3CGOA

Irak-4 inhibitors (part ii)- a structure based assessment of imidazo[1,2 a]pyridine binding
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
356
structure length
332
Chain Sequence
b'DNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLASFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYREHTIEEWKELIYKEVMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 10
publication title IRAK-4 inhibitors. Part II: A structure-based assessment of imidazo[1,2-a]pyridine binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 332
sequence length 356
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cgoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cgoA01
5CEMA 4FSNA 2YA9A 5FXRA 4FSYA 4QTAA 3OXZA 5E8XA 2CGVA 4MD7E 1IRKA 3C50A 4O0VA 1BKXA 4O86A 4YJRA 2WU6A 2W0JA 3FAAA 3K3JA 3EQPA 3LZBA 2XF0A 4AW5A 4OTDA 3QQJA 4JNWA 3LJ0A 5GZ8A 4GVAA 3OT8A 3PE2A 3QTZA 4JVGA 3REPA 4O38A 4AP7A 2B7AA 1Z57A 4TYGA 3SD0A 2XB7A 2XK3A 2XK6A 3ACKA 1PYEA 4AA0A 4RIXA 4C4GA 3TNIA 2WU7A 3V04A 1CM8A 3Q96A 4DH1A 4NW6A 4GSBA 4UB7A 5E7RA 4UWBA 3PSCA 4IAAA 4LFIA 3VHEA 2R3PA 5EI2A 4XUFA 5ANEA 2G15A 4QQTA 3LW0A 4IXPA 2X6EA 4BCQA 4GFGA 1PXNA 4IADA 2UZDA 2WMQA 5HTBA 4NFNA 1DI9A 3IS5A 4YZDA 5BPYA 4DT8A 5T68A 1IA8A 5AMNA 2PHKA 4IB5A 2VTLA 1XBCA 5GJGA 3RAHA 4EKKA 1REJA 3AC1A 2C6LA 2J5FA 3F3TA 4AGUA 5M4UA 4AT4A 5HHWA 3VO3A 2WQBA 4ASZA 4EH3A 3LQ3A 3ZZEA 4ZEGA 1K3AA 4DT9A 4I24A 2GNHA 3PIXA 4IAZA 4WA9A 2HAKA 5D1JA 2R0UA 3O8PA 4G34A 3AD5A 5KHXA 4ZMEA 2PPQA 3NW5A 4ONAA 4EZ7A 4ZK5A 3PE1A 1KE6A 2QO7A 3BQCA 4IFCA 3PPJA 3R71A 5I0BA 2UZTA 1UA2A 4M7IA 4HCTA 3ROYA 3ITZA 2QKRA 4LM5A 1KE7A 3ZO1A 4DTKA 4ID7A 3PWDA 3SRVA 3ZUUA 3GU5A 4X2NA 3I60A 4BDAA 2BPMA 3LXNA 2FO0A 4V01A 4RMZA 4QTEA 5JQ8A 1Q8TA 3ODYX 4FOBA 4L43A 3UC3A 4BDDA 4FKPA 3P23A 1Z9XA 2YM5A 3Q4ZA 4HCUA 2WTWA 3ZH8A 4AOTA 4BCGA 2HK5A 3FXZA 1KOAA 4CG8A 4G9CA 3QXPA 2XIZA 4O83A 3CY3A 3EFLA 4I6BA 3VUHA 4JRNA 3ZLYA 4PMTA 3ZYAA 3L9NA 3GP0A 2QOHA 4F09A 3QKKA 4RJ4A 3SXRA 4JT3A 4CTBA 5I9VA 2YCRA 2B9HA 2JBOA 2GHGA 4FV2A 4DGLC 3CQWA 3FL5A 3UZTA 1Q99A 2GHMA 4AU8A 3V5LA 2VTRA 2XNEA 4IWDA 3GCUA 3PDTA 3DBFA 3B2WA 2WQEA 4FUYA 3FI4A 1UU8A 3QTSA 3V51A 5M57A 3ZM4A 4F1TA 3DQXA 4I0SA 5EYCA 4EYJA 5C8KA 3FQEA 3P5KA 4L53A 2AC5A 2ITYA 2Y7JA 1B6CB 4WUAA 4XG2A 4XV1A 2I0YA 2J4ZA 2XIKA 4J71A 4XJ0A 1ZY4A 1K2PA 2XMYA 2YERA 3D7TA 2HIWA 3D2IA 4EOIA 3QZIA 5AP4A 4L7SA 4ACMA 4O7NA 5DRBA 5L6WL 5E1EA 4DG0E 5GZAA 4FKRA 4AX8A 3SW4A 3TIYA 3F9NA 2WFYA 4BDIA 3ZEPA 4EH4A 3ZSGA 3HA6A 1L3RE 4GG7A 3VNTA 1PXPA 4FYOA 3RPYA 4D2SA 4XV9A 2VTOA 3GGFA 3UJGA 2W1IA 4CV8A 1JKTA 3ZCLA 2J9MA 5LOHA 2J51A 1RQQA 3AQVA 4Y95A 3T3VA 1SNUA 4EOSA 3TUBA 1TQPA 5DN3A 2OF4A 3UP2A 4FV1A 2W7XA 5EDQA 3KRWA 4ZP5A 3DKGA 4LI5A 3MB7A 2QOLA 3PXFA 1YOJA 2ETMA 2UZVA 4WHZA 5CSHA 2FB8A 5HG8A 5E9EA 4YZCA 1S9JA 5CXHA 4HVHA 2C6DA 4QD6A 2IW8A 3VJOA 4CRSA 1A9UA 1WBVA 4KRDA 5A3XA 3R8UA 3F6XA 5DOSA 2ITXA 5EQPA 4DBXA 2WQMA 4BBMA 3G15A 3KFAA 5HLNA 4LOQA 4WUNA 4W4YA 4S30A 1JAMA 1VYZA 1H4LA 5JMSA 2JAMA 1HOWA 1VZOA 4R3CA 1WBTA 2CCHA 3EQBA 3EFWA 4QQ5A 3GQLA 2B54A 4ZLZA 3N9XA 2ZDUA 4PMSA 5FRIA 4GT4A 5EW9A 3NUSA 4HZRA 4QT1A 4M14A 5HX8A 4R78A 4ZTQA 3MH2A 3AC4A 4FYNA 4F6SA 3NR9A 4BBEA 4NZWB 2HZ0A 2EXEA 3QWKA 2PZIA 3OT3A 3UO6A 3V8SA 2XYNA 4GUBA 4Y5HA 4ITIA 3DK3A 2Y6OA 5AV1A 3W2CA 4J7BA 4FT0A 1UU7A 2X2LA 4IBMA 5DFPA 5IA4A 4YZMA 4ZY4A 4ZZMA 4IB1A 1ZYDA 4L3JA 1LPUA 3A7JA 4MXOA 4FT3A 2LAVA 4CMUA 3ZU7A 2RIOA 2B9FA 3HZTA 1UU9A 1XH9A 4IAKA 3OZ6A 1OIYA 2WEIA 4ITHA 4E1ZA 2V7AA 5TE0A 3UTOA 3B8QA 1QPCA 3QFVA 5CANA 4NM3A 4MWHA 2OJJA 4U7ZA 3NSZA 1WVXA 2R64A 4G1WA 1KV2A 2X8IA 4ZTNA 4BCIA 3S0OA 4A9YA 5E1SA 4O2ZA 4FVQA 1PW2A 4KIOA 2QOFA 4M69B 4OBQA 4ZZNA 3M11A 3O96A 4DFZE 3SVVA 3MY1A 1U4DA 3N51A 4GKHA 3R7YA 5IQGA 3BZ3A 4PDSA 3QYWA 3BHYA 2QU5A 2OJIA 2YISA 5CYIA 1Q97A 3F5PA 4IZAA 4QYGA 5H8GA 2B52A 1H1RA 2ZM4A 3GCVA 2J0LA 2R3IA 5EOBA 2YLFA 3KVWA 1PXOA 3QQKA 3HRCA 4YSJA 3PVWA 1Q4LA 1PRYA 4EL9A 4BDBA 3BGZA 3PVUA 2W1CA 2ZV2A 3MPAA 5ANKA 3O51A 3G9LX 4EJ7A 3UDBA 1TQIA 3TV6A 3LLTA 4O21A 3HMIA 3ALOA 5HICA 3FLNC 4IVBA 3NX8A 3TCPA 2X1NA 4NCTA 4UZHA 4EONA 5C8MA 4XP0A 4HPUE 4Z16A 4OTQA 1U54A 4AN9A 5JGDA 1J1BA 5L2SA 3UGCA 4FV7A 4J95A 4FE2A 1CSNA 3L8XA 4YSMA 1JKSA 2VO0A 3VBQA 1B39A 1KE8A 2V7OA 3CBLA 3QGWA 3R73A 3AC2A 1QL6A 3CC6A 4HYIA 4ZAUA 2OBJA 5AWMA 3HUCA 5IH5A 3QXOA 4BDCA 5CQUA 5J5SA 4F9AA 3COHA 2WTVA 3F3ZA 4OGRA 3GCQA 4XG4A 5C27A 5K9IA 4L7FA 5LWMA 3UNKA 3HA8A 1OBGA 1Q62A 4NIFB 1QPDA 4FSQA 4CQGA 4O7RA 3I81A 3VF8A 3PY3A 3BRBA 3B2TA 4A9TA 2JLDA 3VUKA 4CKIA 4AGWA 2JC6A 3NUPA 1E9HA 5M4FA 3EOCA 2H8HA 3SKCA 4FEUA 3A8XA 4AFJA 1ZAOA 3QAME 2XJ0A 4ANQA 2B53A 2UZEA 4GVJA 2OZOA 4NJDA 4TKSA 4APPA 2YCQA 4YHJA 1ZMUA 3FSFA 2R3OA 4JOAA 2YEXA 4DFNA 4K0YA 3F3UA 5JKGA 4F6WA 3NYOA 3IO7A 3DFCB 4QP1A 5ETAA 4O0TA 4GJ3A 4FTLA 3A60A 4IMYA 4J8NA 4RA4A 4R6VA 4L00A 5EQEA 3PG1A 4CFFA 2VTIA 3MH3A 4BC6A 3P1AA 4E3CA 3AGLA 5L4QA 1APME 4R7BA 2Y0AA 2RSVA 2X6DA 4BCOA 1JKKA 4DE4A 4CV9A 2XNGA 5K4JA 1PXIA 5HU9A 3MJ1A 3ZDIA 1DS5A 1YKRA 5EHYA 3R9RA 5K5NA 4U45A 4W4WA 1P14A 2VD5A 1MRUA 4RIYB 5K3YA 4EZ5A 5JRQA 3NLBA 1NT2A 4FIEA 3RZFA 4MNFA 4RT7A 3SG8A 2C1AA 3QZFA 5DT3A 4FNZA 1S9IA 1Z5MA 3KRJA 5IQDA 4WG5A 3UOLA 3EQGA 3TN8A 4DAWA 2X8EA 4MBLA 3QX4A 3T8OA 3NW7A 4L52A 4UMUA 1P4OA 4UXLA 4E4MA 1URCA 4P2KA 2JITA 1JPAA 3NPCA 4E20A 5CAOA 4EWQA 2J50A 3AG9A 1OECA 3RMFA 4C4HA 2IVTA 2QONA 4CQEA 1YWNA 3HMOA 4NU1A 5KBRA 2QOBA 3UG2A 4HVDA 2IZSA 4FV4A 4C38A 4H1JA 5HVJA 4HYUA 3EB0A 3WOWA 1ZWSA 4RG0A 3UVRA 4D1XA 4CG9A 4N57A 3CKXA 1QPEA 5LMKA 4C3PA 4DEBA 2R7BA 3W2RA 3BLRA 5HCYA 4F1MA 3BE2A 5D12A 2V55A 3QRKA 2B55A 4UMTA 5M44A 1W98A 4U80A 3BX5A 2X39A 3N4TA 2QKWB 3AC5A 5J9ZA 1E1VA 5DPVA 4PMPA 1F5QA 2VTAA 4HGSA 5A4LA 2ITQA 4ZXTA 1G8AA 4M8TA 1XWSA 5HLWA 5JRSA 1ZOGA 3PA5A 4U97A 1GIIA 1MP8A 5E8YA 3ANRA 5HBHA 5A54A 4IW0A 3FHIA 1YDTE 5HCXA 5CF5A 3CTJA 2FUMA 2ESMA 3GU8A 3KMMA 4H36A 4XH6A 1SMHA 5F1ZA 4DEIA 3ZLWA 4QMNA 4NH1A 4Y85A 4CKJA 2A4LA 3DB6A 1WBOA 3V01A 2YN8A 3TKIA 1LUFA 4XRLA 4YZBA 4WSQA 1H08A 3LHJA 2OF2A 5GZ9A 3SDJA 2HELA 4FKGA 4EOKA 1GZNA 3D5VA 1MRYA 1R1WA 2E9OA 4G31A 3D83A 2BDFA 3DZQA 4BTFA 2JIUA 2W1FA 4QRCA 2KULA 2UW0A 5AR2A 3PRFA 4D2PA 4Z7GA 4G5JA 3Q5ZA 4G17A 4OTIA 3A4OX 3BCEA 2XRUA 5C01A 4O82A 3A61A 4FKOA 1PXKA 4CCBA 3FYJX 3DAKA 2HCKA 3QWJA 5DT0A 3FKOA 1ZYJA 4HGLA 4TWNA 2ONLA 3R1SA 4IWQA 5CZHA 3I7CA 3GC9A 3OW4A 3BQRA 2QNJA 3QRTA 5DGZA 4EI4A 4YURA 2WIHA 3FKLA 4LYNA 4I4EA 3NNUA 4ALWA 4C3FA 2J90A 2GU8A 3G51A 4JDHA 2OXXA 3FV8A 4TN6A 2XUUA 4C59A 3KMWA 4QMXA 2WXVA 4A06A 2WTIA 3BHTA 4QMPA 3L9LA 5M06A 3VS4A 3CQEA 3EWHA 4I21A 4BWPA 3OG7A 3FI2A 1KOBA 5BUEA 5K4IA 1J3HA 1W84A 4PPAA 5CAPA 3U51A 4D4VA 3FLYA 5CNNA 4IWPA 1W7HA 3WBLA 2WMXA 4WIHA 4QMYA 2CGXA 2WTKB 4G9RA 1XR1A 5IDNA 3HMNA 2WGJA 3FMEA 3FL4A 2B1PA 3EN6A 3FPMA 4C7TA 3OW3A 5LWNA 3SHEA 4I0TA 4TXCA 2XBJA 5JGBA 5F4NA 3BHUA 5CEKA 1UU3A 2J0JA 4F0IA 2P55A 2VU3A 3BWFA 4E4NA 4ANBA 4GG5A 3KB7A 4CSVA 2XA4A 5HKMA 3VJNA 3C51A 4DEAA 3KGAA 4DG3E 1G3NA 3G0EA 3PYYA 4DGGA 1KE9A 4EQMA 3TM0A 4E73A 1UNLA 2QHMA 2CLQA 3ZO2A 1BL7A 1Q8ZA 3FXWA 4OTWA 2PUPA 5I3OA 1M7NA 5CQWA 4D2TA 2CLXA 2G1TA 3DLZA 4FZFB 3KQ7A 1CMKE 5M08A 3ZLXA 3DBEA 2X9EA 3TL8A 3HNGA 5LVOA 3C5UA 4C62A 4GS6A 1H01A 1DAYA 1PMEA 4ZY6A 4FKSA 3BHVA 4L9IA 4YJSA 5DIAA 5EOLA 5TR6A 3CEKA 1PJKA 2VAGA 3EN4A 4II5A 5EKOA 5I9UA 3TKHA 3QQLA 3MS9A 4C58A 5IQEA 2DQ7X 5BYZA 4FKWA 2AYPA 4F9WA 5KMJA 4CFUA 3DKFA 4FV0A 3U9NA 5HO7A 5TO8A 3UVQA 3QKLA 4PTCA 2WMWA 3D15A 1UKHA 2BRMA 3L8PA 1CTPE 4WNMA 5HIBA 4D55A 3Q6UA 3VS1A 3F61A 3O50A 2GNLA 4LRKA 4P7EA 4NKAA 2YITA 3CQUA 4YP8A 5LMAA 3KXXA 3R7VA 4A4XA 4MBJA 3MH0A 5IA1A 4YTIA 4PPCA 5FP6A 3TDWA 2HZIA 2C3KA 3BPRA 3R21A 4CT1A 4WNOA 2XK8A 4FT5A 1RE8A 2J0IA 2PE0A 1JSVA 2BIYA 2CSNA 3I6UA 4IEBA 4PV0A 1OL2A 2YFXA 3C4EA 4QMSA 1OM1A 3Q9XA 5IKWA 3EHAA 3AT2A 3W18A 2O3PA 1OIQA 3MTFA 4MXZA 4I94A 4Q9SA 2HZ4A 4YC3A 5CEPA 3EQCA 5EM5A 3ZLSA 3FY0A 4YHFA 3KRRA 1ZRZA 4AZWA 5LVMA 4HVGA 1MQ4A 3HRBA 1FMKA 4G3EA 4BI2A 5M07A 1UKIA 4FGRA 4IB3A 3V8WA 4QYHA 2VWXA 3ODZX 3CIKA 2UUEA 3OWPA 1YHWA 3GFWA 4EUUA 3MIAA 2GNGA 1ZMWA 4JX3A 3ZC5A 4EHZA 4USFA 1B38A 3FE3A 4C8BA 4XHKB 2OW3A 2XIYA 3MTLA 3C4ZA 3CJGA 4EC9A 4ENYA 2QD9A 4PF4A 5EYDA 3AMBA 2PVFA 4I5MA 5KCVA 5EHOA 2J2IB 3FZTA 5FM3A 4O6LA 2QG7A 1OITA 4TWOA 1XBBA 1WAKA 1YQJA 4HYHA 5ICPA 3II5A 4IC8A 3TXOA 3QCYA 3UP7A 1NVQA 3C4WA 3I5NA 3UIMA 4C4JA 4NW5A 5EW3A 4MNEA 4K2RA 3LM0A 5EI8A 4XV2A 3CSVA 3HV5A 3R9DA 3ORMA 4I23A 3RNYA 1LR4A 3CS9A 2C6TA 3VBYA 5JK3A 4IM0A 5M56A 4FTTA 5FTGA 4FTIA 3UIUA 1YOMA 4FBXA 5FBNC 3N4UA 2CCIA 5J7BA 2HW7A 4QMWA 3U4UA 4CMOA 2CPKE 3WZEA 2XCHA 4LMNA 5IUGA 2E9UA 3OF0A 3V5JA 4KAOA 3G90X 1H1WA 4YTFA 3RM7A 3SX9A 1Y8YA 3DDQA 3TG1A 3D94A 3HL7A 4ARKA 3QCQA 4FIIA 3ZFXA 5A6NA 2IZRA 3Q4TA 4KIPA 3TZ9A 4BKJA 4OW8A 4DFBA 5DBXA 2XP2A 3DTWA 1YRPA 4RIWB 4U41A 4M97A 4C36A 3F7WA 4S33A 3QQGA 1X8BA 2XNPA 3DOGA 1U46A 3VRZA 1OKVA 3FUPA 3VAPA 2C6KA 3THBA 4AOIA 4EK4A 2OLCA 2ZV8A 5F94A 4X2GA 3ZTXA 2CKOA 5GINE 1M2QA 5JT2A 3TV4A 4FEVA 4G5PA 4X7QA 5BYYA 3QALE 3SXSA 4GFMA 5A4QA 4JS8A 3HAMA 1XO2B 2A0CX 1K9AA 3KULB 3A4PA 3NAYA 3M2WA 2F7ZE 4QP4A 4IX3A 2IN6A 3VVHA 4AS0A 4TL0A 5CX9A 4UBAA 3RALA 3KXNA 3O23A 5AX3A 1JOWB 3KREA 1Q8WA 4QMQA 5IZFA 4EH5A 3GCPA 5FTOA 4JDKA 3LXLA 4A4LA 4Q9ZA 2QR8A 2VTJA 2Y4PA 2R3MA 4EEVA 5C03A 3ENHA 1OKZA 3LIJA 3KF7A 3DAEA 3POOA 5J87A 2GNJA 3G2FA 4XS2A 4JBPA 4Y8DA 5GIPE 5FEQA 4RQVA 3ZBXA 1FQ1B 4D1ZA 5L6PA 2GTNA 4RFZA 4A4OA 4EZ3A 4K77A 1PXMA 3IQ7A 4WO5A 2O0UA 4FV8A 4DCAA 4QPMA 3QZHA 5JH6A 4NSTA 4I4FA 4F7LA 3QC4A 4QMMA 4CMTA 2VX1A 5DNRA 2PMIA 2QU6A 5CSVA 5D7AA 3GUBA 4M3QA 2EU9A 5KMOA 4CKRA 3C1XA 5DG5A 5G6VA 3W8LA 3C7QA 1O9UA 4OTFA 5AAFA 2R3GA 4AW2A 3Q4UA 4RC3A 2QQ7A 2E9PA 5AR5A 3UVPA 4L42A 3HV6A 1VR2A 2O8YA 4AA4A 1IAJA 4PMMA 2O5KA 4BFMA 3QL8A 3PZHA 3WIKA 5FM2A 3LJ2A 5HE3A 1ERKA 5CWZA 2UV2A 3DKCA 4KS8A 3U87A 4DEHA 1BL6A 3JXWA 4CZUA 4R1VA 1JKLA 4X6RA 2OG8A 4FG8A 1BYGA 5EI6A 2IG7A 2GFCA 4C33A 2BFXA 3QQUA 4GUEA 2RG6A 3NW6A 5C26A 4ZTMA 5FG8A 1PXLA 3PP0A 3I79A 5BMSA 3DCVA 4AOJA 3JVRA 4FTOA 1T46A 3E8NA 5I4NA 3QGYA 5CT0A 4DF3A 1GZKA 3D9VA 5IA3A 4B6LA 3C5IA 5HE0A 4TW9A 5L8JA 3R28A 4C4FA 4C61A 4ZMFA 2UVYA 4BDKA 4FL3A 4DGNA 2XS0A 1FGKA 3MIYA 4M69A 4U3ZA 3ATTA 4XLVA 5HBJA 3ROCA 4FTNA 3D5WA 2CGWA 2YM3A 2ZJWA 4MQ1A 3UODA 1YDSE 2BZJA 1UNHA 1NVSA 3MPMA 4MXCA 3WILA 4BIBA 3HMMA 2W9ZB 4O0RA 2OIBA 1KSWA 2I0EA 2W1GA 3Q4CA 4G16A 5CU4A 2R7IA 4JAIA 4ZJIA 4QP7A 5C9CA 4FKTA 3PXZA 3TV7A 2YM7A 3GU7A 4H05A 4D2WA 3D14A 5CI7A 4QNAA 1YXXA 2PSQA 2EUFB 4XRJA 2I40A 4FZ6A 4D0WA 4LG4A 5HBEA 3TWJA 3QQFA 3COIA 4CD0A 2OK1A 4U9AA 3FWQA 1Q24A 3ZO4A 4DITA 2WMAA 5D10A 5CVFA 4QQCA 4WNPA 1T45A 2P33A 5AP1A 3U55A 5IEYA 4DFYA 2ZM3A 2X81A 3EN5A 5ETFA 3IOKA 5JQ5A 1KUTA 2O65A 4I5HA 5FQDC 3NUXA 4AN2A 5IH6A 4G3FA 3C9WA 3L8SA 1ZARA 2JDOA 5AA9A 4A9UA 2G9XA 4NT4A 4AT5A 4F1OA 3EQHA 2PZRA 4BDFA 4RWIA 3RJCA 4AN3A 2I0HA 2WMBA 3MYGA 4HNFA 2YM8A 1M2RA 4ERKA 1DAWA 2NPQA 4LRMA 1R0PA 1XKKA 3FC1X 4NIFA 2CJMA 1PKGA 5F20A 4M12A 4E4XA 5I9WA 3UQCA 4WNKA 3DPKA 5HTIA 2FVDA 4MXAA 2C5YA 3E3BX 5KMMA 4FR4A 2C3JA 2JAVA 4G6OA 4I6QA 5DWRA 3VRYA 3AOXA 5EW8A 5CU0A 5KBQA 4K18A 1J7UA 2W1EA 3DU8A 4LUEA 3MFSA 2YABA 2PVRA 3PSDA 2QCSA 5HG7A 3TT0A 3LFAA 2HENA 4B4LA 3E87A 3R30A 4YUQA 1ZOHA 4I6HA 4E5AX 2WKMA 2VWUA 3HUBA 1OPKA 1SZMA 3LOKA 3UOHA 4ZSEA 4BCMA 3O71A 4WBBB 5KO1A 5EG3A 2VWWA 1YVJA 5LVNA 3P78A 2BDJA 2W1DA 2Z7LA 3D2KA 3HVCA 4RJ7A 4X0MA 5GJDA 2QC6A 1XHAA 5AUZA 3BYVA 3MPTA 2WNTA 2IJMA 2ZMDA 5M4CA 2VNYA 5IA0A 4V0GB 4M84A 3LFFA 5L2IA 3EN7A 4IC7A 5JZNA 3SA0A 3RK7A 4RIYA 4EK3A 1V0OA 4XG3A 2JDRA 4ZS0A 4U8ZA 4CFNA 3CD3A 2W1HA 3NS9A 4N70A 2QOIA 3T9TA 5EKNA 3G9NA 3E63A 4MQ2A 4O7TA 3MFRA 4LMUA 2R5TA 4O2PA 3GCSA 3VQHA 2ITUA 5LXMA 4YPDA 5ANDA 3S1HA 2R9SA 3QTWA 3COKA 2JEDA 4PUZA 1NW1A 4FVRA 3POZA 4W9XA 4WG4A 2F2CB 2W9FB 4PDOA 2WOTA 3D5XA 3LFCA 1E1XA 3OWLA 4IIRA 4NJ3A 4IJ9A 1BI7A 1QPJA 3IW5A 2DYLA 2WTKC 2XKDA 3AXWA 4IACA 4IVDA 3ULIA 4OAUC 3I7BA 4NK9A 3SOCA 3E64A 3SQQA 3VS0A 5JFWA 3WZUA 3R8ZA 2JDVA 1BMKA 4GEOA 3O8UA 4H3QA 4O7LA 4RWKA 3EZRA 4QP3A 1REKA 3R1QA 2V0DA 1FVTA 4YBJA 4QNYA 3S4QA 4DH5A 3FDNA 3I0OA 5J7HA 3CY2A 4CLIA 1GZ8A 2W5BA 4FV9A 3FSKA 3HECA 3R22A 4IQ6A 5AUWA 2GQSA 3BBWA 2JFLA 1FVRA 4EH8A 4Y83A 2J0MB 2WMUA 3MN3A 3CPBA 5BX0A 4IX6A 2CGUA 1KE5A 2C0TA 2P2HA 3OMVA 1Y91A 2W99B 4KD1A 4EUTA 4MH7A 2PZ5A 4F99A 5KKRC 2QLQA 4TYHB 2Y6MA 4LGHA 4RX9A 4ZTLA 3WZJA 4FICA 4UYNA 5KUPA 3W33A 4YO6A 4N0SA 5IMXA 3ALNA 4IAIA 4GK3A 4QOXA 4LQMA 1P5EA 3FZSA 4O7YA 3F2RA 2HXLA 2F7XE 5IUIA 5B2MA 4AA5A 4RFMA 2A19B 1NVRA 2CKEA 3LCKA 1AGWA 2GHLA 2X4ZA 5AAEA 1L8TA 2JKKA 4EJNA 2EB3A 1VJYA 3FPQA 4RX8A 3V8TA 4D9UA 3MVJA 4O7ZA 5HEZA 1JNKA 2ITNA 2BRBA 2JKOA 3O7LD 1UWHA 3GQIA 3W2SA 2AC3A 3CJFA 4WD5A 3W16A 3DLSA 3QYZA 2YZLA 4NYEA 3LE6A 3FC2A 5M4IA 3KVXA 1Q8YA 2B9IA 5E8TA 4RBLA 4X2KA 4NTSA 2YAAA 4UWYA 3EQFA 5C4KA 2ZYBA 3CTHA 5ANJA 4IVAA 2XYUA 2G2FA 3QRJA 4PL4A 2WMRA 3IW8A 3LJ1A 3LFBA 5IA5A 3MB6A 3SLSA 3PJ3A 3QUEA 2YAKA 1M2PA 4M68A 2HXQA 4JDJA 3OS3A 4CTCA 4D28A 3LFEA 5AFVA 3P4KA 4F6UA 4U44A 1J7IA 2RFEA 4D5HA 3VUGA 3E7OA 5IEXA 2IZTA 3UQGA 1LEWA 1XH7A 3HMPA 3LFQA 3PJCA 3MSSA 4GIIA 4MVFA 4RGJA 3BYUA 5CENA 5HU3A 4UY9A 4JIKA 4A07A 4A7CA 3FZ1A 4MXXA 3ZUVA 4CZTA 4DH3A 4DTBA 3AMYA 2QURA 2DS1A 3GB2A 2ZOQA 1ZZLA 5KMNA 5M09A 3A7IA 3QTUA 2G2IA 2I0VA 2RL5A 5FP5A 3ZXZA 3CCNA 4NUSA 1GNGA 1OBDA 3R01A 1ZY5A 1W0XC 3JYAA 4FKLA 4TYHA 2UW4A 4I22A 2W96B 3VW6A 4AGDA 2J6MA 5L3AA 4IHPA 3PWYA 4YNEA 4EH2A 3ORZA 1P2AA 2WMTA 5D7VA 1VEBA 4AACA 1Y6AA 3TIZA 4EOQA 4K8AA 2HW6A 2OO8X 3BI6A 3SRVB 4AT3A 2CNQA 2RFSA 3RK9A 2WMSA 2EVAA 4HGEA 3NRMA 1FGIA 4FK3A 4QYEA 3QRIA 4KKGA 3Q9ZA 3R7GA 3SW7A 2JIIA 1W83A 4FODA 4IJPA 4G2FA 3DJ6A 3MA3A 2GCDA 2PY3A 5CF8A 2P0CA 3CKWA 3GOPA 3Q5IA 4MBIA 4FC0A 5CU2A 4ANLA 4LV5A 3UOJA 2RFNA 3OCBA 4RLKA 5HNGA 3GU6A 3ZSHA 3HP2A 4GV1A 5TF9A 4EH6A 3RINA 2IPXA 3ELJA 4O0SA 3GBZA 3OY1A 3MGYA 4BHZA 3KCKA 3QD4A 3EKNA 1OPLA 3PY1A 4MXYA 5KX8A 1JSTA 1LP4A 2XK4A 3GVUA 3K3IA 3TTIA 5FEEA 4MKCA 1UVRA 4UMQA 4RX5A 2PVNA 2X2MA 3MY0A 3LMGA 3UPXA 3V5QA 1VYWA 4GT5A 4NWMA 2I7QA 4KINA 4QP9A 1JQHA 4FKQA 3EYHA 3FZPA 4ANSA 3WYYA 5J8IA 2PYWA 2ITTA 3UO4A 4FTRA 4BR3A 3V5WA 1IASA 4IZ5A 4RRVA 2F9GA 4U79A 5E8UA 3IGGA 4EWHA 5C8NA 4WOVA 4R3PA 3R8PA 5GHVA 3BYSA 3EIDA 3MVMA 4IANA 3D7TB 2PVLA 4CGAA 3DB8A 3PA4A 4EORA 3S00A 3V6SA 3MW1A 5HIDA 4G3GA 3QKMA 3CD8A 4F9BA 3VS5A 5JFXA 2C30A 2GS6A 4DFXE 4PPBA 3ZONA 2BHHA 4ANMA 3KRXA 4BCKA 3PJ8A 5HD4A 4FZ7A 4QP2A 4TYEA 2V62A 2XJ2A 4TZRA 5CTPA 5EM6A 5AUXA 4J96A 3SAYA 3PXKA 2XH5A 5AIRA 5DLSA 3VQUA 1DM2A 1FPUA 3QA8A 1NXKA 2UZUE 4X3FB 5H8BA 2CNVA 2QHNA 3AD4A 3MI9A 1OIRA 2YM6A 4JBQA 2O2UA 3NUYA 4XX9A 3RK5A 2VTMA 2XEZA 5HIEA 1H0WA 3FI8A 5F95A 3F2AA 1OB3A 4IVCA 2OI4X 3JY0A 4WG3A 4XCUA 3LQ5A 3OP5A 2VWIA 4ZTSA 4D2RA 1Q61A 4FIHA 4D2VA 1SVGA 5DE2A 3R83A 1BLXA 4F0FA 3RWQA 3TNQB 2XVDA 4F65A 4UMRA 1GZOA 4EOPA 4XG9A 4W9WA 3HYHA 1TKIA 2OZAA 3ZZWA 5B0XA 5HE1A 2P3GX 5HX6A 3BEAA 5CU6A 3LMIA 1ZYLA 4KIKA 4QMUA 5A4EA 5DRDA 2VWVA 4M67A 3RKBA 4BZOA 3ZM9A 4E26A 3K2LA 5J1VA 2YIXA 3GENA 3QCXA 4EOLA 2NRYA 2C5NA 4NKSA 3F88A 3KXMA 4G3CA 2WELA 4PX6A 2UW6A 3ZO3A 4RX7A 4K9YA 4TWPA 5HI2A 4ZS4A 2VZ6A 1UV5A 4USEA 2BMCA 4ALUA 2QVSE 5M55A 4LGGA 2CNUA 4RVKA 2FSMX 3PP1A 4MTAA 2C6IA 2BROA 2BAKA 2FSLX 4U5JA 2XZSA 3R7UA 3ZC6A 1J1CA 3RAKA 2OWBA 3H9OA 4ZJJA 5CALA 2Y4IB 4P5QA 2LGCA 3KK8A 3Q32A 5DA3A 4YLKA 2VUWA 2ITZA 4RIWA 4P4CA 5HO8A 2UVXA 4IX5A 4KABA 4YU2A 1WCCA 4E6CA 5DR9A 1YXUA 4TWCA 3M42A 4K33A 2EWAA 4ACGA 2HOGA 4LL0A 4M0ZA 4CZYB 2JD5A 4OTHA 4IAFA 1SNXA 3QC9A 4L68A 5AR4A 3W8QA 4EQUA 3LVPA 2HY0A 3MY5A 3EQRA 3ANQA 3GI3A 3ORLA 3VULA 2PVYA 1WBWA 4BYIA 5CAQA 5I9ZA 4JL9A 5L2WA 4YJQA 4U81A 3UO5A 4X6QC 3A62A 3NAXA 5AUUA 4BCJA 3MFTA 4DYMA 3CTQA 4I93A 4BI1A 3FI3A 5CEQA 4DFUA 5L2TA 1WFCA 2YDJA 4AF3A 4I3ZA 2PZPA 4PL5A 4EK6A 2W1ZA 4XG7A 4FIGA 4WRGA 5EDRA 2VRXA 2OFVA 1YXTA 4YJUA 3HEGA 2V22A 3NCZA 1Q41A 1R3CA 2OIQA 4MWIA 1YXVA 3FZOA 2CDZA 4DINA 4EHGA 4YTCA 4PTEA 2C5VA 2Z7QA 5HTCA 4UX9A 1U54B 5H9BA 4C35A 4CVAA 3H0YA 2PVJA 2EB2A 3DNDA 3KK9A 4QMOA 5KKRB 2R3JA 4KSQA 4HJOA 4KS7A 3GC8A 1EH4A 4MCVA 4AUAA 1UWJA 3QBNA 4P90A 5DMZA 3H9RA 4BI0A 3O0GA 3ULZA 3UZPA 3CE3A 4RFYA 2YIYA 4G3DA 4KWPA 3A7FA 5BVEA 3QTQA 4O6EA 2BR1A 3VW8A 1BUHA 2OJGA 4B7TA 2UZOA 3KC3A 5AP5A 4MYGA 4JX7A 4Q2AA 4J98A 3GEQA 4X2JA 4BN1A 3P0MA 1Y6BA 4W4VA 3TZMA 2BKKA 1IG1A 4O0YA 2P4IA 3W2OA 3H10A 3I0QA 3FEGA 4CEGA 5GIOE 1QMZA 1R39A 2PVHA 4B8MA 3AT4A 3E92A 4TPTA 1WVWA 3P08A 4MF0A 4CYIA 2VV9A 1IA9A 5AX9A 2OXDA 4YLLA 1WZYA 4F4PA 5FWKK 3WYXA 4OTRA 5KMIA 4IE9A 5K5XA 4F9CA 2GTMA 3DS6A 3TKUA 5CXZA 5C4LA 5EYMA 2J0KA 2J7TA 4MF1A 4EH7A 2QR7A 2Z7RA 3BELA 5DEYA 4EQCA 1SM2A 3PUPA 5I9XA 4AG8A 2VTPA 2UZBA 2GNIA 3IOPA 4J52A 4XBRA 5LARA 3RPSA 4ZSGA 4DEEA 4ZZOA 4FSUA 5IPJA 4LOOA 2XK7A 4DC2A 1KV1A 3DBCA 4U0IA 3U8WA 3FLQA 3OUKA 4E4LA 3C0HA 3DXQA 1JVPP 2C4GA 2R3FA 2BFYA 1OGUA 4O91A 5DH3A 4C4EA 2CKPA 4DGMA 4GFOA 3ORPA 3V5PA 1ZLTA 2JFMA 2HZNA 3PTGA 3Q53A 3W2QA 5J9YA 3PXYA 5LMBA 3IK3A 3WF8A 3EL7A 3EFJA 4GK4A 4GYGA 4XYFA 2OXYA 5DYJA 4BTMA 2R3RA 4B0GA 4H39A 2C68A 3I4BA 3FMNA 3OOMA 4GK2A 4TY1A 3UBDA 1A48A 3LXPA 4W8EA 2QOOA 2YCSA 3PSBA 2ZDTA 3ATSA 3KRLA 3OCGA 3UOKA 4RVMA 2HYYA 3ZMMA 4CFVA 4EK5A 2BIKB 5CSXA 5BVKA 3Q9WA 4HZSA 4I6FA 3UMWA 4LUDA 3K5UA 4NTTA 5CAUA 3IPHA 4JLCA 4KBAA 1M17A 3DJ5A 3H9FA 3QZGA 2A2AA 4HVSA 3WE4A 4KB8A 4BVUA 3FY2A 3SC1A 2WIPA 3C4FA 2OICA 4FTJA 2PULA 3UG1A 3IW6A 3DDPA 3DK7A 4AGCA 4DGOA 1ZMVA 2RKUA 3RP9A 4S32A 2VWYA 2Z60A 4JR3A 5IQCA 4NM7A 3MWUA 5CVGA 5HCZA 5AA8A 3QRUA 4GU6A 4O27B 2I1MA 4QYYA 3WI6A 4IM3A 2BRNA 2R2PA 2W4KA 1URWA 2RG5A 4D5KA 4Y5QA 4OTPA 4XOYA 1QCFA 4KKEA 4Z3VA 2ITOA 3UQFA 3AC8A 1F3MC 2VTQA 3FMHA 4H58A 5A14A 4QO9A 3QF9A 3ETAA 4L6QA 2Q0NA 2UZNA 4UMPA 5DEWA 2O64A 3E8CA 4WBOA 5EYKA 5CU3A 3DK6A 4FUXA 3K54A 4ORKA 3UZRA 4ZSJA 4FKJA 3FLZA 4R8QA 5AV2A 2PUNA 1PMNA 4GL9A 4ENXA 4M15A 3DQWA 5CEIA 3ZDUA 4C2WA 4I1ZA 3OWKA 4GH2A 2R0IA 3D0EA 2XK9A 4ZOGA 3L1SA 4L44A 5CF6A 4L01A 1GAGA 4R3RA 1XJDA 3QHRA 5KZ0A 2JDTA 2PUUA 1XH6A 3OXIA 2GFSA 3F69A 4TYIA 3QA0A 5IG1A 2ZB0A 3GNIB 3W10A 3GT8A 4JRVA 4YMJA 4MD8E 3NWWA 5H2UA 4YZNA 3R8MA 2E2BA 4HOKA 2YJSA 2ZMCA 3FKNA 5BQ0A 3BV3A 4KA3A 4YHTA 2PE2A 2Z8CA 4FV3A 4EHEA 2B0QA 4FSMA 1H1PA 4F7SA 2WHBA 2A1AB 4N4SA 3TTJA 4BZNA 2PMLX 3ZHPC 1PMVA 1KWPA 3LPBA 4FG7A 4USDA 4XEYA 4PP7A 4O7SA 3HRFA 4M66A 2PMNX 3HV3A 2CN8A 5GNKA 5BMMA 2UZWE 1IAHA 2YDIA 3RCDA 3QHWA 3BKBA 3R2BA 5DHJA 4EBVA 3RGFA 3PA3A 3IONA 3LFNA 3LLAA 5BYLA 5M51A 3C4CA 2UW8A 4U3YA 4YC6A 2IW9A 3CGFA 3QD2B 3BIZA 3R1YA 1U5QA 5JN2A 4YC8A 3R9OA 1OVEA 2XM9A 2JIVA 3LQ8A 3SV0A 3WIGA 5CAVA 5B2LA 2GQRA 4QPAA 3KL8A 2PTKA 5HD7A 3G0FA 2QO2A 3R1NA 3SG9A 3AD6A 4JG6A 2I6LA 4FT9A 3SXFA 3C13A 3E88A 4GCJA 4MAOA 5FLFA 4FG9A 4D1SA 3EMGA 4JG7A 4BCNA 3LMHA 4BYJA 5IQFA 2IVVA 1PHKA 2C47A 4O0WA 4FV5A 1G8SA 3PZEA 2C3IB 4BKZA 2WPAA 3NYNA 2X7GA 2PMOX 1Q3DA 5G1XA 4O1OA 3EH9A 4FNWA 4RLLA 3F66A 3GFEA 4H3PA 5AP2A 3G6HA 4AZSA 4ACCA 2F2UA 1WMKA 2F7EE 3BGQA 3WF7A 2XJ1A 2HY81 1Q8UA 3EJ1A 3PVGA 2XIRA 4YBKA 1Q5KA 4K11A 4R7IA 4GJ2A 4IWOA 3R00A 4ZTRA 1IEPA 5AR8A 1YI6A 2YACA 4LRJA 5IUHA 5HVYA 4CFWA 4I41A 3OUNB 3Q9YA 4ZLYA 2FSTX 2R4BA 3FMMA 1IR3A 4J1RA 5JFSA 3R8VA 2BTRA 4H3BA 3VBWA 3ZS5A 4BTJA 2JKMA 3QX2A 2GS7A 3FBVA 1I09A 5B2KA 5BUJA 3BV2A 4RIOA 2QO9A 3RAWA 3VHKA 3L8VA 2VGPA 1STCE 3RAIA 2PUIA 1OL7A 5DR6A 4O81A 3FMJA 4XP2A 3QTRA 4PNIA 1WBNA 1H00A 5BVDA 5C1QB 4NM5A 2OH4A 3HV7A 3A7GA 4MX9A 4UXQA 4JDIA 4Y46A 2FA2A 2C0OA 1G5SA 3WARA 2BZIB 1MUOA 2C5OA 3R63A 3WE8A 5CEOA 5IU2A 4Q5EA 3TNWA 3UIBA 3KKVA 3E3PA 5FUTA 1OMWA 1BI8A 3UPZA 2OSCA 4ZIMA 4O1PA 3NNXA 4OUCA 4BRXA 3V5TA 4X3FC 3W2PA 1YI4A 2E9NA 4RJ3A 4CRLA 2RF9A 1CDKA 1UNGA 3A8WA 1DI8A 3R7EA 4FL2A 5E8WA 4BCPA 4OR5A 3HLLA 4YJVA 1I44A 1GIHA 2ZB1A 3LXKA 2IVUA 3AC3A 2IVSA 3DZOA 3RPVA 3F5XA 4DH7A 2BALA 2BKZA 4EOMA 4XV3A 5AIKA 5L8KA 3FJQE 4MNEB 3U6HA 2DUVA 3UYSA 4C34A 4DEGA 4J53A 2WO6A 3H4JA 1RDQE 3U9CA 5IQHA 1FINA 5LQFA 4H1MA 1CKPA 4MK0A 2OU7A 2BZHB 3QD3A 2JDSA 3HGKA 3LCOA 1ZXEA 4I5CA 4PDYA 4BDHA 4J8MA 2BUJA 3KXZA 2VTTA 2VWBA 3C0IA 5ETCA 2BHEA 1JLUE 4MEDA 2NO3A 1OZ1A 3BE9A 4JXFA 3VBVA 3PY0A 3MDYA 2IW6A 5HE2A 3I6WA 3VUDA 3RBWA 3NDMA 2RGPA 3NGAA 5CVHA 5LVPA 3KN6A 1YW2A 3OROA 2W4OA 4X21A 2F49A 3FYKX 3S3IA 1CKIA 5M53A 2X7FA 5L2QA 5L6OA 4BIEA 5JGAA 2GDOA 2Y4IC 3FLWA 3ORKA 3MV5A 3MH1A 5HESA 5HNBA 2CKQA 4O84A 3OWJA 1V0PA 4M13A 3EKKA 3TJDA 2WD1A 2J5EA 5D41A 2C69A 2FGIA 5BVWA 2JBPA 2PE1A 4CXAA 3A7HA 4OT6A 3RHKA 4KUJA 4C2VA 3OD6X 4HW7A 2F4JA 3DBQA 3V3VA 4KBCA 3H30A 3NMUF 4ACDA 3GXLA 3KY2A 1ZYCA 3E93A 3PXRA 1YI3A 2ERKA 2JGZA 3R0TA 4LGDA 4ASEA 1OL1A 2PK9A 4QYFA 4N6YA 4D0XA 3U6JA 3TZ7A 4X3FA 5LCJA 2OJFE 4UZDA 3HDMA 3HP5A 4ERWA 3Q3BA 5AUYA 2VGOA 4AFEA 3RZBA 2R3KA 3VN9A 5IH4A 3JVSA 3QTIA 3T9IA 4HVIA 3QQHA 2UW9A 3QUPA 3LCTA 1F0QA 2CN5A 2VO7A 2W06A 4Q5HA 2NRUA 4RSSA 3DAJA 3TJCA 3N4VA 5FGKA 1CKJA 4EYMA 1R78A 4S31A 4I92A 4DN5A 4O22A 5EDPA 3RI1A 2PWLA 3CGOA 4NCTC 3OTVA 4DFLA 3EFKA 3DKOA 4R1YA 3PLAE 2GPHA 3K5VA 3OEFX 3CPCA 1FMOE 4FTKA 3JY9A 4RWLA 1ND4A 2AUHA 2X2KA 2QOKA 5AAGA 5JSMA 4YLJA 4FX3A 4J97A 4MD9E 2ZV9A 4FSRA 3GU4A 2WQOA 5AP6A 4W8DA 5EH0A 3R8LA 1GIJA 3I5ZA 3DA6A 4B9DA 4IX4A 3R9HA 4GKIA 5ITAA 5AM7A 3KMUA 5EFQA 3SGCA 2Q83A 4C57A 4V05A 2YM4A 4DLIA 3RM6A 4RIXB 4BF2A 4CNHA 5BUIA 3W1FA 4EK8A 3KXGA 4TT7A 3R7OA 2R3HA 3S95A 4IDVA 3MVLA 4L3PA 1YOLA 4KIQA 1WBSA 1XH4A 3T3UA 2W4JA 4FSZA 1W82A 2XNMA 3MA6A 1XH5A 2HWOA 4TNBA 2PVMA 4QTBA 5DI1A 5CNOA 2WZJA 4YNOA 4XLIA 5FXQA 5T3QA 5E8SA 2OFUA 2PU8A 3GC7A 2HWPA 5IDPA 2DWBA 5KE0A 5J95A 4FEQA 4WT6A 4BTKA 2FYSA 4Y72A 1H07A 2YCFA 3P79A 5IA2A 3VBXA 4BCHA 5AADA 3HX4A 4DCEA 4F9YA 1P4FA 1FBNA 4APCA 5K0KA 2XKCA 3S2PA 3LFSA 2ZVAA 2NP8A 4FOCA 5H8EA 4X3JA 3CXWA 3RWPA 3P9JA 4GW8A 4QMLA 3FMDA 3JS2A 5I5ZA 5LVLA 2C5XA 4FNXA 2EXMA 5CT7A 2VWZA 3W55A 3VC4A 3D7ZA 5IQBA 4U6RA 4HNIA 1GY3A 1BX6A 1TQMA 1W8CA 3G33A 3Q04A 4FTMA 2ETRA 5JFVA 3QTXA 2ETKA 3PLSA 4AE9A 5DR2A 5HLPA 4DHFA 4QMZA 4DBNA 4DA5A 1HCLA 4BDEA 2XNNA 1H26A 3ACJA 4FSTA 3VUTA 2X4FA 1J91A 4F7NA 4OBPA 4XG8A 5FEDA 3UC4A 5LMKC 4I20A 2NNWB 4QTDA 3U4WA 4RC4A 2BRGA 2W5HA 5FXSA 5AR3A 4HGTA 3NIZA 4IM2A 4EKLA 1FVVA 2WB8A 5CF4A 3ORNA 3P7BA 2WTJA 1OUYA 5AM6A 4C37A 2V5QA 2Q0BA 5HG9A 4GRBA 5LCKA 4LL5A 1PKDA 2W05A 2REIA 4YZ9A 2OJ9A 2G01A 3FQSA 3P86A 5HNIX 5AEPA 3KN5A 2GQGA 2UW7A 3LFDA 2UZLA 2Z2WA 3GOKA 3JR1A 1PY5A 4JAJA 2YLEA 4OBOA 4BWXA 2BDWA 4NL0A 3ORIA 4KBKA 4E6AA 3QLFA 4HYSA 4F64A 4FL1A 4YO4A 4BGHA 3NUNA 3ORTA 3DV3A 5ANOA 4AQCA 2KTYA 4ZSAA 3L9PA 5IQIA 3TNHA 2XCKA 4OLIA 4JBOA 1OL5A 3RTPA 2A27A 2C0IA 5JEBA 3E8EA 3IDCA 3OHTA 4YGAA 3MJ2A 2YDKA 4MHAA 4TNDA 5AV4A 3NCGA 3NNVA 3RCJA 3FHRA 2YWPA 2BTSA 4F70A 3EL8A 4L67A 5E8VA 5FTQA 5EM8A 3PJ2A 2ONLC 3Q52A 1M14A 3LAUA 5CASA 1R0EA 2BAJA 4UV0A 5J1WA 2C6MA 4I0RA 3A99A 3PJ1A 4C02A 4ANOA 2VO3A 3BU5A 4ASDA 4L3LA 4BCFA 4BDJA 1V1KA 2OKRA 3I1AA 4E5BA 4FK6A 4TYJA 4FTCA 2BZKB 4PP9A 4Z9LA 2B9JA 5EM7A 4FGBA 5AV0A 3IDPA 5D11A 4UWCA 3C0GA 5FD2A 4U42A 3UIXA 4DG2E 2VX3A 3WF6A 4JI9A 4BICA 3TZ8A 3PPZA 3RPRA 2Z7SA 4JQEA 3VS3A 4OTGA 2ITWA 1U5RA 1SVEA 5E8ZA 2H6DA 5IQAA 4FZDB 4WKQA 5K0XA 2C6EA 4AXAA 3M1SA 4CCUA 5FDPA 3IGOA 4C3RA 3EYGA 4EBWA 2ERZE 1OIUA 4XNEA 3OTUA 3ERKA 3ZRKA 2Y9QA 4V04A 5IMEA 1OI9A 3O8TA 4FEWA 1OPJA 1H1SA 4GIHA 4FT7A 4TTHB 1RW8A 4ZTHA 1WVYA 2ZV7A 3QU0A 4D4SA 4IZ7A 3TDVA 2B4SB 1GOLA 3D4QA 4FIFA 5KNJA 4C4IA 3PXQA 4FVPA 2WTDA 2EXCX 2IZUA 3LCSA 4Z7HA 4HPTE 5BVNA 3QCSA 3KEXA 4AWIA 5TOZA 3DTCA 4QP8A 4BGGA 4C0TA 3LKMA 2W17A 3OY3A 4YJOA 4IDTA 4IZYA 5HO6A 4A9RA 3G5DA 1MQBA 2QODA 4F63A 2PZYA 2W5AA 3KF4A 2VN9A 4KKHA 5AV3A 5J9LA 2G2HA 4FTQA 3SOAA 5ANIA 3BWJA 3PG3A 5H3QA 3PRIA 3OBJA 3GC0A 4D58A 1YHSA 2X0GA 1H0VA 3CR0A 5AP0A 4F08A 5CSPA 4DH8A 4IAYA 5HVKA 3P7CA 4S2ZA 4ALVA 3F82A 3PPKA 4UN0C 4FKUA 4P5ZA 4BBFA 3ZRLA 4EC8A 2UW3A 1Y57A 4PWNA 2BILB 4UEUA 4IFGA 3ZFMA 1YDRE 1H24A 3F5GA 4FKIA 4IB0A 1GJOA 4YR8A 4OAVB 5EQYA 3VF9A 3RNIA 3IW7A 3KULA 1M7QA 4D9TA 2YZAA 4J99A 4BGQA 1YWVA 1OL6A 4L8MA 3UNZA 3A2CA 3WZDA 4XP3A 4RZWA 4AE6A 4UALA 2WEVA 3DNEA 5DVRA 5CI6A 4N6ZA 3MFUA 4TRLA 4ZLOA 3TI1A 4CYJA 2XBAA 3H0ZA 3OEZA 3W32A 4ZSLA 1JBPE 4BDGA 4FEXA 1FOTA 4O96A 4QQJA 4BL1A 2WQNA 4QMVA 4FA2A 4O7VA 4RJ5A 1XBAA 5AUVA 3HDNA 4R5SA 4R5YA 2QOCA 3UMXA 4D4YA 4CLJA 2XM8A 1XH8A 4E6DA 5A4TA 2VX0A 3OCTA 4L46A 5ACBC 3E8DA 4RWJA 5BVOA 4OT5A 3F3WA 3O7LB 3TNPC 4CT2A 2OH0E 3BYOA 1JSUA 1HCKA 1NY3A 3MVHA 1PYXA 2GS2A 3QLGA 4RVTA 1JWHA 3DFAA 1ATPE 4U40A 2GSFA 2VTHA 4GMYA 5A4CA 5I3RA 2XKEA 3ET7A 4M0YA 4G6LA 1PMUA 1LEZA 4CFMA 3AGMA 3VUIA 1O6YA 3G6GA 3ZXTA 5HGIA 3O17A 2GNFA 4RA5A 3ZRMA 3ZBFA 5CS6A 5AP3A 4G6NA 1M52A 3DGKA 4PNKA 3NZ0A 1J7LA 2XKFA 3HKOA 4FMQA 2O63A 2XRWA 2XNOA 4RPVA 5ANGA 2Z02A 3NVKI 4E93A 4FZAB 5BVFA 4FF8A 3NNWA 4AW0A 4PDPA 3P7AA 1PF8A 1ZOEA 3BGPA 2QLUA 4Z55A 5E91A 3RVGA 4YTHA 2X9FA 2WMVA 3OBGA 2VO6A 4EOJA 5LJJA 3WF5A 1SYKA 3O2MA 3AMAA 3BLQA 1YWRA 2Y8OA 5A9UA 1H1QA 3JPVA 5AR7A 2OGVA 4ASXA 3BHHA 4XBUA 1OUKA 2VTSA 3ENMA 3ZSIA 5IISA 4JG8A 2BCJA 3EN9A 3B8RA 4QTCA 3UE4A 1RJBA 4JJRA 1Q3WA 3OCSA 4BHNA 5IEVA 1XQZA 2YIWA 2QG5A 2X8DA 3ZEWA 3OOGA 3IW4A 5F9EA 4DTAA 4LV8A 4QP6A 5AP7A 4FNYA 2CHLA 2UW5A 2FH9A 4KNBA 4AAAA 2YIQA 3DY7A 4FSWA 3TUDA 3BU6A 3PIZA 4ZY5A 5CLPA 2ACXA 3LM5A 4X2FA 5FDXA 3NUUA 3R9NA 3DXNA 4IH8A 3DJ7A 4O7WA 3KU2A 2P2IA 5J79A 3EQDA 2OIDA 4QPSA 5A46A 3TACA 2YJRA 5CSWA 1O6LA 4D4RA 4BWKA 4F7JA 2R3NA 4GYIA 4ANNA 3ORXA 5I9YA 2QI8A 3E5AA 4GU9A 3VUMA 4PL3A 4DEDA 4O0XA 3VBTA 4E6QA 5IF1A 1AQ1A 3NYXA 1V0BA 3F2NA 4RVLA 3WZKA 3FLSA 2F57A 2WOUA 5HORA 1YHVA 4BZDA 1TVOA 2VTNA 4HCVA 2XIXA 3KA0A 5CZIA 4AZFA 5HG5A 4FKVA 3FXXA 4YJPA 4YJNA 2RFDA 2GMXA 5A6OA 4A9SA 1MRVA 2YWVA 3ZUTA 1O6KA 3R02A 4Y73A 4U43A 2WTCA 2C3LA 2X7OA 4O0UA 5EK7A 3ZOSA 5B7VA 4CFXA 2ZM1A 3V6RA 4AZTA 4KSPA 4B99A 3R7IA 2OZAB 4AZVA 3VS2A 4R77A 2ITVA 1SVHA 3KXHA 3LCDA 4RJ6A 5E92A 2XEYA 4E8AA 4L45A 4RQKA 2UVZA 3R2YA 3DT1A 4KIKB 2YIRA 1H8FA 5KHWA 3OC1A 4BIDA 3OFMA 3FMLA 2CMWA 5TKDA 4PQNA 3F5UA 4NFMA 4AZEA 4ZJVA 5KMKA 3Q2JA 3R04A 4DLJA 3BEGA 3D5UA 2H96A 3FMKA 3DBDA 3IKAA 5AUTA 4NEUA 3BU3A 4E5WA 3QUDA 4BY9E 3KCFA 1NA7A 4JQ7A 5KZIA 4YPSA 3BBTB 4BKYA 3BLHA 5CY3A 3COMA 5ACKA 3TEIA 4ITJA 4XG6A 2YHVA 4JIAA 4V0GA 4RC2A 4FTUA 5FBOA 4YJTA 1H25A 3OXTA 4K1BA 4B8LA 5E90A 2FSOX 2QOQA 3FQHA 1AD5A 3QD0A 2BAQA 3PIYA 3WF9A 3F3VA 3F7ZA 3DXPA 5D9HA 4WRSA 5ETIA 4QMTA 3VS7A 3UYTA 2R3LA 3U54A 4KRCA 3E7VA 3MBLA 2H34A 2VNWA 3IECA 5AJQA 1WBPA 4S34A 3IDBA 4I5PA 4PTGA 4WSYA 4BB4A 3NVMB 5E4HA 3C4XA 3Q6WA 4XMOA 1YXSA 2C6OA 4K6ZA 3MESA 5BNJA 3OVVA 4FTAA 4RJ8A 3E62A 3HV4A 3Q60A 4JR7A 4UYAA 1U59A 1A06A 2WAJA 3H3CA 3CP9A 2IO6A 2PVKA 5L8LA 4W4XA 4JQ8A 3TUCA 3ID6C 4LOPA 1OKWA 3NEWA 3FZRA 4GT3A 5HOAA 4EH9A 2JKQA 4FIJA 3EQIA 3IG7A 1Y8GA 2XNBA 3PFQA 1PXJA 4PY1A 5DT4A 2BRHA 4FV6A 3PVBA 5HZNA 5GJFA 2ZAZA 3RPOA 5J5TA 3L9MA 2PL0A 5TT7A 2E9VA 3HAVA 3BYMA 2H9VA 1ZZ2A 4RZVA 1OKYA 4R7HA 5HQ0A 4EHVA 2ITPA 4AW1A 3U6IA 3NIEA 1H28A 1H27A 3VWAA 3ZFYA 3JUHA 5T6KA 3Q2MA 2BVAA 2C1BA 3NUAA 4NM0A 4XOZA 3EZVA 3RHXA 3VS6A 3AT3A 3CLYA 4JBVA 3UNJA 3VIDA 4ACHA 2R3QA 3R6XA 4PRJA 4EOOA 5JZJA 2SRCA 4E7WA 4F0GA 3NYVA 5KMLA 5EHLA 4FI1A 1ZYSA 2IWIA
chains in the Genus database with same CATH superfamily
5CEMA 4FSNA 4LDTA 2YA9A 5FXRA 4FSYA 4QTAA 3OXZA 5E8XA 2CGVA 4MD7E 1IRKA 3C50A 3PUFC 4O0VA 1BKXA 4O86A 4YJRA 2WU6A 2W0JA 3FAAA 3K3JA 3EQPA 3LZBA 2XF0A 4AW5A 4OTDA 3QQJA 4JNWA 3LJ0A 5GZ8A 4GVAA 3OT8A 3PE2A 3QTZA 4JVGA 3REPA 4O38A 4AP7A 2B7AA 1Z57A 4TYGA 3SD0A 2XB7A 2XK3A 2XK6A 3ACKA 1PYEA 4AA0A 4RIXA 4C4GA 3TNIA 2WU7A 3V04A 1CM8A 3Q96A 4FRFA 4DH1A 4NW6A 4GSBA 4UB7A 5E7RA 4UWBA 3PSCA 4IAAA 4LFIA 3VHEA 2R3PA 5EI2A 4XUFA 5ANEA 2G15A 4QQTA 3LW0A 4IXPA 2X6EA 4BCQA 4GFGA 1PXNA 4IADA 2UZDA 2WMQA 5HTBA 4NFNA 1DI9A 3IS5A 4YZDA 5BPYA 4DT8A 5T68A 1IA8A 5AMNA 2PHKA 4IB5A 2VTLA 1XBCA 5GJGA 3RAHA 4EKKA 1REJA 3AC1A 2C6LA 2J5FA 3F3TA 4AGUA 5M4UA 4AT4A 2AQXA 5HHWA 2WQBA 3VO3A 4ASZA 4EH3A 3ZZEA 4ZEGA 3LQ3A 1K3AA 4DT9A 4I24A 2GNHA 3PIXA 4IAZA 4WA9A 2HAKA 5D1JA 2R0UA 3O8PA 4G34A 3AD5A 5KHXA 4ZMEA 2PPQA 3NW5A 4ONAA 4EZ7A 4ZK5A 3PE1A 1KE6A 2QO7A 3BQCA 4IFCA 3PPJA 3R71A 5I0BA 4F78A 2UZTA 1UA2A 4M7IA 4HCTA 3ROYA 3ITZA 2QKRA 4LM5A 1KE7A 3ZO1A 4DTKA 4ID7A 3PWDA 3SRVA 3ZUUA 3GU5A 4X2NA 3I60A 4BDAA 2BPMA 3LXNA 2FO0A 4V01A 4RMZA 4QTEA 5JQ8A 1Q8TA 3ODYX 4FOBA 4L43A 3UC3A 4BDDA 4FKPA 3P23A 1Z9XA 2YM5A 3Q4ZA 4HCUA 2WTWA 3ZH8A 4AOTA 4BCGA 2HK5A 3FXZA 1KOAA 4CG8A 4G9CA 3QXPA 2XIZA 4O83A 3CY3A 3EFLA 4I6BA 3VUHA 4JRNA 3ZLYA 4PMTA 3ZYAA 3L9NA 3GP0A 2QOHA 4F09A 3QKKA 4RJ4A 3SXRA 4JT3A 4CTBA 5I9VA 2YCRA 2B9HA 2JBOA 2GHGA 4FV2A 4DGLC 3CQWA 3FL5A 3UZTA 1Q99A 2GHMA 4AU8A 3V5LA 2VTRA 2XNEA 4IWDA 3GCUA 3PDTA 3DBFA 3B2WA 2WQEA 4FUYA 3FI4A 1UU8A 3QTSA 3V51A 5M57A 3ZM4A 4F1TA 3DQXA 4I0SA 5EYCA 4EYJA 5C8KA 3FQEA 3P5KA 4L53A 2AC5A 2ITYA 2Y7JA 1B6CB 4WUAA 4XG2A 4XV1A 2I0YA 2J4ZA 2XIKA 4J71A 4XJ0A 1ZY4A 1K2PA 2XMYA 2YERA 3D7TA 2HIWA 3D2IA 4EOIA 3QZIA 5AP4A 4L7SA 4ACMA 4O7NA 5DRBA 5L6WL 5E1EA 4DG0E 5GZAA 4FKRA 4AX8A 3SW4A 3TIYA 3F9NA 2WFYA 4BDIA 3ZEPA 4EH4A 3ZSGA 3HA6A 1L3RE 4GG7A 3VNTA 1PXPA 4FYOA 3RPYA 4D2SA 4XV9A 2VTOA 3GGFA 3UJGA 2W1IA 4CV8A 1VLRA 1JKTA 3ZCLA 2J9MA 5LOHA 3O5AA 2J51A 1RQQA 3AQVA 4Y95A 3T3VA 1SNUA 4EOSA 3TUBA 1TQPA 5DN3A 2OF4A 3UP2A 4FV1A 2W7XA 5EDQA 3KRWA 4ZP5A 3DKGA 4LI5A 3MB7A 2QOLA 3PXFA 1YOJA 2ETMA 2UZVA 4WHZA 5CSHA 2FB8A 5HG8A 5E9EA 4YZCA 1S9JA 5CXHA 4HVHA 2C6DA 4QD6A 2IW8A 3VJOA 4CRSA 3BL7A 1A9UA 1WBVA 4KRDA 5A3XA 3R8UA 3F6XA 5DOSA 2ITXA 5EQPA 4DBXA 2WQMA 4BBMA 3G15A 3KFAA 5HLNA 4LOQA 4WUNA 4W4YA 4S30A 1JAMA 1VYZA 1H4LA 5JMSA 2JAMA 1HOWA 1VZOA 4R3CA 1WBTA 2CCHA 3EQBA 3EFWA 3BL9A 4QQ5A 3GQLA 2B54A 4ZLZA 3N9XA 2ZDUA 4PMSA 5FRIA 1OGYA 4GT4A 5EW9A 4AXDA 3NUSA 4HZRA 4QT1A 4M14A 5HX8A 4R78A 4ZTQA 3MH2A 3AC4A 4DHZA 4FYNA 4F6SA 3NR9A 4BBEA 4NZWB 2HZ0A 2EXEA 1W2FA 2PZIA 3OT3A 3QWKA 3UO6A 3V8SA 2XYNA 4GUBA 4Y5HA 4ITIA 3DK3A 2Y6OA 5AV1A 3W2CA 4J7BA 4FT0A 1UU7A 2X2LA 4IBMA 5DFPA 5IA4A 4YZMA 4ZY4A 4ZZMA 4IB1A 1ZYDA 4L3JA 1LPUA 3A7JA 4MXOA 4FT3A 2LAVA 4CMUA 3ZU7A 2RIOA 2B9FA 3HZTA 1UU9A 1XH9A 4IAKA 3OZ6A 1OIYA 2WEIA 4ITHA 4E1ZA 2V7AA 5TE0A 3UTOA 3B8QA 1QPCA 3QFVA 5CANA 4NM3A 4MWHA 2OJJA 4U7ZA 3NSZA 1WVXA 2R64A 4G1WA 1KV2A 2X8IA 4ZTNA 4BCIA 3S0OA 4A9YA 5E1SA 4O2ZA 4FVQA 1PW2A 4KIOA 2QOFA 4M69B 4OBQA 4ZZNA 3M11A 3O96A 4DFZE 3SVVA 3MY1A 1U4DA 3N51A 4GKHA 3R7YA 5IQGA 3BZ3A 4PDSA 3QYWA 3BHYA 2QU5A 2OJIA 2YISA 5CYIA 3W0OA 1Q97A 3F5PA 4IZAA 4QYGA 5H8GA 2B52A 1H1RA 2ZM4A 3GCVA 2J0LA 2R3IA 5EOBA 2YLFA 3KVWA 1PXOA 3QQKA 3HRCA 4YSJA 3PVWA 1Q4LA 1PRYA 4EL9A 4BDBA 3BGZA 3PVUA 2W1CA 2ZV2A 3MPAA 5ANKA 3O51A 3G9LX 4EJ7A 3UDBA 1TQIA 3TV6A 3LLTA 4O21A 3HMIA 3ALOA 5HICA 3FLNC 4IVBA 3NX8A 3TCPA 2X1NA 4NCTA 4UZHA 4EONA 5C8MA 4XP0A 4HPUE 4Z16A 4OTQA 1U54A 4AN9A 5JGDA 1J1BA 5L2SA 3UGCA 4FV7A 4J95A 4FE2A 1CSNA 3L8XA 4YSMA 1JKSA 2VO0A 3VBQA 1B39A 1KE8A 2V7OA 3CBLA 3QGWA 3R73A 3AC2A 1QL6A 3CC6A 4HYIA 4ZAUA 2OBJA 5AWMA 4JMQA 3HUCA 5IH5A 3QXOA 4BDCA 5CQUA 5J5SA 4F9AA 3COHA 2WTVA 3F3ZA 4OGRA 3GCQA 4XG4A 5C27A 5K9IA 4L7FA 5LWMA 3UNKA 3HA8A 1OBGA 1Q62A 4NIFB 1QPDA 4FSQA 4CQGA 4O7RA 3I81A 3VF8A 3PY3A 3BRBA 3B2TA 4A9TA 2JLDA 3VUKA 4CKIA 4AGWA 2JC6A 3NUPA 4AQKA 1E9HA 5M4FA 3EOCA 2H8HA 3SKCA 4FEUA 3A8XA 4AFJA 1ZAOA 3W0MA 3QAME 2XJ0A 4ANQA 2B53A 2UZEA 4GVJA 2OZOA 4NJDA 4TKSA 4APPA 2YCQA 4YHJA 1ZMUA 3FSFA 2R3OA 4JOAA 2YEXA 4DFNA 4K0YA 3F3UA 5JKGA 4F6WA 3NYOA 3IO7A 3DFCB 4QP1A 5ETAA 4O0TA 4GJ3A 4FTLA 3A60A 4IMYA 4J8NA 4RA4A 4R6VA 4L00A 1G8KA 3PG1A 4CFFA 5EQEA 2VTIA 3MH3A 4BC6A 3P1AA 4E3CA 3AGLA 5L4QA 1APME 4R7BA 2Y0AA 2RSVA 2X6DA 4BCOA 1JKKA 4DE4A 4CV9A 2XNGA 5K4JA 1PXIA 5HU9A 3MJ1A 3ZDIA 1DS5A 1YKRA 5EHYA 3R9RA 5K5NA 4U45A 4W4WA 1P14A 2VD5A 1MRUA 4RIYB 5K3YA 4EZ5A 5JRQA 3NLBA 1NT2A 4FIEA 3RZFA 4MNFA 4RT7A 3SG8A 2C1AA 3QZFA 5DT3A 4FNZA 1S9IA 1Z5MA 3KRJA 5IQDA 4WG5A 3UOLA 3EQGA 3TN8A 4DAWA 2X8EA 4MBLA 3QX4A 3T8OA 3NW7A 4L52A 4UMUA 1P4OA 4UXLA 4E4MA 1URCA 4P2KA 2JITA 1JPAA 3NPCA 4E20A 5CAOA 4EWQA 2J50A 3AG9A 1OECA 3RMFA 4C4HA 2IVTA 2QONA 4CQEA 1YWNA 3HMOA 4NU1A 5KBRA 2QOBA 3UG2A 4HVDA 2IZSA 4FV4A 4C38A 4H1JA 5HVJA 4HYUA 3EB0A 3WOWA 1ZWSA 4RG0A 3UVRA 4D1XA 4CG9A 4N57A 3CKXA 1QPEA 5LMKA 4C3PA 4DEBA 2R7BA 3W2RA 3BLRA 5HCYA 4F1MA 3BE2A 5D12A 2V55A 3QRKA 2B55A 4UMTA 5M44A 1W98A 4U80A 3BX5A 2X39A 3N4TA 2QKWB 3AC5A 5J9ZA 1E1VA 5DPVA 4PMPA 1F5QA 2VTAA 4HGSA 5A4LA 2ITQA 4ZXTA 1G8AA 4M8TA 1XWSA 5HLWA 5JRSA 1ZOGA 3PA5A 4U97A 1GIIA 1MP8A 5E8YA 3ANRA 5HBHA 5A54A 2ZFYA 4IW0A 3FHIA 1YDTE 5HCXA 5CF5A 3CTJA 2FUMA 2ESMA 3GU8A 3KMMA 4H36A 4XH6A 1SMHA 5F1ZA 4DEIA 3ZLWA 4QMNA 4NH1A 4Y85A 4CKJA 2A4LA 3DB6A 1WBOA 3V01A 2YN8A 3TKIA 1LUFA 4XRLA 4YZBA 4WSQA 1H08A 3LHJA 2OF2A 5GZ9A 3SDJA 2HELA 4FKGA 4EOKA 1GZNA 3D5VA 1MRYA 1R1WA 2E9OA 4G31A 3D83A 2BDFA 3DZQA 4BTFA 2JIUA 2W1FA 4QRCA 2KULA 2UW0A 5AR2A 3PRFA 4D2PA 4Z7GA 4G5JA 3Q5ZA 4G17A 4OTIA 3A4OX 3BCEA 2XRUA 5C01A 4O82A 3A61A 4FKOA 1PXKA 4CCBA 3FYJX 3DAKA 2HCKA 3QWJA 5DT0A 3FKOA 1ZYJA 4HGLA 4TWNA 2ONLA 3R1SA 4IWQA 5CZHA 3I7CA 3GC9A 3OW4A 3BQRA 2QNJA 3QRTA 5DGZA 4EI4A 4YURA 2WIHA 3FKLA 4LYNA 4I4EA 3NNUA 4ALWA 4C3FA 2J90A 2GU8A 3G51A 4JDHA 2OXXA 3FV8A 4TN6A 2XUUA 4C59A 3KMWA 4QMXA 2WXVA 4A06A 2WTIA 3BHTA 4QMPA 3L9LA 5M06A 3VS4A 3CQEA 3EWHA 4I21A 4BWPA 3OG7A 3FI2A 1KOBA 5BUEA 5K4IA 1J3HA 1W84A 4PPAA 5CAPA 3U51A 4D4VA 3FLYA 5CNNA 4IWPA 1W7HA 3WBLA 2WMXA 4WIHA 4QMYA 2CGXA 2WTKB 4G9RA 1XR1A 5IDNA 3HMNA 2WGJA 3FMEA 3FL4A 2B1PA 3EN6A 3FPMA 4C7TA 3OW3A 5LWNA 3SHEA 4I0TA 4TXCA 2XBJA 5JGBA 5F4NA 3BHUA 5CEKA 1UU3A 2J0JA 4F0IA 2P55A 2VU3A 3BWFA 4E4NA 4ANBA 4GG5A 3KB7A 4CSVA 2XA4A 5HKMA 3VJNA 3C51A 4DEAA 3KGAA 4DG3E 1G3NA 3G0EA 3PYYA 4DGGA 1KE9A 4EQMA 3TM0A 4E73A 1UNLA 2QHMA 2CLQA 3ZO2A 1BL7A 1Q8ZA 3FXWA 4OTWA 2PUPA 5I3OA 1M7NA 2XARA 5CQWA 4D2TA 2CLXA 2G1TA 3DLZA 4FZFB 3KQ7A 1CMKE 5M08A 3ZLXA 3DBEA 2X9EA 3TL8A 3HNGA 5LVOA 3C5UA 4C62A 4GS6A 1H01A 1DAYA 1PMEA 4ZY6A 4FKSA 3BHVA 4L9IA 4YJSA 5DIAA 5EOLA 5TR6A 3CEKA 1PJKA 2VAGA 3EN4A 4II5A 5EKOA 5I9UA 3TKHA 3QQLA 3MS9A 4C58A 5IQEA 2DQ7X 5BYZA 4FKWA 2AYPA 4F9WA 5KMJA 4CFUA 3DKFA 4FV0A 3U9NA 5HO7A 5TO8A 3UVQA 3QKLA 4PTCA 2WMWA 3D15A 1UKHA 2BRMA 3L8PA 1CTPE 4WNMA 5HIBA 4D55A 3UDTA 3Q6UA 3VS1A 3F61A 3O50A 2GNLA 4LRKA 4P7EA 4NKAA 2YITA 3CQUA 4YP8A 5LMAA 3KXXA 3R7VA 4A4XA 4MBJA 3MH0A 5IA1A 4YTIA 4PPCA 5FP6A 3AKKA 3TDWA 2HZIA 2C3KA 3BPRA 3R21A 3BLAA 4CT1A 4WNOA 2XK8A 4FT5A 1RE8A 2J0IA 2PE0A 1JSVA 2BIYA 2CSNA 3I6UA 4IEBA 4PV0A 1OL2A 2YFXA 3C4EA 4QMSA 1OM1A 3Q9XA 5IKWA 3EHAA 3AT2A 3W18A 2O3PA 1OIQA 3MTFA 4MXZA 4I94A 4Q9SA 2HZ4A 4YC3A 5CEPA 3EQCA 5EM5A 3ZLSA 3FY0A 4YHFA 3KRRA 1ZRZA 4AZWA 5LVMA 4HVGA 1MQ4A 3HRBA 1FMKA 4G3EA 4BI2A 5M07A 1UKIA 4FGRA 4IB3A 3V8WA 4QYHA 2VWXA 3ODZX 3CIKA 2UUEA 3OWPA 1YHWA 3GFWA 4EUUA 3MIAA 2GNGA 1ZMWA 4JX3A 3ZC5A 4EHZA 4USFA 1B38A 3FE3A 4C8BA 4XHKB 2OW3A 2XIYA 3MTLA 3C4ZA 3CJGA 4LV7A 4O4FA 4EC9A 2QD9A 4PF4A 5EYDA 4ENYA 3AMBA 2PVFA 4I5MA 5KCVA 5EHOA 2J2IB 3FZTA 5FM3A 4O6LA 2QG7A 1OITA 4TWOA 1XBBA 1WAKA 1YQJA 4HYHA 5ICPA 3II5A 4IC8A 3TXOA 3QCYA 3UP7A 3ML1A 1NVQA 3C4WA 3I5NA 3UIMA 4C4JA 4NW5A 5EW3A 3W0PA 4MNEA 4K2RA 3LM0A 5EI8A 4XV2A 3VONA 3CSVA 3HV5A 3R9DA 3ORMA 4I23A 3RNYA 1LR4A 3CS9A 2C6TA 3VBYA 5JK3A 4IM0A 5M56A 4FTTA 5FTGA 4FTIA 3UIUA 1YOMA 4FBXA 5FBNC 3N4UA 2CCIA 5J7BA 2HW7A 4QMWA 3U4UA 4CMOA 2CPKE 3WZEA 2XCHA 4LMNA 5IUGA 2E9UA 3OF0A 3V5JA 4KAOA 3G90X 1H1WA 4YTFA 3RM7A 3SX9A 1Y8YA 3DDQA 3TG1A 3D94A 3HL7A 4ARKA 3QCQA 4FIIA 3ZFXA 5A6NA 2IZRA 3Q4TA 4KIPA 3TZ9A 4BKJA 4OW8A 4DFBA 5DBXA 2XP2A 3DTWA 2AEGA 1YRPA 4RIWB 4U41A 4M97A 4C36A 3F7WA 4S33A 3QQGA 1X8BA 2XNPA 3DOGA 1U46A 3VRZA 1OKVA 3FUPA 3VAPA 2C6KA 3THBA 4AOIA 4EK4A 2OLCA 2ZV8A 5F94A 4X2GA 1W2DA 3ZTXA 2CKOA 5GINE 1M2QA 5JT2A 3TV4A 4FEVA 4G5PA 4X7QA 5BYYA 3QALE 3SXSA 4GFMA 5A4QA 4JS8A 3HAMA 1XO2B 2A0CX 1K9AA 3KULB 3A4PA 3NAYA 3M2WA 2F7ZE 4QP4A 4IX3A 2IN6A 3VVHA 4AS0A 4TL0A 5CX9A 4UBAA 3RALA 3KXNA 3O23A 5AX3A 1JOWB 3KREA 1Q8WA 4QMQA 5IZFA 4EH5A 3GCPA 5FTOA 4JDKA 3LXLA 4A4LA 4Q9ZA 2QR8A 2VTJA 2Y4PA 2R3MA 4EEVA 5C03A 3ENHA 1OKZA 3LIJA 3KF7A 3DAEA 3POOA 5J87A 2GNJA 3G2FA 4XS2A 4JBPA 4Y8DA 5GIPE 5FEQA 4RQVA 3ZBXA 1FQ1B 4D1ZA 5L6PA 2GTNA 4RFZA 4A4OA 4EZ3A 4K77A 1PXMA 3IQ7A 4WO5A 2O0UA 4FV8A 4DCAA 4QPMA 3QZHA 5JH6A 4NSTA 4I4FA 4F7LA 3QC4A 4QMMA 4CMTA 2VX1A 5DNRA 1XMLA 2PMIA 2QU6A 5CSVA 5D7AA 3GUBA 4M3QA 2EU9A 5KMOA 4CKRA 3C1XA 5DG5A 4AAYA 5G6VA 3W8LA 3C7QA 1O9UA 4QDVA 4OTFA 5AAFA 2R3GA 4AW2A 3Q4UA 4RC3A 2QQ7A 2E9PA 5AR5A 3UVPA 4L42A 3HV6A 1VR2A 2O8YA 4AA4A 1IAJA 4PMMA 2O5KA 4BFMA 3QL8A 3PZHA 3WIKA 5FM2A 3LJ2A 5HE3A 1ERKA 5CWZA 2UV2A 3DKCA 4KS8A 3U87A 4DEHA 1BL6A 3JXWA 4CZUA 4R1VA 1JKLA 4X6RA 2OG8A 4FG8A 1BYGA 5EI6A 2IG7A 2GFCA 4C33A 2BFXA 3QQUA 4GUEA 2RG6A 3NW6A 5C26A 4ZTMA 5FG8A 1PXLA 3PP0A 3I79A 5BMSA 3DCVA 4AOJA 3JVRA 4FTOA 1T46A 3E8NA 5I4NA 3QGYA 5CT0A 4DF3A 1GZKA 3D9VA 5IA3A 4B6LA 3C5IA 5HE0A 4TW9A 5L8JA 3R28A 4C4FA 4C61A 4ZMFA 2UVYA 4BDKA 4FL3A 4DGNA 2XS0A 1FGKA 3MIYA 4M69A 4U3ZA 3ATTA 4XLVA 5HBJA 3ROCA 4FTNA 3D5WA 2CGWA 2YM3A 2ZJWA 4MQ1A 3UODA 1YDSE 2BZJA 1UNHA 1NVSA 3MPMA 4MXCA 3WILA 4BIBA 3HMMA 2W9ZB 4O0RA 2OIBA 1KSWA 2I0EA 2W1GA 3Q4CA 4G16A 5CU4A 2R7IA 4JAIA 4ZJIA 4QP7A 5C9CA 4FKTA 3PXZA 3TV7A 2YM7A 3GU7A 4H05A 4D2WA 3D14A 5CI7A 4QNAA 1YXXA 2PSQA 2EUFB 4XRJA 2I40A 4FZ6A 4D0WA 4LG4A 5HBEA 3TWJA 3QQFA 3COIA 4CD0A 2OK1A 4U9AA 3FWQA 1Q24A 3ZO4A 4DITA 2WMAA 5D10A 5CVFA 4QQCA 4WNPA 1T45A 2P33A 5AP1A 3U55A 5IEYA 4DFYA 2ZM3A 2X81A 3EN5A 5ETFA 3IOKA 5JQ5A 1KUTA 2O65A 4I5HA 5FQDC 3NUXA 4AN2A 5IH6A 4G3FA 3C9WA 3L8SA 1ZARA 2JDOA 5AA9A 4A9UA 2G9XA 4NT4A 4AT5A 4F1OA 3EQHA 2PZRA 4BDFA 4RWIA 1TZDA 3RJCA 4AN3A 2I0HA 2WMBA 3MYGA 4HNFA 2YM8A 1M2RA 4ERKA 1DAWA 2NPQA 4LRMA 1R0PA 1XKKA 3FC1X 4NIFA 2CJMA 1PKGA 5F20A 4M12A 4E4XA 5I9WA 3UQCA 4WNKA 3DPKA 5HTIA 2FVDA 4MXAA 2C5YA 2XALA 3E3BX 5KMMA 4FR4A 2C3JA 2JAVA 4G6OA 4I6QA 5DWRA 3VRYA 3AOXA 5EW8A 5CU0A 5KBQA 4K18A 1J7UA 2W1EA 3DU8A 4LUEA 3MFSA 2YABA 2PVRA 3PSDA 2QCSA 5HG7A 3TT0A 3LFAA 2HENA 4B4LA 3E87A 3R30A 4YUQA 1ZOHA 4I6HA 4E5AX 2WKMA 2VWUA 3HUBA 1OPKA 1SZMA 3LOKA 3UOHA 4ZSEA 4BCMA 3O71A 4WBBB 5KO1A 3P5JC 5EG3A 2VWWA 1YVJA 5LVNA 3P78A 2BDJA 2W1DA 2Z7LA 3D2KA 3HVCA 4RJ7A 4X0MA 5GJDA 4AXCA 2QC6A 1XHAA 5AUZA 3BYVA 3MPTA 2WNTA 2IJMA 2ZMDA 5M4CA 2VNYA 5IA0A 4V0GB 4M84A 3LFFA 5L2IA 3EN7A 4IC7A 5JZNA 3SA0A 3RK7A 4RIYA 4EK3A 1V0OA 4XG3A 2JDRA 4ZS0A 4U8ZA 4CFNA 3CD3A 2W1HA 3NS9A 4N70A 2QOIA 3T9TA 5EKNA 3G9NA 3E63A 4MQ2A 4O7TA 3MFRA 4LMUA 2R5TA 4O2PA 3GCSA 3VQHA 3W0NA 2ITUA 5LXMA 4YPDA 5ANDA 3S1HA 2R9SA 3QTWA 3COKA 2JEDA 4PUZA 1NW1A 4FVRA 3POZA 4W9XA 4WG4A 2F2CB 2W9FB 4PDOA 2WOTA 3D5XA 3LFCA 1E1XA 3OWLA 4IIRA 4NJ3A 4IJ9A 1BI7A 1QPJA 3IW5A 2DYLA 2WTKC 2XKDA 3AXWA 4IACA 4IVDA 3ULIA 4OAUC 3I7BA 4NK9A 3SOCA 3E64A 3SQQA 3VS0A 5JFWA 3WZUA 3R8ZA 2JDVA 1BMKA 4GEOA 3O8UA 4H3QA 4O7LA 4RWKA 3EZRA 4QP3A 1REKA 3R1QA 2V0DA 1FVTA 4YBJA 4QNYA 3S4QA 4DH5A 3FDNA 3I0OA 5J7HA 3CY2A 4CLIA 1GZ8A 2W5BA 4FV9A 3FSKA 3HECA 3R22A 4IQ6A 5AUWA 2GQSA 3BBWA 2JFLA 1FVRA 4EH8A 4Y83A 2J0MB 2WMUA 3MN3A 3CPBA 5BX0A 4I6LA 4IX6A 2CGUA 1KE5A 2C0TA 2P2HA 3OMVA 4DDIA 1Y91A 2W99B 4KD1A 4EUTA 4MH7A 2PZ5A 4F99A 5KKRC 2QLQA 4TYHB 2Y6MA 4LGHA 4RX9A 4ZTLA 3WZJA 4FICA 4UYNA 5KUPA 3W33A 4YO6A 4N0SA 5IMXA 3ALNA 4IAIA 4GK3A 4QOXA 4LQMA 1P5EA 3FZSA 4O7YA 3F2RA 2HXLA 2F7XE 5IUIA 5B2MA 4AA5A 4RFMA 2A19B 1NVRA 2CKEA 3LCKA 1AGWA 2GHLA 2X4ZA 5AAEA 1L8TA 2JKKA 4EJNA 2EB3A 1VJYA 3FPQA 3W0QA 4RX8A 3V8TA 4D9UA 3MVJA 4O7ZA 5HEZA 1JNKA 2ITNA 2BRBA 2JKOA 3O7LD 1UWHA 3GQIA 3W2SA 2AC3A 3CJFA 4WD5A 4BJJB 3W16A 3DLSA 3QYZA 2YZLA 4NYEA 3LE6A 3FC2A 5M4IA 3KVXA 1Q8YA 2B9IA 5E8TA 4RBLA 4X2KA 4NTSA 2YAAA 4UWYA 3EQFA 5C4KA 2ZYBA 3CTHA 5ANJA 4IVAA 2XYUA 2G2FA 3QRJA 4PL4A 2WMRA 3IW8A 3LJ1A 3LFBA 5IA5A 3MB6A 3SLSA 3PJ3A 3QUEA 2YAKA 1M2PA 4M68A 2HXQA 4JDJA 3OS3A 4CTCA 4D28A 3LFEA 5AFVA 3P4KA 4F6UA 4U44A 1J7IA 2RFEA 4D5HA 3VUGA 3E7OA 5IEXA 2IZTA 3UQGA 1LEWA 1XH7A 3HMPA 3LFQA 3PJCA 3MSSA 4GIIA 4MVFA 4RGJA 3BYUA 5CENA 5HU3A 4UY9A 4JIKA 4A07A 4A7CA 3FZ1A 4MXXA 3ZUVA 4CZTA 4DH3A 4DTBA 3AMYA 2QURA 2DS1A 3GB2A 4AXEA 2ZOQA 1ZZLA 5KMNA 5M09A 3A7IA 3QTUA 2G2IA 2I0VA 2RL5A 5FP5A 3ZXZA 3CCNA 4NUSA 1GNGA 1OBDA 3R01A 1ZY5A 1W0XC 3JYAA 4FKLA 4TYHA 2UW4A 4I22A 2W96B 3VW6A 4AGDA 2J6MA 5L3AA 4IHPA 3PWYA 4YNEA 4EH2A 3ORZA 1P2AA 2WMTA 5D7VA 1VEBA 4AACA 1Y6AA 3TIZA 4EOQA 4K8AA 2HW6A 2OO8X 3BI6A 3SRVB 4AT3A 2CNQA 2RFSA 3RK9A 2WMSA 2EVAA 4HGEA 3NRMA 1FGIA 4FK3A 4QYEA 3QRIA 4KKGA 3Q9ZA 3R7GA 3SW7A 2JIIA 1W83A 4FODA 4IJPA 4G2FA 3DJ6A 3MA3A 2GCDA 2PY3A 5CF8A 2P0CA 3CKWA 3GOPA 3Q5IA 4MBIA 4FC0A 5CU2A 4ANLA 4LV5A 3UOJA 2RFNA 3OCBA 4RLKA 5HNGA 3GU6A 3ZSHA 3HP2A 4GV1A 5TF9A 4EH6A 3RINA 2IPXA 3ELJA 4O0SA 3GBZA 3OY1A 3MGYA 4BHZA 3KCKA 3QD4A 3EKNA 1OPLA 3PY1A 4MXYA 5KX8A 1JSTA 1LP4A 2XK4A 3GVUA 3K3IA 3TTIA 5FEEA 4MKCA 1UVRA 4UMQA 4RX5A 2PVNA 2X2MA 3MY0A 3LMGA 3UPXA 3V5QA 1VYWA 4GT5A 4NWMA 2I7QA 4KINA 4QP9A 1JQHA 4FKQA 3EYHA 3FZPA 4ANSA 3WYYA 5J8IA