3CGOA

Irak-4 inhibitors (part ii)- a structure based assessment of imidazo[1,2 a]pyridine binding
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
356
structure length
332
Chain Sequence
DNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLASFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYREHTIEEWKELIYKEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 10
publication title IRAK-4 inhibitors. Part II: A structure-based assessment of imidazo[1,2-a]pyridine binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 332
sequence length 356
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cgoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cgoA01
4YJPA 1BKXA 2V62A 4EBWA 4O27B 4UXQA 2WQBA 4KKEA 1F3MC 4DG3E 1KV2A 3ACJA 4GIIA 4QMXA 3HDNA 4FSWA 5EM5A 2UZOA 3UPXA 3VJOA 5IH5A 1R0EA 3MWUA 3DK7A 2GPHA 5J9LA 1G8SA 4TYJA 5ANJA 5I3RA 3BHHA 1OIRA 1U4DA 3PTGA 2QU6A 4OTQA 5ETCA 4XBUA 1UU3A 4EYMA 2OLCA 2IVSA 2R3NA 2UZEA 5CNNA 3VUMA 5J95A 3FZ1A 4TNBA 4GKHA 5FEDA 4AZFA 3SOCA 2Y8OA 3G2FA 1UKIA 4LRKA 4FSUA 2RKUA 3BKBA 5DR9A 5AP1A 5JFWA 2CHLA 4JDJA 4EOLA 3NW6A 2FGIA 3LCTA 3DLZA 3IW6A 1JVPP 5CI7A 4DTBA 4RWIA 3UYTA 3RBWA 3Q6UA 4HYHA 4PPCA 1UNGA 3QC9A 4CTCA 2IZSA 2VX0A 1A06A 2XJ0A 1ZARA 3PVWA 3Q9ZA 3R04A 4XCUA 4ZIMA 5A6OA 1ZYSA 4EBVA 4F9BA 5AUYA 2VZ6A 1YWNA 1OIQA 3QKMA 4FKUA 5EYKA 4EYJA 1G8AA 3NAXA 4JX7A 3ZCLA 3TTJA 4LUDA 2HXLA 1ZYCA 4FV2A 3Q5ZA 2R0UA 4D0XA 4EZ5A 3U51A 2I0EA 4C0TA 3NYVA 4JG7A 2OIDA 5HE2A 4WUAA 3W2OA 3VIDA 2WMRA 3NVKI 3DKGA 1IASA 5I5ZA 1U59A 5IDNA 2X7FA 2WTKB 2Y7JA 3OBGA 5IKWA 1MUOA 1R3CA 4NUSA 2YCRA 5DMZA 2X7GA 5C8MA 4RIXB 2BRNA 3PJ2A 3DQWA 2UW3A 4FKGA 1OL5A 1OUKA 2AUHA 2WO6A 4S34A 5FUTA 2QOCA 3KB7A 3RM6A 2QOOA 2I0YA 4RIWA 5L2QA 2PZ5A 3KFAA 3LFEA 4YPSA 5EDQA 3OF0A 4RX8A 2PMNX 1M7NA 4TW9A 4JR7A 3Q3BA 4FTMA 2GFCA 4RX5A 2YM8A 4D2TA 2JBPA 4FEQA 4J53A 2X6DA 5JGBA 4UWYA 2VTPA 3PVGA 4LL5A 3GCQA 4OW8A 5J5SA 4ZOGA 5J7BA 2NNWB 4FEVA 3M1SA 2JIUA 2JDRA 2C0TA 3KXNA 3DNDA 3LFDA 5FM3A 4CVAA 4FGRA 3L9NA 4TTHB 1S9IA 2B53A 2W1IA 3K3IA 4I0TA 2C1AA 2Y4IC 3F9NA 3GBZA 4NM0A 4EH3A 1E1VA 4G31A 1ZYLA 4RSSA 3RAKA 4DFBA 3QRTA 2FVDA 4I21A 4L6QA 4YJNA 4BIDA 1MP8A 3FZPA 4F99A 5HTBA 2CKQA 3NCGA 4HGEA 4FYOA 3O8UA 5IUIA 4NSTA 3TWJA 1UWJA 4JDHA 4IVDA 4MNFA 5AWMA 2YDJA 2YIQA 3KXXA 1VEBA 4EH2A 3D83A 4FT0A 5TT7A 1LR4A 5L4QA 3RTPA 2UW9A 2H34A 4O2PA 2VUWA 4G5JA 4JRVA 2IZTA 4AX8A 4CMUA 5JMSA 5IQIA 4AW0A 2UW5A 3EN6A 1YI6A 4RC4A 4H3PA 4XUFA 3TJCA 4GW8A 4CKRA 4GYIA 4R5YA 4O91A 1H00A 2PVMA 4IWPA 4QYGA 3F5PA 2J0MB 3IDBA 4CZTA 3K2LA 4BGQA 4J96A 4BCKA 3W2QA 3R2YA 4RWJA 1KSWA 5AM7A 1PYEA 3TKUA 4F9YA 1A48A 1OIYA 2G1TA 4X2KA 3QQHA 4M84A 4FIEA 4I23A 5HIBA 4O81A 2C6IA 1U46A 2QQ7A 2UZTA 2QR8A 2XNGA 3A99A 3E8CA 3GU7A 5E1SA 3PLAE 4ZY6A 3VS0A 4L68A 1HCLA 4BCHA 4YMJA 4OUCA 4OTRA 3HV7A 2PE0A 4EH8A 2JDTA 5AR4A 2JAMA 2IG7A 4LGGA 3EQIA 2WGJA 2ITTA 4CV8A 4EHEA 1NVQA 3KQ7A 3O23A 4FI1A 4XOZA 2B54A 3FMLA 4HJOA 1SYKA 2OO8X 4K6ZA 5AV3A 2JFMA 4BDFA 4C34A 4Z7GA 4OBPA 4O7YA 3CY2A 5EKNA 3I7CA 2WTJA 1H1WA 3GQLA 3KEXA 3O8TA 4ACMA 3FMJA 4EI4A 2YABA 4D2SA 1WBWA 2O65A 5HIEA 5BUIA 2R2PA 3Q5IA 4JX3A 3EQRA 4XG9A 1EH4A 1OKVA 2QLUA 2YERA 1IA9A 5DR6A 1W98A 3R7OA 5IA2A 3U6HA 4O7LA 2C5YA 2WTCA 3I1AA 4IX5A 2W5BA 4JVGA 4Y8DA 4AG8A 4A4OA 5IEYA 2VU3A 1NA7A 2RFEA 4UALA 3LIJA 4X2NA 1L8TA 4K0YA 2XK7A 2YLFA 2YWPA 5HG5A 4DT8A 5CZHA 5M4UA 4NM5A 4UB7A 4L44A 3E92A 3P9JA 3Q52A 4JIKA 1UNHA 3EH9A 4D1SA 4NKSA 5GJGA 2R7IA 1URWA 2QHNA 3PWDA 1UU9A 4YC6A 5AFVA 4F0IA 4A9RA 5AIKA 3TEIA 1REJA 3W18A 4I5HA 4M69B 4V0GB 1FVTA 2BILB 2QODA 5JGDA 4DCAA 3HRCA 4MXCA 2ACXA 3E7OA 4O96A 4EOJA 3PPZA 3EZRA 3FL5A 2Q0NA 2OJFE 3FPMA 4TY1A 5TO8A 2PY3A 3FI8A 3QGYA 4FKWA 2OJGA 5GIPE 2NRYA 2JLDA 2W05A 4LGDA 5FBOA 4C58A 2ZB1A 4H3QA 3R1SA 2HIWA 4YJUA 4HNIA 3PJCA 2RFDA 3VBTA 4RJ7A 3RPRA 4AGUA 4BDIA 4PRJA 4I5MA 3W2CA 4AT3A 4ASXA 1H28A 4UN0C 5GIOE 4WNMA 3O96A 1RW8A 1SM2A 3QYWA 4ZTHA 4MF1A 4A9YA 2WB8A 4Y83A 3NVMB 3ORMA 3MY1A 3PXKA 4IM0A 3UP7A 3KMMA 3QQGA 4N70A 2HY81 2J0IA 5HBHA 3CKWA 5L2WA 1PXLA 3LPBA 2QOBA 4CD0A 3FZRA 4FBXA 5K0XA 3CC6A 2EXCX 3C7QA 4R78A 5TE0A 3COIA 3ZZEA 5L8JA 5BYZA 2QKWB 3DTCA 5CU6A 4D4RA 2W1FA 2BAJA 3ET7A 3MTFA 3DDPA 2ZYBA 5G1XA 4EK8A 1QPDA 4EWQA 3R8PA 2O2UA 5JZNA 1A9UA 2VO7A 2GNIA 4QMMA 3MA6A 1RJBA 2XK9A 5LCKA 3O0GA 4ZTLA 2QOKA 3IOPA 5HOAA 2PMLX 3TUDA 4K1BA 3L9MA 3F7ZA 3CBLA 4IC7A 3Q9YA 5CALA 2B7AA 4DEAA 4AZTA 5HCZA 5HO6A 4IIRA 2IW6A 4AS0A 1GY3A 3R00A 3RMFA 1XJDA 2A2AA 4TWOA 3MB6A 3PXQA 3FXWA 5LVOA 4KA3A 1YWRA 3DXNA 4CG9A 2PZRA 2GS6A 4ZMFA 3A62A 2WKMA 3DPKA 5F94A 3KVWA 3HV6A 4FUXA 4FKTA 4DE4A 4PDSA 2VO0A 1WZYA 2G01A 2WHBA 5AMNA 4YUQA 3TKIA 5KKRC 3GU8A 2ERZE 4YO4A 2PVHA 3A8WA 5HCXA 1XBBA 3GB2A 2G9XA 5AR3A 4C35A 2LGCA 2XMYA 3HX4A 3MDYA 3DKOA 2WAJA 4D5HA 4DEHA 5DH3A 4LG4A 4QNAA 2HZNA 2GNFA 4KD1A 3A60A 4LGHA 2OWBA 3Q4TA 3R21A 5HCYA 3AMAA 3BEGA 3DNEA 3ACKA 3HUBA 3QCYA 4F1OA 4YZBA 4NJ3A 5CSXA 5FP6A 4LQMA 1H01A 5IDPA 4PL4A 3VUDA 4G16A 1K2PA 4E4XA 1YOLA 3HVCA 3NPCA 3UDBA 1OKZA 5HQ0A 4BN1A 3ROCA 5HTIA 2C3KA 3VBYA 1PY5A 2W1EA 2ZV2A 3RNYA 1ZYJA 2CGXA 3PDTA 3AMBA 4ONAA 3MH3A 4CRLA 3U87A 3LFFA 4LM5A 2GHMA 4OT6A 4FT9A 3MBLA 2E9VA 4E4LA 2OFUA 5ANIA 5KHWA 4I92A 3HMIA 2PVNA 3QWKA 3QAME 3VS6A 3GU5A 1Q24A 2C0IA 4QMTA 5IQAA 5E8WA 3ERKA 4YC3A 4IZYA 1Q4LA 2X8IA 4AW2A 1OIUA 4FTJA 2YAAA 2OJIA 2XK8A 2CKEA 4G5PA 3W10A 5DG5A 4AP7A 2ITZA 3S3IA 1Z5MA 4AUAA 2BVAA 4E6AA 5F4NA 4O0RA 4I0RA 2I0VA 1OITA 2W0JA 3QCSA 4E73A 4FV1A 4DA5A 4BCGA 4FNYA 1MQBA 3S4QA 2PVKA 1QCFA 3BHTA 3LM0A 3KN6A 3CJFA 3QKKA 4JRNA 5K9IA 3E8NA 4Y5QA 1AQ1A 2QVSE 4CTBA 2EUFB 3QQFA 2WU6A 4X21A 3CQEA 3EKKA 1PXMA 3PXRA 4U80A 2HY0A 5FXQA 1ZAOA 5CEMA 4F7JA 1FVRA 5CI6A 4ANBA 4X6RA 4BZNA 3U6JA 2IO6A 4BL1A 4G2FA 3KRJA 4BKYA 3DAJA 2BPMA 2OF4A 2QG5A 5HLNA 3F3TA 3AC4A 4KINA 3KRRA 4IHPA 4O0SA 5AP6A 3RK9A 3QTSA 3OEFX 3UIUA 4ANOA 4EKKA 4BI0A 2F7ZE 3OWKA 2C0OA 4GFGA 4IQ6A 4EOIA 4M3QA 4BKZA 5AV2A 1ZMWA 1B6CB 3W8LA 4FGBA 3RNIA 3BV2A 3BHVA 1Q8TA 3O8PA 4O0VA 3WZKA 2ZV8A 2Y4PA 5CQUA 4EUTA 4MXOA 4QQTA 2GSFA 2HCKA 4GU6A 5AUXA 3NW7A 3UIMA 4L3LA 5J9YA 2Y6OA 2BROA 4NIFA 3RZBA 1QPEA 3PG3A 5EW3A 4FZ6A 5DR2A 4DBNA 3MJ2A 1U54A 4BCJA 4EOMA 4F64A 5KO1A 3GC7A 3WIKA 3LQ5A 3HMMA 2YIXA 4FV6A 4DTKA 4QMPA 5DVRA 1ZLTA 4CFMA 2XNBA 4NFMA 4RG0A 3N4UA 2KULA 4IAZA 4QD6A 3FY2A 4O0YA 3PSDA 2UZVA 4U41A 3VWAA 2WOUA 4Q2AA 1H1RA 4FL3A 4Q9ZA 2CNQA 1TQMA 1Q3WA 1ZZ2A 3POOA 4LOOA 4IFCA 5L6PA 3PY1A 2PVJA 5AA8A 1T45A 1OKYA 5JRSA 4P7EA 4USEA 5LWNA 5CEOA 2QI8A 4IWQA 3R30A 4RA5A 1UKHA 5DT3A 2QD9A 4QMYA 4E6DA 3ZO2A 4GFMA 5LMAA 2QOIA 3O7LD 4KSPA 2ZM3A 5FP5A 4R7HA 4YHJA 4IBMA 4E6QA 2X6EA 1RE8A 5A4EA 2Z7QA 3LCSA 4DFZE 4TN6A 2RG5A 4KIKA 3ATTA 1I09A 1WBSA 3H9OA 4DC2A 3EQPA 2WQEA 4B0GA 2ZM1A 4QRCA 5HNBA 3RJCA 4MKCA 4FTUA 4X0MA 4NL0A 4OAUC 1WBNA 5AP3A 2ZB0A 4CLJA 2W7XA 3DFCB 4LOQA 4YZCA 3UJGA 4BY9E 2BZIB 2GS7A 4EK4A 4K33A 4V04A 5L8LA 4EZ7A 3PUPA 2W1DA 5HNGA 5B2KA 3PPJA 3C4EA 4B9DA 4ANMA 3GGFA 2R7BA 3W32A 5LVPA 5CF6A 4GMYA 2W9ZB 4D2VA 2UZDA 3OW3A 1UA2A 2XCKA 4OTPA 3N4VA 4GKIA 1APME 5TOZA 3FSFA 4C37A 4FIIA 3OXZA 4ZLYA 3FI2A 4C8BA 5JFVA 4DLIA 3FMMA 4BVUA 5KMMA 4MCVA 3E3BX 1HCKA 2W1HA 5I9ZA 4DFNA 4RVMA 3S0OA 1CDKA 2C6MA 3O7LB 4Y73A 4CKIA 4MHAA 3V5JA 5ICPA 2HWPA 4JT3A 4YP8A 1J7IA 3V51A 4E20A 5CZIA 2ZDTA 4CMTA 5LXMA 2CKPA 1MQ4A 2FH9A 2WTVA 3HP2A 3GXLA 3CPBA 2YJSA 4XNEA 3N9XA 4Y46A 1OBGA 4R8QA 3KY2A 1GIHA 4WG5A 5KMIA 2QOHA 2WU7A 4YTCA 3QQUA 4ZSGA 5BYLA 5L2IA 3WZDA 2RFSA 4XS2A 2JEDA 3NGAA 4I3ZA 4CZYB 5M56A 4FEUA 3ZFXA 2X4FA 3T3UA 4G3EA 1ZY5A 4UMQA 3S95A 1ERKA 3FLZA 4KIPA 2YACA 4HZSA 1OMWA 2X9FA 5C01A 3SW4A 3PSCA 4J97A 2BHHA 2P33A 3ODYX 1OL2A 5EYMA 2R3PA 4YLKA 2EXMA 5HLPA 3VS7A 5J7HA 2B9HA 3VUKA 4BHZA 4BDEA 3CSVA 1Q8UA 2CCIA 4FR4A 1JSTA 2WOTA 4TYHA 4N57A 2O0UA 4O0WA 4Y5HA 3BU6A 4IB0A 2GMXA 3V5LA 1WVYA 5T3QA 4EOPA 5A4LA 3LQ8A 2X2MA 3KF7A 1QPCA 3KRLA 3RHKA 4G6NA 4QQ5A 4YZDA 3KC3A 4WRSA 2XYNA 4WNKA 4PTGA 5HVYA 1RDQE 4DFLA 3P5KA 4R5SA 5C4LA 2JKQA 4N6YA 2XKFA 4FVQA 3LXKA 4CQEA 4OAVB 3REPA 3SX9A 3NNVA 4HCUA 4KSQA 3FE3A 4EK5A 3NMUF 3ZHPC 4EUUA 2YAKA 4MVFA 2ZOQA 3FC2A 5AR2A 4D28A 3EQBA 4DGLC 3AMYA 3JYAA 4XMOA 1NVSA 4X3FC 2BZJA 4KIQA 4X2FA 5BVKA 2J4ZA 2RIOA 4BB4A 4GT5A 2VTNA 5FTGA 3QTXA 3MY5A 3R22A 2XNPA 3F5XA 1WMKA 4MNEB 4AW1A 4C02A 5JH6A 3KXZA 4XH6A 3ZSIA 4QTBA 4YTFA 2XKCA 4FZFB 4AOTA 2YITA 3R8ZA 4ORKA 5C8KA 3ORXA 3LAUA 4YU2A 3QF9A 4PWNA 5AUWA 1KE8A 2XK3A 4MD9E 1NY3A 5EG3A 2CLQA 3T3VA 4RGJA 4AGDA 1BLXA 3MSSA 4A4LA 5A4QA 4RC3A 3DTWA 4I41A 3WZEA 4EOOA 2XK4A 2ETKA 4D2PA 2YM3A 5L6OA 2C6KA 3BGZA 4UBAA 4YO6A 4AGWA 1SNXA 5JGAA 2ITYA 1GIIA 4TL0A 2X2KA 2PE2A 2Z60A 5IMEA 2OXDA 3OVVA 2O64A 4MAOA 4O7RA 4L7SA 3KK8A 3BELA 3SDJA 4ZLZA 3C0GA 3SRVB 1ZOHA 5CAQA 3RK7A 2PZIA 3BBTB 3GOPA 3UG2A 2H6DA 2Z2WA 4W9WA 4L3PA 2WD1A 1JKSA 4A4XA 4TRLA 3HP5A 3U9CA 2C3JA 3GP0A 4NM7A 5JSMA 3QTUA 3COMA 1YKRA 4NM3A 3BPRA 4DH3A 4KBKA 3CS9A 4ZAUA 4IAAA 3N51A 3V8SA 2JDVA 3OY1A 2C68A 3Q9XA 5KBRA 4S31A 5CNOA 5IZFA 1ZXEA 4L43A 3QTZA 5AUZA 5J87A 4DH5A 3PJ1A 2R3MA 1CKPA 1U5QA 2PVRA 2W17A 4M12A 4RZWA 3HMNA 5LMKC 2A4LA 4PMSA 3PIXA 5BMSA 4C38A 4IJ9A 4WKQA 2QO7A 2VO6A 3RHXA 2W5HA 5D7VA 5I9VA 5M4CA 4PF4A 4WG4A 3SQQA 4J52A 3H9FA 3ZEWA 3Q32A 2BZKB 3R73A 3H10A 4FVRA 3UIBA 3C0HA 4IC8A 2R3FA 3LOKA 4DGOA 5FGKA 1YDTE 3ZRLA 5E8VA 3WIGA 4NJDA 5CU0A 3FI3A 5CT0A 4CFNA 2XIKA 3HRFA 4GEOA 4F70A 2JIVA 3TUCA 3OOMA 3ZM9A 3R1YA 4E4MA 4O7SA 2OZAB 4QPMA 4ASEA 5F95A 3NIZA 4LFIA 4XEYA 3FYJX 3CTQA 5EM8A 3BQRA 4YTIA 1JSUA 2FSOX 1GZ8A 3KXMA 4U43A 4BYIA 5CAUA 1W7HA 2R3KA 3OCBA 4HPUE 3WYXA 1WBOA 4BDCA 5IU2A 5KUPA 4QOXA 5A4TA 3UGCA 5BUJA 2W96B 3ORZA 3FI4A 4MF0A 2X1NA 5A46A 2VV9A 4FKQA 4XRJA 5AAEA 3ZONA 3PIYA 2VWXA 4LYNA 1IAHA 4G3DA 3T8OA 5F1ZA 5HO7A 3CJGA 3EN4A 2RF9A 4HCVA 2BAKA 5EM6A 2B1PA 4BR3A 3THBA 1VYZA 3HV5A 1W8CA 1YOMA 5M57A 2EB2A 3SOAA 5GZ9A 4YJOA 3QRUA 5IA5A 5EK7A 4CGAA 2F57A 4BCMA 3KULB 3DK3A 5ETAA 4EQCA 5EQEA 3LQ3A 4E1ZA 3EN5A 4MBLA 4BDAA 5HLWA 2P2IA 4IAKA 5A9UA 4GS6A 1KV1A 1OVEA 1YWVA 2GS2A 3LFBA 1P4FA 4P90A 4KS7A 5LVNA 3A7FA 5FDXA 2UZNA 4L45A 4ACGA 2JFLA 4U9AA 4D2WA 3Q4UA 4UZHA 5CY3A 3W33A 3R71A 2OI4X 4CFFA 3VS2A 4FTNA 1UNLA 3MFRA 4C33A 3HMOA 5CX9A 4EK3A 4EC9A 3C5UA 3EQFA 5DRBA 4OTWA 5E1EA 3UOKA 4BDDA 4IADA 3DCVA 5CU2A 3KRWA 3WYYA 3AT2A 4PL3A 3MIAA 2BMCA 4GIHA 2X0GA 4XBRA 1R1WA 5CTPA 2CKOA 5IEXA 1PMVA 2Y6MA 4MXZA 5JKGA 4YHFA 4A06A 3QTQA 3QXPA 4IWOA 2Q83A 4LRJA 3JS2A 3D7ZA 3I79A 3NUYA 4RFZA 4ALWA 4BCIA 2WMUA 3I60A 4C4IA 5CQWA 5EQPA 3UBDA 3FY0A 2WTKC 3CD8A 2E9PA 3Q4CA 4APPA 4UXLA 2XP2A 3GU4A 3BLQA 1ND4A 4G9RA 4QMLA 4DBXA 2QURA 1AD5A 2YCSA 3A7IA 2ITPA 3R8LA 3VC4A 1LEWA 3QTRA 5LQFA 2ZMCA 2YEXA 3D7TA 4RVKA 5CAOA 1FINA 3Q2MA 4I24A 2XM9A 4NFNA 3D5XA 3RAWA 3FQSA 4AOIA 4XLIA 4J8MA 5M07A 3OMVA 3P23A 4XG2A 4F7LA 3UYSA 1J1BA 2FO0A 4APCA 2V7OA 3MYGA 4U42A 1LPUA 4QP6A 3DLSA 2C6OA 3HKOA 4FTIA 2ZMDA 2JDSA 3PSBA 2HZ0A 3PWYA 5T6KA 5HNIX 5I0BA 3WZJA 3QD4A 2VAGA 3NYOA 2CPKE 4YJTA 2DS1A 2WFYA 2XNNA 4ZSLA 5AA9A 3HAVA 4M0YA 2YWVA 3GC8A 2CJMA 1BUHA 4XOYA 2JGZA 1KE7A 4C2VA 2WMWA 4W8DA 2R3RA 2E2BA 5IA1A 3F3UA 2JKKA 4FEXA 3QRKA 4A9SA 4YURA 5A14A 4YNOA 3LFAA 4MD8E 4DEEA 5AV1A 1PXNA 3QFVA 5EHYA 4IZ5A 3QLGA 4USFA 3U55A 4WNOA 4AU8A 4IW0A 5JK3A 3PXFA 2QNJA 4RPVA 2XEYA 1YHWA 4FV4A 2GNGA 4XX9A 1IEPA 2XS0A 3TM0A 2JC6A 2A0CX 1M2PA 2IPXA 3QRIA 5HX8A 4ERKA 4BDHA 3OTVA 5M4IA 4QP8A 2DQ7X 5CEPA 2VO3A 3FMNA 4KNBA 5FWKK 3C4CA 2VWZA 4Q9SA 2BCJA 4FKVA 4ALVA 1QMZA 1M17A 3OCSA 3UODA 4AZWA 2V7AA 4J1RA 1Y6AA 2BKZA 2Z02A 5JT2A 4PMMA 4F9AA 4RVLA 5LJJA 3ORTA 2OU7A 3OZ6A 4GH2A 4E3CA 4OTHA 3HA8A 3D5UA 5BQ0A 1V1KA 4YJRA 3I81A 3JPVA 4R1YA 5HEZA 2PPQA 4JBQA 4QQJA 2XK6A 3GQIA 1X8BA 2R9SA 2WIHA 3LKMA 3NNWA 4GUBA 5HKMA 4O84A 2ITNA 4HVHA 5M51A 1OI9A 3Q4ZA 1NW1A 4JJRA 4L00A 5ACBC 1WAKA 1OL1A 3EL7A 3NUSA 4RX9A 3SLSA 3SV0A 3DXQA 2YLEA 4C3RA 5CEIA 3OUKA 1SVGA 4GT3A 3CGOA 3PE1A 4G6OA 4RLLA 2VX1A 3FUPA 5IF1A 3UPZA 4WUNA 4ZP5A 5HU9A 5BPYA 5FDPA 4MX9A 3LCOA 2VTMA 4ZSAA 3ALNA 4K2RA 3SXFA 2WTDA 2XKDA 4EHGA 4AT5A 4O6EA 1XWSA 3QTWA 3SD0A 2HELA 4N0SA 3TJDA 4C7TA 5KMOA 2J5FA 3MV5A 3PZHA 5FRIA 3UMXA 3BYUA 4LV8A 4GJ2A 3I5ZA 3VUIA 5M4FA 3DGKA 1H07A 4I6FA 2CSNA 3EHAA 3PLSA 5H3QA 4WRGA 3BIZA 3A4PA 4QP2A 1UU8A 3DFAA 5G6VA 2IVVA 5IQHA 3UG1A 1FMKA 5CLPA 1YXSA 5HTCA 3MVMA 4IAFA 2J2IB 4ZTRA 2X7OA 2A19B 3NS9A 3QLFA 4EHVA 3FZSA 2CGUA 1W0XC 4DEDA 3IG7A 4M0ZA 4AAAA 5L2TA 4AA4A 4CMOA 3P4KA 2RGPA 4IB5A 2VGOA 1GZKA 3VBXA 3F2NA 2C3IB 3D2IA 3W2RA 3P1AA 4FKIA 1YXVA 3P0MA 5TR6A 2FSTX 4RWLA 3QUDA 5C03A 5JFSA 5HGIA 1GZNA 1MRVA 4X3FA 4XV2A 3U4WA 2WMAA 3ENMA 3BI6A 3PA5A 3ZLXA 1G5SA 3RPSA 2WQMA 2IVTA 3QGWA 3RAIA 3F2RA 4RFMA 1JSVA 3DZOA 3G5DA 4OT5A 4LV5A 4AN3A 2BTRA 2PTKA 4IWDA 3UOJA 3UE4A 5KCVA 5FBNC 2C6LA 3CIKA 3CTJA 2XNOA 3IGGA 1UV5A 3IK3A 2DYLA 4OBQA 5EOBA 3IQ7A 5B2MA 5KMNA 4FYNA 4JLCA 4HZRA 3WF7A 2BIYA 4Z9LA 4XG3A 4MBJA 3F82A 1XH9A 5E8UA 1CKIA 2OK1A 3ZU7A 3DQXA 2XIYA 4XG4A 4G17A 2GHLA 5KMJA 3COKA 4U3ZA 4PY1A 3F5GA 5HZNA 4G3GA 1NVRA 5HVKA 2W9FB 4F65A 4FIJA 3G15A 5CS6A 3TIYA 3WF8A 3ZM4A 5IA3A 1FBNA 3O71A 1PXKA 3O51A 3SG8A 3TI1A 1FQ1B 5ANOA 3QQJA 4CFWA 2BIKB 2GU8A 3D94A 2CNVA 4DTAA 4GG7A 4PPAA 2GQSA 4G3FA 3L8XA 4BI2A 2VRXA 3R0TA 4O86A 2UUEA 3OCGA 2E9OA 3OXIA 2FB8A 3OWJA 3ZH8A 3NYNA 4D4VA 2R0IA 3MY0A 1YVJA 5DEYA 4GYGA 4E8AA 1J7LA 3A7GA 2BDWA 2GNHA 2X81A 3SW7A 3SC1A 4IH8A 4NTTA 3RPYA 4B6LA 3QCXA 1XR1A 3MESA 2HK5A 4QMOA 5L6WL 2W06A 1XH6A 4K9YA 1P4OA 3QALE 4RA4A 5J1WA 2VWUA 3G90X 4LL0A 1K3AA 4I93A 2VTIA 2YDIA 3F3ZA 3R2BA 3HL7A 3DB6A 3GUBA 2Z7LA 2V0DA 2BDJA 1WFCA 2W5AA 4P2KA 3UZRA 3BBWA 5DI1A 4FL2A 3NWWA 4I4FA 1XH4A 3DZQA 3KRXA 4BCPA 4KABA 2BKKA 4EKLA 4JAJA 3MJ1A 4ZLOA 4K18A 2ERKA 4I6BA 2VTJA 4W4VA 3EB0A 3V6SA 4X3JA 4AF3A 3HYHA 3KU2A 4FTCA 5HE1A 4EORA 3RZFA 4PP9A 4M14A 4RIYA 1KE5A 5EOLA 4NW6A 3UVQA 3FMEA 3LVPA 2W1ZA 2FUMA 3F7WA 4HCTA 3EQHA 1JBPE 4F0GA 3MS9A 3IW8A 2YM5A 4RRVA 3DBCA 4L01A 4OBOA 2J0JA 3FPQA 4AZSA 2H96A 1DAYA 1SVEA 4LRMA 4NCTC 3R7EA 5ITAA 4FZ7A 5EYDA 4DYMA 2GFSA 2UZLA 3D4QA 2ZDUA 3C4ZA 5AUTA 3SA0A 3CP9A 4FL1A 1ZRZA 3KL8A 3DB8A 4EQUA 4X7QA 3MH1A 4IE9A 5EHOA 4B4LA 3TZ9A 2RL5A 4I94A 4O7VA 2UZBA 3HZTA 3ZXTA 3ZBFA 5FTOA 2WMTA 1H0VA 5BNJA 4N6ZA 5M44A 2HYYA 2WNTA 3CTHA 3IDPA 5FM2A 4IANA 5C9CA 4LUEA 4FTOA 1REKA 3S1HA 1O6LA 1H24A 4FX3A 2OXXA 1CSNA 5FTQA 4DEBA 4BKJA 3CLYA 4UEUA 4D5KA 4JQ7A 4OLIA 4CFXA 1OZ1A 4IX3A 1ATPE 3DDQA 3C50A 3RGFA 4XV1A 4HNFA 3RPOA 3P08A 5JQ8A 5CSWA 2JITA 2P3GX 3V04A 3R01A 4A07A 4FOCA 3PPKA 4J99A 2PMIA 3FV8A 3PA3A 3SG9A 2VWBA 2XVDA 4H1MA 4R6VA 2F7XE 2R5TA 3LJ1A 3NR9A 4DITA 4FV9A 4EC8A 4OTIA 4FV3A 4KRDA 2XUUA 3B2WA 5AP7A 3T9TA 4RIXA 4YLLA 1O6KA 3MVJA 3LFQA 1H08A 4BGGA 3R7IA 3FHIA 5DT4A 4JDIA 4CCUA 2BZHB 4U6RA 3NZ0A 3TIZA 2C5NA 4NK9A 4UZDA 3BEAA 5ANKA 2VTHA 3PVUA 4ASDA 3HLLA 1M14A 3PXZA 3KCFA 2R4BA 4EEVA 3BYSA 2PUIA 3II5A 3RVGA 5CXHA 4XHKB 4JS8A 4DHFA 2PULA 2IZRA 3SVVA 4IJPA 5J79A 4KKGA 4RIWB 3V01A 4WT6A 5D11A 4RJ3A 5K5NA 4RQKA 4CFVA 3F3WA 3HRBA 3DS6A 4JQ8A 5I9UA 3ZRKA 5KBQA 3DBQA 3U8WA 2OH0E 2GQRA 3GVUA 3KF4A 4R7IA 4GG5A 3BLHA 4F6WA 3VF9A 2BAQA 3LCDA 4D55A 2C6DA 4FT7A 3G0EA 2RFNA 2VN9A 3EWHA 4F1TA 1K9AA 4DN5A 4FV8A 1UVRA 4EONA 5IUGA 2C5OA 3FYKX 5IQGA 5LARA 5FXRA 1SVHA 3ZLSA 2CN8A 3TKHA 5JEBA 3Q6WA 4IFGA 5KX8A 4DGMA 4JBOA 4BTJA 4DAWA 4XG8A 3FKNA 2VTAA 5AM6A 2WMQA 2UZWE 1GJOA 4FVPA 3SHEA 4TXCA 3IECA 2QCSA 4AWIA 2XBAA 3E5AA 5I4NA 3I0QA 4L67A 2IWIA 4CFUA 4QYHA 1Y57A 5IA4A 2UW0A 4GFOA 2I7QA 3QCQA 4DH8A 4L46A 4YJVA 4FE2A 3BV3A 5EQYA 4QP9A 4BDJA 1P2AA 5EW9A 3BX5A 5J9ZA 4CQGA 1GAGA 3UC3A 3BQCA 4HW7A 3TTIA 5EDRA 2CN5A 5HE0A 3QUPA 4YNEA 5L2SA 4ZZNA 4HVGA 1YXTA 3GC9A 2H8HA 4XJ0A 3OUNB 3VN9A 4C62A 1P14A 2ETMA 2GDOA 4IVBA 5CVHA 3RI1A 5DHJA 4AT4A 3QL8A 4I20A 1OGUA 3GNIB 1UWHA 2C5XA 4RMZA 4FMQA 2UVZA 2O5KA 3BYVA 3Q96A 4RLKA 3RWQA 3TDWA 1OB3A 3L1SA 2PUPA 2GQGA 1ZMUA 3KN5A 3TZ7A 1Y6BA 4IX6A 3ZBXA 4E93A 4FNWA 3ZO3A 3MH2A 1AGWA 1BI8A 4KIOA 4M68A 1B39A 3FDNA 4XP3A 4ZJVA 4U40A 5D41A 4QP7A 5E91A 4I22A 1CKJA 4L3JA 3VRYA 3F2AA 1WVXA 3EQDA 3FHRA 3UOLA 2Z7RA 4NEUA 3UMWA 2CLXA 4BZOA 3R8UA 3EYGA 3FLNC 1PMNA 3CCNA 4OTFA 2B9IA 2PZPA 2XIXA 4QT1A 1MRUA 1I44A 4U7ZA 3U9NA 4L9IA 4GVAA 3H9RA 1LUFA 4ZSJA 2VTQA 1H25A 4H1JA 4PMTA 3RWPA 3K3JA 4ZS0A 3VQUA 5GHVA 3R9NA 3NUPA 4BZDA 3IW5A 3P7AA 5CEQA 2W4KA 1JKTA 1OM1A 2R3IA 3DBEA 5C4KA 2J0KA 3BGQA 2VTRA 3W1FA 4I5PA 2NP8A 1XO2B 4HYSA 2WMBA 3JUHA 2P2HA 2FSMX 2C1BA 5BVWA 3R8VA 2X39A 4M69A 3D9VA 4V0GA 5F20A 2CGVA 4WOVA 3QD2B 5HIDA 2V22A 1OL7A 1STCE 3AC8A 4WIHA 2PUUA 3G0FA 1PF8A 1IR3A 2JAVA 5DT0A 3RALA 5AX9A 4S32A 3R8MA 1FGIA 3C9WA 3A7JA 4RJ8A 4XV3A 1E9HA 2JKMA 3FLYA 4MXYA 1Q99A 2XH5A 3PRIA 3IDCA 4U5JA 1JNKA 3QXOA 4RVTA 3FL4A 4YBKA 4O7TA 3VHKA 3EKNA 3OCTA 5HBEA 4B99A 3F3VA 5J1VA 3UZTA 2YFXA 2YIWA 4IXPA 3HMPA 4O7WA 4BCFA 4BWPA 3ZDUA 4D9TA 2G2FA 3DA6A 4MEDA 1LEZA 2F2UA 4O7NA 4M97A 3D2KA 4X6QC 2ZVAA 4ACHA 4PP7A 3FQHA 3GCSA 3OC1A 1VZOA 3LCKA 4F4PA 3KMWA 4ZZOA 3FQEA 1JAMA 3O50A 3I7BA 3C4XA 2IW9A 3RAHA 2ZM4A 3ROYA 2BRGA 2GCDA 4IVAA 4W4YA 4ZMEA 5K0KA 5GINE 3ETAA 4UWCA 3D5WA 4O38A 5DOSA 3ZZWA 2IW8A 3FLSA 4I6QA 3QX4A 4CSVA 4L52A 1MRYA 4O0TA 3CGFA 4DT9A 2WMXA 4J8NA 4U44A 2X9EA 2O8YA 1FMOE 3DV3A 4IB1A 2UVYA 4USDA 2Q0BA 1B38A 1SMHA 3OW4A 4M8TA 3UTOA 1GIJA 4QMNA 3QYZA 2G2IA 3G6HA 4HGTA 3TXOA 3TNPC 5HG7A 3VO3A 2PVLA 4RQVA 5JRQA 3KKVA 3BGPA 1T46A 2O63A 3IGOA 3BWJA 5CSVA 4CV9A 3ZC5A 3GOKA 3EIDA 4JG6A 3LLTA 4BCQA 4KAOA 5HHWA 3VS1A 4A7CA 3HDMA 3QZGA 4CRSA 2Y0AA 4P4CA 4AZVA 1Y8YA 4F1MA 4PDYA 4O7ZA 3AD5A 5I9WA 4QPAA 2WEVA 5D1JA 3VS3A 5B7VA 2UW4A 1YHVA 1XH8A 2J0LA 1ZZLA 3V3VA 1JKKA 4NH1A 2R3QA 4UMTA 3TZMA 5C8NA 3FWQA 4FTQA 3L8SA 4FV0A 4EH7A 3F69A 3MW1A 1Y91A 5T68A 3HEGA 2O3PA 3MPTA 3W16A 4AN9A 5DE2A 1XH5A 3QZHA 4O0UA 3ZC6A 2VGPA 3B8RA 4C4FA 4EOKA 1FOTA 4BFMA 2Z7SA 4RBLA 4BGHA 4DLJA 3L9LA 3QD3A 1KE6A 2BALA 4JDKA 4FUYA 3ENHA 4GU9A 4RFYA 1VJYA 1G3NA 3WOWA 1M52A 4O22A 4RJ5A 4O83A 3E7VA 4GCJA 3K54A 4C61A 3UP2A 5AUVA 3MVHA 3ZTXA 2KTYA 1H1QA 4ZJJA 3NEWA 1XQZA 3EQGA 4TPTA 2F2CB 3VW8A 3ZXZA 4BTFA 4UMUA 1R78A 5AP5A 2XF0A 2DUVA 4BC6A 4QP3A 3UQGA 2XA4A 3FLQA 2VTLA 4L53A 3VNTA 1VR2A 2QOFA 3LW0A 3BRBA 2XM8A 3H0YA 3DAKA 4FSNA 4H3BA 4GRBA 4XP2A 3ID6C 4R7BA 1Q61A 3QU0A 2J6MA 2I40A 3KXHA 3LMIA 4Z55A 1YHSA 3LE6A 4FIHA 4CXAA 2VTOA 3QBNA 4F7SA 3POZA 1GOLA 2C30A 2XCHA 5IEVA 2X4ZA 3IW4A 3LM5A 3NIEA 4ZK5A 4ZY4A 2XJ1A 4ZSEA 2XYUA 2XBJA 1KE9A 4W4WA 3UO5A 5DBXA 4QMUA 4MYGA 5KZIA 2QOLA 1Q8ZA 1ZWSA 5CF5A 3CR0A 2HOGA 2XNEA 3F61A 3R7GA 4IDVA 3V5PA 2VWWA 3AXWA 4S33A 3VVHA 2WXVA 2VTSA 3UO6A 4C2WA 5H8EA 4C4EA 4DEIA 5M06A 4TZRA 2YM6A 3S00A 5DIAA 4G3CA 4C3FA 5IH4A 2R3OA 3CQUA 3D5VA 3MFTA 3UO4A 2F9GA 3F5UA 4AE9A 5CAVA 4RT7A 5CENA 5LCJA 1KWPA 4FNZA 4M67A 5EI6A 2WPAA 3VUHA 3RINA 3FJQE 2QR7A 3OWLA 4IEBA 2WMVA 3WILA 2QU5A 5EH0A 4WSQA 5E8YA 4DEGA 4EHZA 3ATSA 4AFJA 4ACCA 3U4UA 4LOPA 4XLVA 4MWHA 3EFKA 3QHWA 4QQCA 2QOQA 3VUTA 2YIYA 3EMGA 3AGLA 3MFUA 3CKXA 3CEKA 5BUEA 3OS3A 4O82A 4HOKA 3RM7A 1XHAA 3BYMA 2PVFA 4O21A 4QO9A 2R3GA 3AQVA 3R6XA 3VW6A 4B8LA 4ZTMA 5AEPA 3TNWA 4D2RA 1Q3DA 2W4JA 4G1WA 4KB8A 4BWKA 2V55A 3NAYA 5EFQA 4MQ2A 4ZTSA 4X2GA 3W55A 4PNKA 3LFNA 5ETIA 4X2JA 3IPHA 1KOAA 4EH5A 4MTAA 1H27A 3T9IA 4F63A 2PZYA 3V5WA 1IAJA 2C47A 3GEQA 4FV7A 5CWZA 4YSMA 3F66A 3JR1A 1H4LA 4F0FA 2B9FA 3O2MA 4TYEA 4F08A 1F0QA 5A4CA 3AT3A 5H8BA 2FYSA 4UY9A 4W8EA 4WD5A 5E8XA 5BVNA 1Z9XA 3ULIA 4F7NA 1BMKA 2ITQA 1QL6A 3DY7A 4LMNA 3KMUA 4O6LA 4BDGA 3B2TA 4HGSA 1W83A 3P7CA 3VRZA 4R77A 1VYWA 4ANQA 5FLFA 3MA3A 2X8EA 5IA0A 2NRUA 4R3RA 2WQNA 3GENA 4Q5HA 4E7WA 4DG2E 2UW7A 1SZMA 4FICA 4NIFB 3WZUA 4BF2A 4DINA 2EWAA 1U54B 4FZDB 4I1ZA 4O1PA 1CMKE 1PKGA 3HV3A 4Y72A 2HZ4A 3DBDA 4J7BA 5AR8A 5EKOA 4BCOA 3NNUA 4RIOA 5AP2A 1Z57A 5M08A 3WARA 2NPQA 1TQIA 3VF8A 4YZ9A 5DFPA 1JQHA 3AGMA 4WG3A 5BVEA 3F6XA 4ZJIA 4CYIA 4F6UA 5KMLA 2YDKA 1H26A 2Y4IB 3LXPA 4J98A 3JXWA 3K5VA 4QMQA 3UQFA 4JXFA 3R02A 4U8ZA 2HXQA 3E93A 3LXNA 4XP0A 5IUHA 2OJ9A 4PDOA 3UVPA 5JFXA 1JWHA 5AV4A 4XG6A 3WI6A 5BVDA 5IMXA 3E8DA 3OY3A 4FG9A 4U81A 4DGNA 4ZZMA 4MXAA 4M66A 3R9RA 3FBVA 1WBTA 2UVXA 3ZSGA 3DJ7A 5GZ8A 1U5RA 3D14A 3KK9A 4ZS4A 3DAEA 4LMUA 4IZAA 4ZTQA 5CANA 3FXZA 4FOBA 3D15A 2F7EE 3FMKA 4QYYA 4KIKB 2YCFA 3M2WA 5IPJA 4WBOA 3LLAA 2P55A 1PRYA 1V0PA 2J90A 3HECA 2YZAA 5IISA 3DT1A 3VHEA 1F5QA 4IAIA 2VNWA 3LFCA 2ITUA 1PW2A 3R7YA 1M7QA 5CXZA 5M55A 3BU5A 3JY9A 5H9BA 3EYHA 4HVIA 4JBVA 5K4JA 5JQ5A 2IJMA 3GT8A 4PL5A 5EI2A 3EFLA 3HUCA 3PG1A 4M15A 3VQHA 4EH4A 5CF8A 2R3JA 3ZUUA 4R3PA 4OGRA 4F9WA 4IZ7A 3PIZA 3O17A 4PV0A 1OL6A 4JL9A 1FVVA 4PNIA 3R7UA 3SAYA 3OP5A 1OPKA 3JVRA 5DGZA 2HW7A 2P0CA 1V0BA 3C5IA 3LHJA 5BMMA 5C27A 4H39A 2XNMA 4CLIA 3MFSA 3DKFA 4KUJA 5DLSA 4GJ3A 4DCEA 4MD7E 1IRKA 2PMOX 4EH9A 3FAAA 4E6CA 3DXPA 4RJ6A 2J50A 4CYJA 1DAWA 2OIQA 3QKLA 3FZOA 4PX6A 5GNKA 3GCUA 4ANNA 4S2ZA 3QWJA 3ORIA 3E87A 5DWRA 5E8ZA 3W2SA 4K8AA 1PMEA 3PA4A 3TACA 2ONLC 3NCZA 3A2CA 2REIA 4PMPA 3ZUVA 3COHA 4FSYA 4GV1A 3FSKA 2YISA 4AE6A 4QMVA 3MH0A 4FODA 3JVSA 2W4OA 3ANQA 4FSZA 5EYCA 2R64A 4AN2A 5GZAA 5M09A 3C51A 4BIBA 3QTIA 1Q41A 5HG9A 4AGCA 3SKCA 4YLJA 4E26A 4OR5A 1YDRE 4E5BA 4HYUA 3SGCA 4HPTE 3E3PA 4FSQA 1GNGA 5CAPA 3AC2A 4TYHB 3IO7A 3PFQA 4ITHA 4KWPA 5CU4A 3RKBA 3ZFYA 3G9LX 1YXXA 2C4GA 3EOCA 4ENYA 5AV0A 5DRDA 2H9VA 2BTSA 4GK4A 2A27A 4KKHA 5AP0A 3BE9A 4ARKA 4II5A 2X2LA 4O2ZA 5I3OA 4U97A 2X8DA 3MN3A 4AW5A 4CNHA 2PE1A 2BRMA 5EI8A 5E90A 4MNEA 3E64A 5CVFA 2E9NA 5DN3A 3ZUTA 3LJ0A 1TQPA 3OD6X 3QZIA 3FC1X 3EJ1A 4WHZA 4FSTA 4FF8A 4NZWB 3C13A 3AC1A 3BCEA 4IDTA 5IQFA 3L9PA 5GJFA 4MWIA 3ZSHA 5A6NA 1PHKA 5IQBA 3PE2A 4EH6A 5K5XA 5HICA 2CMWA 3DJ6A 3LJ2A 3GC0A 1JPAA 1BL6A 3P79A 5AADA 5EW8A 4V05A 5E92A 3DJ5A 3VUGA 3FMDA 4M13A 3ZOSA 2OGVA 3TUBA 4QYEA 3QHRA 4YC8A 3UZPA 5FXSA 2YHVA 5EM7A 3G33A 4ZXTA 3RCJA 3R83A 4BBEA 4H05A 3SRVA 1WCCA 5EHLA 2W99B 4A9UA 4RZVA 1WVWA 3CE3A 4FTAA 4Y95A 3PP0A 5AR5A 5C26A 4IAYA 1DI8A 1M2RA 3NUAA 4Y85A 4D58A 3Q9WA 4AACA 2WMSA 4BDBA 4F9CA 4FG8A 4FK6A 1YI4A 3AD4A 3M11A 3LZBA 1QPJA 4OTGA 4YTHA 1P5EA 2C5VA 4I5CA 4IB3A 5FEEA 3UVRA 4BBFA 5LMKA 4PDPA 4HVSA 4FTRA 2ITWA 3OTUA 4C3PA 3NSZA 4Z3VA 3NUXA 2OBJA 2QC6A 4KBCA 5CSHA 5DA3A 2QO2A 3PRFA 3A4OX 3QA8A 5DEWA 5L8KA 4CEGA 1DM2A 4TYIA 5C1QB 2JD5A 3E63A 3ZLWA 5D7AA 4FC0A 3JY0A 5ETFA 1XKKA 2HENA 2J9MA 3F88A 4ASZA 4FEWA 4PTEA 3UNZA 4C57A 4ACDA 5DYJA 5CF4A 3ALOA 4U79A 4EOSA 1W82A 3BYOA 4LI5A 3GI3A 1UU7A 3EN7A 4JNWA 1BX6A 4MXXA 3OT8A 2J51A 5BYYA 2BDFA 2OZAA 2LAVA 3TNIA 4NT4A 4UMPA 5J5TA 5KKRB 3LMGA 3PP1A 4NWMA 4EWHA 5D12A 5GJDA 4XYFA 2UZUE 3OG7A 4AFEA 4BI1A 4YGAA 1BYGA 3W8QA 1OPJA 4NKAA 5E8SA 4D4YA 4DF3A 3V5QA 3MVLA 2PSQA 1Y8GA 4GL9A 3WF5A 3BLRA 3EFJA 2OIBA 3QQLA 2YN8A 4PUZA 4B7TA 4YHTA 2ZV7A 3OBJA 3PY3A 4DGGA 2JDOA 4TWNA 3HV4A 3HNGA 3OT3A 1DS5A 3R63A 5HESA 2W1GA 2PUNA 1FPUA 3SXSA 4TYGA 3AD6A 1KUTA 5FD2A 4ANLA 5D10A 4TWPA 3KA0A 1OUYA 2GTMA 2BFYA 4ENXA 5LOHA 3V6RA 1M2QA 3V5TA 5LVMA 1YQJA 4CG8A 5IQCA 2XIRA 5B0XA 3CY3A 1BL7A 3KULA 3UNKA 2XRWA 2XKEA 3Q53A 3AC3A 3WF6A 4IMYA 4AXAA 5DNRA 3RK5A 3DKCA 2QONA 2B0QA 5BVOA 4GK2A 2VNYA 4QPSA 2HZIA 4YSJA 4CT1A 3KGAA 4G6LA 5F9EA 4KBAA 3P86A 4Z7HA 2YA9A 4V01A 2WEIA 4G9CA 1ZOGA 4JQEA 2P4IA 5HVJA 4FIFA 5CVGA 1PXOA 4TWCA 4XRLA 2ITOA 3OOGA 3R1NA 3PYYA 3UC4A 4AQCA 3KREA 4K77A 4WSYA 4QTEA 3GU6A 3TCPA 2WQOA 4PPBA 3AG9A 4QTDA 5AAFA 5LMBA 4EJNA 5TF9A 1CM8A 2GNLA 3H3CA 5IG1A 4GUEA 2GNJA 3DU8A 3NUNA 4J71A 3ZLYA 1H1PA 2VWIA 1ZOEA 4GSBA 3FMHA 4KRCA 2CNUA 4PTCA 2OFVA 4UV0A 3TZ8A 4YPDA 2C6EA 2VWVA 3RCDA 3NW5A 5HD7A 3VS5A 4D1ZA 2Y9QA 1PMUA 3UQCA 1RQQA 3H0ZA 1E1XA 4QMZA 4C59A 5KHXA 3ZDIA 4D1XA 4IVCA 4Q5EA 3M42A 4FK3A 2EXEA 2HAKA 3I4BA 4RX7A 3ZFMA 5AX3A 5AIRA 3VS4A 3AOXA 4JOAA 4FKOA 2XEZA 3I6UA 4FNXA 4EQMA 1PXIA 3QUEA 2YCQA 5FG8A 3VBWA 4C4JA 3ZS5A 2OZOA 2VX3A 4E4NA 4IACA 3BE2A 4JIAA 1OPLA 3C0IA 4G34A 4S30A 3VAPA 2B52A 1JKLA 3MPMA 5K4IA 2OSCA 4XV9A 1YRPA 3EN9A 3R9OA 2BHEA 3D7TB 4WA9A 1OKWA 4JI9A 3TG1A 4EK6A 2B9JA 3BHUA 3MPAA 3ODZX 2ITXA 2WTWA 3B8QA 3EL8A 2JKOA 2A1AB 2OKRA 2RG6A 4FA2A 3OWPA 2B4SB 2UW6A 4UYAA 3ORKA 3FKOA 4H36A 4L42A 4ID7A 3UIXA 1TVOA 2F4JA 3OXTA 4UX9A 4FT5A 1DI9A 4FSMA 3U6IA 3H30A 5ACKA 3ORLA 3QRJA 4E5AX 4NYEA 1NXKA 3I0OA 3PVBA 2Z8CA 4FG7A 5CU3A 5A3XA 1Q8YA 1J91A 3NX8A 1JLUE 4ITJA 4YBJA 3HA6A 5HORA 4ANSA 5JZJA 3ORNA 4FKJA 2PVYA 2VTTA 3QC4A 4BDKA 4DG0E 1XBCA 5H8GA 1GZOA 4I6HA 4QTAA 2F49A 4MK0A 1O9UA 2OJJA 4CCBA 3CQWA 4K11A 2EU9A 3EQCA 3A8XA 1H8FA 1PXPA 3MI9A 2BUJA 4QTCA 2I6LA 3G9NA 4O0XA 3EZVA 3S2PA 5AAGA 2VD5A 3KCKA 4BICA 5HU3A 5FEQA 2YM7A 2AC3A 4QMWA 4L7FA 4RJ4A 1WBPA 1PXJA 4BTMA 4CT2A 4EJ7A 3QA0A 1IA8A 3ZMMA 4BBMA 2C3LA 1BI7A 2QO9A 3ZO4A 3C4WA 1YW2A 4AZEA 4O1OA 2OICA 4GT4A 4ERWA 2JBOA 3TDVA 3IOKA 2PYWA 4TT7A 2IZUA 2AC5A 4W9XA 4U0IA 4YZNA 4DFUA 2UV2A 2ESMA 5HI2A 2OF2A 5CT7A 4MQ1A 5IQEA 4JG8A 4QMSA 4NU1A 5A54A 3D0EA 5BX0A 5CYIA 3C4FA 4GVJA 4CZUA 1CTPE 5HX6A 4N4SA 3OEZA 3RPVA 2V5QA 4BTKA 2VWYA 4RWKA 2AYPA 3NRMA 4IM2A 5LVLA 1L3RE 3PY0A 2I0HA 4DH7A 4ZY5A 1S9JA 4HVDA 5KNJA 2I1MA 2PHKA 2ITVA 3TL8A 3N4TA 5H2UA 4TNDA 4YR8A 4QNYA 5AR7A 5K3YA 3WE4A 3WBLA 3Q04A 4UWBA 2WELA 2BR1A 4FKLA 3TN8A 3NLBA 4PQNA 4ITIA 3QD0A 3TNHA 3FKLA 3ULZA 2PK9A 3PZEA 3DK6A 4DFYA 3WF9A 3R28A 2OXYA 4A9TA 1NT2A 4R1VA 4D9UA 5JN2A 5KE0A 3OFMA 4C4GA 3ZYAA 1KOBA 1Q62A 4AOJA 2YIRA 4IM3A 3I6WA 5HO8A 3R7VA 3TNQB 3R1QA 5LWMA 2QLQA 5M53A 4F6SA 4H58A 3MGYA 4UMRA 2FA2A 1PKDA 1JOWB 1H1SA 4HYIA 3Q60A 3L8VA 4BCNA 5IQDA 2ONLA 3MTLA 4BIEA 3ANRA 3NYXA 1J7UA 4FSRA 1FGKA 2WZJA 4EOQA 3IW7A 5HBJA 2J5EA 3LXLA 3A7HA 1YOJA 1O6YA 3NDMA 1OBDA 3C1XA 5KZ0A 4QYFA 1J3HA 3AC5A 4ALUA 4YJSA 5BVFA 5L3AA 5B2LA 4OTDA 2FSLX 3MIYA 2OH4A 3SXRA 3DOGA 1J1CA 2YJRA 3BWFA 2GHGA 4I0SA 4E5WA 3E88A 1URCA 5J8IA 3BZ3A 2G15A 4D0WA 4MH7A 4P5ZA 3OROA 4EL9A 3CPCA 1V0OA 4MBIA 3UOHA 4B8MA 3CXWA 2NO3A 2R3LA 3G51A 3NUUA 4FTLA 4CKJA 4L8MA 2CCHA 2HW6A 4BYJA 3E62A 4JR3A 4R3CA 4WBBB 1W84A 4M7IA 5DPVA 1H0WA 4FV5A 1WBVA 3QQKA 4FTKA 5EDPA 4ZTNA 3LMHA 2ZJWA 4C4HA 3PJ3A 4GK3A 4U45A 4Z16A 4BWXA 1XBAA 3KXGA 4W4XA 4X3FB 3OHTA 5IH6A 2PL0A 2YZLA 2R3HA 3GFWA 2QHMA 1YDSE 5HG8A 4HGLA 2PU8A 4QP4A 3IS5A 4DH1A 3W2PA 2EB3A 4BRXA 2BRHA 4JBPA 4NTSA 5E4HA 2WIPA 2IN6A 3E8EA 4FZAB 3EFWA 4UYNA 5ANDA 3CD3A 2OG8A 4FKRA 4D4SA 3TT0A 4JAIA 5E9EA 2ETRA 3PXYA 5HE3A 3L8PA 1Q8WA 1IG1A 3GCPA 3ELJA 3FXXA 5FQDC 3UNJA 2CDZA 4FIGA 2JIIA 3VBQA 2YM4A 3H4JA 3ITZA 5D9HA 3TV7A 2QG7A 5ANEA 2WTIA 4FTTA 3VBVA 3PJ8A 3WE8A 4KS8A 3ORPA 3V8TA 5AJQA 5HD4A 3LFSA 5AUUA 5KMKA 1R0PA 3RP9A 3ZEPA 3Q2JA 3QX2A 3ZRMA 5AP4A 4XG7A 3BU3A 3TV4A 4J95A 1R39A 2CGWA 4C36A 2SRCA 4IX4A 4NW5A 5ANGA 5E8TA 3IONA 4YJQA 5CSPA 3P78A 4DFXE 2QKRA 3HGKA 4YZMA 2XRUA 1OECA 2PWLA 3P7BA 1PJKA 2RSVA 4FKSA 3AT4A 3GCVA 5CEKA 1YI3A 2GTNA 3G6GA 3NNXA 4QP1A 3BHYA 4I4EA 3ZO1A 1ZMVA 1PYXA 2BRBA 3HAMA 4AA0A 1ZYDA 2W1CA 4ZEGA 4U3YA 4RC2A 2DWBA 3U54A 3K5UA 2OW3A 1SNUA 2B55A 2EVAA 3V8WA 4P5QA 2C6TA 3DBFA 2E9UA 3A61A 3FZTA 3VJNA 2XZSA 3KVXA 3FLWA 4TKSA 4EZ3A 2UW8A 3R9DA 2XIZA 2ZV9A 3R9HA 1TKIA 4F09A 3TV6A 1XH7A 2J7TA 5TKDA 3QZFA 4WNPA 1HOWA 2IVUA 1ZY4A 5CASA 3GFEA 2XB7A 5I9YA 4AA5A 3I5NA 3IKAA 4NCTA 4FKPA 4WO5A 4RIYB 3MB7A 3VULA 2XJ2A 1Q5KA 1YXUA 2BFXA 2HWOA 5I9XA 4BHNA 3FEGA 2C69A 2ZAZA 2G2HA 1Q97A 1LP4A 5E7RA 4FT3A
chains in the Genus database with same CATH superfamily
4YJPA 1BKXA 2V62A 4EBWA 4O27B 4UXQA 2WQBA 4KKEA 1F3MC 4DG3E 1KV2A 3ACJA 4GIIA 4QMXA 3HDNA 4FSWA 5EM5A 2UZOA 3UPXA 3VJOA 5IH5A 1R0EA 3MWUA 3DK7A 2GPHA 5J9LA 1G8SA 4TYJA 5ANJA 5I3RA 3BHHA 1OIRA 1U4DA 3PTGA 2QU6A 4OTQA 5ETCA 4XBUA 1UU3A 4EYMA 2OLCA 2IVSA 2R3NA 2UZEA 5CNNA 3VUMA 5J95A 3FZ1A 4TNBA 4GKHA 5FEDA 4AZFA 3SOCA 2Y8OA 3G2FA 1UKIA 4LRKA 4FSUA 2RKUA 3BKBA 5DR9A 5AP1A 5JFWA 2CHLA 4JDJA 4EOLA 3NW6A 2FGIA 3LCTA 3DLZA 3IW6A 1JVPP 5CI7A 4DTBA 4RWIA 3UYTA 3RBWA 3Q6UA 4HYHA 4PPCA 1UNGA 3QC9A 4CTCA 2IZSA 2VX0A 1A06A 2XJ0A 1ZARA 3PVWA 3Q9ZA 3R04A 4XCUA 4ZIMA 5A6OA 1ZYSA 4EBVA 4F9BA 5AUYA 2VZ6A 1YWNA 1OIQA 3QKMA 4FKUA 5EYKA 4EYJA 1G8AA 3NFFB 3NAXA 4JX7A 3ZCLA 3TTJA 4LUDA 2HXLA 1ZYCA 4FV2A 3Q5ZA 2R0UA 4D0XA 4EZ5A 3U51A 2I0EA 4C0TA 3NYVA 4JG7A 2OIDA 5HE2A 4WUAA 3W2OA 3VIDA 2WMRA 3NVKI 3DKGA 1IASA 5I5ZA 1U59A 5IDNA 2X7FA 2WTKB 2Y7JA 3OBGA 5IKWA 1MUOA 1R3CA 4NUSA 2YCRA 5DMZA 2X7GA 5C8MA 4RIXB 2BRNA 3PJ2A 3DQWA 2UW3A 4FKGA 1OL5A 1OUKA 2AUHA 2WO6A 4S34A 5FUTA 2QOCA 3KB7A 3RM6A 2QOOA 2I0YA 4RIWA 5L2QA 2PZ5A 3KFAA 3LFEA 4YPSA 5EDQA 3OF0A 4RX8A 2PMNX 1M7NA 4TW9A 4DHZA 4JR7A 3Q3BA 4FTMA 2GFCA 4RX5A 2YM8A 4D2TA 2JBPA 4FEQA 4J53A 2X6DA 5JGBA 4UWYA 2VTPA 3PVGA 4LL5A 3GCQA 4OW8A 5J5SA 4ZOGA 5J7BA 2NNWB 4FEVA 3M1SA 2JIUA 2JDRA 2C0TA 3KXNA 3DNDA 3LFDA 5FM3A 4CVAA 4FGRA 3L9NA 4TTHB 1S9IA 2B53A 2W1IA 3K3IA 4I0TA 2C1AA 2Y4IC 3F9NA 3GBZA 4NM0A 4EH3A 1E1VA 4G31A 1ZYLA 4RSSA 3RAKA 4DFBA 3QRTA 2FVDA 4I21A 4L6QA 4YJNA 4BIDA 1MP8A 3FZPA 4F99A 5HTBA 2CKQA 3NCGA 4HGEA 4FYOA 3O8UA 5IUIA 4NSTA 3TWJA 1UWJA 4JDHA 4IVDA 4MNFA 5AWMA 2YDJA 2YIQA 3KXXA 1VEBA 4EH2A 3D83A 4FT0A 5TT7A 1LR4A 5L4QA 3RTPA 2UW9A 2H34A 4O2PA 2VUWA 4G5JA 4JRVA 2IZTA 4AX8A 4CMUA 5JMSA 5IQIA 4AW0A 2UW5A 3EN6A 1YI6A 4RC4A 4H3PA 4XUFA 3TJCA 4GW8A 4CKRA 4GYIA 4R5YA 4O91A 1H00A 2PVMA 4IWPA 4QYGA 3F5PA 2J0MB 3IDBA 4CZTA 3K2LA 4BGQA 4J96A 4BCKA 3W2QA 3R2YA 4RWJA 1KSWA 5AM7A 1PYEA 3TKUA 4F9YA 1A48A 1OIYA 2G1TA 4X2KA 3QQHA 4M84A 4FIEA 4I23A 5HIBA 4O81A 2C6IA 1U46A 2QQ7A 2UZTA 2QR8A 2XNGA 3A99A 3E8CA 3GU7A 5E1SA 3PLAE 4ZY6A 3VS0A 4L68A 1HCLA 4BCHA 4YMJA 4OUCA 4OTRA 3HV7A 2PE0A 4EH8A 2JDTA 5AR4A 2JAMA 2IG7A 4LGGA 3EQIA 2WGJA 2ITTA 4CV8A 4EHEA 1NVQA 3KQ7A 3O23A 4FI1A 4XOZA 2B54A 3FMLA 4HJOA 1SYKA 2OO8X 4K6ZA 5AV3A 2JFMA 4BDFA 4C34A 4Z7GA 4OBPA 4O7YA 3CY2A 5EKNA 3I7CA 2WTJA 1H1WA 3GQLA 3KEXA 3O8TA 4ACMA 3FMJA 4EI4A 2YABA 4D2SA 1WBWA 2O65A 5HIEA 5BUIA 2R2PA 3Q5IA 4JX3A 3EQRA 4XG9A 1EH4A 1OKVA 2QLUA 2YERA 1IA9A 5DR6A 1W98A 3R7OA 5IA2A 3U6HA 4O7LA 2C5YA 2WTCA 3I1AA 4IX5A 2W5BA 4JVGA 4Y8DA 4AG8A 4A4OA 5IEYA 2VU3A 1NA7A 2RFEA 4UALA 3LIJA 4X2NA 1L8TA 4K0YA 2XK7A 2YLFA 2YWPA 4O4DA 5HG5A 4DT8A 5CZHA 5M4UA 4NM5A 4UB7A 4L44A 3E92A 3P9JA 3Q52A 4JIKA 1UNHA 3EH9A 4D1SA 4NKSA 5GJGA 2R7IA 1URWA 2QHNA 3PWDA 1UU9A 4YC6A 5AFVA 4BJJB 4F0IA 4A9RA 5AIKA 3TEIA 1REJA 3W18A 4I5HA 4M69B 4V0GB 1FVTA 2BILB 2QODA 5JGDA 4DCAA 3HRCA 4MXCA 2ACXA 3E7OA 4O96A 4EOJA 3PPZA 3EZRA 3FL5A 2Q0NA 2OJFE 3FPMA 4TY1A 5TO8A 2PY3A 3FI8A 3QGYA 4FKWA 2OJGA 5GIPE 2NRYA 2JLDA 2W05A 4LGDA 5FBOA 4C58A 2ZB1A 4H3QA 3R1SA 2HIWA 4YJUA 4HNIA 3PJCA 2RFDA 3VBTA 4RJ7A 3RPRA 4AGUA 4BDIA 4DDIA 4PRJA 4I5MA 3W2CA 4AT3A 4ASXA 1H28A 4UN0C 5GIOE 4WNMA 3O96A 1RW8A 1SM2A 3QYWA 4ZTHA 4MF1A 4A9YA 2WB8A 4Y83A 3NVMB 3ORMA 3MY1A 3PXKA 4IM0A 3UP7A 3KMMA 3QQGA 4N70A 2HY81 2J0IA 5HBHA 3CKWA 5L2WA 1PXLA 3LPBA 2QOBA 4CD0A 3FZRA 4FBXA 5K0XA 3CC6A 2EXCX 3C7QA 4R78A 5TE0A 3COIA 3ZZEA 5L8JA 5BYZA 2QKWB 3DTCA 5CU6A 4D4RA 2W1FA 2BAJA 3ET7A 3MTFA 3DDPA 2ZYBA 5G1XA 4EK8A 1QPDA 4EWQA 3R8PA 2O2UA 5JZNA 1A9UA 2VO7A 2GNIA 4QMMA 3MA6A 1RJBA 2XK9A 5LCKA 3O0GA 4ZTLA 2QOKA 3IOPA 5HOAA 2PMLX 3TUDA 4K1BA 4QEBA 3L9MA 3F7ZA 3CBLA 4IC7A 3Q9YA 5CALA 2B7AA 4DEAA 4AZTA 5HCZA 5HO6A 4IIRA 2IW6A 4AS0A 1GY3A 3R00A 3RMFA 1TFFA 1XJDA 2A2AA 4TWOA 3MB6A 3PXQA 3FXWA 5LVOA 4KA3A 1YWRA 3DXNA 4CG9A 2PZRA 2GS6A 4ZMFA 3A62A 2WKMA 3DPKA 5F94A 3KVWA 3HV6A 4FUXA 4FKTA 4DE4A 4PDSA 2VO0A 1WZYA 2G01A 2WHBA 5AMNA 4YUQA 3TKIA 5KKRC 3GU8A 2ERZE 4YO4A 3TYKA 2PVHA 3A8WA 5HCXA 1XBBA 3GB2A 2G9XA 5AR3A 4C35A 2LGCA 2XMYA 3HX4A 3MDYA 3DKOA 2WAJA 4D5HA 4DEHA 5DH3A 4LG4A 4O4FA 4QNAA 2HZNA 2GNFA 4KD1A 3A60A 4LGHA 2OWBA 3Q4TA 3R21A 5HCYA 3AMAA 3BEGA 3DNEA 3ACKA 3HUBA 3QCYA 3W0OA 4F1OA 4YZBA 4NJ3A 5CSXA 5FP6A 4LQMA 1H01A 5IDPA 4PL4A 3VUDA 4G16A 1K2PA 4E4XA 1YOLA 3HVCA 3NPCA 3UDBA 1OKZA 5HQ0A 4BN1A 3ROCA 5HTIA 2C3KA 3VBYA 1PY5A 2W1EA 2ZV2A 3RNYA 1ZYJA 2CGXA 3PDTA 3AMBA 4ONAA 3MH3A 4CRLA 3U87A 3W0MA 3LFFA 4LM5A 2GHMA 4OT6A 4FT9A 3MBLA 2E9VA 4E4LA 2OFUA 5ANIA 5KHWA 4I92A 3HMIA 2PVNA 3QWKA 3QAME 3VS6A 3GU5A 1Q24A 2C0IA 4QMTA 5IQAA 5E8WA 3ERKA 4YC3A 4IZYA 1Q4LA 2X8IA 4AW2A 1OIUA 4FTJA 2YAAA 2OJIA 2XK8A 2CKEA 4G5PA 3W10A 5DG5A 4AP7A 3W0QA 2ITZA 3S3IA 1Z5MA 4AUAA 4LV7A 2BVAA 4E6AA 5F4NA 4O0RA 4I0RA 2I0VA 1OITA 2W0JA 3QCSA 4E73A 4FV1A 4DA5A 4BCGA 4FNYA 1MQBA 3S4QA 2PVKA 1QCFA 3BHTA 3LM0A 3KN6A 3CJFA 3QKKA 4JRNA 5K9IA 3E8NA 4Y5QA 1AQ1A 2QVSE 4CTBA 2EUFB 3QQFA 2WU6A 4X21A 3CQEA 3EKKA 1PXMA 3PXRA 4U80A 2HY0A 5FXQA 1ZAOA 5CEMA 4DHJA 4F7JA 1FVRA 5CI6A 4ANBA 4X6RA 4BZNA 3U6JA 2IO6A 4BL1A 4G2FA 3KRJA 4BKYA 3DAJA 2BPMA 2OF4A 2QG5A 5HLNA 3F3TA 3AC4A 4KINA 3KRRA 4IHPA 4O0SA 5AP6A 3RK9A 3QTSA 3OEFX 3UIUA 4ANOA 4EKKA 4BI0A 2F7ZE 3OWKA 2C0OA 4GFGA 4IQ6A 4EOIA 4M3QA 4BKZA 5AV2A 1ZMWA 1B6CB 3W8LA 4FGBA 2AQXA 3RNIA 3BV2A 3BHVA 1Q8TA 3O8PA 4O0VA 3WZKA 2ZV8A 2Y4PA 5CQUA 4EUTA 4MXOA 4QQTA 2GSFA 2HCKA 4GU6A 5AUXA 3NW7A 3UIMA 4L3LA 5J9YA 2Y6OA 2BROA 4NIFA 3RZBA 1QPEA 3PG3A 5EW3A 4FZ6A 5DR2A 4DBNA 3MJ2A 1U54A 2X0PA 4BCJA 4EOMA 4F64A 5KO1A 3GC7A 3WIKA 3LQ5A 3HMMA 2YIXA 4FV6A 4DTKA 4QMPA 5DVRA 1ZLTA 4CFMA 2XNBA 4NFMA 4RG0A 3N4UA 2KULA 4IAZA 4QD6A 3FY2A 4O0YA 3PSDA 2UZVA 4U41A 3VWAA 2WOUA 4Q2AA 3W0SA 1H1RA 4FL3A 4Q9ZA 2CNQA 1TQMA 1Q3WA 1ZZ2A 3POOA 4LOOA 4IFCA 5L6PA 3PY1A 2PVJA 5AA8A 1T45A 1OKYA 5JRSA 4P7EA 4USEA 5LWNA 5CEOA 2QI8A 4IWQA 3R30A 4RA5A 1UKHA 5DT3A 2QD9A 4QMYA 4E6DA 4O4CA 3ZO2A 4GFMA 5LMAA 2QOIA 3O7LD 4KSPA 2ZM3A 5FP5A 4R7HA 4YHJA 4IBMA 4E6QA 3W0RA 2X6EA 1RE8A 5A4EA 2Z7QA 3LCSA 4DFZE 4TN6A 2RG5A 4KIKA 3ATTA 1I09A 1WBSA 3H9OA 4DC2A 3EQPA 2WQEA 3AKKA 4B0GA 2ZM1A 4QRCA 5HNBA 3RJCA 4MKCA 4FTUA 4X0MA 4NL0A 3UDSA 4OAUC 1WBNA 5AP3A 2ZB0A 4CLJA 2W7XA 3DFCB 4LOQA 4YZCA 3UJGA 1XMMA 4BY9E 2BZIB 2GS7A 4EK4A 4K33A 4V04A 5L8LA 4EZ7A 3ML1A 3PUPA 2W1DA 5HNGA 5B2KA 3PPJA 3C4EA 4B9DA 4ANMA 3GGFA 2R7BA 3W32A 5LVPA 5CF6A 4GMYA 2W9ZB 4D2VA 2UZDA 3OW3A 1UA2A 2XCKA 4OTPA 3N4VA 4GKIA 1APME 5TOZA 3FSFA 4C37A 4FIIA 3OXZA 4ZLYA 3FI2A 4C8BA 5JFVA 4DLIA 3FMMA 4BVUA 5KMMA 4MCVA 3E3BX 1HCKA 2W1HA 5I9ZA 4DFNA 4RVMA 3S0OA 1CDKA 2C6MA 3O7LB 4Y73A 4CKIA 4MHAA 3V5JA 5ICPA 2HWPA 4JT3A 4YP8A 1J7IA 3V51A 4E20A 5CZIA 2ZDTA 4CMTA 5LXMA 2CKPA 1MQ4A 2FH9A 2WTVA 3HP2A 3GXLA 3CPBA 2YJSA 4XNEA 3N9XA 4Y46A 1OBGA 4R8QA 3KY2A 1GIHA 4WG5A 5KMIA 2QOHA 2WU7A 4YTCA 3QQUA 4ZSGA 5BYLA 5L2IA 3WZDA 2RFSA 4XS2A 2JEDA 3NGAA 4I3ZA 4CZYB 5M56A 4FEUA 3ZFXA 2X4FA 3T3UA 4G3EA 1ZY5A 4UMQA 3S95A 1ERKA 3FLZA 4KIPA 2YACA 4HZSA 1OMWA 4JMQA 2X9FA 5C01A 3SW4A 3PSCA 4J97A 2BHHA 2P33A 3ODYX 1OL2A 5EYMA 2R3PA 4YLKA 2EXMA 5HLPA 3VS7A 5J7HA 2B9HA 3VUKA 4BHZA 4BDEA 3CSVA 1Q8UA 2CCIA 4FR4A 1JSTA 2WOTA 4TYHA 4N57A 2O0UA 4O0WA 4Y5HA 4DHIB 3BU6A 4IB0A 2GMXA 3V5LA 1WVYA 5T3QA 4EOPA 5A4LA 3LQ8A 2X2MA 3KF7A 1QPCA 3KRLA 3RHKA 4G6NA 4QQ5A 4YZDA 3KC3A 4WRSA 2XYNA 4WNKA 4PTGA 5HVYA 1RDQE 4DFLA 3P5KA 4R5SA 5C4LA 2JKQA 4N6YA 2XKFA 4FVQA 3LXKA 4CQEA 4OAVB 3REPA 3SX9A 3NNVA 4HCUA 4KSQA 3FE3A 4EK5A 3NMUF 3ZHPC 4EUUA 2YAKA 4MVFA 2ZOQA 3FC2A 5AR2A 4D28A 3EQBA 4DGLC 3AMYA 2ZFYA 3UDTA 3JYAA 4XMOA 1NVSA 4X3FC 2BZJA 4KIQA 4X2FA 5BVKA 2J4ZA 2RIOA 4BB4A 4GT5A 2VTNA 5FTGA 3QTXA 3MY5A 3R22A 2XNPA 3F5XA 1WMKA 2X0QA 4MNEB 4AW1A 4C02A 5JH6A 3KXZA 4XH6A 3ZSIA 4QTBA 4YTFA 2XKCA 4FZFB 4AOTA 2YITA 3R8ZA 4ORKA 5C8KA 3ORXA 3LAUA 4YU2A 3QF9A 4PWNA 5AUWA 1KE8A 2XK3A 4MD9E 1NY3A 5EG3A 2CLQA 3T3VA 4RGJA 4AGDA 1BLXA 3MSSA 4A4LA 5A4QA 4RC3A 3DTWA 4I41A 3WZEA 4EOOA 2XK4A 2ETKA 4D2PA 2YM3A 5L6OA 2C6KA 3BGZA 4UBAA 4YO6A 4AGWA 1SNXA 5JGAA 2ITYA 1GIIA 4TL0A 2X2KA 2PE2A 2Z60A 5IMEA 2OXDA 3OVVA 2O64A 4MAOA 4O7RA 4L7SA 3KK8A 3BELA 3SDJA 4ZLZA 3C0GA 3SRVB 1ZOHA 5CAQA 3RK7A 2PZIA 3BBTB 3GOPA 3UG2A 2H6DA 2Z2WA 4W9WA 4L3PA 2WD1A 1JKSA 4A4XA 4TRLA 3HP5A 3U9CA 2C3JA 3GP0A 4NM7A 5JSMA 3QTUA 3COMA 1YKRA 4NM3A 3BPRA 4DH3A 4KBKA 3CS9A 4ZAUA 4IAAA 3N51A 3V8SA 2JDVA 3OY1A 2C68A 3Q9XA 5KBRA 4S31A 5CNOA 5IZFA 1ZXEA 4L43A 3QTZA 5AUZA 5J87A 4DH5A 3PJ1A 2R3MA 1CKPA 1U5QA 2PVRA 2W17A 4M12A 4RZWA 3HMNA 5LMKC 2A4LA 4PMSA 3PIXA 5BMSA 4C38A 4IJ9A 4WKQA 2QO7A 2VO6A 3RHXA 2W5HA 5D7VA 5I9VA 5M4CA 4QDVA 4PF4A 4WG4A 3SQQA 4J52A 3H9FA 3ZEWA 3Q32A 2BZKB 3R73A 3H10A 4FVRA 3UIBA 3C0HA 4IC8A 2R3FA 3LOKA 4DGOA 5FGKA 1YDTE 3ZRLA 2AEGA 5E8VA 3WIGA 4NJDA 5CU0A 3FI3A 5CT0A 4CFNA 2XIKA 3HRFA 4GEOA 4F70A 2JIVA 3TUCA 3OOMA 3ZM9A 3R1YA 4E4MA 4O7SA 2OZAB 4QPMA 4ASEA 5F95A 3NIZA 4LFIA 4XEYA 3FYJX 3CTQA 5EM8A 3BQRA 4YTIA 1JSUA 2FSOX 2XAMA 1GZ8A 3KXMA 4U43A 4BYIA 5CAUA 1W7HA 2R3KA 3OCBA 4HPUE 3WYXA 1WBOA 4BDCA 5IU2A 5KUPA 4QOXA 5A4TA 3UGCA 5BUJA 2W96B 3ORZA 3FI4A 4MF0A 2X1NA 5A46A 2VV9A 4FKQA 4XRJA 5AAEA 3ZONA 3PIYA 2VWXA 4LYNA 1IAHA 4G3DA 3T8OA 5F1ZA 5HO7A 3CJGA 3EN4A 2RF9A 4HCVA 2BAKA 5EM6A 2B1PA 4BR3A 3THBA 1VYZA 3HV5A 1W8CA 1YOMA 5M57A 2EB2A 3SOAA 5GZ9A 4YJOA 3QRUA 5IA5A 5EK7A 4CGAA 2F57A 4BCMA 3KULB 3DK3A 5ETAA 4EQCA 1TZDA 5EQEA 3LQ3A 4E1ZA 3EN5A 4MBLA 4BDAA 5HLWA 2P2IA 4IAKA 5A9UA 4GS6A 1KV1A 1OVEA 1YWVA 2GS2A 3LFBA 1P4FA 4P90A 4KS7A 5LVNA 3A7FA 5FDXA 2UZNA 4L45A 4ACGA 2JFLA 4U9AA 4D2WA 3Q4UA 4UZHA 5CY3A 1XMLA 3W33A 3R71A 2OI4X 4CFFA 3VS2A 4FTNA 1UNLA 3MFRA 4C33A 3HMOA 5CX9A 4EK3A 4EC9A 3C5UA 3EQFA 5DRBA 4OTWA 5E1EA 3UOKA 4BDDA 4IADA 3DCVA 5CU2A 3KRWA 3WYYA 3AT2A 4PL3A 3MIAA 2BMCA 3PUFC 4GIHA 2X0GA 4XBRA 1R1WA 5CTPA 2CKOA 5IEXA 1PMVA 2Y6MA 4MXZA 5JKGA 4YHFA 4A06A 3QTQA 3QXPA 4IWOA 2Q83A 4LRJA 3JS2A 3D7ZA 3I79A 3NUYA 4RFZA 4ALWA 4BCIA 2WMUA 3I60A 4C4IA 5CQWA 5EQPA 3UBDA 3FY0A 2WTKC 3CD8A 2E9PA 3Q4CA 4APPA 4UXLA 2XP2A 3GU4A 3BLQA 1ND4A 4G9RA 4QMLA 4DBXA 2QURA 1AD5A 2YCSA 3A7IA 4I6LA 2ITPA 3R8LA 3VC4A 1LEWA 3QTRA 5LQFA 2ZMCA 2YEXA 3D7TA 4RVKA 5CAOA 1FINA 3Q2MA 4I24A 2XM9A 4NFNA 3D5XA 3RAWA 3FQSA 4AOIA 4XLIA 4J8MA 5M07A 3OMVA 3P23A 4XG2A 4F7LA 3UYSA 1J1BA 2FO0A 4APCA 2V7OA 3MYGA 4U42A 1LPUA 4QP6A 3DLSA 2C6OA 3HKOA 4FTIA 2ZMDA 2JDSA 3PSBA 2HZ0A 3PWYA 5T6KA 5HNIX 5I0BA 3WZJA 3QD4A 2VAGA 3NYOA 2CPKE 4YJTA 2DS1A 2WFYA 2XNNA 4ZSLA 5AA9A 3HAVA 4M0YA 2YWVA 3GC8A 2CJMA 1BUHA 4XOYA 2JGZA 1KE7A 4C2VA 2WMWA 4W8DA 2R3RA 2E2BA 5IA1A 3F3UA 2JKKA 4FEXA 3QRKA 4A9SA 4YURA 5A14A 4YNOA 3LFAA 4MD8E 4DEEA 5AV1A 1PXNA 3QFVA 5EHYA 4IZ5A 3QLGA 4USFA 3U55A 4WNOA 3VONA 4AU8A 4IW0A 5JK3A 3PXFA 2QNJA 4RPVA 2XEYA 1YHWA 4FV4A 2GNGA 4XX9A 1IEPA 2XS0A 3TM0A 2JC6A 2A0CX 1M2PA 2IPXA 3QRIA 5HX8A 4ERKA 4BDHA 3OTVA 5M4IA 4QP8A 2DQ7X 5CEPA 2VO3A 3FMNA 4KNBA 5FWKK 3C4CA 2VWZA 4Q9SA 2BCJA 4FKVA 4ALVA 1QMZA 1M17A 3OCSA 3UODA 4AZWA 2V7AA 4J1RA 1Y6AA 2BKZA 2Z02A 5JT2A 4PMMA 4F9AA 4RVLA 5LJJA 3ORTA 2OU7A 3OZ6A 4GH2A 4E3CA 4OTHA 3HA8A 3D5UA 5BQ0A 1V1KA 4YJRA 3I81A 3JPVA 4R1YA 5HEZA 2PPQA 4JBQA 4QQJA 2XK6A 3GQIA 1X8BA 2R9SA 2WIHA 3LKMA 3NNWA 4GUBA 5HKMA 4O84A 2ITNA 4HVHA 5M51A 1OI9A 3Q4ZA 1NW1A 4JJRA 4L00A 5ACBC 1WAKA 1OL1A 3EL7A 3NUSA 4RX9A 3SLSA 3SV0A 3DXQA 2YLEA 4AQKA 4C3RA 5CEIA 3OUKA 1SVGA 4GT3A 3CGOA 3PE1A 4G6OA 4RLLA 2VX1A 3FUPA 5IF1A 3UPZA 1W2FA 4WUNA 4ZP5A 5HU9A 5BPYA 5FDPA 4MX9A 3LCOA 2VTMA 4ZSAA 3ALNA 4K2RA 3SXFA 2WTDA 2XKDA 4EHGA 4AT5A 4O6EA 1XWSA 3QTWA 3SD0A 2HELA 4N0SA 3TJDA 4C7TA 5KMOA 2J5FA 3MV5A 3PZHA 5FRIA 3UMXA 3BYUA 4LV8A 4GJ2A 3I5ZA 3VUIA 5M4FA 3DGKA 1H07A 4I6FA 2CSNA 3EHAA 3PLSA 5H3QA 4WRGA 3BIZA 3A4PA 4QP2A 1UU8A 3DFAA 5G6VA 2IVVA 5IQHA 3UG1A 1FMKA 5CLPA 1YXSA 5HTCA 3MVMA 4IAFA 2J2IB 4ZTRA 2XANA 2X7OA 2A19B 3NS9A 3QLFA 4EHVA 3FZSA 2CGUA 1W0XC 4DEDA 3IG7A 4AXFA 4M0ZA 4AAAA 5L2TA 4AA4A 4CMOA 3P4KA 2RGPA 4IB5A 2VGOA 1GZKA 3VBXA 3F2NA 2C3IB 3D2IA 3W2RA 3P1AA 3UDZA 4FKIA 1YXVA 3P0MA 5TR6A 2FSTX 4RWLA 3QUDA 5C03A 5JFSA 5HGIA 1GZNA 1MRVA 4X3FA 4XV2A 3U4WA 2IF8A 2WMAA 3ENMA 3BI6A 3PA5A 3ZLXA 1G8KA 1G5SA 3RPSA 2WQMA 3AKJA 2IVTA 3QGWA 3RAIA 3F2RA 4RFMA 1JSVA 3DZOA 3G5DA 4OT5A 4LV5A 4AN3A 2BTRA 2PTKA 4IWDA 3UOJA 3UE4A 5KCVA 5FBNC 2C6LA 3CIKA 3CTJA 2XNOA 3IGGA 1UV5A 3IK3A 2DYLA 4OBQA 5EOBA 3IQ7A 5B2MA 5KMNA 4FYNA 4JLCA 4HZRA 3WF7A 2BIYA 4Z9LA 4XG3A 4MBJA 3F82A 1XH9A 5E8UA 1CKIA 2OK1A 3ZU7A 3DQXA 2XIYA 4XG4A 4G17A 2GHLA 5KMJA 3W0NA 3COKA 4U3ZA 4PY1A 3F5GA 5HZNA 4G3GA 1NVRA 5HVKA 2W9FB 4F65A 4FIJA 3G15A 5CS6A 3TIYA 3WF8A 3ZM4A 5IA3A 1FBNA 3O71A 1PXKA 3O51A 3SG8A 3TI1A 1FQ1B 5ANOA 3QQJA 4CFWA 2BIKB 2GU8A 3D94A 2CNVA 4DTAA 4GG7A 4PPAA 2GQSA 4G3FA 3L8XA 4BI2A 2VRXA 3R0TA 4O86A 2UUEA 3OCGA 2E9OA 3OXIA 2FB8A 3OWJA 3ZH8A 3NYNA 4D4VA 2R0IA 3MY0A 1YVJA 5DEYA 4GYGA 4E8AA 1J7LA 3A7GA 2BDWA 2GNHA 2X81A 3SW7A 3SC1A 4IH8A 4NTTA 3RPYA 4B6LA 3QCXA 1XR1A 3MESA 2HK5A 4QMOA 5L6WL 2W06A 1XH6A 4K9YA 1P4OA 3QALE 4RA4A 5J1WA 2VWUA 3G90X 4LL0A 1K3AA 4I93A 2VTIA 2YDIA 3F3ZA 3R2BA 3HL7A 3DB6A 3GUBA 2Z7LA 2V0DA 2BDJA 1WFCA 2W5AA 4P2KA 3UZRA 3BBWA 5DI1A 4FL2A 3NWWA 4I4FA 1XH4A 3DZQA 3KRXA 4BCPA 4KABA 2BKKA 4EKLA 4JAJA 3MJ1A 4ZLOA 4K18A 2ERKA 4I6BA 2VTJA 4W4VA 3EB0A 3V6SA 4X3JA 4AF3A 3HYHA 3KU2A 4FTCA 5HE1A 4EORA 3RZFA 4PP9A 4M14A 4RIYA 1KE5A 5EOLA 4NW6A 3UVQA 3FMEA 3LVPA 2W1ZA 2FUMA 3F7WA 4HCTA 3EQHA 1JBPE 4F0GA 3MS9A 3IW8A 2YM5A 4RRVA 3DBCA 4L01A 4OBOA 2J0JA 3FPQA 4AZSA 2H96A 1DAYA 1SVEA 4LRMA 4NCTC 3R7EA 5ITAA 4FZ7A 5EYDA 4DYMA 2GFSA 2UZLA 3D4QA 2ZDUA 3C4ZA 5AUTA 3SA0A 3CP9A 4FL1A 1ZRZA 3KL8A 3DB8A 4EQUA 4X7QA 3MH1A 4IE9A 5EHOA 4B4LA 3TZ9A 2RL5A 4I94A 4O7VA 2UZBA 3HZTA