3CGOA

Irak-4 inhibitors (part ii)- a structure based assessment of imidazo[1,2 a]pyridine binding
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
356
structure length
332
Chain Sequence
DNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLASFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYREHTIEEWKELIYKEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 10
publication title IRAK-4 inhibitors. Part II: A structure-based assessment of imidazo[1,2-a]pyridine binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 332
sequence length 356
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cgoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cgoA01
1ND4A 4EK5A 5HD7A 4ANLA 4BN1A 5TE0A 3U9CA 2RFDA 3E5AA 3PXZA 4QMSA 5D9HA 3OZ6A 4XP3A 3S0OA 4ITHA 2XK9A 1SVEA 4RFZA 3O8UA 3ZSIA 2UVZA 4RRVA 4Q9SA 1WBTA 3OUNB 4ZTHA 5IDPA 2BCJA 2DYLA 1JBPE 1I09A 4IADA 4K77A 3RCJA 5KHXA 4MXXA 2VNYA 4EWQA 3PJ3A 3EL8A 5JQ5A 4YHTA 3OXZA 4J8MA 4F1TA 4J97A 4BTMA 3IQ7A 4AU8A 1QCFA 5GINE 3E8EA 4I21A 3CS9A 4ANQA 4JT3A 4UY9A 1Q4LA 5EI8A 3TTJA 1VYWA 2O65A 1R78A 4FNZA 4YNOA 5FEDA 2Y4IC 2XK4A 3POZA 2R2PA 3EZRA 4TRLA 5M51A 4PY1A 4AGWA 1KE9A 1PRYA 3LMGA 4PDPA 4A9UA 4MCVA 5CU3A 4L9IA 4S31A 3TACA 4F1MA 5K9IA 3ZLWA 4CLIA 3GFEA 4ZMFA 4HGSA 3C9WA 4RT7A 1QPDA 3R21A 5I3RA 3WZDA 3DXNA 5E92A 2QOBA 3E88A 4K8AA 3VS4A 4M13A 3EFWA 4ZZNA 2YACA 3K54A 3QCXA 3V5WA 1IA9A 3P5KA 2FO0A 3QRIA 3U4UA 4X2KA 5M56A 3SG8A 4F70A 1FVVA 4QTBA 2Q0NA 4FEQA 3NUUA 4AT5A 1I44A 1TQIA 1E9HA 2QOHA 3RM6A 3IGGA 4ZY4A 3GXLA 2ETKA 2JKKA 1PW2A 3JUHA 4YSMA 4B9DA 4MBLA 4M66A 3KKVA 2XM9A 3WF7A 5F94A 4ZSAA 2YIRA 2I0YA 2B9FA 2BRBA 3EQBA 5M4CA 4QMVA 3FPQA 5ETFA 3DA6A 2KTYA 1ZY5A 2CGVA 4RC4A 5IEXA 3QCSA 2XRWA 3NNVA 3G15A 2JDVA 5C4KA 4IVAA 4XNEA 4D9TA 4FV7A 2QKRA 3NAYA 3RWQA 4GK3A 3D2KA 1Q8UA 3SVVA 2ITVA 4JIKA 3RJCA 4EQUA 1L8TA 3NYOA 3UBDA 2O2UA 2OH4A 4O7RA 4ZMEA 5K4JA 2P33A 5E8VA 4QQJA 1PXNA 4RLKA 4P5ZA 4E5WA 1WVXA 5A4EA 2W17A 1FINA 4ZLOA 3U4WA 5LVNA 2XNOA 3BELA 3P7AA 4NJDA 2HZ4A 4YTCA 4DEGA 1CTPE 1W83A 3CE3A 3ORZA 4R78A 2OBJA 2YDJA 4C8BA 2CDZA 2RFSA 3L8SA 3NYNA 4FKJA 2NRUA 3LM0A 3P7CA 3QWJA 2C69A 3PYYA 5ANGA 3UOKA 2RIOA 4YJSA 2AC5A 4NIFB 1LR4A 3FMEA 1J7UA 4PWNA 4R7IA 4L00A 2GNFA 2W5AA 3PA3A 2OK1A 3P0MA 4TYHA 5CXHA 2IZRA 4KIKA 1KV1A 4O0YA 2JKMA 3EQIA 4AQCA 5DMZA 3QQFA 5EFQA 2OWBA 5JMSA 3AC3A 2WXVA 5HIBA 2XIRA 3BBWA 1F5QA 4DE4A 4GU9A 2F57A 3MV5A 5BMMA 3OROA 4QP6A 3PVBA 4AA4A 4DEIA 4FZFB 2WMBA 3R1NA 4HGTA 5FDXA 2YIXA 3W32A 3DLSA 1RW8A 4F7SA 2WQMA 4RX9A 4DT8A 1ZXEA 4IX4A 3R7YA 3VUMA 2DS1A 2J7TA 2P2HA 4JXFA 3WILA 2R3OA 2QU6A 4V05A 5AV4A 3HUBA 3GU4A 4RX7A 4QMOA 5D11A 3DPKA 2CLQA 1JSTA 3O17A 3PWYA 3O0GA 4CLJA 2R3HA 2HXLA 3V01A 3MESA 2RG5A 3LFEA 4LUEA 4BWPA 1JSUA 3ZUTA 3A62A 2CKOA 3BI6A 3W2OA 5CF8A 3FZSA 4FVPA 1Q3DA 4Y73A 3U6HA 1F3MC 2OGVA 5BYLA 2CN8A 1XR1A 1H1RA 4GFGA 4E6DA 1YXSA 5J87A 4OUCA 4E6CA 1O6KA 2AYPA 4RVTA 4BGGA 3QD0A 5AP1A 3O2MA 2XJ0A 1WVYA 4ZTMA 4FKVA 4RBLA 1OMWA 1BL7A 4IVDA 4O0XA 4AFJA 3NMUF 2UW8A 2JLDA 3FLQA 3Q9XA 4J8NA 3QRTA 3ZC6A 4O7TA 2I0HA 2XMYA 4AZVA 3F66A 2BPMA 3CCNA 2GFSA 1Q8WA 2EB2A 3F6XA 3MSSA 2J5EA 3QALE 4IANA 4MXYA 4BDEA 4NCTA 3SQQA 3DXQA 3U9NA 3PTGA 3RPSA 2WB8A 1REKA 3N51A 4OR5A 5KMMA 1OL7A 4FEVA 2YJRA 4DG0E 3UIUA 3FXWA 2VN9A 3DK7A 3EH9A 2ZV9A 4FNXA 4QP1A 5AV0A 3UVRA 4LOPA 4AF3A 4F4PA 4MXZA 3G51A 3HUCA 3VBWA 4AE6A 4LRJA 3AOXA 2C68A 3NPCA 3EQPA 3OMVA 3QF9A 4NCTC 3C4CA 2OICA 3FZTA 4MF0A 5CS6A 5IA5A 4XV1A 4W8EA 5DHJA 2FSLX 4ASEA 1SVHA 3PVUA 5AP0A 2OFUA 2QLUA 4F9CA 2BRNA 5K4IA 4RJ4A 4QYHA 2ITPA 1J7IA 5L8LA 3SKCA 5I9VA 5IA2A 1SNXA 3AC8A 4E6QA 3C4WA 3ZM9A 4ZAUA 1G8AA 4A4OA 3PVWA 5C27A 3RM7A 2GFCA 5I0BA 3POOA 3OCSA 4E4MA 3KB7A 4K2RA 1PJKA 3A60A 3HMPA 3IGOA 4WG4A 5B0XA 3EN4A 3MN3A 2X9EA 4FKRA 2W99B 2AC3A 2XNMA 4CCUA 2JIVA 5DR6A 5EQPA 2WMRA 5KBRA 3F7ZA 3Q9WA 4FGRA 4CQGA 3I7CA 3ORKA 5BVWA 5M06A 2SRCA 1UVRA 3Q32A 4OW8A 1ZY4A 2HK5A 4MNEB 2J90A 2WTKC 4KD1A 4C3RA 4YJQA 5JEBA 2UZNA 3KMMA 2WNTA 2YCRA 4HZSA 3DB8A 3VUKA 3TIYA 2B9IA 3PXRA 5CVGA 3O50A 3OY3A 4CV8A 1NVQA 3A61A 4J96A 4FIFA 2B9HA 3UIMA 3HRBA 4I41A 3K2LA 3HP2A 2WMVA 3LCDA 4JOAA 3R9RA 5DGZA 5CALA 4L45A 3UC4A 4EH9A 2C6TA 2P3GX 3CQEA 3ZM4A 4AACA 5EI2A 3KFAA 4JAIA 1WBSA 3BV2A 2GNIA 4AN2A 3NW7A 2Z7RA 4IEBA 2QG7A 5EYKA 3DJ6A 4JDJA 2JFMA 2G2IA 4C58A 5HU9A 3GI3A 5DT4A 3W1FA 4E3CA 3FQEA 4IIRA 4AS0A 3G2FA 3IDBA 3QQHA 5AV2A 4EI4A 4V0GB 3RAKA 1Q8YA 4DTBA 4YP8A 4WA9A 4AA0A 4MVFA 1XH7A 3QA0A 4FTUA 4GW8A 3WBLA 3OCBA 5CF5A 2V5QA 5K3YA 2E9UA 1DI9A 2E9NA 4KKEA 3NR9A 4IMYA 5EM6A 5C03A 3TKHA 5HORA 2CNQA 5IEYA 4J71A 1O9UA 2B7AA 3OUKA 3I60A 4IWOA 2GNLA 3MJ2A 4M15A 4NKAA 5FEQA 3RAWA 4O7LA 4FV0A 3SXRA 4D2SA 5CZHA 4YBKA 4E5AX 1SZMA 1UWHA 2HW7A 3R0TA 4XCUA 3R8UA 3LPBA 3O7LD 3VF8A 4C62A 4E7WA 4FEWA 1OPLA 4UEUA 3WZKA 1GIJA 4HYSA 3PA5A 2J2IB 3OWJA 2XYNA 4G1WA 1YVJA 4MWIA 2XH5A 1YQJA 3VS3A 2JBPA 4D4RA 3LJ0A 3PPJA 3ZSHA 1ZWSA 3AXWA 2E9PA 4WRGA 4FEXA 1ZYCA 5AUUA 5H3QA 1V0PA 4X3FB 4ZY6A 3C0GA 4UALA 2R3KA 3DFAA 3FY0A 4CG9A 4CFNA 2CHLA 3TNWA 4LOQA 2J0IA 2YDKA 3FI3A 4O22A 2P55A 2QOFA 5E90A 4QYYA 4KB8A 5AUXA 1UV5A 3EB0A 4UMQA 5AM7A 3OXIA 3PG1A 4MWHA 4CKJA 3QLFA 3OT8A 4FOBA 4FTTA 4U81A 3AC5A 2C5OA 3W2RA 2X7GA 5F20A 2R3NA 4DT9A 5T3QA 2G2FA 3DB6A 4M7IA 4CTBA 5AUYA 4UMUA 1XH5A 2YCQA 2P4IA 3TL8A 2QU5A 2XZSA 4AN3A 4F9BA 4FL3A 4RQVA 5HO7A 4PTCA 4L68A 3PUPA 4X2FA 2VO6A 5BVEA 2BKKA 2YHVA 5C9CA 4BIEA 4L7SA 4JRVA 4BDHA 4EH7A 4FKGA 4FYNA 3MB6A 3KQ7A 4EKLA 2LAVA 5A9UA 3NX8A 2XKCA 5EYDA 2QHNA 4ZTSA 5JSMA 3NW6A 3G90X 4HCVA 4MEDA 1NXKA 4MD7E 4ZS0A 4IWPA 2UW3A 3HX4A 4GJ3A 3KL8A 5J7HA 3NVMB 4P7EA 4LRKA 5DPVA 1AQ1A 5EYMA 1J1CA 1YI3A 3HV3A 3ZRMA 4F63A 3EN5A 3HKOA 5HG9A 4EH4A 1R39A 1CM8A 3B8QA 3LM5A 3GC0A 3PWDA 3TZ8A 4PTGA 4CSVA 3DBCA 4MQ1A 2OIBA 3EQHA 1H00A 4BI0A 4QMZA 4Q9ZA 3GB2A 2FH9A 3T3VA 2ITWA 3FMKA 3UQCA 4PV0A 1H1SA 3HA8A 3GC8A 4RLLA 1OGUA 3MPMA 4U44A 3QU0A 2O63A 5CT0A 3VBVA 4BL1A 3E62A 1OL5A 4GH2A 2HZIA 4A07A 5FTGA 4LG4A 4O7WA 2YLEA 5HE0A 3W8LA 5EM7A 3E8NA 4C3PA 2F2CB 3UQGA 5J9YA 3MFTA 1YOLA 3HDNA 5DFPA 5AADA 3RK7A 4L43A 3VUHA 1OL6A 4RJ6A 2C6KA 4NH1A 4P4CA 5CI6A 5CEKA 3MS9A 4I6BA 4FV9A 1OECA 2ITOA 2IW8A 4FKOA 4BI2A 2XK6A 5FBOA 3ZH8A 4YMJA 5DRDA 4N57A 2OI4X 3UYTA 2QOLA 4DGNA 2ITYA 3AG9A 2OIQA 2VO3A 1GZ8A 4O0VA 3R30A 3U6IA 2OXDA 3D7ZA 4JRNA 3ROYA 1KUTA 4TPTA 5AV3A 2Y6MA 4L01A 5GIOE 4O7YA 4I23A 3MYGA 4FKPA 2JEDA 4IJPA 4LM5A 5BVKA 3QQKA 3GBZA 1PKGA 1UU7A 3FXZA 2YZLA 4O21A 4Y5QA 3UNJA 4UYNA 2BKZA 3NGAA 1OBDA 2PZRA 4W9XA 3LXPA 1Y8YA 4LYNA 1XKKA 2X6DA 4FT0A 4QRCA 2Y8OA 4IFCA 5TO8A 3SW4A 3ZC5A 3ZZEA 2CCHA 4IAZA 1JOWB 4BCJA 4GT3A 4BDGA 1QL6A 1VZOA 2QR8A 3O8TA 4XEYA 3QBNA 2HAKA 5CYIA 5D10A 4YHJA 4S34A 3Q52A 4O0SA 2W4OA 3A4OX 3NUAA 2CKEA 2IZSA 4FICA 1G8SA 1H0WA 4XLIA 2GMXA 2OO8X 3FI4A 3QKLA 4I3ZA 5L6PA 3FHRA 3ODZX 4G3DA 1PXMA 3PJ8A 1B39A 1YOMA 4BKYA 4J95A 4M68A 2GHLA 5JGAA 3SV0A 3QCYA 4QQ5A 2BR1A 1JVPP 1FBNA 5HBEA 3N4UA 2Y4IB 3TG1A 4U6RA 4I5MA 2W5HA 4BHNA 2QD9A 5G1XA 4X6QC 1FMOE 1MP8A 3EQRA 4CZTA 1PXLA 4HVGA 3BYOA 2C6LA 4CFUA 5BPYA 2PPQA 2YM5A 1YDSE 3JS2A 5AAFA 4EONA 5HG7A 5B2LA 4NW5A 4N70A 4AFEA 2UZVA 3ZLXA 1E1XA 2BUJA 4FUYA 2YIYA 3IDCA 5AEPA 3HECA 2XIYA 4PPBA 5CANA 2X7FA 1YXVA 4HGEA 5DH3A 4O7SA 4BCMA 5KUPA 2H96A 1YXXA 4EBVA 2YCFA 5J9LA 1AD5A 5A6NA 3HGKA 1UWJA 3RPYA 1Q62A 2ITNA 2QR7A 1B6CB 5IH5A 2VGPA 3FYKX 3HMMA 2B54A 2XA4A 3ACJA 3UE4A 4EH6A 3VHEA 4EQCA 3OHTA 5J9ZA 4BTJA 5KKRB 3RPRA 4CD0A 4FSTA 3GCVA 3IKAA 2PUNA 1GIHA 4AW5A 4RIWA 3NW5A 4D2WA 3SG9A 3GNIB 3R2YA 4C4JA 4FG8A 4KSPA 2G9XA 4JIAA 4FX3A 4H1MA 3ORXA 5DOSA 1K9AA 3C4XA 5JRSA 5A4QA 3QWKA 2W1EA 4ZIMA 3NNUA 1XO2B 1DS5A 4L42A 4EYJA 3KU2A 3LCTA 3GENA 3OY1A 4AOJA 2C1BA 1M7NA 3UIBA 4FTNA 4HNIA 5FLFA 4MTAA 3QYWA 2PZPA 3F61A 3HA6A 4RA5A 3T9TA 1FQ1B 4R1VA 4NM5A 2X7OA 2X8DA 5CLPA 2PE1A 3COKA 3F2AA 5AA9A 5DYJA 3DNDA 5CU2A 4TW9A 4R6VA 3FMJA 3BGQA 4CMUA 3BYUA 5LMBA 3NUPA 5EKNA 4JBQA 2R3RA 2C3KA 2JD5A 1MRVA 3LJ2A 4O0RA 3NYVA 4QP4A 3BEAA 4YGAA 3SGCA 2ITQA 3NIEA 4IAFA 3TN8A 5EM5A 3CJFA 4M0ZA 2OH0E 4JX3A 4TYJA 3ZUVA 3LFDA 4FKQA 3GU8A 2Z60A 2W1HA 3HV4A 1GNGA 4Z7GA 2UUEA 1YXUA 3FLSA 2I0VA 3KVWA 3F5GA 4W8DA 5CU0A 4BY9E 2JGZA 4ZLZA 2PK9A 3GT8A 3EZVA 4RWIA 4BGQA 2WMUA 3U54A 4QYEA 3L8VA 4LMUA 3PZHA 2C5VA 3KMUA 3N9XA 3W2CA 3RNIA 1PMEA 2VX1A 3UO4A 4EHGA 4OTPA 2JAMA 4JG6A 4YLLA 1OZ1A 4O83A 2QO2A 3R7VA 3FUPA 3CIKA 1M14A 1PYXA 4LGDA 3VJNA 5DNRA 2UVXA 4Z3VA 1YDRE 2XKDA 4IB5A 5FRIA 1Q41A 4FT7A 2G2HA 3OG7A 3TNHA 4NTSA 1TQMA 4PTEA 3COIA 5FUTA 3R7EA 2W4JA 3LFNA 3DK3A 3Q96A 1H07A 4G16A 4JG7A 3DK6A 2XIXA 3TUDA 1G5SA 3A7GA 4NM0A 3RHKA 2JBOA 3W16A 1YWRA 4O1PA 4CZUA 1ZAOA 1ZYDA 3UMWA 5HO6A 4TYHB 2GS6A 5H8EA 3ZRKA 4W4XA 4QTAA 4PL3A 4BGHA 2WQBA 3VS0A 2Y9QA 4O27B 2IPXA 3UVQA 1YXTA 2WIPA 4N6ZA 3BV3A 4HYHA 3NUYA 4OTWA 3IO7A 5L2QA 4YU2A 2VO0A 3UJGA 3KN5A 4JAJA 3CP9A 1XH4A 4HPUE 4I0TA 3C4FA 3PG3A 4K33A 5H2UA 4RWLA 2PY3A 4HPTE 4IXPA 4S30A 3AMBA 3FEGA 4H05A 3HVCA 4AE9A 2Z2WA 2XVDA 1JKLA 2GTMA 2ZDTA 3GU6A 5CNOA 4WNKA 2GHGA 3MY1A 4BDDA 1ATPE 4IB3A 3R9OA 4O81A 4APPA 1BMKA 2UZWE 4FKUA 4D2VA 1K2PA 3BHUA 5L6WL 5AUTA 2WTWA 3MFRA 4N6YA 4TYIA 3DXPA 4U97A 3BE9A 5CWZA 1Q8TA 3JY0A 3CTQA 1O6LA 1P2AA 3VNTA 1UKHA 3R73A 5LVPA 2UZUE 4FIEA 3ZBXA 4F7NA 3QQGA 5FG8A 3IW8A 3F5PA 4NUSA 2RG6A 4L44A 2QLQA 4QD6A 5HX8A 5J5TA 4QNAA 1Q3WA 4A4XA 5HIEA 3RBWA 2XEZA 5LARA 3KEXA 5ETAA 2QO9A 2JDRA 5DIAA 2W1GA 3E3PA 4XV9A 5L2IA 4FF8A 4ZJIA 3TT0A 5AR7A 1JWHA 4WD5A 4BCPA 2PHKA 3W18A 3S95A 3QUDA 5GZ9A 1JQHA 4EHVA 4YURA 4OAVB 3HAVA 2QOKA 1KSWA 2R5TA 5I9YA 3UNKA 1QPEA 1ZRZA 3R71A 4E5BA 1OIQA 4XV2A 3UPXA 2Z02A 3CY2A 1OITA 3BHYA 5ANIA 4CCBA 2CN5A 5BYZA 1KOAA 4NFMA 3QC4A 1CDKA 2ITTA 3UO6A 3MPAA 3Q6UA 5KMLA 4BCOA 4AW2A 3ANRA 4G5PA 4U41A 2W4KA 2XEYA 2XNNA 3CPCA 2B1PA 3R7GA 4LL5A 5H9BA 5JK3A 3EN6A 3NZ0A 4PMPA 4RWJA 3QD2B 4KRCA 5I9UA 2YA9A 4O91A 4AZEA 1VR2A 5M44A 2PL0A 3OCTA 1REJA 4CVAA 3LLAA 4XS2A 2WGJA 3LFAA 4N0SA 3EOCA 4DBXA 3OT3A 3LXNA 1HCKA 3QTUA 4D1SA 4L67A 3FI8A 3DJ5A 2JITA 4GSBA 2J6MA 2R7IA 4A9SA 3TKUA 5E1EA 4BDIA 4M69B 5E8ZA 4E6AA 3S00A 5LVLA 2IW6A 2W1IA 1SM2A 1H26A 3B8RA 2PVLA 2XK7A 3BU6A 5HCZA 4GG5A 3R04A 3HAMA 3K3JA 4FVRA 4G3GA 5JKGA 4EOKA 5CT7A 5IISA 5AP4A 4P90A 3D7TA 4E20A 1URCA 3QQLA 3EKNA 3LHJA 4FZ7A 2B52A 1JAMA 5T68A 3LCOA 2PVRA 3VUIA 3I0QA 5IA4A 3S3IA 4YR8A 4NWMA 4FYOA 4K18A 4LV5A 4EYMA 5HTCA 3NLBA 3AT4A 3WZEA 3BEGA 3DTCA 3NIZA 1WBOA 1PHKA 2WTCA 2B9JA 3PP1A 4X21A 3ZSGA 4ZTLA 4E4NA 3QXOA 1IG1A 4FL2A 4I6QA 3KGAA 4XG3A 2EXCX 4L3JA 3R7UA 3MVJA 2GU8A 3FYJX 5A4LA 4EZ5A 3HV7A 3RKBA 5JT2A 4FT3A 3V5PA 4HOKA 2KULA 2PMNX 1Y6AA 4CT1A 1RJBA 4D58A 5B7VA 2ZM3A 2HY0A 4L6QA 3WF6A 2FA2A 1FGIA 2GPHA 5GZAA 4LGGA 1LEZA 4EJNA 5HVJA 3FZPA 4HJOA 5T6KA 1H01A 3G6HA 4FKSA 2W96B 3EQGA 2BHEA 4YJVA 2ZB1A 2XM8A 4CGAA 3RCDA 3KXHA 2R3JA 1UU3A 4FOCA 5IDNA 5HNGA 2EU9A 2PUUA 5HNIX 1H1QA 3NSZA 4PMTA 4QMQA 1NT2A 2UW0A 1UKIA 1DM2A 2H9VA 3UO5A 3PIXA 1OKWA 3OXTA 5K0XA 4U8ZA 4FR4A 3Q4CA 5AWMA 4FV8A 3QTQA 2JKQA 3GEQA 3MI9A 4WG3A 2PVNA 4L3PA 1WBPA 1W0XC 3CQUA 3DKFA 4QP8A 4FK3A 4QTEA 2OZAA 4B99A 1W8CA 4OTHA 4ZJJA 1BLXA 3EN7A 3LXKA 2REIA 2XUUA 3S4QA 3QRJA 2A1AB 4RA4A 3BWJA 3LLTA 5G6VA 4DEBA 1P4FA 5LOHA 3CC6A 4DG2E 2F7ZE 4PQNA 5EG3A 3TZMA 2EWAA 2VTOA 3D9VA 3IOPA 3KK9A 3ZFYA 4GK4A 4DFUA 2C47A 3LW0A 2X8IA 3FXXA 4O86A 2X2LA 4ZSGA 3KXXA 2NPQA 3ORLA 4PRJA 1SNUA 2VTAA 4O0WA 4EOPA 2HW6A 5BUJA 2WKMA 3GCQA 3VS6A 4I6FA 4EOIA 3SW7A 4IX3A 5KBQA 4BFMA 3RTPA 4I5HA 5FWKK 2Y7JA 3PIYA 4RVMA 2J50A 4AZWA 5IQBA 2QOIA 3UGCA 5DR2A 4NM7A 2ZOQA 2CPKE 3T3UA 5ANKA 3I5NA 4IBMA 3Q04A 4MH7A 3SLSA 2W9ZB 3LAUA 4CT2A 4WBBB 2XNGA 3W8QA 2GS2A 3F7WA 3V8SA 1J1BA 3VO3A 4YUQA 5M4IA 1B38A 3PSDA 5CSWA 2PZ5A 3CSVA 3FZRA 2H34A 4FI1A 2NRYA 3BPRA 1BKXA 3HRCA 3VBQA 3W33A 3UP7A 4QMPA 4O7NA 4RIXA 5ACKA 4F0IA 4OTRA 4F9AA 4ID7A 2O64A 3M2WA 5ANDA 4H3BA 4FV2A 5CXZA 3OOMA 2BHHA 3PXYA 1Q97A 4TN6A 2FGIA 4C4EA 5C01A 1BI7A 1E1VA 3GGFA 4WNOA 5DT0A 4BCKA 4F08A 2J0KA 3G5DA 2X8EA 4DGOA 5IQAA 3PY3A 2VWYA 1LP4A 4ACMA 5C4LA 4BTFA 4JL9A 3ZFMA 3QC9A 4R77A 2BTSA 3LVPA 3O96A 3GCPA 4FA2A 2E2BA 3IW5A 4RVLA 3HYHA 4DBNA 4FV6A 5CSPA 4WHZA 3A7FA 5LVMA 4TNDA 3RK5A 2OFVA 4EOLA 4IW0A 2BRMA 2QODA 2QCSA 4JQ7A 4NFNA 3C5IA 4DH3A 2BFYA 2G15A 2A19B 5AX3A 4IHPA 5CVFA 5AFVA 5GIPE 2EXMA 3CGOA 3ORNA 3VS7A 3WIGA 4ZS4A 3MGYA 3Q2MA 2RL5A 5DRBA 2PYWA 1XBCA 4I4EA 5IQIA 2VTPA 3ANQA 3R9HA 3E64A 4EOOA 4D4SA 3IS5A 4GFOA 4ACHA 4D1XA 1FVTA 1OKVA 2VZ6A 3I4BA 3LOKA 4ACDA 4GRBA 4G5JA 3TM0A 3BKBA 3NEWA 1U5RA 2YAAA 4QP9A 4BZDA 2IG7A 4B6LA 2XK3A 4CQEA 4EL9A 4F6SA 3JXWA 4IH8A 5JGDA 3FI2A 2JFLA 4ENYA 2X0GA 2UZLA 2CNUA 1YHVA 4EBWA 3UG2A 3MVMA 4OTDA 3H30A 3EHAA 4U5JA 4BIBA 5D7VA 5ICPA 3CPBA 5KMNA 4JG8A 3UZRA 1ZOEA 3TWJA 3FLWA 1OKYA 3VVHA 3OP5A 4XJ0A 2WHBA 4ALUA 4ASZA 3QL8A 4Q2AA 4FC0A 4Y46A 2BRHA 2GNGA 4MBJA 3GOKA 4S32A 1GZOA 4ZOGA 4IZAA 4NZWB 4DINA 1PKDA 4DEAA 2H8HA 2WTJA 4LOOA 4X2GA 4DN5A 4MBIA 5DA3A 4XOZA 3FDNA 4FSUA 4C37A 1NW1A 4YZDA 3VULA 1H24A 4XLVA 2R3LA 2XIKA 3DQWA 4MD9E 4XP0A 2I0EA 4V04A 3C50A 2YITA 4TXCA 5HICA 4MNFA 4R7HA 1Q8ZA 1PXJA 4XMOA 5B2KA 5HU3A 1PXPA 5A54A 4KIOA 3VJOA 4O82A 2CJMA 2YM7A 4QYFA 1XBAA 4E1ZA 2AUHA 1P5EA 1OBGA 2WQNA 2OJ9A 3WYYA 4U80A 5GHVA 2PTKA 4IFGA 4UX9A 1ZARA 5TF9A 3EN9A 4I22A 2BIYA 4E93A 4F0GA 1YRPA 2OJJA 1PXIA 3NUNA 3M1SA 4RG0A 3VF9A 3I81A 2GQGA 2HENA 4FTAA 3QTIA 3ET7A 3K5UA 3MY0A 1PYEA 2W1DA 2A4LA 3MBLA 2C3IB 5IUGA 1IEPA 2BDWA 4S33A 4UXQA 5HESA 5IQHA 3F2RA 2YM8A 3I5ZA 4M0YA 4YZNA 4GT4A 1DAWA 5BYYA 4ZP5A 3SOAA 1WFCA 2WFYA 3V5LA 1J7LA 4FNWA 3DJ7A 4EK4A 4FSNA 3DKOA 4FTKA 4H58A 5L4QA 4ZTNA 3VW8A 1PMNA 1SMHA 4TWPA 3BIZA 4FODA 4IM2A 4NW6A 4FT9A 4G9CA 4UYAA 4FT5A 5E1SA 4FG9A 4JBVA 3S2PA 1OPKA 5KHWA 5L2TA 4NIFA 2BZIB 4AUAA 1LPUA 2XP2A 5CEMA 4KA3A 5JQ8A 4BDFA 5HE2A 3L8PA 4HZRA 4LRMA 3QTRA 1BYGA 5AP2A 4I93A 5AR2A 3RNYA 5C8NA 5KMIA 3Q4ZA 1H4LA 1R1WA 3QTXA 5GJDA 3CR0A 2R64A 4E8AA 3TDWA 2WOTA 4QP7A 3PP0A 2C0IA 2BVAA 5E8TA 4IB0A 4BCHA 4GKHA 3SA0A 2ZAZA 4MD8E 2F49A 3QKKA 4M14A 4L3LA 4N4SA 1Z5MA 3HLLA 5A6OA 2W5BA 3OC1A 4QQCA 4BCFA 3VIDA 3P86A 5D12A 3LCSA 5FTQA 4DGMA 4DHFA 3E63A 4FIJA 2BDFA 3QTWA 5EM8A 2R9SA 3Q3BA 4DTAA 5GJFA 4IDTA 3N4TA 3QUPA 2BROA 2YCSA 3FZ1A 3HMNA 3W2SA 4F7LA 2GNJA 3FL5A 4YNEA 4O38A 5HEZA 3UDBA 3MH2A 2Z7QA 4ANBA 2ERZE 3ZCLA 2OF4A 4NU1A 5E8SA 3ZMMA 4UZHA 4E4LA 3LJ1A 3MY5A 4DH8A 4ZLYA 4QMNA 3UOLA 3DKGA 3I79A 2BRGA 3ERKA 3ZU7A 3QX4A 5IA0A 5EI6A 4NEUA 4DCAA 1YOJA 5EOLA 4AAAA 4EQMA 4RIWB 1JKTA 3EIDA 5ANJA 2GS7A 3IONA 3WYXA 3OFMA 3BYSA 4WOVA 2VTJA 2CGWA 2R3QA 4L53A 4QOXA 2XK8A 3TNPC 5J1WA 3HV6A 5KMOA 2IWIA 2YZAA 4UB7A 4KWPA 4BDKA 2PVFA 4A7CA 3TJDA 1GZNA 3DBQA 3I0OA 3A7JA 4F65A 4YC8A 2BTRA 5LCKA 5IQFA 1DAYA 3H3CA 4GYGA 2WMSA 4C3FA 4CFWA 4TL0A 3ID6C 4BI1A 2CLXA 2Z8CA 4Y5HA 3LMIA 4JDIA 2GSFA 2YAKA 4OBOA 3THBA 3QRUA 2C6DA 4FZAB 2YLFA 4QMMA 4EK6A 5M53A 4D2PA 4FL1A 3SRVA 4BCIA 4YHFA 4NT4A 1AGWA 4FKTA 2IVTA 3P9JA 4ZJVA 3H9OA 4MXAA 1OM1A 4DCEA 3LMHA 4F64A 4QMWA 3PPZA 4U79A 2HXQA 2XJ2A 3FC2A 4O96A 1OB3A 2F2UA 2I7QA 5A14A 3BU5A 2GDOA 3KY2A 1IR3A 4D4VA 4RX5A 4HNFA 4BDJA 3RZFA 2PVJA 3CQWA 2WMTA 4MXCA 2BFXA 3QZHA 3ULIA 3VRZA 4ACGA 3N4VA 4D0WA 3GC7A 2ZVAA 4TWOA 3SDJA 4OT5A 4GT5A 4KUJA 2VRXA 4PMMA 5IH4A 5IU2A 4UMPA 1RE8A 4RIYA 4UMTA 2CNVA 1BI8A 4FKIA 2YJSA 3MJ1A 5E8XA 1X8BA 2I6LA 3QZFA 4I5CA 2QKWB 3UZTA 3E93A 3ZBFA 2O8YA 5JZJA 4UBAA 4HYIA 2G1TA 3GU5A 3MTFA 2IVSA 3HEGA 3KRWA 4O2PA 5BX0A 1KE7A 3QX2A 4GYIA 5FP6A 4ANOA 2PZYA 4K11A 4O1OA 3AMAA 1XH6A 4PDSA 2QVSE 2B55A 4A9TA 5CX9A 2WMAA 5CNNA 3F5UA 3LFSA 4LMNA 4Z55A 2YWPA 3FWQA 2JDTA 4IWQA 1A9UA 4ZSEA 3A4PA 3V8TA 4F7JA 4C4HA 3R00A 4BDCA 5JFSA 1IRKA 1KE6A 4IACA 4QMXA 3FLNC 5HTBA 4C4GA 4O84A 2GCDA 4MNEA 3F3WA 2C6MA 2Y0AA 3PPKA 4H3PA 4HW7A 3PIZA 4BBFA 4BCQA 3QFVA 2V22A 4FSMA 5HTIA 4KKGA 3PJCA 3LQ5A 2VWWA 5FXQA 4EC8A 4Z7HA 5CF6A 4OTFA 5C26A 5DEYA 5CEQA 3CY3A 3VBXA 2HIWA 4FZ6A 5FM2A 1XHAA 3VRYA 3KULA 3HZTA 3AT3A 5BQ0A 3BWFA 4DEHA 3PXFA 3R02A 4Z16A 5HLWA 1S9JA 4YJPA 3IK3A 4YPDA 5EW3A 1YWVA 4BCGA 1H28A 2C1AA 5ETCA 3TTIA 3NRMA 3R8VA 2ERKA 3E3BX 4ORKA 1U5QA 4HCUA 3ZO1A 4I92A 5I9XA 1NVRA 4EC9A 1GAGA 4RZVA 3FBVA 2X4ZA 2H6DA 5HHWA 5AP3A 3QLGA 3G0FA 3F3TA 3VWAA 4EHZA 1OUYA 1OIUA 3A7IA 3FJQE 4I0RA 1U54A 3KXNA 2BAJA 3ORPA 4FTOA 4RWKA 3VC4A 4FUXA 3QKMA 1M52A 3HV5A 4JR3A 5DVRA 2UZDA 3KREA 3NUXA 2Z7SA 1FMKA 4TYEA 3L8XA 4QPAA 5CSHA 4O6EA 3TNIA 2VNWA 4ASXA 4FSZA 4XHKB 3QHRA 5LVOA 4U9AA 2ZM1A 2EUFB 4LI5A 4FBXA 2XNEA 3DFCB 4JX7A 4AW1A 3LFCA 4XP2A 1FPUA 4IAYA 3TZ9A 3ATSA 3U51A 3UOJA 4RQKA 3GP0A 4PF4A 5E8WA 1ZZLA 3EFJA 5CSXA 3NNXA 4KSQA 3OW3A 3V51A 5HBHA 3CTHA 5J5SA 4IWDA 4USEA 2X4FA 3I7BA 3R28A 2VWXA 4GL9A 3FSKA 3FAAA 2VX0A 5HOAA 4AZFA 4K0YA 5H8BA 3ZDUA 4IAIA 5HBJA 1OKZA 3MH1A 3NWWA 3LFFA 4F9WA 3D83A 1TQPA 5KNJA 3C5UA 2J5FA 4A06A 2XIZA 4FG7A 4WNMA 3BHTA 4FVQA 2Y4PA 4GEOA 2P0CA 4EZ7A 3UG1A 4J99A 5HX6A 2RKUA 3D5XA 3D7TB 2PVKA 3BGZA 3DCVA 1M17A 1UNHA 3IG7A 4TZRA 4GFMA 4H3QA 4JVGA 3LQ8A 2G01A 4U43A 2X81A 3B2TA 3F3UA 3LXLA 4EJ7A 4W9WA 4QQTA 2JIUA 3BGPA 5A3XA 4G31A 3DTWA 2R3FA 2XF0A 2YEXA 4H36A 4BDAA 2VTLA 3QCQA 5BUEA 3DBFA 5IZFA 4QMUA 3IOKA 3ELJA 2W06A 4TNBA 5CI7A 5IQDA 5AR3A 3IPHA 3OWKA 3C13A 3A8XA 1ZMWA 5KZIA 2VGOA 2WU6A 2C30A 3GQIA 4JBPA 4CYIA 4O0UA 1ZOGA 3G9NA 4KBKA 5C8KA 4JQEA 5CAQA 2YABA 5JFWA 4R8QA 3SX9A 1MRUA 1IAJA 2XNPA 2QI8A 4PP7A 3CTJA 3ZXTA 5AR4A 5CAVA 5HD4A 4S2ZA 2XNBA 2YIWA 3HRFA 4ZSJA 2PMLX 1ZMVA 3EJ1A 4FKWA 4CNHA 5EDQA 3OVVA 5F1ZA 3DY7A 4WNPA 4HVDA 4QYGA 4U42A 2PSQA 3G6GA 4FTQA 2XCKA 3FL4A 4MK0A 4TKSA 5HGIA 3ZHPC 4ANNA 1SYKA 1H1PA 3MW1A 4XBRA 5IUIA 5EDPA 4EH2A 3PDTA 1JKKA 3BX5A 5CEPA 4JNWA 4C57A 4I5PA 3NUSA 4D2TA 4GCJA 2CKPA 5D1JA 4ZTRA 3KA0A 3ROCA 2XYUA 2UVYA 4EOMA 3JYAA 4IC8A 4LGHA 4YJUA 4JQ8A 4KIKB 4FSRA 4KBCA 2OZAB 4YZBA 3SXFA 2XRUA 4IDVA 4DLJA 4IAAA 1PF8A 4EORA 4A9RA 5AAEA 4U40A 4OTQA 3CJGA 2XBJA 3REPA 3NVKI 3RK9A 4KRDA 4D0XA 4FTCA 1L3RE 5A4CA 3WIKA 3OBJA 2WQEA 1MQBA 3BBTB 3ETAA 3KRRA 3I6UA 4FSYA 5LQFA 4X6RA 5IQEA 4YJOA 5EQYA 2Q83A 3K5VA 3KCKA 3FY2A 4U7ZA 5HLNA 1UU9A 1V0BA 2BAKA 2UZTA 3EMGA 3WOWA 4USDA 2PE2A 1LUFA 5AUZA 4C36A 4UMRA 3UMXA 4EWHA 2QQ7A 2C0OA 3GU7A 4IZ7A 1H25A 2WPAA 4CEGA 3Q4UA 4GS6A 4XRLA 5L2SA 5LMKC 2X1NA 3BQRA 3FSFA 1H1WA 4GIIA 2RGPA 1H8FA 1HCLA 3V5QA 2VAGA 2CKQA 1MUOA 5D7AA 5ANEA 1WBVA 4JJRA 4LUDA 3U8WA 3E8DA 1VYZA 3QGWA 1BUHA 5AR8A 2V0DA 3QYZA 5CTPA 4OTGA 4J52A 3DBDA 1CKIA 3BLRA 4BBMA 3DT1A 4D2RA 2FB8A 2V62A 4DFBA 2ZM4A 1IA8A 1XH9A 5TR6A 5FDPA 3MIAA 4FGBA 4G6LA 2QO7A 4ANMA 5FGKA 3P79A 3U6JA 2VX3A 4RJ5A 5AP6A 1ZYLA 4OBQA 2JKOA 3H9FA 2YFXA 2WIHA 4FTJA 4DYMA 3MFUA 1W82A 4RIXB 2RFNA 3KN6A 5HCXA 4D28A 1JNKA 3ZYAA 2HELA 3EKKA 3NCZA 4X2JA 4WO5A 2NO3A 3MTLA 4OGRA 3BZ3A 4XUFA 4PUZA 5CAUA 3FZOA 2QC6A 4X7QA 4GK2A 2LGCA 3R9DA 3C51A 4QPMA 2PULA 4YC6A 4B7TA 4E4XA 3VS5A 3VQUA 3WE8A 4B8MA 3R63A 4FIIA 2XBAA 5FXRA 2QONA 2YDIA 4BRXA 2Q0BA 3R1YA 3JVRA 4J98A 2V55A 4FEUA 1YI4A 4TYGA 1YW2A 4BWXA 3KVXA 5B2MA 4FV4A 5FQDC 4DTKA 3ENHA 5GNKA 3WF8A 4CFVA 3CXWA 2X2KA 4TY1A 3VQHA 3GOPA 3W2PA 3FMLA 5I5ZA 3P78A 1U4DA 3ZONA 3P1AA 1Y91A 3EFLA 4DFXE 4I1ZA 4I6HA 4DFZE 4CKRA 5FXSA 2UZOA 3K3IA 2UZBA 3JY9A 4Y83A 3VS1A 3UPZA 3TKIA 4P5QA 4RX8A 2WTDA 1FGKA 2C3JA 3R7OA 1YI6A 3FMNA 3OWPA 3WE4A 1RDQE 4CFXA 3V5JA 4WT6A 4EUTA 1T46A 1Q99A 3O7LB 4FSQA 5CU4A 4K9YA 4YZCA 3AD5A 2WTKB 3RINA 3LCKA 3BRBA 4O6LA 1Z57A 3D5WA 4GMYA 2CGUA 3ALOA 3LZBA 5DN3A 4M12A 5H8GA 4E26A 3DDQA 3VBYA 2C4GA 4RMZA 5CY3A 3LFQA 1KV2A 3R6XA 4M97A 3O51A 3WARA 2NNWB 4F0FA 4IQ6A 3BU3A 3DAEA 1VJYA 4XG4A 4L8MA 2IJMA 3KXGA 3F5XA 4FV5A 2W9FB 4KIPA 4LQMA 4BB4A 5KE0A 5I3OA 5CQWA 5ETIA 4KIQA 4CYJA 4GJ2A 3WZJA 3OBGA 3AC1A 4EZ3A 3CKWA 4G9RA 5KKRC 3C1XA 1Q5KA 3RMFA 5EQEA 1GIIA 2YISA 4IVCA 4JBOA 2HY81 3KRJA 3TNQB 5J79A 3FLYA 4XOYA 3C0IA 1OPJA 3QQJA 1DI8A 4HVHA 5A46A 4BTKA 4A4LA 5HI2A 4ALWA 2DQ7X 4U0IA 1GJOA 3JR1A 4FTRA 4CRLA 5A4TA 2YN8A 3BCEA 2R7BA 1HOWA 3Q6WA 2JAVA 2ETMA 3COMA 3GFWA 1OIRA 3IDPA 5M4UA 4BKZA 4BDBA 1QMZA 3QRKA 4ZTQA 4HVIA 3TV4A 1OIYA 3VBTA 2WMWA 4PPAA 4LFIA 3FC1X 5BVDA 4AP7A 2UW4A 3BQCA 5KCVA 4EH8A 2VTMA 3D5VA 3BHHA 3FQHA 4FIGA 4ONAA 4DC2A 4XG9A 3RHXA 2R4BA 3FMHA 4JS8A 2PMOX 3RZBA 3P08A 2VWZA 3WF5A 4BYJA 1KE5A 4LV8A 4UWBA 1BL6A 3NNWA 1M2RA 3NCGA 4O7ZA 3PSCA 3FHIA 3OOGA 5IG1A 4PL5A 4DF3A 4C34A 2OJIA 3DV3A 2VU3A 4M8TA 2BAQA 2A27A 2YIQA 3AC4A 4DLIA 1NY3A 2FVDA 3OTUA 2X9FA 3R1QA 3QHWA 5IUHA 5KO1A 4NKSA 2W1ZA 3F82A 2UW9A 2XB7A 4AT3A 4MQ2A 2ZDUA 3H0ZA 4KINA 4D5HA 4C4FA 4APCA 3QZIA 3PY0A 4DG3E 3D15A 3DAKA 1GZKA 2WELA 3PVGA 4BR3A 3KC3A 5EW9A 2F7EE 1ZLTA 2VTTA 1OUKA 3ZUUA 3VHKA 4QP3A 3F3ZA 3Q60A 3CLYA 4IZYA 1RQQA 2R0UA 4NM3A 4RZWA 5CAPA 3TV6A 4PX6A 3A7HA 3M42A 5LCJA 5I9ZA 2CCIA 3QTSA 3Q9ZA 4UWCA 4R3PA 4B0GA 4EHEA 2C5NA 3MA3A 2IW9A 4F09A 3T9IA 4CXAA 2BALA 4ZSLA 4X0MA 3II5A 4IJ9A 3SC1A 5L2WA 2ZV7A 4AZTA 3R1SA 2J4ZA 1W84A 3R01A 5EOBA 2VO7A 4JDHA 2C3LA 3ZO4A 3DNEA 5HE3A 4BBEA 3ATTA 3U55A 2NP8A 3BE2A 1Q61A 5HO8A 3I1AA 4AG8A 5DT3A 5EHLA 4CG8A 3DGKA 1YKRA 4IAKA 3QZGA 4BZOA 3GCSA 3ORMA 1K3AA 4ERWA 5DE2A 3DS6A 5AV1A 3W10A 2VTQA 1JKSA 5J8IA 2WTVA 3IW4A 3PLSA 1T45A 4YJRA 2X2MA 3HDMA 4NSTA 3O23A 3RWPA 3ZTXA 1MQ4A 3PXKA 2ETRA 3ACKA 3KCFA 4EUUA 2A0CX 2R0IA 4J1RA 2GQSA 3L9MA 4AX8A 4MHAA 4RFYA 5HCYA 5HZNA 2YM3A 5EW8A 4XG6A 4NK9A 1OVEA 3R8ZA 4NL0A 4CFMA 5TOZA 3PY1A 5GJGA 3V5TA 4DITA 1XH8A 5M09A 3D2IA 2B0QA 4DEEA 1Q24A 4KABA 3QQUA 5EDRA 5EK7A 2DWBA 3FPMA 2W05A 1V0OA 2J0JA 3SRVB 1APME 4GUEA 4C02A 2QHMA 1GOLA 2HCKA 2X39A 4II5A 4UV0A 5KMJA 1IAHA 3CEKA 4M3QA 4KS7A 4EOJA 3SXSA 3CD3A 4BWKA 4GUBA 3LIJA 1ZZ2A 3GC9A 2WQOA 3ZOSA 1ZYSA 4NJ3A 3UC3A 2PVHA 2YM6A 4O2ZA 4AA5A 5AMNA 1URWA 1WBWA 4HVSA 3UTOA 3MIYA 5CENA 4DAWA 4IB1A 4TWCA 5M4FA 3AGLA 1XBBA 4CV9A 5HVKA 3B2WA 4C2VA 3I6WA 4W4WA 5GZ8A 5IA3A 5F4NA 1R0EA 2VWVA 1M2QA 3AGMA 4M69A 3DBEA 3PXQA 4RIYB 4RPVA 3QUEA 4GG7A 2VTHA 2UW6A 3GQLA 5BVNA 1FOTA 2QOOA 5FBNC 4ERKA 4WRSA 4W4VA 3QGYA 3W55A 3F3VA 2XKFA 3FMDA 2WEVA 4DFYA 4F9YA 3DAJA 4Y95A 5TT7A 4QMTA 3R8LA 3ZLSA 4TT7A 2E9VA 4HGLA 4R1YA 3IW7A 4YO6A 5FM3A 1PY5A 5ACBC 4FTLA 4C4IA 3UNZA 4DH5A 4RVKA 2EVAA 3E7OA 2RF9A 4QPSA 2OXXA 3V3VA 4PL4A 4B8LA 1H0VA 2W7XA 2PVYA 1CKJA 3L1SA 5IMXA 4IM0A 3ORTA 5DI1A 1TVOA 1H08A 4CMTA 4FV3A 3VUDA 4I4FA 5JGBA 5LJJA 3MB7A 4V01A 1OI9A 2CGXA 5IF1A 3HMOA 3F9NA 1WVWA 3AD4A 4D4YA 4G2FA 1V1KA 2VWBA 2XJ1A 4IVBA 5FTOA 5KZ0A 3L9LA 4PDOA 1Y57A 3HP5A 5E7RA 3TEIA 3A2CA 3OCGA 3KULB 4BVUA 4XG2A 2YERA 2GQRA 2O5KA 3KMWA 2EB3A 2CMWA 4ZEGA 4KS8A 5EYCA 4C59A 5JN2A 5ANOA 2OLCA 5DLSA 3U87A 3OEZA 4M84A 1KOBA 5HE1A 3Q2JA 4RJ7A 3BLQA 4XG8A 2FSTX 4RGJA 4I20A 2WZJA 3ZRLA 4EOSA 5I9WA 5AR5A 2OXYA 2R3PA 3HNGA 5IQGA 3KK8A 2C5YA 3ZEWA 3MH3A 3L9NA 3PJ2A 5K5XA 2OIDA 2ITUA 4C35A 4QNYA 3TV7A 1WAKA 4QTDA 4O0TA 1U54B 4U45A 1KE8A 4GU6A 4OT6A 4CTCA 3NAXA 3BYMA 4C0TA 4MXOA 2OZOA 4C33A 2XS0A 5AIRA 2ZV2A 5LWNA 1WBNA 1PMVA 5EHOA 5JH6A 2OSCA 2IN6A 3UYSA 3W2QA 2ACXA 4KBAA 3ULZA 4AN9A 3TUBA 1QPJA 4K6ZA 1SVGA 3CKXA 4JLCA 2WO6A 2WU7A 3SHEA 2R3GA 2OW3A 4JDKA 4XBUA 5TKDA 3GUBA 2B4SB 5IEVA 3MA6A 5CSVA 5JZNA 4R7BA 4RSSA 4BICA 3PZEA 4EEVA 4D55A 1U46A 5M57A 4BKJA 5CVHA 3G0EA 3ZO2A 4FNYA 3TXOA 4H39A 2RSVA 4YLJA 4EK8A 3ODYX 2Z7LA 2JDSA 3CD8A 3D14A 3RVGA 2UW5A 4F99A 4NYEA 2OU7A 3ZFXA 3VUGA 1U59A 3KRXA 3E7VA 1WZYA 4H1JA 3BYVA 4A9YA 3EL7A 3KXZA 5F95A 3MH0A 4NTTA 5E8UA 3V6SA 1S9IA 2OKRA 2FSMX 4MX9A 4EH5A 4G6OA 5FEEA 2JIIA 1ERKA 5K0KA 3WI6A 4I24A 2GHMA 4G3FA 3NS9A 2YWVA 3OEFX 3RALA 3O8PA 4ZY5A 4JR7A 2J0MB 5AIKA 3BHVA 3TIZA 2CSNA 4XYFA 3R2BA 3ZZWA 3AT2A 4QO9A 4D5KA 5FP5A 4YC3A 4B4LA 4CMOA 4DH1A 3VS2A 3QXPA 1O6YA 4YLKA 4XH6A 1Y8GA 5LXMA 4F6WA 4F1OA 2VTIA 5IQCA 2W1FA 4Q5EA 3MVHA 4MYGA 2FYSA 3FV8A 3C4ZA 3DKCA 3EWHA 3G9LX 3PFQA 4GVJA 4BIDA 3D5UA 3DDPA 2IZUA 3H10A 3EQDA 1XJDA 4D9UA 4R3RA 4ENXA 2GNHA 4ZZMA 4WIHA 3CBLA 4Y72A 4YO4A 4X2NA 3H0YA 5C8MA 1YHSA 3OWLA 1IASA 5J95A 2WD1A 2HYYA 1GY3A 4BZNA 2E9OA 4PMSA 5L8KA 2J0LA 2ESMA 3RPVA 5JFVA 1XWSA 3H9RA 2QOQA 3LFBA 1OL1A 4HYUA 4ITIA 4AW0A 3C0HA 3Q9YA 3DOGA 3E8CA 3Q5ZA 2QG5A 5AX9A 3T8OA 3F2NA 3TI1A 2VTSA 3P23A 4RIOA 3DQXA 5FD2A 4C61A 2VTNA 1CKPA 3V8WA 3ZXZA 5IA1A 3OF0A 4G34A 4C2WA 4FK6A 2A2AA 2J9MA 5AUVA 3FKOA 5IPJA 5M07A 2FUMA 4I0SA 4KNBA 2F9GA 1CMKE 5CQUA 4DGGA 4GVAA 4HCTA 4BCNA 3OD6X 2BILB 4E73A 2BIKB 3D0EA 4XRJA 4DFLA 4O7VA 5AUWA 2IZTA 3LQ3A 5BUIA 4AOTA 4G3CA 4AWIA 3H4JA 3RAIA 3PE1A 4Y85A 2ITZA 5BMSA 3LE6A 2HOGA 2V7OA 3TZ7A 5CEOA 4UN0C 3DZOA 3NYXA 2ITXA 3EQFA 3S1HA 4XV3A 2GTNA 2R3MA 3R83A 2XKEA 5IKWA 3RAHA 3VAPA 2PMIA 3SD0A 3UQFA 2VTRA 2O3PA 2HWOA 1ZMUA 2HZ0A 3KXMA 4EK3A 1H27A 1F0QA 3C4EA 1STCE 3DZQA 2P2IA 4PP9A 5AP5A 3P7BA 2OF2A 3R8PA 4FV1A 2HZNA 1QPCA 2V7AA 4UZDA 4IZ5A 4J53A 4YZ9A 3RP9A 5CASA 2OG8A 4W4YA 4YJTA 2PUPA 4IX6A 4KKHA 4YTIA 1WCCA 5KX8A 4QT1A 2IVUA 5KMKA 2C6IA 5AP7A 5CEIA 4FZDB 1YHWA 3C7QA 4TTHB 1YWNA 3M11A 3ZO3A 3PLAE 1CSNA 3MPTA 4V0GA 4EH3A 5ITAA 2PU8A 5JFXA 4PDYA 3PRFA 5E91A 3ENMA 2WOUA 4R5YA 5M55A 5JRQA 4YZMA 3RPOA 5DEWA 5HG8A 3PRIA 1TKIA 4WUAA 3VUTA 4ASDA 5CF4A 2ZJWA 1A48A 4BC6A 1JPAA 1M7QA 2W1CA 3A99A 3Q4TA 5AJQA 4ZZOA 3QD4A 4USFA 1BX6A 1P14A 3OW4A 3KF4A 1VEBA 3ITZA 1PXOA 1YDTE 4IM3A 5LWMA 4UWYA 5J7BA 3QTZA 4DFNA 2VUWA 4WUNA 3UOHA 2RFEA 5AM6A 3TJCA 4M67A 5BVOA 2JC6A 3IW6A 3OTVA 5EHYA 2UV2A 4YSJA 4YTFA 3RGFA 2F7XE 3JVSA 2BZHB 4X3JA 2J51A 3FMMA 2WEIA 5D41A 2HWPA 2UZEA 4QTCA 3QA8A 5HLPA 4ACCA 3VW6A 2QOCA 4IX5A 3OS3A 4AGDA 1M2PA 3TDVA 2O0UA 1G3NA 4FSWA 4X3FA 3LKMA 4BHZA 4R5SA 5DR9A 3MVLA 4G3EA 2PWLA 3R8MA 4P2KA 4AT4A 4EKKA 3AQVA 1UNLA 3F69A 3UIXA 3UZPA 4G17A 1J3HA 2R3IA 4CZYB 5L8JA 2Y6OA 2X6EA 1UU8A 5EH0A 4FTMA 5EKOA 4ZXTA 2ZB0A 3EFKA 3WZUA 2XCHA 4MKCA 5HG5A 4X3FC 1NVSA 3MDYA 1ZOHA 4G6NA 3FKLA 4AGUA 4AZSA 4EOQA 2OJGA 3E92A 1W98A 4GKIA 4L46A 3KRLA 2BZJA 1LEWA 4XX9A 2C5XA 3A8WA 4YBJA 5I4NA 4C7TA 3KF7A 5HQ0A 3SAYA 1PMUA 5J1VA 3ALNA 2WMXA 3QD3A 4Z9LA 3PE2A 3D4QA 2QURA 4KAOA 3FLZA 2FSOX 2W0JA 4JI9A 2ZYBA 3JPVA 1P4OA 4WBOA 4YJNA 3EYHA 4TWNA 4RFMA 3AMYA 4UXLA 1J91A 4AOIA 2C0TA 2WMQA 2BZKB 4MAOA 1UNGA 4QP2A 3ZLYA 4ANSA 1R3CA 5HIDA 3D94A 2VWIA 2C6EA 5DBXA 5F9EA 5K5NA 4IC7A 3GVUA 2PE0A 3EQCA 3L9PA 4J7BA 1JSVA 3F88A 4U3YA 4BYIA 3TUCA 4GV1A 1JLUE 3ORIA 5IMEA 3PSBA 3FE3A 3FKNA 3ZEPA 4FE2A 3NDMA 4PNKA 1FVRA 2WTIA 3VN9A 5HKMA 3MWUA 4I94A 2ZV8A 4OTIA 4CKIA 1MRYA 2PZIA 3CGFA 4DEDA 5BNJA 4OAUC 4GIHA 4YPSA 3TCPA 2B53A 5AAGA 4PPCA 3IECA 4FMQA 5CAOA 1Z9XA 1R0PA 2UW7A 3HL7A 3AC2A 4Q5HA 1XQZA 4RJ8A 5CZIA 5IH6A 4Y8DA 3HMIA 3O71A 4IE9A 4RJ3A 3SOCA 3UP2A 3E87A 4WKQA 3UODA 3WF9A 2ONLA 4OBPA 3R7IA 3GCUA 4DH7A 5HVYA 4ALVA 5LMKA 1NA7A 2JDOA 2ZMDA 2I1MA 4ITJA 4XG7A 5HNBA 4DGLC 5CU6A 4OLIA 4FIHA 4C38A 5LMAA 3EYGA 3Q53A 4WSQA 3DU8A 3DLZA 4WSYA 4D1ZA 4AGCA 5E4HA 2DUVA 2ONLC 1PXKA 2YM4A 3COHA 3MFSA 4FTIA 4RC3A 5DG5A 2BDJA 3Q5IA 4L52A 1EH4A 4PNIA 4CFFA 1WMKA 2VWUA 2EXEA 1A06A 2OJFE 2ZMCA 4YTHA 2WAJA 4FKLA 4U3ZA 3ZDIA 2VV9A 3V04A 2PVMA 3BLHA 5E9EA 4BF2A 1UA2A 1OL2A 4R3CA 2IVVA 2VD5A 3R9NA 4QMLA 2C6OA 3UVPA 4ARKA 2IO6A 1KWPA 4L7FA 4DA5A 4LL0A 2F4JA 2BMCA 3AD6A 5E8YA 2QNJA 3RI1A 1W7HA 5DWRA 1Y6BA 3R22A 4MF1A 5BVFA 3FQSA 4K1BA 5L6OA 5M08A 5AA8A 4ZK5A 2PUIA 4RC2A 4CRSA 2I40A 3G33A 4AXAA 4QMYA 4F6UA 1ZYJA 3V6RA 3ZS5A 3P4KA 3QAME 5C1QB 3PA4A 4WG5A 5L3AA 3PJ1A
chains in the Genus database with same CATH superfamily
1ND4A 4EK5A 5HD7A 4ANLA 4BN1A 5TE0A 3U9CA 2RFDA 3E5AA 3PXZA 4QMSA 5D9HA 3OZ6A 4XP3A 3S0OA 4ITHA 2XK9A 1SVEA 4RFZA 3O8UA 3ZSIA 3NFGB 2UVZA 4RRVA 4Q9SA 1WBTA 3OUNB 4ZTHA 5IDPA 2BCJA 2DYLA 1JBPE 1I09A 4IADA 4K77A 3RCJA 5KHXA 1W2CA 2VNYA 4MXXA 3PJ3A 3EL8A 4EWQA 5JQ5A 4YHTA 3OXZA 4J8MA 4F1TA 4J97A 4BTMA 3IQ7A 4AU8A 1QCFA 5GINE 3E8EA 4I21A 3CS9A 4ANQA 4JT3A 4UY9A 1Q4LA 5EI8A 3TTJA 1VYWA 2O65A 1R78A 4FNZA 4YNOA 5FEDA 3W0PA 2Y4IC 2XK4A 3POZA 3UDTA 2R2PA 3EZRA 4TRLA 5M51A 4PY1A 4AGWA 1KE9A 1PRYA 3LMGA 4PDPA 4A9UA 4MCVA 5CU3A 4L9IA 4S31A 3TACA 4F1MA 2IEWA 5K9IA 3ZLWA 4CLIA 3GFEA 4ZMFA 4HGSA 3C9WA 4RT7A 1QPDA 3R21A 5I3RA 3WZDA 3DXNA 5E92A 2QOBA 3E88A 4K8AA 3VS4A 4M13A 5BV3A 3EFWA 4ZZNA 2YACA 3K54A 3QCXA 3V5WA 1IA9A 3P5KA 2FO0A 3QRIA 3W0RA 3U4UA 4X2KA 5M56A 3SG8A 4F70A 1FVVA 4QTBA 2Q0NA 4FEQA 3NUUA 4AT5A 1I44A 1TQIA 1E9HA 2QOHA 3RM6A 3IGGA 4ZY4A 3O5AA 3GXLA 2ETKA 2JKKA 1PW2A 3JUHA 4YSMA 4B9DA 4MBLA 4M66A 3KKVA 2XM9A 3WF7A 5F94A 4ZSAA 2YIRA 2I0YA 2B9FA 2BRBA 3EQBA 5M4CA 4QMVA 3FPQA 5ETFA 3DA6A 2KTYA 1ZY5A 2CGVA 4RC4A 5IEXA 3QCSA 2XRWA 3NNVA 3G15A 4FJVA 2JDVA 5C4KA 4IVAA 4XNEA 4D9TA 4FV7A 2QKRA 3NAYA 3RWQA 4GK3A 3D2KA 1Q8UA 3SVVA 2ITVA 4JIKA 3RJCA 4EQUA 1L8TA 3NYOA 3UBDA 2O2UA 2OH4A 4O7RA 4ZMEA 5K4JA 4F78A 2P33A 5E8VA 4QQJA 1PXNA 4RLKA 4P5ZA 4E5WA 1WVXA 5A4EA 2W17A 1FINA 4ZLOA 3U4WA 5LVNA 2XNOA 3BELA 3P7AA 4NJDA 2HZ4A 3TMOA 4YTCA 4DEGA 1CTPE 1W83A 3CE3A 3ORZA 4R78A 2OBJA 2YDJA 4C8BA 2CDZA 2RFSA 3L8SA 3NYNA 4FKJA 2NRUA 3LM0A 3P7CA 3QWJA 2C69A 3PYYA 5ANGA 3UOKA 2RIOA 4YJSA 2AC5A 4NIFB 1LR4A 3FMEA 1J7UA 4PWNA 4R7IA 4L00A 2GNFA 2W5AA 3PA3A 2OK1A 3P0MA 4TYHA 5CXHA 2IZRA 4KIKA 1KV1A 4O0YA 2JKMA 3EQIA 4AQCA 5DMZA 3QQFA 5EFQA 2OWBA 5JMSA 3AC3A 2WXVA 5HIBA 2XIRA 3BBWA 1F5QA 4DE4A 4GU9A 2F57A 3MV5A 5BMMA 3OROA 4QP6A 3PVBA 4AA4A 4DEIA 4FZFB 2WMBA 3R1NA 4HGTA 5FDXA 2YIXA 3W32A 3DLSA 1RW8A 4F7SA 2WQMA 4RX9A 4DT8A 1ZXEA 4IX4A 3R7YA 3VUMA 2DS1A 2J7TA 2P2HA 4JXFA 3WILA 2R3OA 2QU6A 4V05A 5AV4A 3HUBA 3GU4A 4RX7A 4QMOA 5D11A 3DPKA 2CLQA 1JSTA 3O17A 3PWYA 3O0GA 4CLJA 2R3HA 2HXLA 3V01A 3MESA 2RG5A 3LFEA 4LUEA 4BWPA 1JSUA 3ZUTA 3A62A 2CKOA 3BI6A 3W2OA 5CF8A 3FZSA 4FVPA 1Q3DA 4Y73A 3U6HA 1F3MC 1G8KA 2OGVA 5BYLA 2CN8A 1XR1A 1H1RA 4GFGA 4E6DA 1YXSA 5J87A 4OUCA 4E6CA 1O6KA 1W2DA 2AYPA 4RVTA 4BGGA 3QD0A 5AP1A 3O2MA 2XJ0A 1WVYA 4ZTMA 4FKVA 4RBLA 1OMWA 1BL7A 4IVDA 4O0XA 4AFJA 3NMUF 2UW8A 2JLDA 3FLQA 3Q9XA 4J8NA 3QRTA 3ZC6A 4O7TA 2I0HA 2XMYA 4AZVA 3F66A 2BPMA 3CCNA 2GFSA 1Q8WA 2EB2A 3F6XA 3MSSA 2J5EA 3QALE 4IANA 4MXYA 4BDEA 4NCTA 3SQQA 3DXQA 3U9NA 3PTGA 3RPSA 2WB8A 1REKA 3N51A 4OR5A 5KMMA 1OL7A 4FEVA 2YJRA 4DG0E 3UIUA 3FXWA 2VN9A 3DK7A 3EH9A 2ZV9A 4FNXA 4QP1A 5AV0A 3UVRA 4LOPA 4AF3A 4F4PA 4LDTA 4MXZA 3G51A 3HUCA 3VBWA 4AE6A 4LRJA 3AOXA 2C68A 3NPCA 3EQPA 3OMVA 3QF9A 4NCTC 3C4CA 2OICA 3FZTA 4MF0A 5CS6A 5IA5A 4XV1A 4W8EA 5DHJA 2FSLX 4ASEA 1SVHA 3PVUA 5AP0A 2OFUA 2QLUA 4F9CA 2BRNA 5K4IA 4RJ4A 4QYHA 2ITPA 1J7IA 5L8LA 3SKCA 5I9VA 5IA2A 1SNXA 3AC8A 4E6QA 3C4WA 3ZM9A 4ZAUA 1G8AA 4A4OA 3PVWA 5C27A 3RM7A 2GFCA 5I0BA 4DHJA 3POOA 3OCSA 4E4MA 3KB7A 4K2RA 1PJKA 3A60A 3HMPA 3IGOA 4WG4A 5B0XA 3EN4A 3MN3A 2X9EA 4FKRA 2W99B 2AC3A 2XNMA 4CCUA 2JIVA 5DR6A 5EQPA 2WMRA 5KBRA 3F7ZA 3Q9WA 4FGRA 4CQGA 2XARA 3I7CA 3ORKA 5BVWA 5M06A 2SRCA 1UVRA 3Q32A 4OW8A 1ZY4A 2HK5A 4MNEB 2J90A 2WTKC 4KD1A 4C3RA 4YJQA 5JEBA 2UZNA 3KMMA 2WNTA 2YCRA 4HZSA 3DB8A 3VUKA 3TIYA 2B9IA 3PXRA 5CVGA 3O50A 3OY3A 4CV8A 1NVQA 3A61A 4J96A 4FIFA 2B9HA 3UIMA 3HRBA 4I41A 3W0SA 3K2LA 3HP2A 2WMVA 3LCDA 4JOAA 3R9RA 5DGZA 5CALA 4L45A 3UC4A 4EH9A 2C6TA 2P3GX 3CQEA 3ZM4A 4AACA 5EI2A 3KFAA 4JAIA 1WBSA 3BV2A 2GNIA 4AN2A 3NW7A 2Z7RA 4IEBA 2QG7A 5EYKA 3DJ6A 4JDJA 2JFMA 2G2IA 4C58A 5HU9A 3GI3A 5DT4A 3W1FA 4E3CA 3FQEA 4IIRA 4AS0A 1XMMA 3G2FA 3IDBA 3QQHA 5AV2A 4EI4A 4V0GB 3RAKA 1Q8YA 4DTBA 4YP8A 4WA9A 4AA0A 4MVFA 1XH7A 3QA0A 4FTUA 4GW8A 3WBLA 3OCBA 5CF5A 2V5QA 5K3YA 2E9UA 1DI9A 2E9NA 4KKEA 3NR9A 4IMYA 5EM6A 4AQKA 5C03A 3TKHA 5HORA 2CNQA 5IEYA 4J71A 1O9UA 2B7AA 3OUKA 3I60A 4IWOA 2GNLA 3MJ2A 4M15A 4NKAA 5FEQA 3RAWA 4O7LA 4FV0A 3SXRA 4D2SA 5CZHA 4YBKA 4E5AX 1SZMA 1UWHA 2HW7A 3R0TA 4XCUA 3R8UA 3LPBA 3O7LD 3VF8A 4C62A 4E7WA 4FEWA 1OPLA 4UEUA 3WZKA 1GIJA 4HYSA 3PA5A 2J2IB 3OWJA 2XYNA 4G1WA 1YVJA 4MWIA 2XH5A 1YQJA 3VS3A 2JBPA 4D4RA 3LJ0A 3PPJA 3ZSHA 1ZWSA 3AXWA 2E9PA 4WRGA 4FEXA 1ZYCA 5AUUA 5H3QA 1V0PA 4X3FB 4ZY6A 3C0GA 4UALA 2R3KA 3DFAA 3FY0A 4CG9A 4CFNA 2CHLA 3TNWA 4LOQA 2J0IA 2YDKA 3FI3A 4O22A 2P55A 2QOFA 5E90A 4QYYA 4KB8A 5AUXA 1UV5A 3EB0A 4UMQA 5AM7A 3OXIA 3PG1A 4MWHA 4CKJA 3QLFA 3OT8A 4FOBA 4FTTA 4U81A 3AC5A 2C5OA 3W2RA 2X7GA 5F20A 2R3NA 4DT9A 5T3QA 2G2FA 3DB6A 4M7IA 4CTBA 5AUYA 4UMUA 1XH5A 3P5JC 2YCQA 2P4IA 3TL8A 2QU5A 2XZSA 4AN3A 4F9BA 4FL3A 4RQVA 5HO7A 4PTCA 4L68A 3PUPA 4X2FA 2VO6A 5BVEA 2BKKA 2YHVA 5C9CA 4BIEA 4L7SA 4JRVA 4BDHA 4EH7A 4FKGA 4FYNA 3MB6A 3KQ7A 4EKLA 1G8JA 2LAVA 5A9UA 3NX8A 2XKCA 5EYDA 2QHNA 4ZTSA 5JSMA 3NW6A 3G90X 4HCVA 4MEDA 1NXKA 4MD7E 4ZS0A 4IWPA 2UW3A 3HX4A 4GJ3A 3KL8A 5J7HA 3NVMB 2AEGA 4P7EA 4LRKA 5DPVA 1AQ1A 5EYMA 1J1CA 1YI3A 3HV3A 3ZRMA 4F63A 3EN5A 3HKOA 5HG9A 4EH4A 1R39A 1CM8A 3B8QA 3LM5A 3GC0A 3PWDA 3TZ8A 4DHZA 4PTGA 4CSVA 3DBCA 4MQ1A 2OIBA 3EQHA 1H00A 4BI0A 4QMZA 4Q9ZA 3GB2A 2FH9A 3T3VA 2ITWA 3FMKA 3UQCA 4PV0A 1H1SA 3HA8A 3GC8A 4RLLA 1OGUA 3MPMA 4U44A 3QU0A 2O63A 5CT0A 3VBVA 4BL1A 3E62A 1OL5A 4GH2A 2HZIA 4A07A 5FTGA 4LG4A 4O7WA 2YLEA 5HE0A 3W8LA 5EM7A 3E8NA 4C3PA 2F2CB 3UQGA 5J9YA 3MFTA 1YOLA 3HDNA 5DFPA 5AADA 3RK7A 4L43A 3VUHA 1OL6A 4RJ6A 2C6KA 4NH1A 4P4CA 5CI6A 5CEKA 3MS9A 4I6BA 4FV9A 1OECA 2ITOA 2IW8A 4FKOA 4BI2A 2XK6A 5FBOA 3ZH8A 4YMJA 5DRDA 4N57A 4DHIB 2OI4X 3UYTA 2QOLA 4DGNA 2ITYA 3AG9A 2OIQA 2VO3A 1GZ8A 4O0VA 3R30A 3U6IA 2OXDA 3D7ZA 4JRNA 3ROYA 1KUTA 4TPTA 5AV3A 2Y6MA 4L01A 5GIOE 4O7YA 4I23A 3MYGA 4FKPA 2JEDA 4IJPA 4LM5A 5BVKA 3QQKA 3GBZA 1PKGA 1UU7A 3FXZA 2YZLA 4O21A 4Y5QA 3UNJA 4UYNA 2BKZA 3NGAA 1OBDA 2PZRA 4W9XA 3LXPA 1Y8YA 4LYNA 1XKKA 2X6DA 4FT0A 4QRCA 2Y8OA 4IFCA 5TO8A 3SW4A 3ZC5A 3ZZEA 2CCHA 4IAZA 1JOWB 4BCJA 4GT3A 4BDGA 1QL6A 1VZOA 2QR8A 3O8TA 4XEYA 3QBNA 2HAKA 5CYIA 5D10A 4YHJA 4S34A 3Q52A 4O0SA 2W4OA 3A4OX 3AKLA 2CKEA 2IZSA 4FICA 1G8SA 3NUAA 1H0WA 4XLIA 2GMXA 2OO8X 3FI4A 3QKLA 4I3ZA 5L6PA 3FHRA 3ODZX 4G3DA 1PXMA 3PJ8A 1B39A 1YOMA 4BKYA 4J95A 4M68A 2GHLA 5JGAA 3SV0A 3QCYA 4QQ5A 2BR1A 1JVPP 1FBNA 5HBEA 3N4UA 2Y4IB 3TG1A 4U6RA 4I5MA 2W5HA 4BHNA 2QD9A 5G1XA 4X6QC 1FMOE 1MP8A 3EQRA 4CZTA 1PXLA 4HVGA 3BYOA 2C6LA 4CFUA 5BPYA 2PPQA 2YM5A 1YDSE 3JS2A 5AAFA 4EONA 5HG7A 5B2LA 4NW5A 4N70A 4AFEA 2UZVA 3ZLXA 1E1XA 2AQXA 2BUJA 4FUYA 2YIYA 3IDCA 5AEPA 3HECA 3W0OA 2XIYA 4PPBA 5CANA 2X7FA 1YXVA 4HGEA 5DH3A 4O7SA 4BCMA 5KUPA 2H96A 1YXXA 4EBVA 2YCFA 5J9LA 1AD5A 5A6NA 3HGKA 1UWJA 3RPYA 1Q62A 2ITNA 2QR7A 1B6CB 5IH5A 2VGPA 3FYKX 3HMMA 2B54A 2XA4A 3ACJA 3UE4A 4EH6A 3VHEA 4EQCA 3OHTA 5J9ZA 4BTJA 5KKRB 3RPRA 4CD0A 4FSTA 3GCVA 3IKAA 2PUNA 1GIHA 4AW5A 4RIWA 3NW5A 4D2WA 3SG9A 3GNIB 3R2YA 4C4JA 4FG8A 4KSPA 2G9XA 4JIAA 4FX3A 4H1MA 3ORXA 5DOSA 1K9AA 3C4XA 5JRSA 5A4QA 3QWKA 2W1EA 4ZIMA 3NNUA 1XO2B 1DS5A 4L42A 4EYJA 3KU2A 3LCTA 3GENA 3OY1A 4AOJA 2C1BA 1M7NA 3UIBA 4FTNA 4HNIA 5FLFA 4MTAA 3QYWA 2PZPA 3F61A 3HA6A 4RA5A 3T9TA 1FQ1B 4R1VA 4NM5A 2X7OA 2X8DA 5CLPA 2PE1A 3COKA 3F2AA 5AA9A 5DYJA 3DNDA 5CU2A 4TW9A 4R6VA 3FMJA 3BGQA 4CMUA 3BYUA 5LMBA 3NUPA 5EKNA 4JBQA 2R3RA 2C3KA 2JD5A 1MRVA 3LJ2A 4O0RA 3NYVA 4QP4A 3BEAA 4YGAA 3SGCA 2ITQA 3NIEA 4IAFA 3TN8A 5EM5A 1ST0A 3CJFA 4M0ZA 2OH0E 4JX3A 4TYJA 3ZUVA 3LFDA 4FKQA 2A98A 3GU8A 2Z60A 2W1HA 3HV4A 1GNGA 4Z7GA 2UUEA 1YXUA 3FLSA 2I0VA 3KVWA 3F5GA 4W8DA 5CU0A 4BY9E 2JGZA 4ZLZA 2PK9A 3GT8A 3EZVA 1VLRA 4RWIA 4BGQA 2WMUA 3U54A 4QYEA 3L8VA 4LMUA 3PZHA 2C5VA 3KMUA 3N9XA 3W2CA 3RNIA 1PMEA 2VX1A 3UO4A 4EHGA 4OTPA 2JAMA 4JG6A 4YLLA 1OZ1A 4O83A 2QO2A 3R7VA 3FUPA 3CIKA 1M14A 1PYXA 4LGDA 3VJNA 5DNRA 2UVXA 4Z3VA 1YDRE 2XKDA 4IB5A 5FRIA 1Q41A 4FT7A 2G2HA 3OG7A 3TNHA 4NTSA 1TQMA 4PTEA 3COIA 5FUTA 3R7EA 2W4JA 3LFNA 3DK3A 3Q96A 1H07A 4G16A 4JG7A 3DK6A 2XIXA 3TUDA 1G5SA 3A7GA 4NM0A 3RHKA 2JBOA 3W16A 1YWRA 4O1PA 4CZUA 1ZAOA 1ZYDA 3UMWA 5HO6A 4TYHB 2GS6A 5H8EA 3ZRKA 4W4XA 4QTAA 4PL3A 4BGHA 2WQBA 3VS0A 2Y9QA 4O27B 2IPXA 3UVQA 1YXTA 2WIPA 4N6ZA 3BV3A 4HYHA 3NUYA 4OTWA 3IO7A 5L2QA 4YU2A 2VO0A 3UJGA 3KN5A 4JAJA 3CP9A 1XH4A 4HPUE 4I0TA 3C4FA 3PG3A 4K33A 5H2UA 4RWLA 2PY3A 4HPTE 4IXPA 4S30A 3AMBA 3FEGA 4H05A 3HVCA 4AE9A 2Z2WA 2XVDA 1JKLA 2GTMA 2ZDTA 3GU6A 5CNOA 4WNKA 2GHGA 3MY1A 4BDDA 1ATPE 4IB3A 3R9OA 4O81A 4APPA 1BMKA 2UZWE 4FKUA 4D2VA 1K2PA 3BHUA 5L6WL 5AUTA 2WTWA 3MFRA 4N6YA 4TYIA 3DXPA 4U97A 3BE9A 5CWZA 1Q8TA 3JY0A 3CTQA 1O6LA 1P2AA 3VNTA 1UKHA 3R73A 1TZDA 2UZUE 4FIEA 3ZBXA 2X0QA 4F7NA 5LVPA 3QQGA 5FG8A 3IW8A 3F5PA 4NUSA 2RG6A 4L44A 2QLQA 4QD6A 5HX8A 5J5TA 4QNAA 1Q3WA 4A4XA 5HIEA 3RBWA 2XEZA 5LARA 3KEXA 5ETAA 2QO9A 2JDRA 5DIAA 2W1GA 3E3PA 4XV9A 5L2IA 4FF8A 4ZJIA 3TT0A 5AR7A 1JWHA 4WD5A 4BCPA 2PHKA 3W18A 3S95A 3QUDA 5GZ9A 1JQHA 4EHVA 4YURA 4OAVB 3HAVA 2QOKA 1KSWA 2R5TA 5I9YA 3UNKA 1QPEA 1ZRZA 3R71A 4E5BA 1OIQA 4XV2A 3UPXA 2Z02A 3CY2A 1OITA 3BHYA 5ANIA 4CCBA 2CN5A 5BYZA 1KOAA 4NFMA 3QC4A 1CDKA 2ITTA 3UO6A 3MPAA 3Q6UA 5KMLA 4BCOA 4AW2A 1ST4A 3ANRA 4G5PA 4U41A 2W4KA 2XEYA 2XNNA 3CPCA 2B1PA 3R7GA 4LL5A 5H9BA 5JK3A 3EN6A 3NZ0A 4PMPA 4RWJA 3QD2B 4KRCA 5I9UA 2YA9A 4O91A 4AZEA 1VR2A 5M44A 2PL0A 3OCTA 1REJA 4CVAA 3LLAA 4XS2A 2WGJA 3LFAA 4N0SA 3EOCA 4DBXA 3BL7A 3OT3A 3LXNA 1HCKA 3QTUA 4D1SA 4L67A 3FI8A 3DJ5A 2JITA 4GSBA 2J6MA 2R7IA 4A9SA 3TKUA 5E1EA 4BDIA 4M69B 5E8ZA 4E6AA 3S00A 5LVLA 2IW6A 2W1IA 1SM2A 1H26A 3B8RA 2PVLA 2XK7A 3BU6A 5HCZA 4GG5A 3R04A 3HAMA 3K3JA 4FVRA 4G3GA 5JKGA 4EOKA 5CT7A 5IISA 5AP4A 4P90A 3D7TA 4E20A 1URCA 3QQLA 3EKNA 3LHJA 4FZ7A 2B52A 1JAMA 5T68A 3LCOA 2PVRA 3VUIA 3I0QA 5IA4A 3S3IA 4YR8A 4NWMA 4FYOA 4K18A 2XALA 4LV5A 4EYMA 5HTCA 3NLBA 3AT4A 3WZEA 3BEGA 3DTCA 3NIZA 1WBOA 1PHKA 2WTCA 2B9JA 3PP1A 4X21A 3ZSGA 4ZTLA 4E4NA 3QXOA 1IG1A 4FL2A 4I6QA 3KGAA 4XG3A 2EXCX 4L3JA 3R7UA 3MVJA 2GU8A 3FYJX 5A4LA 4EZ5A 3HV7A 3RKBA 5JT2A 4FT3A 3V5PA 4HOKA 2KULA 2PMNX 1Y6AA 4CT1A 1RJBA 4D58A 5B7VA 2ZM3A 2HY0A 4L6QA 3WF6A 2FA2A 1FGIA 2GPHA 5GZAA 4LGGA 1LEZA 4EJNA 5HVJA 3FZPA 4HJOA 5T6KA 1H01A 3G6HA 4FKSA 2W96B 3EQGA 2BHEA 4YJVA 2ZB1A 2XM8A 4CGAA 3RCDA 3KXHA 2R3JA 1UU3A 4FOCA 5IDNA 5HNGA 2EU9A 2PUUA 5HNIX 1H1QA 3NSZA 4PMTA 4QMQA 1NT2A 2UW0A 1UKIA 1DM2A 2H9VA 3UO5A 3PIXA 1OKWA 3OXTA 5K0XA 4U8ZA 4FR4A 3Q4CA 5AWMA 4FV8A 3QTQA 2JKQA 3GEQA 3MI9A 4WG3A 2PVNA 4L3PA 1WBPA 1W0XC 3CQUA 3DKFA 4QP8A 4FK3A 2X0PA 2OZAA 4B99A 4QTEA 1W8CA 4OTHA 4ZJJA 1BLXA 3EN7A 3LXKA 2REIA 2XUUA 3S4QA 3QRJA 2A1AB 4RA4A 3BWJA 3LLTA 5G6VA 4DEBA 1P4FA 5LOHA 3CC6A 4DG2E 2F7ZE 4PQNA 5EG3A 3TZMA 2EWAA 2VTOA 3D9VA 3IOPA 3KK9A 3ZFYA 4GK4A 4DFUA 2C47A 3LW0A 2X8IA 3FXXA 4O86A 2X2LA 4ZSGA 3KXXA 2NPQA 3ORLA 4PRJA 1SNUA 2VTAA 4O0WA 4EOPA 2HW6A 5BUJA 2WKMA 3GCQA 3VS6A 4I6FA 4EOIA 3SW7A 4IX3A 5KBQA 4BFMA 3RTPA 4I5HA 5FWKK 2Y7JA 3PIYA 4RVMA 2J50A 4AZWA 5IQBA 2QOIA 3UGCA 5DR2A 4NM7A 2ZOQA 2CPKE 3T3UA 5ANKA 3I5NA 4IBMA 3Q04A 4MH7A 3SLSA 2W9ZB 3LAUA 4CT2A 4WBBB 2XNGA 3W8QA 2GS2A 3F7WA 3V8SA 1J1BA 3VO3A 4YUQA 5M4IA 1B38A 3PSDA 5CSWA 2PZ5A 3CSVA 3FZRA 2H34A 4FI1A 2NRYA 3BPRA 1BKXA 3HRCA 3VBQA 3W33A 3UP7A 4QMPA 4O7NA 4RIXA 5ACKA 4F0IA 4OTRA 4F9AA 4ID7A 2O64A 3M2WA 5ANDA 4H3BA 4FV2A 5CXZA 3OOMA 2BHHA 3PXYA 1Q97A 4TN6A 2FGIA 4C4EA 5C01A 1BI7A 1E1VA 3GGFA 4WNOA 5DT0A 4BCKA 4F08A 2J0KA 3G5DA 2X8EA 4DGOA 5IQAA 3PY3A 2VWYA 1LP4A 4ACMA 5C4LA 4BTFA 4JL9A 3ZFMA 3QC9A 4R77A 2BTSA 3LVPA 3O96A 3GCPA 4FA2A 3VONA 2E2BA 3IW5A 4RVLA 3HYHA 4DBNA 4FV6A 5CSPA 4WHZA 3A7FA 5LVMA 4TNDA 3RK5A 2OFVA 4EOLA 4IW0A 2BRMA 2QODA 2QCSA 4JQ7A 4NFNA 3C5IA 4DH3A 2BFYA 2G15A 2A19B 5AX3A 4IHPA 5CVFA 5AFVA 5GIPE 2EXMA 3CGOA 3ORNA 3VS7A 3WIGA 4ZS4A 3MGYA 3Q2MA 2RL5A 5DRBA 2PYWA 1XBCA 4I4EA 5IQIA 2VTPA 3ANQA 3R9HA 3E64A 4EOOA 4D4SA 3IS5A 4GFOA 4ACHA 4D1XA 1FVTA 1OKVA 2VZ6A 3I4BA 3LOKA 4ACDA 4GRBA 4G5JA 3TM0A 3BKBA 3NEWA 1XMLA 1U5RA 2YAAA 4QP9A 4BZDA 2IG7A 4B6LA 4BJJB 2XK3A 4CQEA 4EL9A 4F6SA 3JXWA 4IH8A 5JGDA 3FI2A 2JFLA 4ENYA 2X0GA 2UZLA 2CNUA 1YHVA 4EBWA 3UG2A 3MVMA 4OTDA 3H30A 3EHAA 4U5JA 4BIBA 5D7VA 5ICPA 3CPBA 5KMNA 4JG8A 3UZRA 1ZOEA 3TWJA 3FLWA 1OKYA 3VVHA 3OP5A 4XJ0A 2WHBA 4ALUA 4ASZA 3QL8A 4Q2AA 4FC0A 4Y46A 2BRHA 2GNGA 4MBJA 3GOKA 4S32A 1GZOA 4ZOGA 4IZAA 4NZWB 4DINA 1PKDA 4DEAA 2H8HA 2WTJA 4LOOA 4X2GA 4DN5A 4MBIA 5DA3A 4XOZA 3FDNA 4FSUA 4C37A 1NW1A 4YZDA 3VULA 1H24A 4XLVA 2R3LA 2XIKA 3DQWA 4MD9E 4XP0A 2I0EA 4V04A 3C50A 2YITA 4TXCA 3PFYA 5HICA 4MNFA 4R7HA 1Q8ZA 1PXJA 4XMOA 5B2KA 5HU3A 1PXPA 5A54A 4KIOA 3VJOA 4O82A 2CJMA 2YM7A 4QYFA 1XBAA 4E1ZA 2AUHA 1P5EA 1OBGA 2WQNA 4AXCA 2OJ9A 3WYYA 4U80A 5GHVA 2PTKA 4IFGA 4UX9A 1ZARA 5TF9A 3EN9A 4I22A 2BIYA 4E93A 4F0GA 1YRPA 2OJJA 1PXIA 3NUNA 3M1SA 4RG0A 3VF9A 3I81A 2GQGA 2HENA 4FTAA 3QTIA 3ET7A 3K5UA 3MY0A 1PYEA 2W1DA 2A4LA 3MBLA 2C3IB 5IUGA 1IEPA 2BDWA 4S33A 4UXQA 5HESA 5IQHA 3F2RA 2YM8A 3I5ZA 4M0YA 4YZNA 4GT4A 1DAWA 3AKJA 5BYYA 4ZP5A 3SOAA 1WFCA 2WFYA 3V5LA 1J7LA 4FNWA 3DJ7A 4EK4A 4FSNA 3DKOA 4FTKA 4H58A 5L4QA 4ZTNA 3VW8A 1PMNA 1SMHA 4TWPA 3BIZA 4FODA 4IM2A 4NW6A 4FT9A 4G9CA 4UYAA 4FT5A 5E1SA 4FG9A 4JBVA 3S2PA 1OPKA 5KHWA 5L2TA 4NIFA 2BZIB 4AUAA 1LPUA 2XP2A 5CEMA 4KA3A 5JQ8A 4BDFA 5HE2A 3L8PA 4HZRA 4LRMA 3QTRA 1BYGA 5AP2A 4I93A 4WG5A 5AR2A 3RNYA 5C8NA 5KMIA 3Q4ZA 1H4LA 1R1WA 3QTXA 5GJDA 3CR0A 2R64A 4E8AA 3TDWA 2WOTA 4QP7A 3PP0A 2C0IA 2BVAA 5E8TA 4IB0A 4BCHA 4GKHA 3SA0A 2ZAZA 4MD8E 2F49A 3QKKA 4M14A 4L3LA 4N4SA 1Z5MA 3HLLA 3W0MA 5A6OA 2W5BA 3OC1A 4QQCA 4BCFA 3VIDA 3P86A 5D12A 3LCSA 5FTQA 4DGMA 4DHFA 3E63A 4FIJA 2BDFA 3QTWA 5EM8A 2R9SA 3Q3BA 4DTAA 5GJFA 4IDTA