 2UUEA 1RW8A 1PMUA 1ZRZA 4V01A 5HNBA 3QZFA 2JEDA 3ZLSA 4F9CA 2X39A 3Q4UA 3TNHA 3U51A 2VTTA 3OY3A 3RCDA 3D5XA 4NFMA 4XOZA 4BDIA 1XH5A 4EBVA 3G0FA 4LRKA 3DCVA 5GJDA 3RVGA 4KWPA 1H28A 5F20A 3TZ9A 2H9VA 4PRJA 3O8TA 3C4CA 2YJRA 4NIFA 5DH3A 4BCOA 4GG7A 4FT9A 3MFRA 4U3ZA 4KBKA 2O64A 4IAYA 3AT4A 3BYVA 4OT5A 4O7LA 4FG7A 1UWHA 4HCVA 5HOAA 3QHRA 1JLUE 3AC8A 4FSWA 2WOTA 1YDSE 5CU3A 4RQVA 3L9MA 2CLQA 4A9RA 4BTKA 5GZ9A 3BEGA 4AX8A 4AN3A 3FC2A 3O8PA 4R3PA 5FDPA 4K33A 3FHIA 2YFXA 4CTCA 5GIPE 4MWHA 4X7QA 4ERWA 2IZSA 3KRJA 3RHXA 1OL5A 2ETRA 2J0IA 1OBDA 3DTCA 2EU9A 2QODA 4AZEA 3LLAA 3RK5A 4FTKA 2PVJA 3QQUA 3FL5A 3GU6A 4FZ7A 4LRJA 3KCFA 4WRSA 3TNQB 4CQGA 4OTFA 2C4GA 5DYJA 2W1GA 4ANQA 3CJGA 4AW5A 1OVEA 2GNIA 4JDIA 3UZRA 4O0XA 4O86A 3R8ZA 3OOMA 4ZSEA 1VEBA 2XNPA 5D9HA 1Q8WA 5JFXA 1URWA 4R77A 1UU8A 2BDWA 4JQ7A 1WBNA 3BKBA 2X1NA 5IQDA 4IZAA 3CPBA 1RJBA 2GNGA 3EFJA 4XJ0A 4FSTA 4S30A 4GK4A 5HBEA 3PVGA 3W1FA 3F5PA 4CSVA 2WKMA 3SAYA 3ZLXA 3HZTA 5G6VA 4X0MA 4TXCA 4BI2A 2QOIA 2GQSA 3E5AA 4QMTA 1OECA 3DBCA 1OM1A 4GIIA 5HTCA 4IWPA 4X2GA 1FOTA 4WOVA 3PJ2A 5JRSA 4DN5A 1PW2A 1BMKA 3DB6A 1CM8A 2X8IA 3GCUA 3I0QA 4EOKA 5HVYA 4IAKA 1YI4A 2FSOX 3PE1A 3RNYA 5LMKC 4G31A 4O7VA 2W4OA 4Q2AA 3I6WA 3HUBA 4PDOA 5FBNC 3DXPA 4D9TA 5KMIA 4BF2A 3IDPA 2PYWA 3K2LA 3GVUA 1I44A 3AG9A 5EM8A 4AP7A 4H1JA 4FV9A 4QQJA 5D1JA 2RG6A 3D83A 5EDRA 3QU0A 4OTHA 2SRCA 1JOWB 5AIKA 5H2UA 2O5KA 4JDKA 4EZ3A 4M8TA 3AGLA 5I3OA 4N57A 4FTMA 5IZFA 1CSNA 1TQIA 3B2TA 3E88A 1IR3A 3OWKA 5J9YA 4XV2A 3AMBA 3RNIA 1OBGA 3PSCA 3RI1A 4FKIA 2W4JA 2JKOA 5HVJA 5M57A 4KA3A 1WZYA 5J8IA 5FTOA 1EH4A 3KREA 3BQRA 5CEKA 3V5LA 4F7LA 3ZDIA 3ZSHA 1FGKA 1XH7A 4PTGA 4EH9A 4EOIA 2CNVA 2R7BA 1U54A 2YABA 3OEFX 1H1QA 3U54A 3IGOA 2C3JA 4JL9A 4NKAA 3TM0A 3HV6A 4I5PA 3C4EA 3CKWA 3GFEA 5K3YA 3M2WA 4QMPA 4LMNA 2X7OA 4BCHA 4UMUA 1PXPA 3BYSA 4RMZA 4TWCA 3K3IA 3R63A 4ANNA 2YIWA 3VBTA 4X3JA 4QMUA 4C3FA 2PUPA 4RX5A 4UX9A 2Z7LA 2FO0A 3P86A 4O2PA 4GW8A 5EKNA 2OFVA 3CTHA 4CFWA 4F7SA 4DEEA 3CSVA 2WTKB 3DQXA 4G17A 2VRXA 1M7NA 2C6TA 2XM8A 4TWOA 3F82A 5CVFA 4DAWA 4AS0A 1BKXA 4OTPA 3ELJA 2PU8A 2JDOA 2XIXA 3R1QA 3PIYA 4I0TA 4EHVA 5J79A 3RBWA 5BMSA 3JPVA 4FIGA 3AT2A 4BGGA 3NAXA 2DYLA 2HK5A 3EQRA 4FG9A 4AQCA 2WTWA 5C8NA 2JFMA 2QONA 3DDQA 2NNWB 3VUHA 5IF1A 5EYDA 4BDFA 1ND4A 3VJOA 5DR6A 4M84A 3MDYA 2XK8A 3QYWA 4FE2A 3RAKA 3QD2B 3LQ8A 3C4ZA 1OIYA 1QCFA 3KXHA 3LCKA 4JG7A 3F3UA 5E8XA 3R0TA 3UMXA 3MYGA 3VS5A 2XK6A 5AADA 5JK3A 2RF9A 2QKWB 5E4HA 4MBIA 3C4XA 2PVNA 4Y95A 4EK5A 1Q8UA 3MB6A 4WG5A 5IA0A 3BWJA 5J7HA 2XS0A 3DAJA 4USDA 4AGCA 2IW6A 2YM4A 1IRKA 3MV5A 2GNLA 4M0YA 4GU9A 5AUUA 2B1PA 4QMMA 3LJ1A 4CEGA 3MTLA 5CXHA 4NSTA 1BLXA 5AA9A 3HRCA 5DWRA 2C6OA 4ZK5A 3DS6A 2R3JA 4Z55A 4BCGA 5FM3A 2FVDA 1OUKA 4C02A 4CFMA 5EOLA 2X4ZA 3RHKA 2IPXA 2QOBA 3DPKA 4EHEA 3QYZA 1P5EA 5HO6A 4YURA 2W9FB 3E62A 2VV9A 2P2IA 1SZMA 1JKSA 3V51A 2V0DA 3ZO3A 3SXFA 4NWMA 3NWWA 3DNEA 1ZYDA 1H4LA 5CEQA 2VWYA 5JMSA 4JVGA 3Q52A 5A9UA 2X9EA 2YAKA 4MD7E 2BR1A 4ZTMA 4C4IA 3VN9A 4FZFB 3QTUA 1VR2A 2EWAA 4Y46A 5AWMA 1DM2A 4ONAA 3R7OA 4FV6A 4PY1A 2PVHA 3TT0A 3QQJA 3MIAA 2PVMA 4P7EA 3D15A 2BZHB 1ZMVA 5HESA 2I0EA 3ZC6A 2WQOA 5CVHA 3PLSA 4FKQA 3KKVA 1IASA 5CASA 3CPCA 5DT0A 5FG8A 4DEBA 4TRLA 1WVXA 1W83A 3UP2A 3VS4A 2QOLA 3CGFA 3NCGA 3R00A 4ACDA 4DTBA 4YHTA 4BI1A 3TI1A 3GGFA 3QRJA 4YPSA 3C9WA 3R2YA 4RX8A 3PP1A 3Q4CA 2I0HA 4ASXA 4NKSA 2JIIA 4QTAA 5EYMA 3W33A 3E92A 3PIZA 5CQUA 1PXMA 3ITZA 1UNGA 3P4KA 4W4YA 4CV8A 5AJQA 5EDPA 4O7RA 4W4WA 2PWLA 3MH3A 5CU6A 4GFGA 4FV7A 2FYSA 2YM8A 4U6RA 3D2IA 4A4LA 4E4MA 4APCA 5K5NA 3ZH8A 2B9HA 5I9YA 4FSQA 4IANA 1WBSA 4JRNA 2XIRA 1OPKA 4RZVA 2A0CX 3WARA 3W8QA 2HWOA 4IM3A 3SKCA 1U59A 2JDSA 5HIDA 4ERKA 4JDJA 5CALA 2OBJA 3BBTB 2X8DA 4RQKA 2G9XA 1J1CA 4BBEA 4LOPA 2R3LA 2BAKA 1SNUA 2W0JA 4BWXA 2BPMA 3C5IA 4IJ9A 3WE4A 3PJCA 4MX9A 3ZUVA 1DS5A 1WBWA 2J0KA 4XEYA 2IN6A 3R83A 4CCBA 5KO1A 5ETCA 5CEPA 3EB0A 3LKMA 1H0WA 1Z57A 1UU7A 1URCA 4IZ5A 3F2RA 3ZHPC 4ZMEA 3OEZA 4WNPA 3I60A 1QPCA 4RGJA 3PIXA 4XG6A 4MXOA 5LMBA 4UWCA 4PP7A 4YZBA 4H39A 4NM7A 2VX3A 4F64A 5GNKA 3UOHA 5DR2A 3D5UA 4I5CA 4XX9A 3SG8A 1J7IA 1PMNA 4R5YA 4ZSLA 3SC1A 4FEXA 1JBPE 1R3CA 1YW2A 2HWPA 2XEZA 3CEKA 2DQ7X 1H1PA 2IVSA 3Q2MA 4J8MA 2UZBA 4CCUA 1YHVA 5E8YA 5H9BA 4CV9A 1J91A 5C1QB 3VJNA 3TZ8A 1E1XA 2PE2A 2PZYA 2OJJA 1K9AA 4MCVA 4QYEA 4RJ3A 2F2UA 5HG8A 2QR7A 1UKHA 4BDAA 4IB5A 1XQZA 2BDFA 2R3RA 3FXXA 3ZC5A 3SDJA 3Q5IA 2W5AA 4ACHA 4PQNA 3HV7A 4EUTA 3EWHA 2UW3A 3RMFA 3IECA 2HY81 4M13A 4IFGA 1G5SA 3F2AA 5JQ8A 3GU5A 2AYPA 5KZIA 3FKOA 3T9TA 5IEVA 1JKTA 3VS0A 1ZOGA 4J1RA 4MHAA 3CD3A 1T45A 3MI9A 4DH3A 5BYYA 4GU6A 4OTWA 3FHRA 4EKLA 2H34A 4PMMA 4FT0A 1DI9A 2BRHA 2C6EA 4Y85A 3PVBA 3BYUA 4C3PA 4DT9A 2RFNA 1IEPA 2W06A 3FZOA 3NPCA 3NW5A 3H10A 3R7IA 2IVVA 3N9XA 1BX6A 1PY5A 4QP4A 3DJ5A 4DYMA 1U54B 4YPDA 3LHJA 4C62A 4EONA 4QTEA 4MEDA 4IH8A 2ITTA 1JPAA 1SVGA 1M17A 4C58A 3L9LA 4IE9A 1Q62A 3TCPA 5J1VA 5AUVA 3FSKA 2OO8X 2RGPA 4TN6A 3IONA 4ACGA 5BX0A 3BRBA 4O83A 5KKRB 4JI9A 4ZZOA 2DUVA 5BPYA 3E87A 3G9NA 3W32A 4FUYA 4NM5A 2YCRA 3HRFA 4R6VA 4ACCA 5HE1A 3GU4A 4NT4A 3W2SA 5AUWA 3GC9A 3ORLA 2JKKA 1YVJA 3ROYA 3ROCA 3QL8A 2IG7A 2XKEA 4FK6A 3HNGA 2YJSA 4QMWA 4EOJA 4YMJA 2VZ6A 3KK8A 3QQFA 3E64A 4U0IA 3AD5A 4BTFA 5IH6A 3GUBA 5KMJA 2J2IB 2JDTA 1DAYA 2WD1A 4IAFA 3VNTA 3SW7A 2PE0A 5D7AA 4XG2A 4L3JA 1XHAA 3FV8A 4F1OA 1NVSA 4S2ZA 4II5A 4C61A 4RT7A 4FT5A 2WIHA 3DBQA 3PA5A 4J97A 3GFWA 3DNDA 4OTQA 2WNTA 2BAJA 4NM3A 4D2VA 3A2CA 1LPUA 5AAEA 5AP0A 2Y4IC 3V6RA 3REPA 3UNKA 3N51A 2OJIA 4I41A 4TZRA 3WOWA 3UIMA 3DKOA 4FYNA 4UMRA 4FIIA 3UNZA 3DK6A 3F7WA 2R3IA 4UWYA 3VUTA 5CF6A 2C3LA 2C69A 2PZRA 2WU7A 3NVMB 2IW8A 3ZCLA 3NUNA 5T3QA 4RWJA 3N4UA 1KV1A 3AOXA 2QLUA 5AIRA 1B39A 2BHEA 4XUFA 2X7GA 5BUJA 2JAVA 3PPZA 2GQGA 3HA6A 2EVAA 3MJ1A 4WUAA 2ITUA 5M55A 3MJ2A 2UW7A 3I4BA 4NJ3A 5EHYA 2VX1A 3ZOSA 3OC1A 4HVHA 2HAKA 3PA3A 4JR3A 4KS8A 4Y83A 3WZEA 3RAHA 1I09A 3FMNA 3EYGA 4P5QA 4PDPA 2GCDA 1U5RA 4PDSA 2ITOA 2UZDA 5CNNA 4GS6A 3LCOA 3SX9A 3KXMA 2HELA 4FV0A 5L2WA 4V0GA 3ETAA 3UG1A 3B8QA 4OAVB 2QO7A 2XCHA 3ANRA 1YQJA 3RPRA 4FYOA 2FH9A 4FX3A 4O0TA 4O0WA 4S32A 2J5FA 2HXLA 3OZ6A 3HEGA 3OY1A 4GT5A 4ZEGA 3DXQA 5K9IA 1FVTA 4YBKA 2PHKA 3FZRA 4JBPA 2GFSA 4ZS4A 3ENMA 4YZDA 4DH5A 4IDTA 4D2SA 1XH8A 5KMLA 4B8LA 4CZUA 4QMOA 3OWJA 4RA5A 4WNOA 3BIZA 3O17A 4ALWA 1PXLA 4TWNA 3F3WA 3FLNC 4L3PA 3QCYA 2NPQA 5CSVA 5DPVA 4DA5A 2Y0AA 4QYGA 4YGAA 4K9YA 2R9SA 3ZRLA 3EQCA 3ZSIA 1O6LA 4ZP5A 1E1VA 1SMHA 2QOQA 3Q4TA 4F08A 3PZHA 3CQWA 4YC8A 2C6IA 3PG1A 3RPOA 3FKNA 3GENA 3JS2A 4BCIA 5IH5A 3OCBA 3LCTA 1MRYA 2XIYA 3UO5A 5HX6A 4DF3A 4F9AA 5LXMA 4HYSA 3FPQA 3R9NA 4ORKA 3C1XA 4HGSA 4FNZA 4N0SA 4FGBA 1XBCA 1WBTA 1ZMWA 2C6MA 4FTNA 3PXZA 4UXQA 3BE2A 4E5AX 4M69B 4FEWA 2FA2A 3EQHA 5K4JA 4YJNA 2HW6A 2Z7QA 1OL2A 3OMVA 2YIXA 3QQGA 4AUAA 4I22A 1F3MC 1ZWSA 4G1WA 4TY1A 5F4NA 4CFVA 4G3EA 4MWIA 1W7HA 2W17A 3R8PA 3SLSA 5A3XA 1OPJA 4XV9A 3AC2A 2YN8A 3TIYA 1FINA 2B55A 4BCJA 3O7LD 3DBFA 4UB7A 2YZLA 5TE0A 3QTWA 4UN0C 5EM5A 5D41A 4L44A 3PSDA 4BDBA 4Z3VA 4XNEA 4A9SA 3U55A 2XJ2A 4O7NA 4HYIA 3FY2A 1V0BA 1R0EA 4MNEA 3R9OA 3TDWA 5E92A 2CKQA 3OTVA 2WMXA 2BAQA 4CKJA 5J5TA 1H24A 2I6LA 4FKUA 4FTUA 3NYOA 4KKEA 3QTXA 5KE0A 3A4OX 3TJCA 3QZIA 3ORMA 3V5QA 2WMWA 5AEPA 4BDDA 5JEBA 4DE4A 4AA0A 3R01A 3L8XA 4PTEA 5AP3A 3R7GA 4X2KA 4D28A 4BZNA 4CYJA 3DFCB 4EK4A 5CF5A 3W2QA 2VNYA 4K11A 2ZMDA 3QAME 4IFCA 4EJNA 4FKRA 4QMYA 3OXZA 4O96A 4YJRA 5E90A 2R0UA 3UQGA 1A06A 1H08A 5E91A 2UW8A 1PJKA 2IZUA 1VZOA 4AE9A 4X3FB 3MY1A 4O38A 3PXQA 1PXIA 4LQMA 4A9UA 2R3PA 5CU2A 4Z7GA 3ORZA 3HYHA 4FKPA 2YM3A 1H1RA 4I23A 3CR0A 2IW9A 4O7WA 3RAIA 5T6KA 1Q5KA 4U80A 4AW1A 2I7QA 4RX7A 3PVWA 3C0IA 3OS3A 4LL5A 2YCQA 3VF9A 4KKHA 4RVTA 3NW6A 4E4XA 3ZUTA 3V5TA 1RQQA 5DNRA 4FOCA 3F5GA 5AUTA 5HU3A 2Z02A 2XJ1A 4D4YA 3F66A 3OWLA 2VWIA 3VULA 1ZARA 2OXYA 2ZYBA 3C50A 1CKJA 5CNOA 2J0LA 3RCJA 3VS7A 3G6GA 2ACXA 5L8LA 3OCGA 4UV0A 1ZMUA 5FLFA 4CYIA 5BQ0A 4HVSA 5L6PA 1V0OA 4FTTA 4PPCA 1ATPE 1OKZA 3I7CA 1WVWA 1ERKA 2A19B 2BFYA 2RFSA 1DAWA 3F5UA 4JS8A 5EI2A 4BTJA 5HE3A 4D58A 4L53A 3EQDA 4A9YA 5BVNA 3FLYA 5JQ5A 5CX9A 3PJ3A 4LG4A 3ZU7A 2R3FA 2FSMX 4YJTA 1XWSA 2GNJA 1JAMA 3ZZEA 5HE0A 2W1ZA 5L2SA 3GU8A 4DG2E 4AACA 2VWWA 4BR3A 3CP9A 3TV6A 4RSSA 2QURA 2YLEA 3T9IA 4BKJA 3O51A 3DAEA 1GY3A 5BVEA 4F7NA 3KA0A 2WXVA 3CY3A 3PJ8A 2ZV2A 4FICA 3RJCA 4BDEA 3OBJA 5AUZA 5GINE 3HMMA 5AX3A 4M14A 5DE2A 2WTJA 4C33A 4WKQA 5AUXA 2V5QA 2B53A 2GQRA 1XR1A 3UIUA 5L8JA 4IBMA 2NP8A 2QOCA 3QC4A 3ZFMA 3QTIA 3R7YA 1LP4A 4O7TA 3DV3A 4XS2A 2XNBA 3D7TA 5I4NA 3JXWA 3ZEPA 3MVLA 5CANA 3FXWA 2J90A 2EB3A 2CLXA 4IVDA 2ITQA 5HE2A 2UZNA 4B4LA 3DBDA 3S3IA 3PY0A 3M1SA 4F1TA 4CQEA 2KULA 5H8BA 3BLRA 2HOGA 2H6DA 4AW0A 4F9WA 4TYIA 4XHKB 4S34A 4BVUA 2YZAA 1SVHA 5HIEA 4GYIA 4D4VA 4WHZA 5HBHA 4CG8A 4YZ9A 2X2MA 3C13A 4O7ZA 3V5JA 3ODZX 4HCUA 5EM6A 4FIFA 5CLPA 4APPA 2JKMA 2XK7A 4DEIA 3QKLA 2VTPA 4FVQA 4YR8A 4I5MA 5L4QA 4I4EA 3W16A 4MVFA 3UVRA 3O50A 4Q9SA 3Q3BA 4MH7A 5CI7A 2QCSA 1RE8A 2CCIA 4PMPA 1GIIA 2EB2A 2HZIA 2YISA 4AGWA 1L8TA 1IA9A 4RJ4A 4CMUA 4I94A 4MD8E 1WBOA 2QVSE 4KKGA 4AT4A 4DC2A 3LQ5A 3AQVA 4ZJIA 1JKKA 5JKGA 4E4LA 4AW2A 4MXZA 2PMIA 2CHLA 4USEA 2BRMA 3TIZA 2VNWA 1GNGA 2BROA 3FI4A 5CZIA 5DI1A 4LUDA 1PYEA 2GFCA 3EH9A 2VUWA 5G1XA 3IOKA 3ZDUA 5JGBA 3VS3A 4H58A 3V04A 4CLIA 2BKZA 4Q9ZA 3HECA 3QUDA 5ANIA 4YU2A 3KXNA 1XH9A 4M66A 4YO6A 4HVDA 4ANSA 3D94A 1NVRA 3L9NA 3NUPA 2VTHA 3MFSA 4XRJA 5E8WA 1VJYA 1JSTA 3NLBA 5J1WA 3C0HA 1W84A 5DGZA 5HHWA 2XF0A 1R0PA 3IG7A 4Y5QA 4USFA 2WAJA 2XRUA 1OUYA 4GVJA 2GTMA 4NYEA 3FDNA 3PFQA 5CY3A 4B6LA 4DINA 1PMVA 3BQCA 5HI2A 3UO4A 4TYGA 4ASEA 3IDCA 4MAOA 3QKMA 3W10A 4L67A 5IQBA 4FIEA 4CTBA 2W9ZB 3C4FA 1PHKA 1W98A 5CU0A 4E5WA 4R7HA 2OF2A 4RJ6A 5CWZA 5AAGA 1ZZ2A 3G5DA 3BHUA 3FMEA 5IISA 2VU3A 3BHVA 3KMWA 3TXOA 5M08A 4V0GB 4KUJA 3VBXA 5LVNA 3AD4A 2Y8OA 1OIRA 2REIA 3NGAA 3LFEA 3NR9A 3QQHA 5LCJA 3R2BA 3FSFA 4GCJA 2UZTA 4FKJA 4EEVA 1KE8A 3D7TB 3WF5A 4M3QA 3ENHA 3EFKA 4O1PA 4FTCA 4Y5HA 4C35A 4YZCA 3ZFXA 4EYMA 4P5ZA 5FUTA 4GK3A 3LXKA 5C8MA 4BTMA 5L8KA 5JFVA 4QMVA 3DY7A 3VW6A 3WIKA 4KAOA 1PMEA 1U4DA 2CGXA 2ZB1A 1YXXA 2ITYA 2Q0BA 1F0QA 4RC3A 2WHBA 1KWPA 4G3FA 3LLTA 2GHGA 3LOKA 2OZOA 4OUCA 5HLPA 4C34A 2V7AA 3D14A 4BGQA 3QRIA 4J8NA 3U6IA 4IXPA 2WU6A 4FV3A 2UW5A 3ZO4A 2ZOQA 4XG7A 4PWNA 4X21A 4QTCA 4U8ZA 1A9UA 1Q61A 5CEMA 5ANGA 2W99B 4YTIA 3QTSA 3FLZA 4G6LA 2X2LA 5TOZA 4ITJA 4AGUA 1YXSA 2UZOA 2VTRA 1J7LA 3QKKA 2QG7A 3KVXA 5GZ8A 1PF8A 4QMQA 3P1AA 4YJVA 3LJ2A 2J4ZA 4JAJA 3R71A 4NFNA 5JN2A 4HYUA 2UW0A 5IQCA 2AC5A 3GNIB 3BBWA 4IC7A 2G01A 2O2UA 4P90A 4ZZMA 3THBA 4FTIA 3VWAA 5CZHA 4W8DA 3P5KA 5HCZA 2NRYA 2R5TA 2C5OA 4ZY4A 3SA0A 3E7OA 4TTHB 4H1MA 4C59A 3G6HA 4AZTA 3E63A 3Q4ZA 3TTJA 4XP2A 1APME 5B0XA 1TQPA 4MNFA 4OGRA 3ZYAA 5J95A 5KCVA 3UVQA 1V1KA 2W1EA 4DFYA 4K0YA 4ZS0A 4E8AA 4UMPA 3ORPA 4J52A 4CRSA 3VS6A 3JVRA 3R9DA 2WEVA 4I6FA 3ACKA 4XBUA 1OKYA 5D7VA 3NUAA 5EW8A 3EZVA 4RIXA 4D2RA 4LGDA 3WYXA 4FA2A 4CRLA 5FWKK 1FVVA 1GIHA 4BI0A 4ITHA 3QUEA 2OIQA 4W4VA 2BVAA 2W1CA 2WPAA 3FQSA 3BWFA 4CLJA 3JY9A 2CKEA 2VTLA 3K3JA 4JXFA 5L2QA 4GMYA 4I24A 4L45A 4M12A 4EOLA 4O0RA 3DKCA 3VBQA 4ZTSA 3L9PA 1R1WA 3UC3A 4O22A 4HGTA 2BALA 3PPJA 4WIHA 4QP7A 5DBXA 4A4XA 4RFZA 3EZRA 3EHAA 2OI4X 3DK3A 4YLKA 5EDQA 4L42A 2OG8A 2OLCA 2XJ0A 4EWQA 3S4QA 2XCKA 2Z7SA 4I92A 4J95A 4DLJA 2X6DA 3F3VA 1GZNA 3BZ3A 3KN6A 3PY1A 5M44A 2J51A 2Y6MA 4PMSA 4N70A 2YAAA 2Y6OA 3U6HA 1XO2B 5GIOE 1BUHA 3TG1A 4FSMA 4KRDA 4ZLZA 2QD9A 3E7VA 4RRVA 5DN3A 3VS2A 3NZ0A 2F49A 4AA5A 3I6UA 4M68A 5CT7A 5FTQA 5CAQA 4R5SA 3NEWA 2J7TA 2W5HA 2B0QA 2LGCA 4BBFA 3IQ7A 5FP6A 4UYAA 4XLIA 3NYXA 4D55A 2GHMA 2E9OA 1KE9A 4F09A 3DGKA 3IPHA 1ZYSA 1IAHA 3LFAA 2QOKA 1O9UA 4FV1A 3NNWA 5IG1A 4ZXTA 3L8PA 4L7SA 2C0TA 2KTYA 2UZWE 4BC6A 1K3AA 4O0VA 3LFBA 3FMDA 5IA3A 5C8KA 5IQAA 4RX9A 4IDVA 4TYHA 2ZV9A 1G3NA 5CQWA 3GEQA 3A7JA 1BI8A 3WF6A 3PXFA 4OTDA 4PPAA 1P2AA 3DB8A 3HLLA 4PTCA 5AP2A 4DH8A 4XRLA 3NUUA 3R1YA 3HMNA 4CFUA 3FYJX 1H1WA 1O6KA 4TW9A 3G90X 5CEIA 4E6CA 3UGCA 4RFYA 2QO2A 4LOQA 3PG3A 4L00A 4RJ5A 5AP5A 4R1VA 2W96B 3UZPA 2ITPA 2A4LA 2GMXA 3V3VA 5IQGA 5JZJA 4DFXE 4QP9A 4LGHA 5IQEA 1S9IA 3UIBA 2QHNA 5TKDA 5C4LA 3JR1A 3IOPA 3E8DA 3HV3A 1U5QA 3D5VA 4ZTQA 5AV2A 3VIDA 5CAPA 3HKOA 3HGKA 5AV0A 2WOUA 4MBJA 4C7TA 1B6CB 3W55A 3AT3A 4GH2A 4TNBA 2VX0A 1CKPA 1JWHA 2ZDTA 4GIHA 3TNPC 4LYNA 4D1XA 5JFWA 5EW3A 5LJJA 1QMZA 4B7TA 2XP2A 4UBAA 3R8UA 3TUCA 3A7FA 1HOWA 2OKRA 3JVSA 3KFAA 4U44A 4X2JA 4KRCA 4I3ZA 2IVUA 2WMTA 3QXPA 4IZYA 4O2ZA 3NRMA 5FP5A 2ETKA 5IUHA 1K2PA 4D2WA 4NL0A 4IJPA 3GQLA 3MPMA 4DG3E 5ITAA 1WMKA 1FVRA 2C6LA 2R3OA 2XK9A 1MRVA 4UY9A 5IEXA 2ERKA 4YLJA 3FY0A 5E8UA 3KXGA 3EN6A 1WVYA 2YDKA 4R1YA 3DDPA 3LMGA 3S2PA 2X4FA 4R78A 5BYLA 3RM6A 5L2IA 4DEHA 5DOSA 3V8TA 5IA1A 4BYIA 4F7JA 5FRIA 4EI4A 3E93A 1YWNA 3SGCA 1VYZA 3GCQA 4MXAA 4BGHA 3OP5A 4EKKA 4BDJA 4PPBA 1H0VA 2Z8CA 3RINA 5E1SA 1MUOA 5LCKA 5AR7A 3LFSA 3UVPA 2R3KA 3VS1A 2C0IA 3EJ1A 3LIJA 4A4OA 2JFLA 2X81A 2OGVA 3IW7A 3KQ7A 3LZBA 3ODYX 4RVLA 3NSZA 5J9LA 5BVOA 1YDTE 4JBOA 2JGZA 3H3CA 5ANOA 4HNFA 4KNBA 4E7WA 3ZXTA 2BMCA 5AR8A 4ZLOA 2Y9QA 4EOPA 4HZSA 5CSHA 4EL9A 3C4WA 2NRUA 3KGAA 1PKDA 1KOAA 1W0XC 2C5YA 3P7CA 4WBBB 3UIXA 3QFVA 4Y72A 2HXQA 2VWUA 3SQQA 4KABA 3V8WA 2OIDA 3QWKA 4IAZA 3R8MA 4UMQA 3WF7A 3FWQA 3TV7A 1YHWA 4ARKA 4U9AA 3HMOA 3MH2A 4IB3A 4IMYA 5CU4A 4J96A 3UE4A 3ANQA 2RSVA 5FQDC 5KNJA 3IW4A 1ZXEA 3NUXA 4C38A 4D9UA 2B9JA 2XZSA 1MQ4A 3DKFA 3P7AA 4MK0A 3T8OA 5CXZA 5EK7A 3RZFA 3CS9A 3R9HA 3PWYA 3SD0A 2O0UA 2XNEA 3VRYA 5EQPA 1UA2A 3HMIA 3BLHA 3KXXA 1Y6AA 4EOSA 3BV2A 3VBYA 3M42A 1ZYCA 3GCSA 3C51A 5E8TA 3UJGA 3W2RA 1YRPA 2C5NA 4O1OA 4DGGA 3ZBFA 4ZAUA 5D12A 5IMXA 2ZV8A 4WG3A 4DFBA 3BEAA 2B9FA 3LFFA 4DG0E 1SYKA 1ZLTA 3ET7A 4BDHA 1GOLA 3FLSA 1TKIA 5IUIA 1R39A 5HIBA 3FI8A 2BZIB 4F99A 1B38A 5F9EA 2YM5A 3Q2JA 1Y8GA 3ALNA 4TKSA 2VO7A 3Q9ZA 4WRGA 4ZSJA 5FXQA 4ANOA 5A6NA 2ITZA 1CKIA 1KUTA 1ZYJA 3G15A 4MD9E 3S0OA 4MQ1A 1M2QA 2PVKA 4RIOA 3RAWA 4K6ZA 4F9BA 4MF1A 2HCKA 5E7RA 1X8BA 4ASZA 3FZTA 3ZM9A 4BKYA 3G9LX 4WG4A 3F5XA 4GT3A 4OBQA 3KMMA 3WBLA 3R7UA 4FOBA 4JJRA 3UYSA 1M7QA 1Q97A 2X9FA 3O2MA 2OXDA 2VTMA 3F9NA 5IPJA 5AP1A 3MW1A 2BDJA 4FMQA 2BZKB 5GZAA 3WF8A 4PMTA 4HCTA 5FXSA 1H8FA 3BHTA 1ZOEA 3S00A 2HZ0A 5LVPA 2YWVA 2G1TA 4U5JA 4F0IA 3R7EA 4FVRA 4BY9E 3FI3A 3L8SA 3COMA 4EUUA 1NVQA 3HA8A 2JDVA 1OITA 1UNLA 5C9CA 3D9VA 4C36A 4Z16A 4C4HA 5IH4A 5IUGA 3GXLA 4FEVA 5C01A 4YNOA 4K77A 5E8ZA 5IEYA 3BGPA 5AX9A 5KBQA 2FSLX 3H4JA 4BCQA 4C2VA 4DEGA 1PXJA 1OL1A 2XIZA 4F70A 4AGDA 3MVJA 2PZIA 1Z5MA 4GUBA 3B2WA 5IQHA 1OIUA 5C03A 4EK6A 5AAFA 1H25A 4F6SA 1MRUA 5HD4A 2Q0NA 3FMMA 3BHHA 3D2KA 3MN3A 1J7UA 3CY2A 5A4TA 3NIZA 4RJ7A 4N6ZA 5K0KA 5L3AA 4K1BA 3VUKA 5I9WA 3C7QA 3WIGA 5H3QA 3BU5A 4CT1A 4EZ5A 4O6LA 2UZEA 4WNMA 2ESMA 5CSXA 3TZ7A 3VO3A 2YCSA 3K54A 4ZTLA 3E8NA 3ID6C 2VGOA 4F0FA 3NUSA 3CTJA 4IB1A 3KVWA 4AAAA 5IDPA 4XP0A 3OD6X 4IEBA 4UYNA 3UODA 4U40A 4TYHB 3IW8A 5GJGA 3U9NA 2YM6A 4O7SA 2W1FA 2DS1A 4WBOA 3WZDA 4HPTE 2BHHA 4E6QA 4YO4A 1BYGA 2X2KA 4WA9A 3ZM4A 3HP5A 4QD6A 1SM2A 4C37A 3AD6A 3PPKA 4FKTA 5CTPA 5DA3A 4U79A 2Z60A 3PA4A 3T3VA 3OVVA 5L6WL 3ZO1A 3UZTA 2XNOA 4PL5A 3LCDA 1DI8A 4RLKA 5DT3A 3A99A 2B4SB 3P78A 5M4IA 1FQ1B 2VN9A 3II5A 1GZOA 4DTKA 1T46A 3GCVA 4EK3A 1YOLA 3RK9A 4EC8A 4FKOA 2EXCX 3VC4A 3W2OA 2VO0A 3QD4A 2H96A 3H30A 3FZ1A 3G33A 2UZUE 3AC4A 3GC7A 4U7ZA 2ITXA 4NTTA 3A7IA 3HL7A 4JBQA 3VRZA 4EK8A 1FBNA 2PK9A 4QP2A 2FUMA 3IW5A 4FBXA 4QQCA 4A7CA 3CJFA 5AA8A 5BUIA 4UZDA 5HLWA 3MIYA 4LM5A 5HVKA 4D2PA 3HVCA 4DGNA 4CZTA 4NK9A 2CDZA 3OUNB 2WMBA 3AC1A 3OUKA 2HIWA 2WFYA 5FBOA 4ALUA 5E8VA 1H26A 3KL8A 2JIUA 4BCFA 2BRBA 4QMNA 5FEDA 4C4GA 2CGVA 3Q32A 3BHYA 4ZJVA 3UG2A 3RZBA 3PLAE 4WSYA 3T3UA 1J3HA 4O81A 2XKCA 3A7GA 3E3PA 4FKSA 4IAIA 4KSPA 4QPMA 3Q6WA 5D11A 4BCPA 5A54A 3MFTA 4FL2A 3KF7A 4AA4A 3EMGA 2J6MA 3KRWA 3L8VA 1OIQA 3GT8A 4IB0A 3TTIA 4R7IA 2EXMA 3ORTA 4DH7A 1KE7A 2HYYA 4O0YA 4GKIA 4YTFA 1JQHA 3IW6A 4QYYA 4EJ7A 3MPAA 4EBWA 1UNHA 2PSQA 4RJ8A 1XH4A 2QR8A 5A4CA 3EQBA 4L7FA 4XG8A 1JSVA 5EH0A 5BVWA 3NNXA 1KE6A 1RDQE 4CD0A 3W8LA 1YOJA 3NNVA 4CZYB 4C2WA 2LAVA 4ACMA 2PL0A 4YJPA 3LPBA 1TQMA 3VUGA 4AT5A 3PVUA 3ZONA 3ZRKA 5HTBA 3P79A 4IQ6A 1FGIA 2PTKA 5HU9A 2XYUA 4EC9A 4QOXA 1JKLA 3IO7A 4GSBA 4TWPA 5F94A 5JRQA 1XBBA 3BELA 3EQFA 4U81A 2W7XA 2I0YA 4BZDA 3ALOA 2WTDA 3L1SA 4BWKA 3V5WA 4GKHA 5ICPA 4J53A 4NUSA 3VQHA 1IG1A 4BDGA 4HGLA 2XNMA 3EYHA 4XG9A 3V5PA 5DMZA 3U4WA 4ENYA 2R3HA 2OU7A 5D10A 3WZJA 5HLNA 2R4BA 2CKPA 2QU6A 4JLCA 4QQ5A 4DH1A 2CGWA 3CD8A 3U9CA 2W4KA 4LMUA 1Q3DA 2PZPA 4QTDA 4BN1A 4Z7HA 3LQ3A 5HG9A 4Y73A 3VF8A 1NW1A 4BICA 1UKIA 4N6YA 4I0SA 3NCZA 2J9MA 3VQUA 3LM5A 4ZMFA 2UVZA 2CNQA 3LXPA 3UBDA 3VUIA 4IC8A 3TACA 2Z2WA 4PNKA 5DIAA 3F6XA 3MVHA 5HG5A 3CGOA 4CKIA 3QTZA 4QP8A 3OW3A 3FZPA 2GS6A 4BZOA 4NJDA 4MXCA 4AU8A 5B7VA 4KIPA 3SXRA 4I6HA 2WTCA 4FG8A 4YC6A 4MYGA 5DHJA 3S95A 1YXUA 2FB8A 5HCYA 2BKKA 1M2RA 4QYFA 3BGQA 2E9UA 2OJFE 5BUEA 2UVYA 4ID7A 3DLSA 4YSMA 5HEZA 2O63A 3EOCA 4GL9A 4EH3A 4EH7A 4DBXA 5AMNA 1XKKA 2UW4A 4YTHA 2JDRA 4CVAA 4JX7A 2ZB0A 4EHGA 4O27B 2DWBA 4DGLC 4FR4A 3GC0A 4DHFA 3P08A 3QRKA 4CKRA 3A8XA 3TKHA 4FNWA 1XH6A 4FNYA 1AGWA 2ONLC 5IKWA 2V62A 2OICA 2RKUA 4NU1A 5AP7A 5IMEA 3LFDA 4QYHA 5EYKA 3V6SA 4U42A 5M4CA 4ANBA 4H05A 3QRUA 4FT3A 3OWPA 4OBOA 3FYKX 2YITA 4GV1A 3QQKA 2ZM3A 1P14A 2IJMA 5CSWA 3EFLA 3PY3A 4O6EA 3R8VA 3O71A 3TNWA 3OXTA 2YDJA 2P3GX 4H36A 2QG5A 4FIHA 2C6DA 3D7ZA 3COHA 4IX4A 3RWPA 2W5BA 3ZLWA 4DFNA 1L3RE 4LL0A 1J1BA 3FMHA 5H8EA 3Q6UA 3QGWA 2Z7RA 3QTQA 2ITVA 1PXOA 2ZJWA 1NA7A 3ZSGA 4PDYA 4EOMA 5EI8A 1LUFA 3QXOA 2VTAA 5LWMA 4CMTA 1ZY4A 4QP6A 4AOIA 4EWHA 2F7ZE 5J7BA 2HENA 3D0EA 3DT1A 4FSRA 3TUDA 4HPUE 4GYGA 4A07A 3EFWA 4IWOA 5LMAA 4E3CA 4BRXA 2PZ5A 3HMPA 2P2HA 3CXWA 3PXYA 4LUEA 5F95A 1GIJA 4P2KA 4FL3A 3ZTXA 2B7AA 2YHVA 5I9XA 3SHEA 2WEIA 4D4SA 4FI1A 3PUPA 4QO9A 3LAUA 4HZRA 3CQUA 3U8WA 3MFUA 5HBJA 2VO3A 3M11A 3MTFA 4PUZA 4HGEA 3ULIA 3MY5A 4G3GA 4E6DA 5FTGA 4JRVA 1BI7A 3QC9A 4TYEA 3EQIA 5DEYA 4D0WA 3F2NA 5A4LA 3UQCA 4C8BA 5LVMA 3ORNA 4AN9A 3R21A 2PMLX 2R3GA 2C47A 2QLQA 3QTRA 1KOBA 5M56A 5GJFA 2ITNA 4FEQA 4OLIA 5M4UA 2IVTA 3VHKA 3OOGA 3TNIA 2OZAA 5AR3A 3IDBA 5EG3A 4G2FA 3U4UA 3ZBXA 2GS2A 4MF0A 3A7HA 1IAJA 3O0GA 5ANDA 3FMKA 3TDVA 3QRTA 2XK4A 1QPEA 2O65A 4D0XA 4YZNA 2PUIA 3LMIA 2I1MA 3UNJA 4B9DA 5FD2A 4FF8A 2RFEA 3AC5A 3AMYA 4X3FA 5GHVA 3RKBA 2OJ9A 3CIKA 3GB2A 4FV8A 4DT8A 3FBVA 5EYCA 4XP3A 3EN9A 2XIKA 4NCTC 2VWVA 5ANKA 2ZMCA 4FTAA 3IKAA 4M7IA 5AM6A 4A06A 5BVFA 2G2IA 4MNEB 2UZLA 5JZNA 3TKUA 4FV2A 1SNXA 2PMNX 3KRRA 4OTGA 2OIBA 3W2CA 5JGDA 2C30A 4X2NA 4YZMA 4X6QC 1Q99A 2XNNA 3DZOA 2I0VA 2QI8A 2WELA 2XBJA 3FC1X 3OCSA 4I1ZA 4K2RA 4BDCA 3FL4A 4JOAA 3SVVA 1CDKA 3FZSA 2VWBA 1H07A 3FI2A 3RGFA 3EN7A 4F0GA 2AUHA 5CSPA 5L2TA 4RG0A 2YEXA 3U87A 4LFIA 5IA4A 4M67A 4I21A 3FQHA 5J5SA 3DA6A 4HVGA 3OBGA 3R8LA 4RZWA 4OW8A 3VAPA 3G51A 4BHNA 4BKZA 4DCAA 5AV3A 4UALA 3RPYA 4MQ2A 4K18A 3SV0A 3KULB 5FGKA 4GRBA 4FKVA 4PX6A 3KRXA 3QLFA 3VUMA 3TWJA 4RIWA 3VUDA 2C1BA 3LFQA 3QBNA 2HZNA 3G2FA 5DLSA 3BCEA 5LOHA 4G3DA 4U97A 4YJOA 4CT2A 5KUPA 4BHZA 3NDMA 1PKGA 4PV0A 2BZJA 4FSZA 4W9XA 4KIKA 4RVKA 4G34A 3OT3A 2ITWA 3CKXA 4RIXB 4G3CA 4IADA 1UVRA 2JBOA 5DG5A 4KINA 4LV8A 4ZZNA 3PSBA 4XV1A 2CKOA 2WTKC 1YXVA 3ATTA 1JVPP 3BU6A 2ETMA 2XVDA 2C6KA 4GJ3A 5DR9A 4AZWA 5CAOA 3KY2A 2G2HA 4RVMA 3OT8A 3GOPA 4ANMA 3UOJA 4NIFB 2PVLA 4L52A 2RL5A 3HDMA 3VHEA 4V05A 2VTSA 4C4JA 5HO7A 4D1SA 3EKNA 4FSNA 3GU7A 3UP7A 3CTQA 4FTOA 1GJOA 2BIYA 2GSFA 4YJQA 5KZ0A 3COKA 3NS9A 3R7VA 5KX8A 2PULA 3R73A 5AM7A 3WILA 4CFXA 4QP1A 3K5UA 4GK2A 3MBLA 3FEGA 2R7IA 2B54A 2HZ4A 3F61A 2E9PA 3N4VA 1P4FA 2JBPA 2WB8A 4JDHA 3LVPA 1Q41A 3H0YA 4X2FA 1YWRA 3ZFYA 5L6OA 5ANEA 2QQ7A 2YWPA 4DBNA 5A14A 1AQ1A 1WFCA 3ORKA 3VBVA 5DRDA 4J71A 4QMXA 5EI6A 2X7FA 1NXKA 4L46A 3CE3A 3TEIA 4DITA 4CFFA 4QNAA 3EQGA 5FEQA 3QQLA 4BB4A 4F9YA 5KMNA 5CT0A 4ZIMA 2XUUA 2WGJA 5CVGA 2VTIA 4RIYB 3A60A 4I93A 4AZFA 4QMLA 2WQEA 3DJ6A 4IIRA 3DAKA 2VWXA 2XH5A 4D1ZA 4J7BA 1OL6A 2WQNA 1F5QA 4BIDA 4HOKA 4PL4A 1UV5A 5C4KA 5CF4A 2JKQA 4I20A 2YCFA 3BYOA 2ZDUA 4BDKA 2F4JA 3RTPA 2OF4A 2VAGA 2GPHA 4RPVA 4AG8A 1PXNA 3ZS5A 5ACKA 3PRFA 4R7BA 4L43A 3I5ZA 3IGGA 4F1MA 5J9ZA 2XRWA 4TPTA 4JR7A 4S31A 2RIOA 4BL1A 3EIDA 4FV4A 4IVCA 2PPQA 3LFCA 4LOOA 4GVAA 3TV4A 5E1EA 3LE6A 4QRCA 2V7OA 3MPTA 4FK3A 4H3PA 5I9UA 3NUYA 4X3FC 5JGAA 2ZVAA 2IZTA 4CXAA 5DT4A 1QPDA 1YI3A 3MSSA 3PYYA 4G5PA 4ZTRA 2A1AB 1OMWA 4ZTNA 4O91A 3Q96A 3UC4A 3DOGA 3W18A 4TT7A 2O3PA 3Q9YA 4CG9A 4EH8A 2E9VA 4HVIA 5KBRA 4LI5A 5I9VA 4AF3A 4E4NA 3MWUA 2GDOA 4G5JA 3SW4A 2FSTX 3KCKA 2UW6A 5M09A 2J5EA 2YIYA 4YLLA 2GU8A 3GCPA 3OW4A 5E9EA 4JIAA 5A4EA 2PE1A 4I0RA 2IZRA 3SXSA 2PUUA 4YP8A 4NTSA 4AXAA 1XBAA 3O8UA 3NVKI 2P33A 3RPVA 3UDBA 3ZUUA 2WIPA 4ZY6A 3ZZWA 4YJUA 2WMRA 2WTIA 4WD5A 4XMOA 5T68A 2UZVA 4LRMA 5AFVA 3KB7A 1AD5A 2W1IA 4UZHA 3MA3A 2J0MB 4IHPA 4IVAA 2BTSA 3FKLA 4MXXA 3UMWA 5EM7A 3SOAA 3PZEA 4KS7A 2CPKE 4EOQA 3A8WA 5HNIX 4NH1A 5C27A 4MKCA 4FTLA 5AV1A 4V04A 5HO8A 5ETFA 4OBPA 3OROA 4W9WA 3UYTA 2WMVA 2YM7A 4OTRA 1Y8YA 4CNHA 4X6RA 3ATSA 2JLDA 3EN5A 3DJ7A 2W1HA 5B2KA 2EXEA 4L8MA 5BNJA 3NIEA 2XKDA 3BV3A 3KULA 1OPLA 3PWDA 4RWLA 4W4XA 2PMOX 2AC3A 2ZM1A 4FKLA 5ETIA 3P7BA 3GOKA 3U6JA 5H8GA 2YERA 4H3BA 4FIJA 4GFMA 4YHFA 3BLQA 3KF4A 3C5UA 3ZXZA 2X8EA 4JAIA 3RALA 5IQIA 1MQBA 3CCNA 2BCJA 4OR5A 1H1SA 4Q5HA 4QP3A 1WBPA 2ZV7A 1Q24A 1QPJA 3R30A 1ZZLA 2C5VA 3JY0A 3POZA 2W05A 4HNIA 2JD5A 2YIRA 3KXZA 4EYJA 5EFQA 5AUYA 2VTQA 4O84A 3E8EA 3MH1A 4O0UA 3ZRMA 2O8YA 4A9TA 1BL7A 3MS9A 1NT2A 4AFEA 2C3KA 2OH0E 1JNKA 4JG8A 4E93A 4I5HA 5EHOA 4F4PA 1KV2A 1TVOA 4FV5A 4R8QA 2P0CA 3SRVA 4RFMA 4E5BA 3PP0A 4Y8DA 3FLWA 1REKA 1H27A 3AMAA 3QD3A 3QALE 3TN8A 4GG5A 4JQEA 2X6EA 2GHLA 2F2CB 5CF8A 2BIKB 2XYNA 1STCE 5A6OA 2OZAB 4AE6A 4N4SA 4JX3A 4F63A 4YC3A 5IA2A 1FPUA 1OKVA 1Q3WA 4IW0A 2CN5A 3UOKA 3SOCA 1XJDA 4U41A 1H00A 3Q53A 2HY0A 2F57A 5LQFA 4KIQA 3QZGA 1E9HA 4L68A 4EH5A 2YDIA 2X0GA 4F65A 2PUNA 4F6WA 3DTWA 4NCTA 3LXNA 5TO8A 5M06A 2IWIA 3BPRA 3MA6A 2C68A 5HG7A 5C26A 1V0PA 3DQWA 2Q83A 2IO6A 3NYNA 3COIA 3DXNA 4G9CA 3N4TA 3VBWA 3BX5A 5CAUA 1OKWA 3PDTA 4JG6A 3LCSA 4GJ2A 3EL8A 1OL7A 1Y57A 3SRVB 2WQMA 4L9IA 3CC6A 5BMMA 2WZJA 4U45A 3WZUA 4BYJA 5I5ZA 3I5NA 4TL0A 2R0IA 1REJA 2YLFA 4L6QA 3P23A 4ALVA 4TNDA 2PY3A 3E3BX 5HX8A 3I7BA 5B2LA 2JAMA 2XNGA 4KBCA 3LXLA 4IAAA 2G2FA 2CMWA 2P4IA 3JYAA 1Q8ZA 3ZMMA 5DFPA 3LFNA 4D5HA 3RM7A 3FJQE 2JC6A 4U3YA 1Q8YA 3H9FA 1Z9XA 4FVPA 4I6QA 5HICA 4PL3A 2B9IA 1M52A 3HDNA 4AZSA 5CS6A 4FKWA 4O82A 4ZLYA 5M4FA 4FZ6A 5B2MA 3DKGA 5M51A 4O21A 4Z9LA 4CGAA 3F7ZA 2BFXA 2W1DA 2E9NA 3FXZA 2PVFA 5HZNA 5CYIA 4I4FA 1QL6A 3R04A 2H8HA 3FAAA 1KSWA 1ZYLA 3R1SA 4FTRA 1HCLA 3R22A 3QX2A 4S33A 2R64A 5I3RA 4FUXA 3BU3A 1GZKA 2Y4PA 3F88A 1A48A 2GNHA 5TR6A 2CN8A 3EL7A 2J0JA 3HX4A 2WMQA 4E26A 3EQPA 3NAYA 5BVKA 3FUPA 1ZOHA 4O7YA 1M2PA 5TT7A 3I1AA 5CI6A 5HCXA 5LMKA 3CLYA 4ASDA 3AC3A
chains in the Genus database with same CATH superfamily
2B52A 2OSCA 3KC3A 4AWIA 5HORA 3O96A 3UPXA 5KMKA 5M07A 4AXDA 3GI3A 4NM0A 1NY3A 2C3IB 3R28A 4LGGA 3EKKA 4FZDB 3C0GA 1ZY5A 3R1NA 2G15A 5TF9A 2UW9A 1R78A 3QHWA 3QLGA 4RA4A 2Y4IB 4FSUA 4IM2A 3TKIA 3MGYA 2XM9A 3R02A 1CTPE 3MVMA 4DGOA 1OB3A 2I40A 2RFDA 2QOHA 2XB7A 4C0TA 2WMAA 5A4QA 4GFOA 1IA8A 2C0OA 3GP0A 3ORXA 3QCQA 4AN2A 3F3ZA 5F1ZA 2ZM4A 4CMOA 1UWJA 3POOA 1GZ8A 3NW7A 3QA8A 4H3QA 1OI9A 3OHTA 4Q5EA 5CEOA 4C4FA 2VTOA 2VO6A 3P0MA 4RC4A 1YXTA 3QF9A 2BILB 3ZO2A 3OXIA 3QA0A 4XH6A 4DCEA 3OFMA 2QOOA 4IX3A 3MESA 3KMUA 3AXWA 4J98A 2OK1A 3WYYA 4EOOA 2JITA 4XG4A 5CENA 4NW5A 5BYZA 5M53A 4KIKB 4C4EA 2QU5A 4G16A 4R3RA 5KKRC 2OWBA 4D5KA 4IWDA 4L3LA 4BCMA 2VTNA 3KK9A 4NZWB 3R6XA 1UU3A 3P9JA 3NNUA 4QPAA 4O0SA 4IZ7A 4ANLA 3UPZA 4YHJA 4DEDA 2OFUA 4C57A 4B8MA 2WMSA 3HV5A 4ZSAA 4UWBA 5JFSA 3JUHA 1LEZA 4QNYA 3W2PA 4FZAB 4FNXA 3GQIA 4L01A 3CBLA 4GT4A 2GTNA 4EH2A 3QWJA 2R3MA 3QD0A 4BFMA 5KHWA 3Q9WA 4HW7A 2VD5A 1S9JA 1FMKA 3KEXA 2XKFA 4RWIA 5HNGA 4HJOA 2R2PA 4FT7A 3MY0A 4EH4A 2QHMA 3SG9A 3A61A 1VYWA 3OTUA 5DVRA 1P4OA 3PRIA 3MH0A 4RIWB 1W82A 4RWKA 4UXLA 5ETAA 1MP8A 1YWVA 4MTAA 3ULZA 2V22A 3ZLYA 2F7EE 4PF4A 3DLZA 2XK3A 4D4RA 3PE2A 4XG3A 3RPSA 1KE5A 3BGZA 4XYFA 3O23A 2QC6A 1YOMA 4DGMA 2E2BA 4OTIA 1Y91A 3UOLA 5JSMA 4K8AA 5HQ0A 4BCKA 3VW8A 4WUNA 3H9RA 4EQUA 4OAUC 4E1ZA 1FMOE 4IX5A 3UQFA 1BL6A 2R3QA 4FODA 2XA4A 4G9RA 3ERKA 3V01A 3RK7A 5EQYA 5AP4A 3FLQA 4AT3A 3NX8A 3H0ZA 4IWQA 4YNEA 3TJDA 1PXKA 4LV5A 2WO6A 1ZAOA 5E8SA 4AFJA 4P4CA 4EQMA 4BIEA 1OGUA 3AGMA 4DFLA 4HYHA 5JT2A 3HAVA 4CFNA 4IACA 2PVRA 3A4PA 3I79A 3IS5A 4EZ7A 2A2AA 4BWPA 3UTOA 3VVHA 1SVEA 2UVXA 3I81A 3FPMA 5J87A 3E8CA 1U46A 3FQEA 4ENXA 2QKRA 5BVDA 5LWNA 1O6YA 4NW6A 5HD7A 4JNWA 2OJGA 2Y7JA 4WNKA 4M97A 3WE8A 3D4QA 3B8RA 3F3TA 4XLVA 3I0OA 3TZMA 1PYXA 4I6BA 1YDRE 5HKMA 2ERZE 5HGIA 5A46A 3GBZA 5EW9A 3WF9A 5I9ZA 1YKRA 3CQEA 2V55A 3ORIA 4ITIA 4WSQA 3HAMA 2FGIA 3K5VA 3DFAA 5ACBC 3R9RA 4KB8A 4M69A 4MBLA 1LEWA 4ZY5A 4JT3A 3PXRA 4KBAA 3UO6A 2VTJA 4U43A 2R3NA 4JIKA 2WMUA 3QCXA 3QZHA 4QPSA 3V8SA 1W8CA 4ZSGA 4PNIA 3KRLA 5IA5A 4YBJA 5LVLA 4DFZE 3Q5ZA 2WQBA 5FM2A 4QMSA 5IQFA 2YA9A 4FC0A 2XBAA 1CMKE 4JQ8A 3BI6A 5I0BA 2P55A 3D5WA 3HUCA 2BRNA 4BCNA 3QGYA 1YI6A 5EQEA 4RIYA 4FTQA 3RWQA 4FEUA 3HP2A 2RG5A 2ZAZA 4UEUA 4QQTA 4YTCA 1Y6BA 5LARA 5AV4A 1WAKA 4RBLA 2WTVA 4FGRA 4PP9A 5LVOA 4DTAA 4RC2A 4KIOA 5FDXA 2BUJA 2PVYA 5JH6A 2OW3A 3F69A 3QCSA 4M15A 5K0XA 3LJ0A 5AR4A 1Q8TA 2UV2A 3S1HA 3FE3A 4XBRA 3PTGA 4TYJA 3TL8A 4B0GA 5EKOA 4DFUA 2YACA 3A62A 5IDNA 1JSUA 3ACJA 3G0EA 3BL9A 4J99A 3DZQA 4G6NA 4NEUA 4E73A 2A27A 4GUEA 4YUQA 4R3CA 2CCHA 4M0ZA 4QTBA 4EQCA 2XEYA 3ZEWA 3H9OA 2VWZA 4E6AA 4ZOGA 4DLIA 5HTIA 5IU2A 3Q9XA 4ZTHA 5AR5A 3AKJA 3LMHA 2F9GA 4DEAA 4F6UA 3RP9A 2CGUA 3TUBA 3EN4A 5ANJA 4B99A 4XOYA 3OCTA 4FTJA 3Q04A 4OT6A 2ONLA 4FKGA 3PJ1A 4GEOA 2A98A 3NYVA 1HCKA 4WT6A 4AZVA 1G8AA 2EUFB 3HV4A 1M14A 2CSNA 3IK3A 3WZKA 4C3RA 4ZJJA 4IX6A 3LW0A 4YSJA 2OXXA 4MXYA 1G8SA 4EHZA 3DBEA 1WCCA 2GS7A 2J50A 2JIVA 3FMLA 2OH4A 2NO3A 3PXKA 4UMTA 3WI6A 3Q60A 1H01A 5KHXA 4AOTA 5KMOA 5DRBA 4KSQA 1YHSA 2BRGA 2YIQA 4YJSA 4EH6A 3HRBA 4EORA 4D2TA 1Q4LA 5EHLA 3KU2A 1LR4A 4AOJA 1PRYA 4KD1A 3QX4A 4RLLA 3UDZA 4QT1A 4WO5A 5AP6A 3BYMA 2C5XA 3GC8A 4FL1A 5AR2A 2VGPA 4QMZA 4JBVA 2HW7A 3DU8A 1ST0A 2CNUA 2F7XE 5EOBA 2XMYA 3MB7A 4IVBA 1GAGA 3KN5A 3DK7A 2QO9A 3FMJA 5DEWA 4BIBA 3OF0A 2GNFA 5CAVA 3QUPA 5FXRA 5KMMA 1WBVA 4XCUA 3O7LB 2BTRA 2QNJA 4FSYA 1OZ1A 4IM0A 5FEEA 4XV3A 1UU9A 4BBMA 5K4IA 2CJMA 5K5XA 2QOFA 4G6OA 3NMUF 2C1AA 3BE9A 3LM0A 3OG7A 4W8EA 2UUEA 1RW8A 1PMUA 1ZRZA 4V01A 5HNBA 3QZFA 2JEDA 3ZLSA 4F9CA 2X39A 3Q4UA 3TNHA 3U51A 2VTTA 3OY3A 3RCDA 3D5XA 4NFMA 4XOZA 4BDIA 1XH5A 4EBVA 3G0FA 4LRKA 3DCVA 5GJDA 3RVGA 4KWPA 1H28A 5F20A 3TZ9A 2H9VA 4PRJA 3O8TA 3C4CA 2YJRA 4NIFA 5DH3A 4BCOA 4GG7A 4FT9A 3MFRA 4U3ZA 4KBKA 2O64A 4IAYA 3AT4A 3BYVA 4OT5A 4O7LA 4FG7A 1UWHA 4HCVA 5HOAA 3QHRA 1JLUE 3AC8A 4FSWA 2WOTA 4LDTA 1YDSE 5CU3A 4RQVA 4DDIA 3L9MA 2CLQA 4A9RA 4BTKA 5GZ9A 3BEGA 4AX8A 4AN3A 3FC2A 3O8PA 4R3PA 5FDPA 4K33A 3FHIA 2YFXA 4CTCA 5GIPE 4MWHA 4X7QA 4ERWA 2IZSA 3KRJA 3RHXA 1OL5A 2ETRA 2J0IA 1OBDA 3DTCA 2EU9A 2QODA 4AZEA 3LLAA 3RK5A 4FTKA 2PVJA 3QQUA 3FL5A 3GU6A 4FZ7A 4LRJA 3KCFA 4WRSA 3TNQB 4CQGA 4OTFA 2C4GA 5DYJA 2W1GA 4ANQA 3CJGA 4AW5A 1OVEA 2GNIA 4JDIA 3UZRA 4O0XA 4O86A 3R8ZA 3OOMA 4ZSEA 1VEBA 2XNPA 5D9HA 1Q8WA 5JFXA 1URWA 4R77A 1UU8A 2BDWA 4JQ7A 1WBNA 3BKBA 2X1NA 5IQDA 4IZAA 3CPBA 1RJBA 2GNGA 3EFJA 4XJ0A 4FSTA 4S30A 4GK4A 5HBEA 3PVGA 3W1FA 3F5PA 4CSVA 2WKMA 2XAMA 3SAYA 3ZLXA 3HZTA 5G6VA 4X0MA 4TXCA 4BI2A 2QOIA 2GQSA 3E5AA 4QMTA 1OECA 3DBCA 1OM1A 4GIIA 5HTCA 4IWPA 4X2GA 1FOTA 4WOVA 3PJ2A 5JRSA 4DN5A 1PW2A 1BMKA 3DB6A 1CM8A 2X8IA 3GCUA 3I0QA 4EOKA 1ST4A 5HVYA 4IAKA 1YI4A 2FSOX 3PE1A 3RNYA 5LMKC 4G31A 4O7VA 3W0OA 2W4OA 4Q2AA 3I6WA 3HUBA 4PDOA 5FBNC 3DXPA 4D9TA 5KMIA 4BF2A 3IDPA 2PYWA 3K2LA 3GVUA 1I44A 1W2DA 3AG9A 5EM8A 4AP7A 4H1JA 4FV9A 4QQJA 5D1JA 2RG6A 3D83A 5EDRA 3QU0A 4OTHA 2SRCA 1JOWB 5AIKA 5H2UA 2O5KA 4JDKA 4EZ3A 4M8TA 3AGLA 5I3OA 4N57A 4FTMA 5IZFA 1CSNA 1TQIA 3B2TA 3E88A 1IR3A 3OWKA 5J9YA 4XV2A 3AMBA 3RNIA 1OBGA 3PSCA 3RI1A 4FKIA 2W4JA 2JKOA 5HVJA 5M57A 4KA3A 1WZYA 5J8IA 5FTOA 1EH4A 3KREA 3BQRA 5CEKA 3V5LA 4F7LA 3ZDIA 3ZSHA 1FGKA 1XH7A 4PTGA 4EH9A 4EOIA 2CNVA 2R7BA 1U54A 2YABA 3OEFX 1H1QA 3U54A 3IGOA 2C3JA 4JL9A 4NKAA 3TM0A 3HV6A 4I5PA 3C4EA 3CKWA 3GFEA 5K3YA 3M2WA 4QMPA 4LMNA 2X7OA 4BCHA 4UMUA 1PXPA 3BYSA 4RMZA 4TWCA 3K3IA 3R63A 4ANNA 2YIWA 4F78A 3VBTA 4X3JA 4QMUA 4C3FA 2PUPA 4RX5A 5JK3A 4UX9A 2Z7LA 2FO0A 3P86A 4O2PA 4GW8A 5EKNA 4QDEA 2OFVA 3CTHA 4CFWA 4F7SA 4DEEA 3CSVA 2WTKB 3DQXA 4G17A 2VRXA 1M7NA 2C6TA 2XM8A 4TWOA 3F82A 5CVFA 4DAWA 4AS0A 1BKXA 4OTPA 3ELJA 2PU8A 2JDOA 2XIXA 3R1QA 3PIYA 4I0TA 4EHVA 5J79A 4BJJA 3RBWA 3W0QA 5BMSA 3JPVA 4FIGA 3AT2A 4BGGA 3NAXA 2DYLA 2HK5A 3EQRA 4FG9A 4AQCA 2WTWA 5C8NA 2JFMA 2QONA 3DDQA 2NNWB 3VUHA 5IF1A 5EYDA 4BDFA 1ND4A 3VJOA 5DR6A 4M84A 3PUFC 3MDYA 2XK8A 3QYWA 4FE2A 3RAKA 3QD2B 3LQ8A 3C4ZA 1OIYA 1QCFA 3KXHA 3LCKA 4JG7A 3F3UA 5E8XA 3R0TA 3UMXA 3MYGA 3VS5A 2XK6A 4O4BB 5AADA 2RF9A 2QKWB 5E4HA 4MBIA 3C4XA 2PVNA 4Y95A 4EK5A 1Q8UA 3MB6A 4WG5A 5IA0A 3BWJA 5J7HA 2XS0A 3DAJA 4USDA 4AGCA 2IW6A 2YM4A 1IRKA 3MV5A 3P5JC 2GNLA 4M0YA 4GU9A 5AUUA 2B1PA 4QMMA 3LJ1A 4CEGA 3MTLA 4LV7A 5CXHA 4NSTA 1BLXA 5AA9A 3HRCA 5DWRA 2C6OA 4ZK5A 3DS6A 2R3JA 4Z55A 4BCGA 5FM3A 2FVDA 1OUKA 4C02A 4CFMA 5EOLA 2X4ZA 3RHKA 2IPXA 2QOBA 3DPKA 4EHEA 3QYZA 1P5EA 5HO6A 4YURA 2W9FB 3E62A 2VV9A 2P2IA 1SZMA 1JKSA 3V51A 2V0DA 3ZO3A 3SXFA 4NWMA 3NWWA 3DNEA 1ZYDA 1H4LA 5CEQA 2VWYA 5JMSA 4JVGA 3Q52A 5A9UA 2X9EA 2YAKA 4MD7E 2BR1A 4ZTMA 4C4IA 3VN9A 4FZFB 3QTUA 1VR2A 2EWAA 4Y46A 5AWMA 1DM2A 4ONAA 3R7OA 4FV6A 4PY1A 2PVHA 3TT0A 3QQJA 3MIAA 2PVMA 4P7EA 3D15A 2BZHB 1ZMVA 5HESA 2I0EA 3ZC6A 2WQOA 5CVHA 3PLSA 4FKQA 3KKVA 1IASA 5CASA 3CPCA 5DT0A 5FG8A 4DEBA 4TRLA 1WVXA 1W83A 3UP2A 3VS4A 2QOLA 3CGFA 3NCGA 3R00A 4O4CA 4ACDA 4DTBA 4YHTA 4BI1A 3TI1A 3GGFA 3QRJA 4YPSA 3C9WA 3R2YA 4RX8A 3PP1A 3Q4CA 2I0HA 4ASXA 1TZDA 4NKSA 2JIIA 4QTAA 5EYMA 3W33A 3E92A 3PIZA 5CQUA 1PXMA 3ITZA 1UNGA 3P4KA 4W4YA 4CV8A 5AJQA 5EDPA 4O7RA 4W4WA 2PWLA 3MH3A 5CU6A 4GFGA 4FV7A 2FYSA 2YM8A 4U6RA 3D2IA 4A4LA 4E4MA 4APCA 5K5NA 3ZH8A 2B9HA 5I9YA 4FSQA 4IANA 1WBSA 4JRNA 2XIRA 1OPKA 4RZVA 2A0CX 3WARA 3W8QA 2HWOA 4IM3A 3SKCA 1U59A 2JDSA 5HIDA 4ERKA 4JDJA 5CALA 2OBJA 3BBTB 2X8DA 4RQKA 2G9XA 1J1CA 4BBEA 4LOPA 2R3LA 2BAKA 1SNUA 2W0JA 4BWXA 2BPMA 3C5IA 4IJ9A 3WE4A 3PJCA 4MX9A 3ZUVA 1DS5A 1WBWA 2J0KA 4XEYA 2IN6A 3R83A 4CCBA 5KO1A 5ETCA 5CEPA 3EB0A 3LKMA 1H0WA 1Z57A 1UU7A 1URCA 4IZ5A 3F2RA 3ZHPC 4ZMEA 3OEZA 4WNPA 3I60A 1QPCA 4RGJA 3PIXA 4XG6A 4MXOA 5LMBA 4UWCA 4PP7A 4YZBA 4H39A 4NM7A 2VX3A 4F64A 5GNKA 3UOHA 5DR2A 3D5UA 4I5CA 4XX9A 3SG8A 1J7IA 1PMNA 4R5YA 4ZSLA 3SC1A 2IEWA 4FEXA 1JBPE 1R3CA 1YW2A 2HWPA 2XEZA 3CEKA 2DQ7X 1H1PA 2IVSA 3Q2MA 4J8MA 2UZBA 4CCUA 1YHVA 5E8YA 5H9BA 4AXEA 4CV9A 1J91A 5C1QB 3VJNA 3TZ8A 1E1XA 2PE2A 2PZYA 2OJJA 1K9AA 4MCVA 4QYEA 4RJ3A 2F2UA 5HG8A 2QR7A 1UKHA 4BDAA 4IB5A 1XQZA 2BDFA 2R3RA 3FXXA 3ZC5A 3SDJA 3Q5IA 2W5AA 4ACHA 4PQNA 3HV7A 4EUTA 3EWHA 2UW3A 3RMFA 3IECA 2HY81 4M13A 4IFGA 1G5SA 3F2AA 5JQ8A 3GU5A 2AYPA 5KZIA 3FKOA 3T9TA 5IEVA 1JKTA 3VS0A 1ZOGA 4J1RA 4MHAA 3CD3A 1T45A 3MI9A 4DH3A 5BYYA 4GU6A 4OTWA 3FHRA 4EKLA 2H34A 4PMMA 4FT0A 1DI9A 2BRHA 2C6EA 4Y85A 3PVBA 3BYUA 4C3PA 3PFYA 4DT9A 2RFNA 1IEPA 2W06A 3FZOA 3NPCA 3NW5A 3H10A 3R7IA 2IVVA 3N9XA 1BX6A 1PY5A 4QP4A 3DJ5A 4DYMA 1VLRA 3KIOC 1U54B 4YPDA 3LHJA 4C62A 4EONA 4QTEA 4MEDA 4IH8A 2ITTA 1JPAA 1SVGA 1M17A 4C58A 3L9LA 4IE9A 1Q62A 3TCPA 5J1VA 5AUVA 3FSKA 2OO8X 2RGPA 4TN6A 3IONA 4ACGA 5BX0A 3BRBA 4O83A 5KKRB 4JI9A 4ZZOA 2DUVA 5BPYA 3E87A 3G9NA 3W32A 4FUYA 4NM5A 2YCRA 3HRFA 4R6VA 4ACCA 5HE1A 3GU4A 4NT4A 3W2SA 5AUWA 3NFFB 3GC9A 3ORLA 2JKKA 1YVJA 3ROYA 3ROCA 3QL8A 2IG7A 2XKEA 4FK6A 3HNGA 2YJSA 4QMWA 4EOJA 4YMJA 2VZ6A 3KK8A 3QQFA 3E64A 4U0IA 3AD5A 4BTFA 5IH6A 3GUBA 5KMJA 2J2IB 2JDTA 1DAYA 2WD1A 4IAFA 3VNTA 3SW7A 2PE0A 5D7AA 4XG2A 4L3JA 1XHAA 3FV8A 4F1OA 1NVSA 4S2ZA 4II5A 4C61A 4RT7A 4AXCA 4FT5A 2WIHA 3DBQA 3PA5A 4J97A 3GFWA 3DNDA 4OTQA 2WNTA 2BAJA 4NM3A 4D2VA 3A2CA 1LPUA 5AAEA 5AP0A 2Y4IC 3V6RA 3REPA 3UNKA 3N51A 2OJIA 4I41A 4TZRA 3WOWA 3UIMA 3DKOA 4FYNA 4UMRA 4FIIA 3UNZA 3DK6A 3F7WA 2R3IA 4UWYA 3VUTA 5CF6A 2C3LA 2C69A 2PZRA 2WU7A 3NVMB 2IW8A 3ZCLA 3NUNA 5T3QA 4RWJA 3N4UA 1KV1A 3AOXA 2QLUA 5AIRA 1B39A 2BHEA 4XUFA 2X7GA 5BUJA 2JAVA 3PPZA 2GQGA 3HA6A 2EVAA 3MJ1A 4WUAA 2ITUA 3AKLA 5M55A 3MJ2A 2UW7A 3I4BA 4NJ3A 5EHYA 2VX1A 4I6LA 3ZOSA 3OC1A 4HVHA 2HAKA 3PA3A 4JR3A 4KS8A 4Y83A 3WZEA 3RAHA 1I09A 3FMNA 3EYGA 4P5QA 4PDPA 2GCDA 1U5RA 4PDSA 2ITOA 2UZDA 5CNNA 4GS6A 3LCOA 3SX9A 3KXMA 2HELA 4FV0A 5L2WA 4V0GA 3ETAA 3UG1A 3B8QA 4OAVB 2QO7A 2XCHA 3ANRA 1YQJA 3RPRA 4FYOA 2FH9A 4FX3A 4O0TA 4O0WA 4S32A 2J5FA 2HXLA 3OZ6A 3HEGA 3OY1A 4GT5A 4ZEGA 3DXQA 5K9IA 1FVTA 4YBKA 2PHKA 3FZRA 4JBPA 2GFSA 4ZS4A 3ENMA 4YZDA 4DH5A 4IDTA 4D2SA 1XH8A 5KMLA 4B8LA 4CZUA 4QMOA 3OWJA 4RA5A 4WNOA 3BIZA 3O17A 4ALWA 1PXLA 4TWNA 3F3WA 3FLNC 4L3PA 3QCYA 2NPQA 5CSVA 5DPVA 4DA5A 2Y0AA 4QYGA 4YGAA 4K9YA 2R9SA 3ZRLA 3EQCA 3ZSIA 1O6LA 4ZP5A 1E1VA 1SMHA 2QOQA 3Q4TA 4F08A 3PZHA 3CQWA 4YC8A 2C6IA 3PG1A 3RPOA 3FKNA 3GENA 3W0PA 3JS2A 4BCIA 5IH5A 3OCBA 3LCTA 1MRYA 2XIYA 3UO5A 5HX6A 4DF3A 4F9AA 5LXMA 4HYSA 3FPQA 3R9NA 4ORKA 3C1XA 4HGSA 4FNZA 4N0SA 4FGBA 1XBCA 1WBTA 1ZMWA 2C6MA 4FTNA 3PXZA 4UXQA 3BE2A 4E5AX 4M69B 4FEWA 2FA2A 3EQHA 5K4JA 4YJNA 2HW6A 2Z7QA 1OL2A 3OMVA 2YIXA 3QQGA 4AUAA 4I22A 1F3MC 1ZWSA 4G1WA 4TY1A 5F4NA 4CFVA 4G3EA 4MWIA 1W7HA 2W17A 3R8PA 3SLSA 5A3XA 1OPJA 4XV9A 3AC2A 2YN8A 3TIYA 1FINA 2B55A 4BCJA 3O7LD 3DBFA 4UB7A 2YZLA 5TE0A 3QTWA 4UN0C 5EM5A 5D41A 4L44A 3PSDA 4BDBA 4Z3VA 4XNEA 4A9SA 3U55A 2XJ2A 4O7NA 4HYIA 3FY2A 1V0BA 1R0EA 4MNEA 3R9OA 2XANA 3TDWA 5E92A 4DHIB 2CKQA 3OTVA 2WMXA 2BAQA 4CKJA 5J5TA 1H24A 2I6LA 4FKUA 4FTUA 3NYOA 4KKEA 3QTXA 5KE0A 3A4OX 3TJCA 3QZIA 3ORMA 3V5QA 2WMWA 5AEPA 4BDDA 5JEBA 4DE4A 4AA0A 3R01A 3L8XA 4PTEA 5AP3A 3R7GA 4X2KA 4D28A 4BZNA 4CYJA 3DFCB 4EK4A 5CF5A 3W2QA 2VNYA 4K11A 3TYKA 2ZMDA 3QAME 4IFCA 4EJNA 4FKRA 4QMYA 3OXZA 4O96A 4YJRA 5E90A 2R0UA 3UQGA 2IF8A 1A06A 1H08A 5E91A 2UW8A 1PJKA 2IZUA 1VZOA 4AE9A 4X3FB 3MY1A 4O38A 3PXQA 1PXIA 4LQMA 4A9UA 2R3PA 5CU2A 3TMOA 4Z7GA 3ORZA 3HYHA 4FKPA 2YM3A 1H1RA 4I23A 3CR0A 2IW9A 4FJVA 4O7WA 3RAIA 5T6KA 1Q5KA 4U80A 4AW1A 2I7QA 4RX7A 3PVWA 3C0IA 3OS3A 4LL5A 2YCQA 3VF9A 4KKHA 4RVTA 3NW6A 4E4XA 3ZUTA 3V5TA 1RQQA 5DNRA 4FOCA 3F5GA 5AUTA 5HU3A 2Z02A 4DHJA 2XJ1A 4D4YA 3F66A 3OWLA 2VWIA 3VULA 1ZARA 2OXYA 2ZYBA 3C50A 1CKJA 5CNOA 2J0LA 3RCJA 3VS7A 3G6GA 2ACXA 5L8LA 3OCGA 4UV0A 1ZMUA 5FLFA 4CYIA 5BQ0A 4HVSA 5L6PA 1V0OA 4FTTA 4PPCA 4DDGA 1ATPE 1OKZA 3I7CA 1WVWA 1ERKA 2A19B 2BFYA 2RFSA 1DAWA 3F5UA 4JS8A 5EI2A 4BTJA 5HE3A 4D58A 4L53A 3EQDA 4A9YA 5BVNA 3FLYA 5JQ5A 5CX9A 3PJ3A 4LG4A 3ZU7A 2R3FA 2FSMX 4YJTA 1XWSA 2GNJA 1JAMA 3ZZEA 5HE0A 2W1ZA 5L2SA 3GU8A 4DG2E 4AACA 2VWWA 4BR3A 3CP9A 3TV6A 4RSSA 4O4EA 2QURA 2YLEA 3T9IA 4BKJA 3O51A 3DAEA 1GY3A 5BVEA 4F7NA 3KA0A 2WXVA 3CY3A 3PJ8A 2ZV2A 4FICA 3RJCA 4BDEA 3OBJA 5AUZA 5GINE 3HMMA 5AX3A 4M14A 5DE2A 2WTJA 4C33A 4WKQA 5AUXA 2V5QA 2B53A 2GQRA 1XR1A 3UIUA 5L8JA 4IBMA 2NP8A 2QOCA 3QC4A 3ZFMA 3QTIA 3R7YA 1LP4A 4O7TA 3DV3A 4XS2A 2XNBA 3D7TA 5I4NA 3JXWA 3ZEPA 3MVLA 5CANA 3FXWA 2J90A 2EB3A 2CLXA 4IVDA 2ITQA 5HE2A 2UZNA 4B4LA 3DBDA 3S3IA 3PY0A 3M1SA 4F1TA 4CQEA 2KULA 5H8BA 3BLRA 2HOGA 2H6DA 4AW0A 4F9WA 4TYIA 4XHKB 4S34A 4BVUA 2YZAA 1SVHA 5HIEA 4GYIA 4D4VA 4WHZA 5HBHA 4CG8A 4YZ9A 2X2MA 3C13A 4O7ZA 3V5JA 3ODZX 4HCUA 5EM6A 4FIFA 5CLPA 4APPA 2JKMA 2XK7A 4DEIA 3QKLA 2VTPA 4FVQA 4YR8A 4I5MA 5L4QA 4I4EA 3W16A 4MVFA 3UVRA 3O50A 4Q9SA 3Q3BA 4MH7A 5CI7A 2QCSA 1RE8A 4JMQA 2CCIA 4PMPA 1GIIA 2EB2A 2HZIA 2YISA 4FRFA 4AGWA 1L8TA 1IA9A 4RJ4A 4CMUA 4I94A 4MD8E 1WBOA 2QVSE 4KKGA 4AT4A 4DC2A 3LQ5A 3AQVA 4ZJIA 1JKKA 5JKGA 4E4LA 4AW2A 4MXZA 2PMIA 2CHLA 4USEA 2BRMA 3TIZA 2VNWA 1GNGA 2BROA 3FI4A 5CZIA 5DI1A 4LUDA 1PYEA 2GFCA 3EH9A 2VUWA 5G1XA 3IOKA 3ZDUA 5JGBA 3VS3A 4H58A 3V04A 4CLIA 2BKZA 4Q9ZA 4BJJB 3HECA 3QUDA 5ANIA 4YU2A 3KXNA 1XH9A 4M66A 4YO6A 4HVDA 4ANSA 3D94A 1NVRA 3L9NA 3NUPA 2VTHA 3MFSA 4XRJA 5E8WA 1VJYA 1JSTA 3NLBA 5J1WA 3C0HA 1W84A 5DGZA 5HHWA 2XF0A 1R0PA 3IG7A 4Y5QA 4USFA 2WAJA 2XRUA 1OUYA 4GVJA 2GTMA 4NYEA 3FDNA 3PFQA 5CY3A 4B6LA 4DINA 1PMVA 3BQCA 5HI2A 3UO4A 4TYGA 4ASEA 3IDCA 4MAOA 3QKMA 3W10A 4L67A 5IQBA 4FIEA 4CTBA 2W9ZB 3C4FA 1PHKA 1W98A 5CU0A 4E5WA 4R7HA 2OF2A 4RJ6A 5CWZA 5AAGA 1ZZ2A 3G5DA 3BHUA 3FMEA 5IISA 2VU3A 3BHVA 3KMWA 3TXOA 5M08A 4V0GB 4KUJA 3VBXA 5LVNA 3AD4A 2Y8OA 1OIRA 2REIA 3NGAA 3LFEA 3NR9A 3QQHA 5LCJA 3R2BA 3FSFA 4GCJA 2UZTA