3CGOA

Irak-4 inhibitors (part ii)- a structure based assessment of imidazo[1,2 a]pyridine binding
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
356
structure length
332
Chain Sequence
DNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLASFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYREHTIEEWKELIYKEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title IRAK-4 inhibitors. Part II: A structure-based assessment of imidazo[1,2-a]pyridine binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 10
total genus 94
structure length 332
sequence length 356
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cgoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cgoA01
4EL9A 1PXOA 3GU7A 2BALA 2OJ9A 3CGFA 3C7QA 3GT8A 3HVCA 5I0BA 2W7XA 3KRWA 2JKKA 4YSMA 4ZLZA 4Z9LA 5I9WA 3TN8A 2OF4A 5GJGA 3BYOA 3R7VA 3ACJA 5KMLA 3AT4A 3SD0A 3S95A 4AXAA 3NEWA 2PVKA 1Q8YA 1YXTA 3D83A 5ANOA 2ZB1A 3E87A 3LM5A 4II5A 4ZAUA 3ATTA 4B6LA 2PE0A 3W2RA 4CV9A 2C68A 5CU6A 3NNXA 2NO3A 2PE2A 4WBOA 5HNIX 4IAKA 5J5SA 3C5IA 2HOGA 5CAVA 5CEQA 1W7HA 2Q0BA 3QKKA 4U79A 4DA5A 3KVWA 2Y6MA 4OT6A 3HNGA 1XHAA 2AC3A 5JGDA 5CU4A 4DFUA 5AP4A 5BPYA 3B2WA 2RF9A 4L3JA 3HZTA 3OC1A 4PV0A 3P86A 3OTVA 3LLTA 4AZTA 4BHZA 4X2JA 3ZZWA 3P9JA 3PZEA 2E9PA 5HE3A 3TV4A 1FPUA 4M68A 1B6CB 4QMXA 5HG8A 3ZLXA 1OMWA 3QHRA 3V51A 4FKTA 5FBNC 4RX9A 3ET7A 2PZRA 1Y8YA 4QP6A 1MRUA 1ZAOA 2CN5A 2ZVAA 3FJQE 3VUMA 5LMKA 3QZIA 3QRJA 4A4OA 4L68A 4C4GA 3A7IA 3C4XA 4FUXA 5BVFA 5BYYA 3EN6A 1W83A 3D14A 2JDVA 4KIQA 5CT0A 1Q8ZA 1ZYSA 2VAGA 2W4OA 3F88A 3NVKI 2BR1A 4CZTA 3PJ3A 4FIIA 4EQMA 3UOHA 2Y7JA 4YZCA 4IACA 5K5NA 1OGUA 2C5OA 4GG5A 2OF2A 4EJ7A 3BPRA 3OW4A 3PG3A 4C7TA 3BYVA 4QMZA 3PY1A 5EI6A 3WBLA 4ANOA 3OXZA 4S31A 3UO5A 4HGTA 4FG7A 2X2LA 3SA0A 3PXKA 4S33A 4FEQA 3E64A 3LFSA 3Q4UA 4E6DA 4M84A 4C4JA 3LFAA 5EYCA 2UZVA 5ETIA 2WOTA 4BYJA 4IM0A 3FI8A 5BX0A 5BVDA 1STCE 4I5HA 3A8WA 3ZMMA 3AMAA 4CXAA 2G2HA 4D2VA 2NRUA 2QOLA 3HEGA 4F9WA 2PZYA 3O96A 4JXFA 2I0HA 2GDOA 2QOKA 3I1AA 3V5PA 2YAAA 2V7AA 2CKOA 1E1XA 3UODA 1ZLTA 3VRZA 1VR2A 5HX6A 1YI6A 3B2TA 5EYMA 5LCJA 3S0OA 3LQ8A 4NM0A 5AV4A 3BGPA 3HMOA 4I6BA 4L7FA 3NYVA 5K3YA 5AV0A 3IONA 2YCRA 4EI4A 3PY0A 4FOCA 4TWNA 5D11A 3WZUA 2IWIA 2VN9A 3LFCA 3R2BA 4NWMA 4UWYA 5DT3A 3JVRA 1MRVA 5CALA 2OIBA 5J7HA 2BZIB 2XEZA 2PYWA 1TQMA 1KUTA 3DBEA 4D55A 3ZXTA 3F69A 3FYKX 4E93A 3JXWA 4YPDA 1YDTE 1VYZA 3ID6C 2UZEA 4YJQA 2QOFA 2R3JA 2BRBA 3TL8A 3ZBFA 4DBNA 4TYIA 4HVIA 1OIQA 4DLIA 3NRMA 4IWPA 3GP0A 1PHKA 5J1WA 4BKJA 4P90A 2WQOA 3UIXA 3VRYA 4ZZOA 2F49A 4E8AA 3QGWA 4NH1A 1OIUA 4YC8A 3HV7A 4ZY6A 3FMHA 2WU7A 5J95A 1W0XC 3D5WA 1FINA 1GZKA 3CJGA 4HVGA 1I09A 2XJ2A 5M4FA 4TNDA 3QZGA 4OTDA 4MVFA 2UV2A 5GZAA 4BCMA 3QUDA 4XG8A 3F5XA 3GNIB 5DH3A 5HNBA 4OAVB 3QQFA 5M08A 4UALA 1R0EA 3GCVA 5KUPA 1R39A 4WUNA 5A3XA 4YZ9A 5JFXA 4EWHA 4RFMA 4O22A 2VNWA 3QD2B 4R1VA 3Q6WA 4YJPA 4BTJA 3NIZA 3WF6A 1FMOE 4CZUA 4RIYA 4YJRA 3WILA 4ZTMA 3PA3A 3AXWA 2R7BA 5E8VA 4DFNA 3BX5A 3FE3A 3OF0A 4R1YA 4BBFA 4DEHA 4JX7A 2Z02A 1WMKA 1TKIA 4MD9E 5BUJA 3VULA 3HMNA 3HV4A 4QMMA 2QCSA 4D1SA 4DTBA 4FKQA 4GCJA 2UW9A 5HX8A 5L8KA 4F08A 2IJMA 5ETFA 4LMUA 3T3UA 4BZNA 3Q9XA 4RMZA 1S9JA 4FNYA 4RJ6A 3FMLA 3ZEPA 4EH7A 3LCSA 4ZTQA 4U7ZA 5M06A 4PMMA 2WMAA 1YQJA 3BV3A 4ZK5A 4DN5A 2PMIA 3REPA 3VS3A 5HLNA 4L42A 4CFVA 4OBPA 3KRJA 1QPEA 4HGSA 2GS2A 3MYGA 4G6NA 4RJ7A 4ZIMA 5M09A 4RZVA 3MS9A 4ZZMA 4XRJA 4F0FA 4H1MA 2GNLA 2ERKA 4V05A 1H1PA 4IM3A 3MTFA 2YITA 4D2SA 2ZV8A 3O2MA 2WTWA 4G5JA 2W4JA 2VX3A 4FKVA 4QMWA 5DWRA 5AP7A 5F4NA 4HVDA 5IEVA 3A61A 3ZHPC 1BUHA 1OI9A 4X2GA 3R8ZA 1ZXEA 2O3PA 4Y8DA 4XG4A 5C27A 2BHHA 3UE4A 4G5PA 4QYGA 4A7CA 3HECA 3BLRA 3PIXA 3R1SA 3BHUA 4JDKA 2W17A 3EZVA 5TF9A 1J1CA 5IU2A 3CTJA 3POOA 3E93A 4FZFB 1FBNA 1JSTA 5E90A 1Q8UA 1R78A 4O27B 3KXZA 3OBGA 4UMQA 4UXQA 4U42A 4ZTNA 3MW1A 3ZH8A 1L3RE 4FL3A 4QMYA 2R3OA 5HLPA 3GCSA 3FLWA 2XNNA 3R8MA 2YLFA 4PNKA 5EOLA 4IVCA 3VJNA 4AA0A 4JQ7A 1Q8WA 3LFDA 1TQIA 3CQUA 4G34A 4X3FC 5HBEA 2WMSA 4OTQA 2I6LA 4QYYA 4YNOA 4HNIA 5AR8A 3R9OA 3SRVB 5HO7A 3IS5A 1LUFA 4OBQA 4ARKA 1KV2A 4PDSA 5FEQA 5JRSA 5J9YA 4AOJA 3UZTA 4F1OA 3AGMA 2XM8A 3ZRMA 2J0LA 2OZAA 4G3FA 5CNNA 4B9DA 5KHWA 4EQUA 5A54A 3LFQA 3D2KA 2C1AA 3BHTA 2B52A 4OT5A 3FMMA 4XYFA 3RMFA 1H08A 1YOMA 5CI6A 3DK6A 4D4VA 1PXMA 3ZM4A 4I94A 2WHBA 5CEPA 4K33A 4FSNA 5IQAA 2C4GA 2FO0A 3ANRA 3O71A 4GS6A 4HCVA 3LW0A 2CCHA 2Z2WA 5KBRA 4IEBA 1OUKA 2QOHA 2FH9A 4AZSA 1VYWA 5L8LA 4RJ8A 2CHLA 3SRVA 4CLJA 4C4FA 3M11A 5C4KA 3DS6A 4CGAA 2PMNX 1B38A 3DV3A 5L3AA 3VS2A 1UWJA 1XKKA 1JNKA 3QLGA 4PMSA 4WG4A 4YGAA 3QAME 4RPVA 4EOQA 5AP5A 5AP6A 5LVNA 4CEGA 3TKIA 2W99B 3P08A 2EB2A 4R77A 3VF8A 4OTGA 5AUTA 1U54B 3EQFA 3DCVA 2RFEA 4IVBA 4CMTA 5IH5A 3MVJA 3PXQA 5JKGA 2PVNA 2GTNA 2JIUA 2XIKA 4FEWA 2VTLA 4AGUA 3PYYA 3QCSA 2X0GA 3PSBA 2W1HA 4ACCA 3VUHA 3MB6A 4M0YA 3E3BX 2QONA 4FMQA 4XG7A 3Q96A 3VAPA 1XH8A 4ANSA 3QQUA 4KA3A 3CEKA 2BHEA 3QBNA 1JKSA 4QNYA 4UWBA 2PVRA 5EW9A 5EI2A 5IF1A 3HDNA 5EH0A 2R3NA 2PZ5A 2F2UA 5AUVA 3VBYA 3WOWA 2XMYA 4HYIA 4B99A 5J87A 4DH7A 1UNGA 2WU6A 5E8TA 3DB8A 5I9XA 4FTLA 4EOMA 3HMIA 4Y85A 5EDRA 3FQEA 3UQGA 5FQDC 2QHNA 5K4IA 5AUXA 4LOPA 4C8BA 2C6TA 3NR9A 4AE9A 5E8XA 4K1BA 4TWCA 1REJA 4AGDA 3NVMB 4BKYA 4NTSA 3OXIA 3Q6UA 2F7EE 3U54A 3QLFA 1UU3A 4YHTA 2EWAA 4G9CA 3KCFA 3QQGA 5ANDA 2RFDA 4GL9A 1PKGA 2QI8A 3QTQA 2ERZE 2X6EA 3RGFA 3U51A 2ZYBA 5AAFA 1J1BA 4CFUA 4H39A 3CY3A 3H0ZA 2QG7A 4R78A 1NVSA 2JEDA 5E4HA 4F9BA 4FTMA 1KV1A 4P4CA 3G9LX 3KCKA 3O7LB 3ANQA 3V04A 5CASA 4J99A 5CEMA 3GCQA 3ZUVA 3IOKA 2YCSA 3FY2A 4RLKA 3RNYA 3TKUA 4YHJA 1QPCA 2E9NA 3GGFA 3IO7A 3DZOA 4O0TA 4RC3A 3VBXA 4FKJA 4YHFA 3UQCA 5I9UA 3T3VA 1E1VA 1M7NA 4HNFA 4OR5A 5HOAA 4IC8A 3TV6A 4ERKA 3WIKA 5EM6A 1OIRA 4EH8A 5EYKA 3OCBA 4OAUC 4WSQA 1SMHA 1V1KA 2C6MA 2CCIA 2ITNA 4JIAA 4PQNA 3MVMA 3RZBA 2V55A 2YIXA 4CZYB 2I7QA 5HESA 3U6HA 4DE4A 1VZOA 1REKA 3EIDA 3HX4A 2XBJA 4LV5A 3C4FA 4FK3A 4MHAA 5DRDA 1PJKA 3A7GA 5AIKA 4WRSA 2C6EA 5DR2A 3OMVA 4BCHA 2PUPA 4W8EA 4C33A 2QO2A 4M0ZA 3BHVA 4W4YA 5FGKA 4QYEA 4A9TA 5IDPA 4I3ZA 2YJSA 2YFXA 2GS7A 4FGBA 4APCA 3V5QA 3EFWA 2V5QA 4I20A 4NIFA 3KF4A 4L67A 3PIZA 4BGGA 2YISA 2REIA 3WF5A 1M2PA 4FV9A 5KNJA 4AZEA 3ZLWA 4I1ZA 4E20A 2ZV9A 3ZFXA 2PVFA 3PE1A 5ANJA 3D7ZA 3HV5A 3PJCA 4ZEGA 1Q3DA 2IW8A 4LGDA 4IDVA 4G6LA 1QPDA 4KBCA 2C5VA 4FT3A 4DGOA 3MPMA 2YERA 3TIYA 2EXCX 4U3ZA 3K3IA 4RVLA 5BQ0A 1SVHA 1XH7A 3A8XA 4GU6A 2PUUA 4IFGA 4QQJA 3D0EA 5AMNA 1PXPA 4QNAA 3R28A 4FZ6A 4GT5A 4KBAA 3HP2A 3FSKA 4USFA 3COKA 3VBWA 3EQCA 4L44A 1BLXA 2Z7RA 5BVNA 3L8XA 1O6YA 3R83A 3SHEA 4ENYA 4JIKA 5HBHA 5H3QA 3QU0A 4F0IA 3GFEA 5EOBA 3CLYA 4DTKA 4EOIA 4QQTA 5A6NA 3EQIA 3MB7A 3U9NA 3W2PA 2CGVA 3MWUA 4HCUA 4RWLA 3SOCA 3KMMA 3EN5A 4BWKA 4NW6A 5HI2A 4YLKA 4EORA 5LVPA 5L6WL 4CSVA 1IG1A 2WFYA 3DKGA 3R8PA 4BIEA 3MH2A 1XBAA 2G01A 2JDSA 5IMXA 2SRCA 4XUFA 4D4SA 3VQUA 1KE5A 4C37A 4FKUA 3DLSA 4YSJA 4O0WA 1GIIA 2BIYA 4IX6A 4FVRA 4PPAA 2FSLX 4W8DA 4YTFA 5BVEA 2ITQA 4HYSA 2X9FA 4IAAA 3ZC5A 2BZHB 2BUJA 3JVSA 2YEXA 3GFWA 3UO4A 2G2FA 3R1NA 4I24A 4A07A 4OLIA 2CNVA 4XP2A 1JPAA 1KSWA 3C50A 1AGWA 4WHZA 5C03A 2VO0A 2ZOQA 3FQHA 4GFOA 4M7IA 3BYSA 4FZDB 5DBXA 4LGGA 3KXMA 2VTJA 3QCXA 2PULA 4O1PA 2ITVA 3R71A 4FT9A 4ANQA 4CTCA 3PVWA 3WE8A 3IOPA 3PPJA 3KVXA 3W2SA 4DH5A 3PDTA 1XH5A 4FE2A 2B9JA 5J79A 2BRGA 3VNTA 3COMA 4AN3A 4EZ3A 2GPHA 5FUTA 1YOLA 4IJPA 4JS8A 3WARA 5A4QA 4CRLA 3OW3A 3DOGA 4FSRA 3TV7A 2FYSA 1H01A 3QRTA 1GZOA 2LAVA 5CEKA 4CG8A 2XIZA 4YLJA 3VWAA 3ZFMA 1BL7A 4FEUA 1XQZA 3T9TA 3VS5A 4BCFA 2XCHA 3L9MA 4E6AA 2J5EA 3KY2A 5AUWA 1A48A 1JSUA 4NCTC 1H0VA 4FBXA 4OTPA 4RC2A 2OG8A 4BCKA 4C02A 4N0SA 5DT0A 2J2IB 5AX9A 3ENHA 4FG9A 4ONAA 4DTAA 4E73A 2AC5A 5L2SA 4KRCA 3ORNA 3KMWA 4RJ4A 2X7OA 3LJ0A 4KRDA 4JJRA 3W10A 5KKRC 4G2FA 4IW0A 4LL0A 4BI2A 2VWUA 4BGHA 5HTIA 2J51A 4E5BA 2Y8OA 5T3QA 2B1PA 4AOIA 4FKWA 4WSYA 5AIRA 3Q2MA 1OKZA 4XCUA 4F65A 3MV5A 1T45A 4RIXA 3BBWA 4M3QA 4GU9A 4ZJIA 3UVPA 1YVJA 5L2IA 2WMQA 5IQBA 4ZMFA 5CU0A 4XX9A 3MA3A 4DGLC 4KABA 3W2QA 2F57A 4IWDA 4G17A 4EUTA 4B8MA 4LUDA 3LXKA 1GZ8A 2O65A 3ZS5A 3ZSIA 4BZOA 1NW1A 3ELJA 5F20A 3Q53A 2ITYA 2R9SA 3EQHA 4ANLA 1ZMWA 1O6KA 4E5WA 4I5MA 4FF8A 3O51A 2ZM4A 4FYOA 1YXUA 2WEVA 4RIOA 2IVTA 4AW1A 2JAMA 3F2RA 2O8YA 2C6DA 3GOKA 4HOKA 5D9HA 3FQSA 4G3DA 3ZO3A 4CYIA 4ZXTA 1G3NA 4EK6A 3FHIA 4F6UA 3C5UA 3FC2A 4RGJA 4C3PA 1PW2A 3OXTA 5IUHA 3FEGA 2WELA 4DEEA 2C5NA 5CAPA 3C13A 4EC9A 1Z5MA 2HXQA 4RWJA 3P7AA 4XEYA 3KKVA 3ULZA 3I6UA 4RIXB 5M4IA 5KMIA 1ZYLA 2VWBA 4G1WA 4TKSA 4UY9A 3NYNA 3R7UA 4D2PA 4J95A 4R8QA 4FT7A 3TDVA 3TTJA 2X2KA 3OVVA 3C9WA 2VTOA 3EQGA 4D2WA 5AV1A 5CAOA 3MFRA 2UVXA 4YTIA 3CD3A 3I6WA 3ZU7A 2YCQA 4DINA 3AD4A 4FV3A 3E8EA 5IMEA 2XK6A 1OUYA 2NPQA 5EYDA 4PWNA 4E6QA 4Q5HA 2JFLA 2QOBA 4KSPA 4YJSA 4AGWA 4XG2A 4ALVA 3R7YA 4RVKA 4YJVA 4LRMA 3WZKA 3LQ5A 3ZDUA 5CXZA 3OWLA 3W55A 1DAWA 2VTRA 2QG5A 1PMEA 2WZJA 1K3AA 3PP1A 4MF1A 3C4CA 3KRLA 1P2AA 1RDQE 2ITTA 4J52A 4MWIA 2R3QA 1W84A 4RX7A 5DPVA 5EKOA 4BCIA 5EFQA 3Q5ZA 4FTCA 5A9UA 2X81A 3DU8A 4DFLA 5CANA 2YDKA 4FSZA 4FYNA 4I23A 3RPOA 5L2WA 3UZPA 5IPJA 1HCLA 4EEVA 4NJDA 5JGBA 2FB8A 3QF9A 2WXVA 4EHZA 4MWHA 5IUIA 3NUPA 4IB5A 2E2BA 3TJCA 3MH1A 2R3LA 5DEYA 3GUBA 3RK7A 3VBTA 3VS0A 1H1QA 4JG7A 3IDBA 2G15A 4E4NA 4NYEA 3JY0A 4H05A 3FSFA 4FSWA 2WTJA 3KF7A 5DFPA 1XJDA 3MY1A 4ZSLA 5IDNA 3PP0A 1H1WA 4JBOA 3QZHA 1XBBA 1APME 4FC0A 3U6JA 2Z7QA 5LMAA 3RP9A 5FBOA 5HE0A 4QP4A 4Q9ZA 5L4QA 5BMSA 3KA0A 5IEYA 4EKKA 4N6ZA 5HIEA 4PNIA 3UMXA 4TRLA 3CPCA 2E9VA 2ACXA 2O2UA 2XCKA 4JR3A 4AUAA 4EOJA 4F9AA 4YURA 4DFBA 2BDFA 3DXPA 3GBZA 3NIEA 3UNZA 4BWXA 4TYGA 2F4JA 3VW6A 4R6VA 4F7NA 2A4LA 1Y6AA 3PVGA 1LPUA 3CP9A 3D7TB 5CT7A 3CXWA 5JEBA 4FKRA 3EQDA 5CQWA 4J98A 3TI1A 5DA3A 2W1IA 3NWWA 3PSCA 4YZDA 4FTAA 3A62A 4DGNA 5KKRB 2XK3A 4XLVA 4XOYA 4WUAA 2I0EA 1YDRE 5EM5A 1J7LA 2DWBA 1QL6A 3VQHA 3ZRKA 3U8WA 4G31A 3CE3A 2V22A 3O8PA 4IHPA 5AAEA 3U6IA 1YW2A 3QTRA 1W98A 4I92A 4UWCA 4P5ZA 2EXMA 3ZLYA 4O83A 1U59A 4E26A 3F5GA 5CVHA 4LFIA 4FNXA 4EH4A 3V8SA 5G1XA 2WQNA 4XP3A 4ACHA 3JR1A 5HCXA 5IKWA 4UZDA 3PZHA 4WIHA 4E1ZA 3CSVA 4G6OA 2J6MA 2HZNA 5BVWA 3K3JA 3NNUA 5B2MA 4FEVA 3W8LA 4AU8A 4GRBA 2YACA 3V3VA 5CSXA 4ZS4A 2QD9A 3D7TA 4G3GA 5HU3A 4BHNA 1H1SA 3LCTA 4NKSA 5DN3A 4MD7E 2RG6A 1IA8A 3DBDA 3G2FA 1JAMA 4NFNA 4FSUA 5JSMA 1YDSE 2VZ6A 1SNUA 2XBAA 3MY5A 4N6YA 3LCOA 4NM3A 4DC2A 4C61A 3R0TA 2QR8A 1KE6A 4O81A 1XBCA 4HYHA 3HYHA 4IAFA 1M2QA 1UWHA 2PTKA 3CJFA 3OT3A 4FTQA 4KWPA 4UV0A 4XG9A 2ITUA 3RM6A 1H27A 4TXCA 1WVWA 5HE1A 4C2WA 4FOBA 4R7IA 2V7OA 4IZ7A 3IGGA 4WNKA 3DKFA 5E91A 5FXQA 4D1XA 2VWXA 2QHMA 3K54A 4RIWB 5HD4A 1M14A 4KNBA 4F70A 2FVDA 3MFTA 3ORTA 3LPBA 2CNQA 4HVHA 5LWMA 3V5JA 2BDWA 3MBLA 3N4TA 1SNXA 4BF2A 4FKLA 4E4MA 2JKMA 1PMUA 1AQ1A 2PHKA 4D58A 3NW6A 2IG7A 2GTMA 5CZIA 3S4QA 2XEYA 2YWVA 3DA6A 1O9UA 3LXNA 5FEDA 4L3PA 3OD6X 3E62A 4JAJA 3CD8A 5C1QB 1ZOGA 3L1SA 4WD5A 4XLIA 4EC8A 2PY3A 3E5AA 4KAOA 2C3IB 5HNGA 1ZRZA 4FTOA 5D7AA 1GAGA 1H07A 3RKBA 3MY0A 3PXFA 4W9WA 4X7QA 4D5HA 4C57A 4D0WA 4YR8A 3ETAA 3F3ZA 4ACMA 2EXEA 4AFJA 3U9CA 5CNOA 1ERKA 5HG7A 4DG3E 1SVGA 3U4UA 3L9LA 4U81A 4MNFA 4O7ZA 3BQCA 4M67A 2PL0A 1P5EA 3GU5A 4JOAA 3AC1A 4Y83A 4DT8A 1Q62A 3FPMA 1YWVA 3ULIA 1Y6BA 4WNOA 4YO6A 3RBWA 3PY3A 4ZTLA 4BI0A 1XO2B 4FV6A 2UZLA 2OJJA 2QOIA 2IN6A 4MK0A 3KK8A 4BRXA 3RCJA 2JIVA 3HA8A 5KMNA 2C3KA 3GI3A 1X8BA 4TPTA 1BL6A 5CSWA 5EQYA 2DUVA 2PUNA 4FKPA 4YO4A 2YZAA 3NCGA 4XG3A 4XV3A 5CU2A 2XK9A 5BMMA 5AUUA 1J7UA 2OJFE 3DPKA 5EQEA 3E63A 1WBPA 4QTCA 4ZZNA 2XIRA 5DR6A 1V0PA 3DXNA 5HG5A 4NEUA 3S1HA 3NUYA 5FWKK 4FR4A 2R2PA 2PVMA 2WMRA 4F09A 4IH8A 4BZDA 1PXKA 3NW7A 2WQMA 1OBDA 4GKHA 2ZJWA 4H1JA 3D5UA 4W4VA 3OUNB 5LOHA 4OTWA 3PVUA 4CT2A 1NVRA 3RJCA 3WI6A 5JQ5A 2H96A 4R7BA 3S3IA 3DGKA 5H8GA 4IXPA 2X2MA 3PLSA 2X8DA 3IKAA 2WTKC 5CSVA 2QO7A 5AP0A 4EK8A 5FDPA 2XB7A 4GJ3A 3ODYX 1XR1A 4K77A 4Q9SA 1R3CA 1UKIA 4BI1A 4O2PA 4LRJA 4QYHA 2XK7A 4NW5A 4NZWB 2VWZA 4UBAA 1WAKA 5JFWA 2GNFA 3GC7A 4AF3A 4WKQA 2CMWA 3NUNA 1UNHA 1ZY5A 3AC3A 3UNKA 5FG8A 1CTPE 3Q9ZA 1Y57A 4U3YA 2BMCA 5HKMA 4ASZA 5AEPA 5IZFA 4QQCA 2ITPA 4C0TA 4JVGA 2ETMA 3F3VA 3VS4A 3O50A 3CY2A 4BDJA 2O5KA 2HWOA 4U5JA 5AUZA 4ZLYA 3F61A 3NW5A 3R02A 2HY81 4DITA 3DQXA 2GQSA 4PMPA 3GQLA 3LFNA 3P4KA 5KMKA 3F2AA 5ETCA 3F7WA 4ID7A 1FOTA 3LOKA 5KX8A 3NAYA 1YWRA 5JZNA 4F64A 2VNYA 1LP4A 2BFXA 2DQ7X 2OIDA 4QP3A 3ZRLA 4QMOA 2ITOA 3QFVA 1Y8GA 2Q0NA 3DFCB 3EMGA 3H0YA 1H28A 3AQVA 3MJ2A 4RZWA 4XV9A 3Q60A 2I0YA 2GU8A 1XH4A 3VUIA 4AW0A 4DAWA 4DHFA 5A4LA 5J5TA 2VRXA 4MYGA 2VTQA 3N9XA 4FIEA 2HZIA 3RK9A 2OJGA 3Q52A 2OSCA 3R9RA 4UYAA 2X7FA 4A9YA 4R5YA 1YKRA 5A4CA 4FTTA 4ALWA 3LKMA 3PLAE 3ZSGA 5TE0A 3PVBA 4GFGA 4O7NA 2C0IA 3HRBA 3H3CA 1PF8A 3TTIA 3AT3A 1MQ4A 3WZDA 2C3LA 2VTTA 4BDCA 4AE6A 2VX1A 2VTSA 2XKFA 3QD3A 4O0RA 4XP0A 3UPXA 5IH4A 5F94A 4IMYA 4F99A 2ZMDA 2E9UA 3F2NA 3FC1X 3LIJA 1KOAA 4K9YA 4O7WA 2XF0A 4ZMEA 4L52A 2UZOA 2HELA 2PK9A 3FI2A 3RHKA 3R22A 5BYZA 5I9VA 1W8CA 2UZDA 4CLIA 4DGGA 3NUSA 4GT3A 5CU3A 3SOAA 4C58A 4PP7A 4YJOA 4V04A 3BHHA 3LMGA 4YNEA 2EB3A 2ITWA 4E4LA 4YU2A 4TWPA 3FMDA 5A4EA 4FV4A 2ZV7A 3QCQA 4KD1A 3GC0A 2UZWE 4MCVA 2PWLA 4RA5A 4RFYA 5DEWA 2GNHA 2ZV2A 1DI8A 3P23A 4GEOA 5AFVA 1OKYA 3NNVA 1H24A 1WVXA 3KXNA 1Y91A 2W1EA 4TYEA 5AA9A 5CEOA 4JX3A 3NYXA 4O91A 2F2CB 3BQRA 3PG1A 5AR3A 3ERKA 1ZMUA 3R7OA 1R1WA 3TUBA 2OLCA 1OPJA 3CBLA 3O7LD 5IA1A 3DDQA 3MPTA 4D4RA 3KEXA 3VIDA 3QGYA 3OY1A 1RQQA 3ORPA 4O1OA 4IAYA 2BIKB 1URCA 4MXCA 2C5XA 4NK9A 4H3BA 2UZUE 4O38A 2HZ0A 2VWVA 2C69A 4BCQA 4F7JA 1OL7A 3PXZA 2AUHA 2Z7SA 3G6GA 4QMLA 4APPA 1IAJA 4ACDA 3FZRA 2ONLC 1E9HA 4Q2AA 4F9CA 4F63A 3G9NA 5EG3A 3KXGA 4ZOGA 3OTUA 3AT2A 4EHGA 4ZTHA 1PRYA 2RKUA 4L9IA 2GSFA 1JKLA 3DLZA 4IB1A 1K2PA 2YM3A 5A14A 4ANMA 4EOSA 3SG9A 3FLZA 1ZMVA 1WZYA 4RLLA 2UVZA 3PPZA 4RT7A 2R3IA 3ORZA 4JNWA 3LLAA 4O6LA 2JKOA 4C34A 4EOLA 2WMBA 4GYIA 5B0XA 4RIYB 2W0JA 4FG8A 3DK3A 3CIKA 3DNEA 5KMOA 4DBXA 3UMWA 1JOWB 4YZNA 1NA7A 4CQGA 4QOXA 4JBPA 2CLXA 4O2ZA 3TUCA 3P7CA 3VUKA 2O0UA 4FKGA 4C4EA 4Z55A 3QUEA 4OUCA 5IEXA 1H8FA 4BY9E 1A9UA 2RL5A 5H8BA 4FL2A 2YN8A 3RTPA 4QPAA 3BI6A 3NUUA 5DR9A 3TEIA 3AC8A 3UOKA 1IR3A 3FZ1A 4Y5HA 2F7ZE 5BNJA 3UTOA 3A2CA 4I21A 4ZTRA 4BDAA 3TJDA 2PU8A 3MVHA 1BKXA 3GC9A 2PZPA 5LVLA 3O23A 3V6RA 3SGCA 2C30A 3N4VA 3E7OA 3W33A 1PY5A 5L2TA 3E92A 3ORLA 1M17A 2ESMA 3BZ3A 1M2RA 4MAOA 4PTCA 3FXZA 1K9AA 4DH1A 4X3JA 3NUAA 4PP9A 1A06A 4NFMA 2XKEA 5E1EA 4L01A 1ZZ2A 2OI4X 3GCUA 4ZSGA 4YZMA 5CI7A 4DEDA 4BTMA 4K0YA 3W18A 4O7YA 2YCFA 3I5ZA 3P7BA 5HICA 5A46A 2OO8X 5DNRA 4D1ZA 4IVDA 4AFEA 4GH2A 3UZRA 1CSNA 1BI8A 3EQPA 2ZDUA 3LE6A 4USDA 4ITJA 3CR0A 4JQEA 4M15A 4BN1A 5CLPA 2WTDA 4MNEB 3K5UA 2OWBA 5ANEA 4CT1A 5DT4A 3TM0A 3MSSA 3VJOA 2J0MB 3IG7A 4PDOA 2JFMA 4FNZA 4WA9A 3HUCA 5AWMA 2YIQA 1VJYA 2PMOX 3MDYA 3FL4A 4I6FA 4YTHA 3T8OA 3W8QA 4KKEA 4OW8A 5A4TA 1YHVA 2HAKA 2YM4A 4FV1A 4QMVA 4I4EA 3TNIA 2PVLA 2XK4A 5CVGA 2B0QA 3QZFA 4OGRA 3F9NA 4O7VA 2OICA 2UW3A 5DLSA 1P4OA 3F5PA 3JS2A 1KE9A 5IA5A 2YJRA 2GHLA 5J9LA 4JL9A 1OVEA 2B55A 4RVTA 3BLHA 3F6XA 3OOGA 4RC4A 4WNPA 4LL5A 2FUMA 2VWWA 1M52A 3OS3A 4N70A 4QPMA 5CX9A 1GJOA 2P2IA 3IQ7A 3KU2A 4FV5A 3R21A 1PMNA 4E5AX 4P5QA 4F1TA 3IW8A 2H34A 4QMPA 2W1DA 4BTFA 3BGQA 3NZ0A 5CYIA 4GVAA 5LARA 4DF3A 4IC7A 5E8SA 5BVOA 3POZA 3LCKA 3MGYA 5TOZA 4AW2A 4RIWA 3HAMA 1FVVA 1WFCA 4C36A 1FGKA 5HVJA 4LOOA 5JRQA 4CFFA 4F4PA 3PA5A 4MXYA 4S2ZA 5H8EA 5HTCA 3CCNA 3TZ8A 4R3RA 1OPLA 1VEBA 4MXXA 1FGIA 2Y0AA 3PJ8A 3V6SA 4AAAA 4ERWA 4EWQA 4ACGA 2C0OA 4YC3A 2NP8A 3TUDA 3ZFYA 3UVRA 1FQ1B 2UW6A 5EDQA 3WE4A 4CD0A 3K2LA 4AN2A 4GVJA 4I5PA 4A4LA 2UW5A 2XIXA 3IW7A 2C6OA 3VHEA 2XH5A 3DJ5A 3DY7A 3HDMA 4ALUA 2GMXA 3AOXA 2R0IA 3NAXA 4AZVA 4F6WA 4QMUA 3ZSHA 2VO3A 4PL4A 4A06A 5AJQA 5JFSA 4EZ7A 4JDJA 5M4UA 2GHGA 3V5LA 5K4JA 3SQQA 1WBVA 3WYYA 1JLUE 1OPKA 5CXHA 5KO1A 1Q61A 4LM5A 3IW6A 3MVLA 4MF0A 4M69B 4CFMA 2W9ZB 5ACBC 5IA3A 4KSQA 5ACKA 1JWHA 4JI9A 4GK4A 4QP7A 2B9IA 1XWSA 3BHYA 5FXRA 5I9ZA 2QLUA 4YJUA 2OKRA 2O64A 2VTIA 5M4CA 2IZTA 3CQWA 4RVMA 3GB2A 5M56A 3FI3A 3ZXZA 4HGLA 4QTBA 3TNPC 4ASDA 5BUIA 1WBWA 3SAYA 4AZWA 4PPCA 4FEXA 3PPKA 3COIA 5EW8A 1U5QA 1UKHA 2JIIA 4EH5A 4RX5A 2QU6A 4B7TA 3D9VA 5M44A 4IX4A 3CTHA 2BCJA 3BU6A 4V01A 5HTBA 3BE9A 4WG3A 1V0OA 3JY9A 4QPSA 3V5WA 5CVFA 3OCGA 3ZEWA 1JKKA 3DQWA 4F7LA 4CFWA 3NUXA 5L6PA 1H4LA 2XK8A 3W1FA 4AT3A 3H30A 4GG7A 2HENA 2XVDA 3A7HA 4FX3A 5IQGA 1LR4A 4BR3A 4M69A 3G0FA 4DG0E 3EFLA 1NXKA 3P78A 5A6OA 4TYJA 3QCYA 4L6QA 5K0XA 2GNGA 4XHKB 2QOQA 4HJOA 3KFAA 4V0GB 2B7AA 4DFXE 4JG6A 5DI1A 3BYUA 3QRUA 4W9XA 4G9RA 4LRKA 5E7RA 3ZONA 2OW3A 4ITIA 5D1JA 5JN2A 1YWNA 3HP5A 4KKHA 1ZYCA 4PTEA 2PE1A 3R1QA 1PKDA 4BDFA 1ZOHA 4W4WA 3W32A 4D5KA 5LVOA 4AGCA 2PVJA 3FKNA 3OWJA 4X2NA 4H36A 5DE2A 3FKOA 1U54A 1H26A 3A99A 1UU8A 2HW6A 3TNQB 1G8SA 1DI9A 4ZS0A 2IVUA 2Y4IB 3BGZA 4A9UA 4Y73A 3T9IA 3VS1A 2PSQA 3H9OA 4ZJJA 4Y72A 3WZEA 4MD8E 4PDYA 2P33A 1ZWSA 5GIOE 3B8QA 2QVSE 4RJ5A 3F5UA 4TYHA 3ZCLA 1MP8A 3FBVA 3MPAA 2B9FA 4C3FA 3BBTB 3ATSA 4FV2A 4QMQA 5I3OA 3I0OA 4EZ5A 4CFXA 5KE0A 3BCEA 4LGHA 2A1AB 4HZRA 5ANGA 5FEEA 4HW7A 5JZJA 4V0GA 2VGOA 4YLLA 4ZTSA 4S34A 2WGJA 3NPCA 2RG5A 3RI1A 2WTKB 4QMNA 2I0VA 4FA2A 3MIAA 3UPZA 2CKEA 3EFKA 3AMYA 3KXXA 3UP2A 3AD5A 4HYUA 3P5KA 1SZMA 1IRKA 3L8VA 3PJ2A 3A7FA 4RWIA 5HD7A 3VBVA 2IVSA 4HPUE 5HGIA 3OCSA 3UG2A 4L7SA 2B9HA 3R7IA 1XH9A 4JLCA 3QALE 3PWDA 3ALOA 4I0RA 4NSTA 2P0CA 2ONLA 3QA8A 5M55A 3FMJA 4J96A 4I6HA 1G5SA 4OBOA 3VS7A 3VUTA 1Z57A 2C6LA 3QTZA 4CQEA 2DYLA 5JH6A 1CDKA 5HZNA 3Q4CA 3F66A 3UOJA 4YJNA 4TZRA 3QTUA 2PZIA 4IAIA 5AR5A 4GIHA 3EH9A 1BI7A 2XNMA 3CPBA 2P3GX 2W9FB 2VGPA 3LJ1A 3QWJA 1DS5A 2YM7A 4IFCA 4AOTA 4AS0A 3R8UA 2Z7LA 3BEAA 5EW3A 3HMMA 4XJ0A 5C26A 2X39A 2GQRA 3FI4A 5M53A 4PTGA 3FXWA 4B8LA 3C4EA 5HQ0A 2HZ4A 4X6QC 4K11A 3Q2JA 1J91A 5EHYA 5TR6A 3ITZA 1P4FA 2XP2A 3A4PA 2UW7A 5AP1A 3RAIA 4YMJA 2HCKA 1YOJA 2LGCA 3BU5A 3MI9A 4GYGA 4PUZA 4QO9A 3WYXA 3Q9YA 3UNJA 4MBLA 3O8UA 2Z8CA 4IADA 5DHJA 5KMMA 4JAIA 4DEBA 3UG1A 3LXPA 2UUEA 3TG1A 5I4NA 1G8AA 3R9NA 4BIBA 3EOCA 3FLSA 4EOPA 4BDGA 3KXHA 1LEWA 4OTHA 3QD4A 5JGAA 3PWYA 3M42A 5GJFA 5CAQA 3CGOA 1WBTA 3M1SA 4U43A 4DEAA 3TZ7A 2OXDA 4QP8A 4WG5A 2J0KA 3RCDA 2OZOA 3QTWA 3COHA 3AMBA 1CKJA 1Q4LA 2Z60A 3OP5A 3GC8A 4IWQA 4O6EA 4Z3VA 4FNWA 2ZDTA 2XZSA 3P79A 4M66A 3LM0A 3FHRA 3R9DA 2VTNA 4DG2E 3ALNA 4GW8A 2XJ0A 3V01A 2WD1A 5T6KA 4NIFB 5T68A 4FVPA 5IQHA 2IO6A 1PYEA 2W4KA 2XNOA 1NVQA 3QHWA 3RWPA 5KHXA 1BMKA 1AD5A 1YHSA 3E7VA 3GQIA 5HVKA 5AM6A 4X6RA 5I5ZA 3LVPA 4FKOA 3ZBXA 3NX8A 4BVUA 3IW5A 1EH4A 5GZ8A 3MH3A 1OKWA 4IB0A 2RIOA 2WMXA 5KZIA 3OBJA 1U46A 3R8LA 1UU9A 2WQEA 4L3LA 3AC4A 3QKLA 4WRGA 2OFVA 3RZFA 4FSTA 3VVHA 4IBMA 3PIYA 5KBQA 2BILB 3G0EA 1OL5A 2GFCA 4CKJA 2KTYA 4FV0A 4UX9A 5IQDA 3PRIA 1F5QA 2XNGA 4D2RA 2PPQA 3D5XA 4HPTE 4PY1A 2PUIA 3SKCA 2BKKA 3A4OX 3Q32A 5EI8A 4KBKA 2QODA 3TT0A 4U44A 1GNGA 3VO3A 3LMIA 2VD5A 3C51A 2B54A 2J9MA 3V8TA 4O7RA 4UB7A 5AR4A 3WF9A 2R3MA 4KIOA 4UYNA 1PXNA 2W1FA 1CMKE 4UXLA 3UO6A 4IQ6A 2OXYA 2W5AA 5I3RA 3HRFA 4A9SA 4NT4A 3G6HA 4I0TA 3GU4A 4PRJA 2BZKB 2HYYA 1QMZA 3FZPA 4Y46A 4D0XA 3NMUF 1JBPE 1WCCA 1YHWA 4MEDA 5GZ9A 4BC6A 3UJGA 3PSDA 3CC6A 3QKMA 5CTPA 1ZYJA 4K8AA 3EHAA 1YI4A 4J8NA 2CGXA 3FUPA 4L8MA 5K5XA 3ZYAA 3LMHA 4XOZA 4YUQA 1I44A 4EH9A 4MBJA 3A60A 4KINA 4QQ5A 5FD2A 3UYTA 4FODA 4MXOA 5J8IA 2CGWA 2CJMA 4CNHA 2J4ZA 3TNWA 3DZQA 2OFUA 4NM5A 4I22A 2V0DA 4UMTA 3R04A 5FDXA 1GY3A 3OEZA 3NSZA 5IUGA 3FLNC 1OITA 3GCPA 4GV1A 2WTVA 4Z7HA 3VUGA 4H3PA 2EUFB 2VTHA 3FKLA 3F3WA 3EJ1A 3NYOA 4MX9A 4U0IA 4EOOA 4XS2A 2VO7A 3R7GA 4KS7A 3M2WA 4AG8A 2QOOA 4X0MA 3MFSA 3IDPA 3CKWA 4GK2A 2QU5A 4C2VA 4TT7A 2KULA 3JUHA 5C8NA 5FM2A 4L53A 3FYJX 4FUYA 2BZJA 4XNEA 1PXLA 2C0TA 2A19B 4J97A 3JPVA 3SW4A 5IA2A 2VX0A 4WT6A 2WMWA 3LZBA 4S32A 4U9AA 4IANA 3L8SA 2CGUA 4HCTA 4QRCA 4CMOA 5IQIA 4YPSA 3EB0A 4EH6A 4DFZE 2QURA 4MH7A 2OU7A 2YDIA 4FICA 4D9UA 2WMVA 2GCDA 4O84A 3D15A 3QYZA 5HCZA 1OZ1A 2YM8A 2X1NA 3FLQA 3MTLA 2UW8A 3OT8A 3E8CA 3QA0A 2J90A 2UZNA 3DNDA 1IASA 4FIHA 4R7HA 5EHLA 5CENA 4CRSA 3P1AA 3IK3A 2DS1A 3OEFX 4NTTA 4M14A 3I0QA 3PUPA 4P2KA 2RFSA 2A2AA 3I7BA 1XH6A 2GNJA 3U4WA 4EK4A 5ICPA 4ANBA 5C4LA 3K5VA 3LFFA 5AV3A 4Z16A 3UIUA 1KWPA 1FVRA 2BRNA 2FGIA 4IX3A 4X21A 2C1BA 2QO9A 5EDPA 3OROA 5HEZA 1V0BA 4IZAA 3EYGA 3DFAA 3RPVA 3BRBA 2ZM1A 3S2PA 5KMJA 5JQ8A 4CMUA 3TXOA 2OZAB 3EZRA 4BDDA 4JG8A 3Q3BA 4FTUA 2IVVA 4Q5EA 1Q3WA 2OBJA 4FZ7A 4I93A 5E8WA 4BCGA 4C62A 1R0PA 3LXLA 3H4JA 3AD6A 4OTIA 4ZLOA 3UDBA 4EK3A 5E92A 4RBLA 5AR2A 1RJBA 3IDCA 2JLDA 4IAZA 3ORKA 1H25A 4EONA 2JGZA 5J1VA 5JMSA 3R2YA 4YZBA 3H10A 4EYMA 2ITXA 3SC1A 4ZJVA 1L8TA 1H00A 3I5NA 1OKVA 2H6DA 4DGMA 2VTPA 5AUYA 3IPHA 4KIKB 5KZ0A 2WO6A 4E3CA 5AA8A 5CF8A 4GIIA 2W5HA 5ITAA 4TNBA 3TNHA 4QT1A 3ZOSA 4LI5A 5LCKA 2R3PA 5CS6A 4EK5A 5JT2A 1UA2A 2YAKA 2WQBA 2XKDA 3HUBA 4FVQA 3DBFA 3DTCA 3LFBA 3HMPA 5E1SA 1UNLA 3ORMA 4YP8A 3KULB 3KQ7A 4XV1A 4LYNA 4UMPA 3DDPA 1J3HA 1TVOA 2FA2A 2WEIA 3TKHA 4E6CA 4EKLA 3ZO4A 4NU1A 3VC4A 3BEGA 2XYUA 4ZSEA 5HE2A 4BBEA 2ETRA 3TWJA 4EH3A 4ZSAA 4C38A 4I0SA 2ITZA 4GFMA 2F7XE 4CVAA 4BYIA 5HLWA 5K9IA 4U45A 3WF8A 1HCKA 2CSNA 1O6LA 3R8VA 3SXRA 1ZZLA 5H9BA 3MESA 4KIKA 4K2RA 3DB6A 5AM7A 3KMUA 2BAJA 2BRMA 4BDIA 5L6OA 4IZYA 3L9NA 3RAKA 3VF9A 1YRPA 3AC2A 2IZSA 4NUSA 5IA0A 2VWYA 3AG9A 2CKQA 5CAUA 3DJ7A 4Z7GA 4YJTA 4FV7A 3C1XA 4CG9A 3KULA 1T46A 4A9RA 3G5DA 3G15A 4CV8A 2G9XA 5CQUA 4BDEA 5F9EA 3I7CA 4AT4A 4ORKA 3NDMA 2IZRA 5EHOA 3SX9A 4TYHB 4O7LA 5TO8A 3MN3A 2WTCA 2XJ1A 3QUPA 1F0QA 3ZZEA 2EVAA 3R30A 4EH2A 3FAAA 4WO5A 2JC6A 5IISA 3BE2A 2GHMA 4PX6A 5FXSA 3SVVA 5J7BA 4RWKA 3DAKA 3ROYA 3FWQA 3I79A 2JDOA 2X8EA 3KGAA 3Q04A 4RG0A 5FRIA 5HORA 5GIPE 2BRHA 4DYMA 3G33A 3H9FA 2VTAA 3BU3A 4RRVA 5FTQA 3UVQA 2R3FA 1RE8A 3Q4ZA 4D28A 5AX3A 1PXIA 4XH6A 2A0CX 2G2IA 3QWKA 4I4FA 4TN6A 3EKKA 4S30A 3SLSA 2W1CA 2PVYA 4EBVA 3C4ZA 3CQEA 2YLEA 4FI1A 3I60A 4O0UA 3H9RA 5G6VA 2J0JA 1QCFA 3HA6A 3ZTXA 4U80A 3IW4A 2NRYA 2Y4IC 3II5A 4X2FA 2YZLA 4N57A 4FTJA 2R3HA 3C0GA 3LJ2A 4GT4A 1MQBA 4FTNA 4IJ9A 4EOKA 3DJ6A 3DBQA 1OL2A 3PE2A 4BICA 3HKOA 5BVKA 2CN8A 5DOSA 4IE9A 3BV2A 5GJDA 1GIHA 4JDIA 5F95A 3KB7A 4CKIA 2QNJA 3DBCA 3GU6A 3VN9A 5B2LA 2HXLA 4U40A 3RHXA 2R0UA 3E8DA 4O82A 3ENMA 2VUWA 4FSMA 4YC6A 5IQFA 1UVRA 4PF4A 2FSTX 4C4HA 4ANNA 3HLLA 4GUEA 4XG6A 5JFVA 3C0HA 3THBA 2XRWA 3GVUA 4E7WA 4RX8A 1YI3A 1ATPE 4KB8A 4EJNA 4F7SA 3FPQA 1URWA 3OWKA 1JQHA 4YBJA 2QC6A 3IECA 1GIJA 4FSYA 4NJ3A 2VU3A 4QP1A 3MFUA 1ZARA 5DVRA 4BCPA 5D12A 4XMOA 4KKGA 4AWIA 2BFYA 4H58A 1FMKA 1YXSA 4FL1A 3W2OA 4BBMA 2P2HA 2FSOX 3E88A 2JD5A 3EN9A 1U4DA 4F0GA 3FXXA 3GEQA 1SVEA 5CSHA 5FTOA 1W82A 1F3MC 3R63A 5HHWA 4C59A 1S9IA 4FTRA 1JKTA 2W1ZA 2R4BA 3SDJA 2X4FA 4WOVA 2BTRA 2WMTA 2H9VA 3QTSA 5EK7A 3PJ1A 5ANKA 3O17A 4FT0A 4UN0C 4AX8A 4YTCA 5HO8A 5HO6A 3UBDA 3FL5A 3F3TA 2C3JA 2ZAZA 4J8MA 3NGAA 5BUEA 5IH6A 2W1GA 5IG1A 2P55A 4DEIA 4JRVA 4MXAA 5GHVA 4O7SA 4DEGA 2GQGA 1JVPP 1UU7A 3EWHA 4DH8A 4RJ3A 4XBRA 3RWQA 3PXYA 4AACA 3QC9A 4BIDA 3QTIA 3R6XA 4EHEA 4CCBA 3RPRA 4O0XA 3TCPA 3SV0A 1LEZA 4RSSA 4NCTA 5DRBA 4LUEA 4L00A 5E8YA 4QTEA 4ASEA 3QL8A 3RVGA 4I5CA 3S00A 3FY0A 3SW7A 3TZ9A 1Z9XA 3E8NA 3DTWA 4AQCA 3TIZA 1B39A 3FZTA 2GNIA 4BDBA 5HIDA 1WBNA 2Y4PA 3HRCA 3QX4A 5CF5A 4X2KA 2WTIA 3UGCA 3HAVA 2CLQA 3ZLSA 3BKBA 3SXFA 2PVHA 1KE8A 3VUDA 2W06A 2JAVA 4FIFA 5E8UA 4AA4A 2R3KA 3I4BA 4QTAA 2IW9A 4O86A 5FM3A 1PXJA 4PL5A 3LAUA 2UW4A 2YHVA 4K6ZA 3U87A 3OWPA 1ZY4A 2V62A 4E4XA 4AW5A 3RALA 2AYPA 5D10A 5HU9A 5EQPA 4G16A 3L8PA 4I6QA 4R5SA 2IZUA 1P14A 2W96B 3LFEA 3EYHA 4RFZA 2UW0A 3FMKA 3OY3A 3PRFA 1ZOEA 2I1MA 3P0MA 3EFJA 3NLBA 2JITA 1ZYDA 3ORIA 3KC3A 4GUBA 4ITHA 4FTKA 2R5TA 3KN6A 4IIRA 4MKCA 2HW7A 5FP6A 2JKQA 1CKPA 4IZ5A 4D9TA 5CF6A 2OIQA 4EHVA 2BTSA 4TY1A 2R3GA 4JQ8A 5AP2A 3BWFA 2XKCA 3MA6A 4QMTA 3KL8A 4RA4A 2CPKE 1GOLA 1Q97A 2XIYA 3NS9A 4FKIA 5C01A 4BGQA 4PL3A 4QTDA 3F3UA 4D2TA 5IA4A 3UYSA 4R3PA 2XM9A 3ZO1A 3OFMA 4LQMA 5HBJA 5AP3A 4MBIA 4O21A 4U41A 3GXLA 5DGZA 2BAKA 1CKIA 3DAJA 5D7VA 5C9CA 1WBSA 4GMYA 4KS8A 4WBBB 5AR7A 2JDRA 3TDWA 2W05A 3Q9WA 5AADA 3BIZA 2OGVA 2H8HA 3QX2A 4ENXA 3EN4A 4UMRA 3B8RA 2QKWB 4GJ2A 4Y5QA 4JT3A 4MTAA 2C6IA 2C47A 4BFMA 3G51A 4ZSJA 5I9YA 4LV8A 2HIWA 3QQHA 3UIMA 4DT9A 2WIHA 4QD6A 1OM1A 4O7TA 5IQCA 4J53A 4OTRA 1Q99A 1PYXA 2IPXA 2XNEA 2ZM3A 3EKNA 3O0GA 5CZHA 5E8ZA 2QKRA 3V5TA 2I40A 2J0IA 2OH0E 4BDKA 3F82A 3N51A 5L8JA 2QQ7A 1M7QA 5FLFA 4EUUA 4BDHA 3GENA 3R00A 4P7EA 3GU8A 2UZBA 1KOBA 4LMNA 5HCYA 3R01A 5HVYA 4B0GA 3OUKA 2Y9QA 4O96A 4I41A 4BKZA 3EN7A 3KREA 1SM2A 4C4IA 2HK5A 4QP9A 4DH3A 5BYLA 3F7ZA 2WIPA 1GZNA 5D41A 4MQ2A 3ACKA 2OH4A 4WNMA 2RSVA 2ZMCA 4TTHB 4DCEA 5ANIA 2WB8A 4KIPA 1TQPA 3CS9A 4L45A 2F9GA 3R7EA 4NL0A 3G90X 3RINA 2XRUA 5M51A 1CM8A 4GK3A 5EM7A 1WBOA 4PMTA 5LJJA 2EU9A 4FTIA 3D94A 3EL7A 4U97A 4UMUA 4IWOA 3KK9A 2X9EA 3MJ1A 2Y6OA 3NNWA 2XYNA 4FIGA 5DYJA 3OZ6A 4A4XA 3ZM9A 1QPJA 4ZY4A 3WZJA 1MRYA 4YBKA 5IQEA 1OIYA 3BELA 2X7GA 4JDHA 2J50A 2QOCA 1FVTA 4M12A 3V8WA 4FIJA 3PA4A 4LG4A 3QQLA 3ZUTA 4UZHA 2YWPA 3QC4A 3ROCA 3C0IA 5B7VA 3ZUUA 2JDTA 2C5YA 2X6DA 4FKSA 3UOLA 4K18A 3UIBA 2YM5A 2C6KA 2W5BA 3CKXA 2WOUA 4IM2A 1YXXA 4HZSA 2YDJA 3UQFA 2B53A 3ZDIA 2GS6A 5LXMA 2OXXA 3FLYA 4M97A 5K0KA 3UC4A 4X3FA 3UC3A 4H3QA 5M07A 1OB3A 5JK3A 4RQVA 3LCDA 3U55A 4CTBA 1HOWA 1IEPA 4U8ZA 2BDJA 4JBQA 4O0SA 5GNKA 3PFQA 2QLQA 1NT2A 5LMKC 1WVYA 4GSBA 3DKOA 3LQ3A 2YIYA 2JBPA 3R1YA 4J1RA 4F9YA 3DKCA 4NKAA 3RAWA 2RFNA 1MUOA 2PMLX 3I81A 2R3RA 3FZOA 4JRNA 1UV5A 2YABA 4C3RA 3L9PA 4M13A 4TWOA 4XBUA 1DM2A 3BWJA 3HV6A 5LMBA 4QP2A 2VWIA 3E3PA 4IVAA 4EQCA 1NY3A 5F1ZA 4ASXA 5LQFA 2NNWB 2O63A 1H1RA 4C35A 3OHTA 3DXQA 1DAYA 4PDPA 2JBOA 3KRXA 4Y95A 4FK6A 1BX6A 4X3FB 3RNIA 2CDZA 2XA4A 4QMSA 5GINE 1H0WA 3QQKA 1BYGA 4QYFA 3PXRA 4BTKA 4HVSA 5AAGA 3KN5A 2IW6A 1JSVA 4D4YA 3FZSA 3HGKA 3RPYA 4DLJA 3C4WA 2B4SB 5M57A 2XNPA 1RW8A 3CTQA 4JR7A 4LOQA 1SYKA 2J7TA 4RQKA 4BL1A 4PPBA 3FMEA 3PTGA 2UZTA 2VTMA 4J7BA 5EM8A 3WIGA 2X8IA 5DMZA 2P4IA 1Q41A 4N4SA 4R3CA 5TKDA 3VW8A 4FZAB 4USEA 3EQBA 5HIBA 1Q8TA 1OECA 2WAJA 5CY3A 5ETAA 3QRIA 3FV8A 4GKIA 5L2QA 4OTFA 4BWPA 1Q5KA 4MQ1A 4W4XA 4XRLA 3W16A 3A7JA 3FDNA 4DFYA 4F6SA 1IAHA 2HWPA 4BCJA 2BPMA 4MXZA 3RK5A 4KUJA 2ETKA 1PMVA 2OK1A 3QRKA 3HL7A 3LHJA 3DAEA 5E9EA 4AN9A 2BROA 4M8TA 2WMUA 4CKRA 1OL6A 2X4ZA 3QXOA 3KRRA 1J7IA 2GFSA 3ZO2A 3BYMA 2R7IA 3QTXA 3Q5IA 4CCUA 4U6RA 4UEUA 4AZFA 3RM7A 4AA5A 4EYJA 2FSMX 2YIWA 2XS0A 3QXPA 3RAHA 2CNUA 3IGOA 4DCAA 4J71A 3AGLA 3RPSA 3EL8A 3HV3A 3OCTA 3D4QA 3DK7A 4F1MA 5H2UA 2WNTA 5CSPA 2WKMA 3WF7A 5B2KA 4MNEA 3ODZX 2WPAA 3MIYA 4AP7A 4BCOA 5J9ZA 2Q83A 2A27A 2J5FA 3JYAA 3O8TA 3ORXA 3D5VA 3UP7A 3R9HA 3BLQA 2OJIA 4B4LA 2RGPA 4TW9A 4BCNA 1OL1A 2ZB0A 4EBWA 3FMNA 4ZP5A 3W2CA 5LVMA 3GOPA 5CF4A 1ND4A 3VS6A 5DG5A 3DT1A 3EQRA 3TACA 2E9OA 2QR7A 4NM7A 4FGRA 4IDTA 5AV2A 2YIRA 2YM6A 2BAQA 5CWZA 5TT7A 3Q4TA 4CFNA 2BVAA 3QD0A 4FT5A 3D2IA 3AC5A 1U5RA 4ZY5A 4TL0A 1IA9A 5HG9A 4L46A 4L43A 4G3EA 3SG8A 1OBGA 4IB3A 3TZMA 3R73A 4G3CA 2XUUA 4XV2A 5C8MA 4CYJA 5LWNA 2BKZA 2G1TA 4IX5A 4O0VA 3VBQA 3ZC6A 5KCVA 5FP5A 3SXSA 3QYWA 3N4UA 2VV9A 2UVYA 4HGEA 1Q24A 4AT5A 4O0YA 2VO6A 2HY0A 2CKPA 5FTGA 4BB4A 5CEIA 1YXVA 1KE7A 3OG7A 5C8KA 2R64A 4FSQA 4FV8A 2XNBA 3VHKA 2YA9A 3MH0A 3NCZA 4JBVA 3QQJA 3OOMA 5EKNA 5DIAA
chains in the Genus database with same CATH superfamily
4EL9A 1PXOA 3GU7A 2BALA 2OJ9A 3CGFA 3C7QA 3GT8A 3HVCA 5I0BA 2W7XA 3KRWA 2JKKA 4YSMA 4ZLZA 4Z9LA 5I9WA 3TN8A 2OF4A 5GJGA 3BYOA 3R7VA 3ACJA 5KMLA 3AT4A 3SD0A 3S95A 4AXAA 3NEWA 2PVKA 1Q8YA 1YXTA 3D83A 5ANOA 2ZB1A 3E87A 3LM5A 4II5A 4ZAUA 3ATTA 4B6LA 2PE0A 3W2RA 4CV9A 2C68A 5CU6A 3NNXA 2NO3A 2PE2A 4WBOA 5HNIX 4IAKA 5J5SA 3C5IA 2HOGA 5CAVA 5CEQA 1W7HA 2Q0BA 3TYKA 3QKKA 4U79A 4DA5A 3AKKA 3KVWA 2Y6MA 4OT6A 3HNGA 1XHAA 2AC3A 5JGDA 5CU4A 4DFUA 5AP4A 5BPYA 2XARA 3B2WA 2RF9A 4L3JA 3HZTA 3OC1A 4PV0A 3P86A 3OTVA 3LLTA 4AZTA 4BHZA 4X2JA 3ZZWA 3P9JA 3PZEA 2E9PA 5HE3A 3TV4A 1FPUA 4M68A 1B6CB 4QMXA 5HG8A 3ZLXA 1OMWA 3QHRA 3V51A 4FKTA 5FBNC 4RX9A 3ET7A 2PZRA 1Y8YA 4QP6A 1MRUA 1ZAOA 2CN5A 2ZVAA 3FJQE 3VUMA 5LMKA 3QZIA 3QRJA 4A4OA 4L68A 4C4GA 3A7IA 3C4XA 4FUXA 5BVFA 5BYYA 3EN6A 1W83A 3D14A 2JDVA 4KIQA 5CT0A 1Q8ZA 1ZYSA 2VAGA 2W4OA 3F88A 3NVKI 4AXDA 2BR1A 4CZTA 3PJ3A 4FIIA 4EQMA 2A98A 2Y7JA 4YZCA 3UOHA 4IACA 5K5NA 1OGUA 2C5OA 4GG5A 2OF2A 4EJ7A 3BPRA 3OW4A 3PG3A 4C7TA 3BYVA 4QMZA 3PY1A 5EI6A 3WBLA 4ANOA 1OGYA 3OXZA 4S31A 3UO5A 4HGTA 4FG7A 2X2LA 3SA0A 3PXKA 4S33A 4FEQA 3E64A 3LFSA 3Q4UA 4E6DA 4M84A 4C4JA 3LFAA 5EYCA 2UZVA 5ETIA 2WOTA 4BYJA 4IM0A 4AQKA 3FI8A 5BX0A 5BVDA 1STCE 4I5HA 3A8WA 3ZMMA 3AMAA 4CXAA 2G2HA 4D2VA 2NRUA 2QOLA 3HEGA 4F9WA 2PZYA 3O96A 4JXFA 2I0HA 2GDOA 2QOKA 3I1AA 3V5PA 2YAAA 2V7AA 2CKOA 1E1XA 4I6LA 3UODA 1ZLTA 3VRZA 1VR2A 5HX6A 1YI6A 3B2TA 5EYMA 5LCJA 3S0OA 3LQ8A 4NM0A 5AV4A 3BGPA 3HMOA 3TMOA 4I6BA 4L7FA 3NYVA 5K3YA 5AV0A 3IONA 2YCRA 3BL9A 4EI4A 3PY0A 4FOCA 4TWNA 5D11A 3WZUA 2IWIA 2VN9A 3LFCA 3R2BA 4NWMA 4UWYA 3PFYA 5DT3A 3JVRA 1MRVA 5CALA 2OIBA 5J7HA 2BZIB 2XEZA 2PYWA 1TQMA 1KUTA 3DBEA 4D55A 3ZXTA 3F69A 3FYKX 4E93A 3JXWA 4YPDA 1YDTE 1VYZA 3ID6C 2UZEA 4YJQA 2QOFA 2R3JA 2BRBA 3TL8A 3ZBFA 4DBNA 4TYIA 4HVIA 1OIQA 4DLIA 3NRMA 4IWPA 3GP0A 1PHKA 5J1WA 4BKJA 4P90A 2WQOA 3UIXA 3VRYA 4ZZOA 2F49A 4E8AA 3QGWA 4NH1A 1OIUA 4YC8A 3HV7A 4ZY6A 3FMHA 2WU7A 5J95A 1W0XC 3D5WA 1FINA 1GZKA 3CJGA 4HVGA 1I09A 2XJ2A 5M4FA 4TNDA 3QZGA 4OTDA 4MVFA 2UV2A 5GZAA 4BCMA 3QUDA 4XG8A 3F5XA 3GNIB 5DH3A 5HNBA 4OAVB 3QQFA 5M08A 4UALA 1R0EA 3GCVA 5KUPA 1R39A 4WUNA 5A3XA 4YZ9A 5JFXA 4EWHA 4RFMA 4O22A 2VNWA 3QD2B 4R1VA 3Q6WA 4YJPA 4BTJA 3NIZA 3WF6A 1FMOE 4CZUA 4RIYA 4YJRA 3WILA 4ZTMA 3PA3A 3AXWA 2R7BA 5E8VA 4DFNA 3BX5A 3FE3A 3OF0A 4R1YA 4BBFA 4DEHA 4JX7A 2Z02A 1WMKA 1TKIA 4MD9E 5BUJA 3VULA 3HMNA 3HV4A 4QMMA 2QCSA 4D1SA 4O4FA 4DTBA 4FKQA 4GCJA 2UW9A 5HX8A 5L8KA 4F08A 2IJMA 5ETFA 4LMUA 3T3UA 4BZNA 3Q9XA 4RMZA 1S9JA 4FNYA 4RJ6A 3FMLA 3ZEPA 4EH7A 3LCSA 4ZTQA 4U7ZA 5M06A 4PMMA 2WMAA 1YQJA 3BV3A 4ZK5A 4DN5A 2PMIA 3REPA 3VS3A 5HLNA 4L42A 4CFVA 4OBPA 3KRJA 1QPEA 4HGSA 2GS2A 3MYGA 4G6NA 4RJ7A 4ZIMA 5M09A 4RZVA 3MS9A 4ZZMA 4XRJA 4F0FA 4H1MA 2GNLA 2ERKA 4V05A 1H1PA 4IM3A 3MTFA 2YITA 4D2SA 2ZV8A 3O2MA 2WTWA 4G5JA 2W4JA 2VX3A 4FKVA 4QMWA 5DWRA 5AP7A 5F4NA 4HVDA 5IEVA 2IF8A 3A61A 3ZHPC 1BUHA 1OI9A 4X2GA 3R8ZA 3UDZA 1ZXEA 2O3PA 4Y8DA 4XG4A 5C27A 2BHHA 3UE4A 4DHJA 4G5PA 4QYGA 4A7CA 3HECA 3BLRA 3PIXA 3R1SA 4O4EA 3BHUA 4JDKA 2W17A 3EZVA 5TF9A 1J1CA 5IU2A 3CTJA 3POOA 3E93A 4FZFB 1FBNA 1JSTA 5E90A 1Q8UA 1R78A 4O27B 3KXZA 3OBGA 4UMQA 4UXQA 4U42A 4ZTNA 3MW1A 3ZH8A 1L3RE 4FL3A 4QMYA 2R3OA 5HLPA 3GCSA 3FLWA 2XNNA 3R8MA 2YLFA 4PNKA 5EOLA 4IVCA 3VJNA 4AA0A 4JQ7A 1Q8WA 3LFDA 1TQIA 3CQUA 4G34A 4X3FC 5HBEA 2WMSA 4OTQA 2I6LA 4QYYA 4YNOA 4HNIA 5AR8A 3R9OA 3SRVB 5HO7A 3IS5A 1LUFA 4OBQA 4ARKA 1KV2A 4PDSA 5FEQA 5JRSA 5J9YA 4AOJA 3UZTA 4F1OA 3AGMA 2XM8A 3ZRMA 2J0LA 2OZAA 4G3FA 5CNNA 4B9DA 5KHWA 4EQUA 5A54A 3LFQA 3D2KA 2C1AA 3BHTA 2B52A 4OT5A 3FMMA 4XYFA 3RMFA 1H08A 1YOMA 5CI6A 3DK6A 4D4VA 1PXMA 3ZM4A 4I94A 2WHBA 5CEPA 4K33A 4FSNA 5IQAA 2C4GA 2FO0A 3ANRA 3O71A 4GS6A 4HCVA 2NYAA 3LW0A 2CCHA 2Z2WA 5KBRA 4IEBA 1OUKA 2QOHA 2FH9A 4AZSA 1VYWA 5L8LA 4RJ8A 2CHLA 3SRVA 4CLJA 4C4FA 3M11A 5C4KA 3DS6A 4CGAA 2PMNX 1B38A 3DV3A 5L3AA 3VS2A 3ML1A 1UWJA 1XKKA 1JNKA 3QLGA 4PMSA 4WG4A 4YGAA 3QAME 4RPVA 4EOQA 5AP5A 5AP6A 5LVNA 4CEGA 3TKIA 2W99B 3P08A 2EB2A 4R77A 3VF8A 4OTGA 5AUTA 1U54B 3EQFA 3DCVA 2RFEA 4IVBA 4CMTA 5IH5A 3MVJA 3PXQA 5JKGA 2PVNA 2GTNA 2JIUA 2XIKA 4FEWA 2VTLA 4AGUA 3PYYA 3QCSA 2X0GA 3PSBA 2W1HA 4ACCA 3VUHA 3MB6A 4M0YA 3E3BX 2QONA 4FMQA 4XG7A 3Q96A 3VAPA 1XH8A 4ANSA 3QQUA 4KA3A 3CEKA 2BHEA 3QBNA 1JKSA 4QNYA 4UWBA 2PVRA 5EW9A 5EI2A 5IF1A 3HDNA 1VLRA 5EH0A 2R3NA 2PZ5A 2F2UA 5AUVA 3VBYA 3WOWA 2XMYA 4HYIA 4B99A 5J87A 4DH7A 1UNGA 2WU6A 5E8TA 3DB8A 5I9XA 4FTLA 4EOMA 3HMIA 4Y85A 5EDRA 3FQEA 3UQGA 3NFGB 5FQDC 2QHNA 5K4IA 5AUXA 4LOPA 4C8BA 2C6TA 3NR9A 4AE9A 5E8XA 4K1BA 4TWCA 1REJA 4AGDA 3NVMB 4BKYA 4NTSA 3OXIA 3Q6UA 2F7EE 3U54A 3QLFA 1UU3A 4YHTA 4AAYA 2EWAA 4G9CA 3KCFA 3QQGA 5ANDA 2RFDA 4GL9A 1PKGA 2QI8A 3QTQA 2ERZE 2X6EA 3RGFA 3U51A 2ZYBA 5AAFA 1J1BA 4CFUA 4H39A 3CY3A 3H0ZA 2QG7A 4R78A 1NVSA 2JEDA 5E4HA 4F9BA 4FTMA 1KV1A 4P4CA 3G9LX 3KCKA 3O7LB 3ANQA 3V04A 5CASA 4J99A 5CEMA 3GCQA 3ZUVA 3IOKA 2YCSA 3FY2A 4RLKA 3RNYA 3TKUA 4YHJA 1QPCA 2E9NA 3GGFA 3IO7A 3DZOA 4O0TA 4RC3A 3VBXA 4FKJA 4YHFA 3UQCA 5I9UA 3T3VA 1E1VA 1M7NA 4HNFA 4OR5A 5HOAA 4IC8A 3TV6A 4ERKA 3WIKA 5EM6A 1OIRA 4EH8A 5EYKA 3OCBA 4OAUC 4WSQA 1SMHA 1V1KA 2C6MA 2CCIA 2ITNA 4JIAA 4PQNA 3MVMA 3RZBA 2V55A 2YIXA 4CZYB 2I7QA 5HESA 3U6HA 4DE4A 1VZOA 1REKA 3EIDA 3HX4A 2XBJA 4LV5A 3C4FA 4FK3A 4MHAA 5DRDA 1PJKA 3A7GA 5AIKA 4WRSA 2C6EA 5DR2A 3OMVA 4BCHA 2PUPA 4W8EA 4C33A 2QO2A 4M0ZA 3BHVA 4W4YA 5FGKA 4QYEA 4A9TA 5IDPA 4I3ZA 2YJSA 2YFXA 2GS7A 4FGBA 4APCA 3V5QA 3EFWA 2V5QA 4I20A 1TZDA 4NIFA 3KF4A 4L67A 3PIZA 4BGGA 2YISA 2REIA 3WF5A 1M2PA 4FV9A 5KNJA 4AZEA 3ZLWA 4I1ZA 4E20A 2ZV9A 3ZFXA 2PVFA 3PE1A 5ANJA 3D7ZA 3HV5A 3PJCA 4ZEGA 1Q3DA 2IW8A 4LGDA 4IDVA 4G6LA 1QPDA 4KBCA 2C5VA 4FT3A 4DGOA 3MPMA 2YERA 3TIYA 2EXCX 4U3ZA 3K3IA 4RVLA 5BQ0A 1SVHA 1XH7A 3A8XA 4GU6A 2PUUA 4IFGA 4QQJA 3D0EA 4O4BB 5AMNA 1PXPA 4QNAA 3R28A 4FZ6A 4GT5A 4KBAA 3HP2A 3FSKA 4USFA 3COKA 3VBWA 3EQCA 4L44A 1BLXA 2Z7RA 5BVNA 3L8XA 1O6YA 3R83A 3SHEA 4ENYA 4JIKA 5HBHA 5H3QA 3QU0A 4F0IA 3GFEA 5EOBA 3CLYA 4DTKA 4EOIA 4QQTA 5A6NA 3EQIA 3MB7A 3U9NA 3W2PA 2CGVA 3MWUA 4HCUA 4RWLA 3SOCA 3KMMA 3EN5A 4BWKA 4NW6A 5HI2A 4YLKA 4EORA 5LVPA 5L6WL 4CSVA 1IG1A 2WFYA 4FJVA 3DKGA 3R8PA 4BIEA 3MH2A 1XBAA 2G01A 2JDSA 5IMXA 2SRCA 4XUFA 4D4SA 3VQUA 1KE5A 4C37A 4FKUA 3DLSA 4YSJA 4O0WA 1GIIA 2BIYA 4IX6A 4FVRA 4PPAA 2FSLX 4W8DA 4YTFA 5BVEA 2ITQA 4HYSA 2X9FA 4IAAA 3ZC5A 2BZHB 2BUJA 3JVSA 2YEXA 3GFWA 3UO4A 2G2FA 3R1NA 4I24A 4A07A 4OLIA 2CNVA 4XP2A 1JPAA 1KSWA 3C50A 1AGWA 4WHZA 5C03A 2VO0A 2ZOQA 3FQHA 4GFOA 4M7IA 3BYSA 4FZDB 5DBXA 4LGGA 3KXMA 2VTJA 3QCXA 2PULA 4O1PA 2ITVA 3R71A 4FT9A 4ANQA 4CTCA 3PVWA 3WE8A 3IOPA 3PPJA 3KVXA 3W2SA 4DH5A 3PDTA 1XH5A 4FE2A 3W0RA 2B9JA 5J79A 2BRGA 3VNTA 3COMA 4AN3A 4EZ3A 2GPHA 5FUTA 1YOLA 4IJPA 4JS8A 3WARA 5A4QA 4CRLA 3OW3A 3DOGA 4FSRA 3TV7A 2FYSA 1H01A 3QRTA 1GZOA 2LAVA 5CEKA 4CG8A 2XIZA 4YLJA 3VWAA 3ZFMA 1BL7A 4FEUA 4AXCA 1XQZA 3T9TA 3VS5A 4BCFA 2XCHA 3L9MA 4E6AA 2J5EA 3KY2A 5AUWA 1A48A 1JSUA 4NCTC 1H0VA 4FBXA 4OTPA 4RC2A 2OG8A 4BCKA 4C02A 4N0SA 5DT0A 2J2IB 5AX9A 3ENHA 4FG9A 4ONAA 4DTAA 4E73A 2AC5A 5L2SA 4KRCA 3ORNA 3KMWA 4RJ4A 2X7OA 3LJ0A 4KRDA 4JJRA 3W10A 5KKRC 4G2FA 4IW0A 4LL0A 4BI2A 2VWUA 4BGHA 5HTIA 2J51A 4E5BA 2Y8OA 5T3QA 2B1PA 4AOIA 4FKWA 4WSYA 5AIRA 3Q2MA 1OKZA 4XCUA 4F65A 3MV5A 1T45A 4RIXA 3BBWA 4M3QA 4GU9A 4ZJIA 3UVPA 1YVJA 5L2IA 2WMQA 5IQBA 4ZMFA 5CU0A 4XX9A 3MA3A 4DGLC 4KABA 3W2QA 2F57A 4IWDA 4G17A 4EUTA 4B8MA 4LUDA 3LXKA 1GZ8A 2O65A 3ZS5A 3ZSIA 4BZOA 1NW1A 3ELJA 5F20A 3Q53A 2ITYA 2R9SA 3EQHA 4ANLA 1ZMWA 1O6KA 4E5WA 4I5MA 4FF8A 3O51A 2ZM4A 4FYOA 1YXUA 2WEVA 4RIOA 2IVTA 4AW1A 2JAMA 3F2RA 2O8YA 2C6DA 3GOKA 4HOKA 5D9HA 3FQSA 4G3DA 3ZO3A 4CYIA 4ZXTA 1G3NA 4EK6A 3FHIA 3KIOC 4F6UA 3C5UA 3FC2A 4RGJA 4C3PA 1PW2A 3OXTA 5IUHA 3FEGA 2WELA 4DEEA 2C5NA 5CAPA 3C13A 4EC9A 1Z5MA 2HXQA 4RWJA 3P7AA 4XEYA 3KKVA 3ULZA 3I6UA 4RIXB 5M4IA 5KMIA 1ZYLA 2VWBA 4G1WA 4TKSA 4UY9A 3NYNA 3R7UA 4D2PA 4J95A 4R8QA 4FT7A 3TDVA 3TTJA 2X2KA 3OVVA 3C9WA 2VTOA 3EQGA 4D2WA 5AV1A 5CAOA 3MFRA 2UVXA 4YTIA 3CD3A 4FRFA 3I6WA 3ZU7A 2YCQA 4DINA 3AD4A 4FV3A 3E8EA 5IMEA 2XK6A 1OUYA 2NPQA 5EYDA 4PWNA 4E6QA 4Q5HA 3NFFB 2JFLA 2QOBA 4KSPA 4YJSA 4AGWA 4XG2A 3PUFC 4ALVA 3R7YA 4RVKA 3O5AA 4YJVA 4LRMA 3WZKA 3LQ5A 3ZDUA 5CXZA 3OWLA 3W55A 1DAWA 2VTRA 2QG5A 1PMEA 2WZJA 1K3AA 3PP1A 4MF1A 3C4CA 3KRLA 1P2AA 1RDQE 2ITTA 4J52A 4MWIA 2R3QA 1W84A 4RX7A 5DPVA 5EKOA 4BCIA 5EFQA 3Q5ZA 4FTCA 5A9UA 2X81A 3DU8A 4DFLA 5CANA 2YDKA 4FSZA 4FYNA 4I23A 3RPOA 5L2WA 3UZPA 5IPJA 1HCLA 4EEVA 4NJDA 5JGBA 2FB8A 3QF9A 2WXVA 4EHZA 4MWHA 5IUIA 3NUPA 4IB5A 2E2BA 3TJCA 3MH1A 2R3LA 5DEYA 3GUBA 3RK7A 3VBTA 3VS0A 1H1QA 4JG7A 3IDBA 2G15A 4E4NA 4NYEA 3JY0A 4H05A 3FSFA 4FSWA 2WTJA 3KF7A 5DFPA 1XJDA 4DHIB 3MY1A 4ZSLA 5IDNA 3PP0A 1H1WA 4JBOA 3QZHA 1XBBA 1APME 4FC0A 3U6JA 2Z7QA 5LMAA 3RP9A 5FBOA 5HE0A 4QP4A 4Q9ZA 5L4QA 5BMSA 3KA0A 5IEYA 4EKKA 4N6ZA 5HIEA 4PNIA 3UMXA 4TRLA 3CPCA 2E9VA 2ACXA 2O2UA 2XCKA 4JR3A 4AUAA 4EOJA 4F9AA 4YURA 4DFBA 2BDFA 3DXPA 3GBZA 3NIEA 3UNZA 4BWXA 4TYGA 2F4JA 3VW6A 4R6VA 4F7NA 2A4LA 1Y6AA 3PVGA 1LPUA 3CP9A 3D7TB 5CT7A 3CXWA 5JEBA 4FKRA 3EQDA 5CQWA 4J98A 3TI1A 5DA3A 2W1IA 3NWWA 3PSCA 4YZDA 4FTAA 3A62A 4DGNA 5KKRB 2XK3A 4XLVA 4XOYA 4WUAA 2I0EA 1YDRE 5EM5A 1J7LA 2DWBA 1QL6A 3VQHA 3ZRKA 3U8WA 4G31A 3CE3A 2V22A 3O8PA 4IHPA 5AAEA 3U6IA 1YW2A 3QTRA 1W98A 4I92A 4UWCA 4P5ZA 2EXMA 3ZLYA 4O83A 1U59A 4E26A 3F5GA 5CVHA 4LFIA 4FNXA 4EH4A 3V8SA 5G1XA 2WQNA 4XP3A 4ACHA 3JR1A 5HCXA 5IKWA 4UZDA 3PZHA 4WIHA 4E1ZA 3CSVA 4G6OA 2J6MA 2HZNA 5BVWA 3K3JA 3NNUA 5B2MA 4FEVA 3W8LA 4AU8A 4GRBA 2YACA 3V3VA 5CSXA 4ZS4A 2QD9A 3D7TA 4G3GA 5HU3A 4BHNA 1H1SA 3LCTA 4NKSA 5DN3A 4MD7E 2RG6A 1IA8A 3DBDA 3G2FA 1JAMA 4NFNA 4FSUA 5JSMA 1YDSE 2VZ6A 1SNUA 2XBAA 3MY5A 4N6YA 3LCOA 4NM3A 4DC2A 4C61A 3R0TA 2QR8A 1KE6A 4O81A 1XBCA 4HYHA 3HYHA 4IAFA 1M2QA 1UWHA 2PTKA 3CJFA 3OT3A 4FTQA 4KWPA 4UV0A 4XG9A 2ITUA 3RM6A 1H27A 4TXCA 1WVWA 5HE1A 4C2WA 4FOBA 4R7IA 2V7OA 4IZ7A 3IGGA 4WNKA 3DKFA 5E91A 5FXQA 4D1XA 2VWXA 2QHMA 3K54A 4RIWB 5HD4A 1M14A 4KNBA 4F70A 2FVDA 3MFTA 3ORTA 3LPBA 2CNQA 4HVHA 5LWMA 3V5JA 2BDWA 3MBLA 3N4TA 1SNXA 4BF2A 4FKLA 4E4MA 2JKMA 1PMUA 1AQ1A 2PHKA 4D58A 3NW6A 2IG7A 2GTMA 5CZIA 3S4QA 2XEYA 2YWVA 3DA6A 1O9UA 3LXNA 5FEDA 4L3PA 3OD6X 3E62A 4JAJA 3CD8A 5C1QB 1ZOGA 3L1SA 4WD5A 4XLIA 4EC8A 2PY3A 3E5AA 4KAOA 2C3IB 5HNGA 1ZRZA 4FTOA 5D7AA 1GAGA 1H07A 3RKBA 3MY0A 3PXFA 4W9WA 4X7QA 4D5HA 4C57A 4D0WA 4YR8A 3ETAA 3F3ZA 4ACMA 2EXEA 4AFJA 3U9CA 5CNOA 1ERKA 5HG7A 4DG3E 1SVGA 1W2DA 3U4UA 3L9LA 4U81A 4MNFA 4O7ZA 3BQCA 4M67A 3W0QA 2PL0A 1P5EA 3GU5A 4JOAA 3AC1A 4Y83A 4DT8A 1Q62A 3FPMA 1YWVA 3ULIA 1XMMA 1Y6BA 4WNOA 4YO6A 3RBWA 3PY3A 4ZTLA 4BI0A 1XO2B 4FV6A 2UZLA 2OJJA 2QOIA 2IN6A 4MK0A 3KK8A 4BRXA 3RCJA 2JIVA 3HA8A 5KMNA 2C3KA 3GI3A 1X8BA 4TPTA 1BL6A 4F78A 5CSWA 5EQYA 2DUVA 2PUNA 4FKPA 4YO4A 2YZAA 3NCGA 4XG3A 4XV3A 5CU2A 2XK9A 5BMMA 5AUUA 1J7UA 2OJFE 3DPKA 5EQEA 3E63A 1WBPA 4QTCA 4ZZNA 2XIRA 5DR6A 1V0PA 3DXNA 5HG5A 4NEUA 3S1HA 3NUYA 5FWKK 4FR4A 2R2PA 2PVMA 2WMRA 4F09A 4IH8A 4BZDA 1PXKA 3NW7A 2WQMA 1OBDA 4GKHA 2ZJWA 4H1JA 3D5UA 4W4VA 3OUNB 5LOHA 4OTWA 3PVUA 4CT2A 1NVRA 3RJCA 3WI6A 5JQ5A 2H96A 4R7BA 3S3IA 3DGKA 5H8GA 4IXPA 2X2MA 3PLSA 2X8DA 3IKAA 2WTKC 5CSVA 2QO7A 5AP0A 4EK8A 5FDPA 2XB7A 4GJ3A 3ODYX 1XR1A 4K77A 4Q9SA 1R3CA 1UKIA 4BI1A 4O2PA 4LRJA 4QYHA 2XK7A 4NW5A 4NZWB 2VWZA 4UBAA 1WAKA 5JFWA 2GNFA 3GC7A 4AF3A 4WKQA 2CMWA 3NUNA 1UNHA 1ZY5A 3AC3A 3UNKA 5FG8A 1CTPE 3Q9ZA 1Y57A 4U3YA 2BMCA 5HKMA 4ASZA 5AEPA 5IZFA 4QQCA 2ITPA 4C0TA 4JVGA 2ETMA 3F3VA 3VS4A 3O50A 3CY2A 4BDJA 2O5KA 2HWOA 4U5JA 5AUZA 4ZLYA 3F61A 3NW5A 3R02A 2HY81 4DITA 3DQXA 2GQSA 4PMPA 3GQLA 3LFNA 3P4KA 5KMKA 3F2AA 5ETCA 3F7WA 4ID7A 1FOTA 3LOKA 5KX8A 3NAYA 1YWRA 5JZNA 4F64A 2VNYA 1LP4A 2BFXA 2DQ7X 2OIDA 4QP3A 3ZRLA 1XMLA 4QMOA 2ITOA 3QFVA 1Y8GA 2Q0NA 3DFCB 3EMGA 3H0YA 1H28A 3AQVA 3MJ2A 4RZWA 4XV9A 3Q60A 2I0YA 2GU8A 1XH4A 3VUIA 4AW0A 4DAWA 4DHFA 5A4LA 5J5TA 2VRXA 4MYGA 2VTQA 3N9XA 4FIEA 2HZIA 3RK9A 2OJGA 3Q52A 2OSCA 3R9RA 4UYAA 2X7FA 4A9YA 4R5YA 1YKRA 5A4CA 4FTTA 4ALWA 3LKMA 3PLAE 3ZSGA 5TE0A 3PVBA 4GFGA 4O7NA 2C0IA 3HRBA 3H3CA 1PF8A 3TTIA 3AT3A 1MQ4A 3WZDA 2C3LA 2VTTA 4BDCA 4AE6A 2VX1A 2VTSA 2XKFA 3QD3A 4O0RA 4XP0A 3UPXA 5IH4A 5F94A 4IMYA 4F99A 2ZMDA 2E9UA 3F2NA 3FC1X 3LIJA 1KOAA 4K9YA 4O7WA 2XF0A 4ZMEA 4L52A 2UZOA 2HELA 2PK9A 3FI2A 3RHKA 3R22A 5BYZA 5I9VA 1W8CA 2UZDA 4CLIA 4DGGA 3NUSA 4GT3A 5CU3A 3SOAA 4C58A 4PP7A 4YJOA 4V04A 3BHHA 3LMGA 4YNEA 2EB3A 2ITWA 4E4LA 4YU2A 4TWPA 3FMDA 5A4EA 4FV4A 2ZV7A 3QCQA 4KD1A 3GC0A 2UZWE 4MCVA 2PWLA 4RA5A 4RFYA 5DEWA 2GNHA 2ZV2A 1DI8A 3P23A 4GEOA 5AFVA 1OKYA 3NNVA 1H24A 1WVXA 3KXNA 1Y91A 2W1EA 4TYEA 5AA9A 5CEOA 4JX3A 3NYXA 4O91A 2F2CB 3BQRA 3PG1A 5AR3A 3ERKA 1ZMUA 3R7OA 1R1WA 3TUBA 2OLCA 1OPJA 3CBLA 3O7LD 5IA1A 3DDQA 3MPTA 4D4RA 3KEXA 3VIDA 3QGYA 3OY1A 1RQQA 3ORPA 4O1OA 4IAYA 2BIKB 1URCA 4MXCA 2C5XA 4NK9A 4H3BA 2UZUE 4O38A 2HZ0A 2VWVA 2C69A 4BCQA 4F7JA 1OL7A 3PXZA 2AUHA 2Z7SA 3G6GA 4QMLA 4APPA 1IAJA 4ACDA 3FZRA 2ONLC 1E9HA 4Q2AA 4F9CA 4F63A 3G9NA 5EG3A 3KXGA 4ZOGA 3OTUA 3AT2A 4EHGA 4ZTHA 1PRYA 2RKUA 4L9IA 2GSFA 1JKLA 3DLZA 4IB1A 1K2PA 2YM3A 5A14A 4ANMA 4EOSA 3SG9A 3FLZA 1ZMVA 1WZYA 4RLLA 2UVZA 3PPZA 4RT7A 2R3IA 3ORZA 4JNWA 3LLAA 4O6LA 2JKOA 4C34A 2AQXA 2WMBA 4GYIA 5B0XA 4EOLA 4RIYB 2W0JA 4FG8A 3DK3A 3CIKA 3DNEA 5KMOA 4DBXA 3UMWA 1JOWB 4YZNA 1NA7A 4CQGA 4QOXA 4JBPA 2CLXA 4O2ZA 3TUCA 3P7CA 3VUKA 2O0UA 4FKGA 4C4EA 4Z55A 3QUEA 4DDGA 4OUCA 5IEXA 1H8FA 4BY9E 1A9UA 2RL5A 5H8BA 4FL2A 2YN8A 3RTPA 4QPAA 3BI6A 3NUUA 5DR9A 3TEIA 3AC8A 3UOKA 1IR3A 3FZ1A 4Y5HA 2F7ZE 5BNJA 3UTOA 3A2CA 4I21A 4ZTRA 4BDAA 3TJDA 2PU8A 3MVHA 1BKXA 3GC9A </