3BBWA

Crystal structure of the erbb4 kinase in its inactive conformation
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
284
structure length
268
Chain Sequence
AQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNEGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-4
publication title Mechanism of Activation and Inhibition of the HER4/ErbB4 Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 268
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bbwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bbwA01
2H96A 2UZTA 3UZTA 5HLWA 4CMTA 2F4JA 4CFWA 4BTMA 1APME 4RIWA 2JFLA 2QD9A 4YU2A 3TUDA 5HKMA 4IX6A 3TEIA 4APPA 2JDSA 2X6DA 4UALA 1Q97A 3QRIA 4FK6A 1JNKA 5FWKK 4P7EA 2OW3A 1IAJA 4ZTRA 3ORKA 1ZLTA 4ALVA 1Q4LA 4QYFA 3VUMA 5AADA 1FGKA 1ZRZA 3TXOA 2P4IA 3NNUA 1JKLA 4FVRA 4M97A 4A7CA 3E8NA 1BL6A 2O3PA 3V5PA 4D4SA 5BQ0A 3KF7A 3QRKA 3R9RA 5CQWA 2XIRA 5EI6A 4KA3A 4ZSEA 3B8RA 4WRGA 3FMEA 2P2IA 4PP7A 4PMTA 3KMWA 3Q9ZA 2CHLA 3OFMA 4S2ZA 4BL1A 1PY5A 4M0YA 3RMFA 2WOTA 3AT4A 3ULIA 3VF8A 2PTKA 2YWPA 4HZSA 4UWYA 5HO7A 4X3FB 3RAKA 1QPCA 4LOOA 5E8TA 3POOA 3KULA 3ULZA 2JDRA 2R3GA 4FTIA 3VBWA 3ET7A 2BFXA 4I6BA 2Y9QA 5E9EA 4R7IA 3VQHA 3UG2A 1YHSA 3EQGA 2W4KA 3O51A 4BY9E 4HGEA 5CS6A 3TI1A 5LVMA 4G3CA 4FTKA 1YWVA 1ZXEA 2P33A 1UA2A 2VAGA 4U80A 4W8DA 3E7VA 4A9YA 3R8PA 4JXFA 2ITXA 1FOTA 3NYVA 5G1XA 3EMGA 4R78A 3W33A 5HE1A 4G17A 4CQEA 3HDNA 4LL0A 3FXWA 3FPMA 1FPUA 4FTNA 3O17A 4I5HA 4LRJA 4RVKA 5DRBA 4ZJJA 4I24A 3KREA 2JKKA 1ZYJA 3QC4A 4GIIA 4FR4A 4XG7A 4F9WA 4O7RA 5C27A 3S0OA 1FINA 2R3OA 1JSTA 3TKUA 4F6UA 3R9DA 2IVSA 4BGHA 4V0GA 1GOLA 3L8PA 4BDBA 4FSRA 3FDNA 3LM0A 4FKRA 3TACA 4WSQA 4AXAA 2WMAA 2Y4PA 2C5OA 4O21A 4QYEA 3DB8A 3L8VA 4FOCA 2W17A 3E63A 4QPAA 3N4UA 4DINA 5I9YA 5BUIA 1SZMA 4Q5EA 4OAUC 3PXYA 3EFLA 3BQCA 1IA9A 5CT7A 5L2TA 4O0SA 2VUWA 3L9NA 4YO4A 5DG5A 2GU8A 3FZOA 4JDIA 5AP1A 4DH5A 3QALE 4AUAA 4FNXA 4TNBA 3R7UA 3QHRA 3UTOA 1OKYA 1HCKA 2QU6A 2JLDA 2PE1A 3RPVA 3GC0A 2PVNA 3AD6A 2XKDA 3HV5A 2H9VA 4H05A 2ONLA 5H8EA 4ACCA 4C02A 5CF6A 3JYAA 3EL8A 4RPVA 4JNWA 3LIJA 4DG2E 4RA4A 2Z02A 1GZKA 4GKHA 4MWIA 3BBWA 2OF2A 2C6OA 3NPCA 4GIHA 3QTRA 4PRJA 4C4HA 5AWMA 3DKFA 5LQFA 3NRMA 4KIQA 5L8LA 2VO0A 5AX9A 1XH8A 2UW7A 4QOXA 3TT0A 4AWIA 2CGVA 5CENA 1KE6A 2JKMA 5IA0A 3MA6A 3WYYA 2J0IA 3ORMA 3LM5A 3ROYA 4KIKA 4LYNA 3LAUA 4LRMA 4XBUA 2WQBA 4K8AA 3MVHA 1J7IA 5C8NA 4N4SA 5FM3A 2YAAA 2Q83A 4PQNA 4XRJA 3CY2A 2QURA 3BHTA 4HVGA 2J4ZA 2RFEA 4KKGA 4PPAA 3RM7A 4BIEA 2BFYA 3P7BA 5IZFA 2QQ7A 4XMOA 4ANMA 5CU0A 5CAUA 3QXOA 3ZTXA 4C36A 3KK8A 1NVQA 5CEQA 2XA4A 4HVHA 2WPAA 2F7XE 4IB0A 1Y6AA 3GFWA 4NH1A 5AV2A 5H2UA 3K54A 2B9JA 2OH0E 4L67A 2GNHA 2J50A 2QR8A 3GC9A 4PX6A 3PA5A 2WEVA 3W2SA 1OM1A 4NFNA 5FEEA 3DZQA 4O7VA 3PRFA 3I6WA 2OLCA 5EG3A 1OKZA 3TZ7A 5DNRA 1OB3A 2OXDA 4H58A 5LXMA 4EZ5A 4IH8A 2Z7LA 3EQBA 4X7QA 4IZ7A 5CZIA 4AGWA 2QO7A 2WD1A 4RX7A 3VJNA 2GTNA 3MB6A 4R8QA 3A4OX 3FKOA 2Z7QA 2I0HA 3T3VA 1OPLA 1W0XC 3QAME 1I44A 3AT3A 2HAKA 4EK8A 3IW8A 4BZOA 4LOPA 2XRWA 3COKA 2ACXA 1PYXA 2OF4A 2JITA 3LHJA 3R1YA 1WVXA 4X6RA 3SRVB 3EN6A 2NNWB 4F0FA 5LWNA 3PVUA 2EXMA 3E93A 4I4EA 4R1YA 2XIXA 2XKCA 5JGDA 3ODYX 5CNOA 3ROCA 2GHMA 3LLTA 4MNEB 4PV0A 5IH5A 3PY3A 4E5BA 4HJOA 3P4KA 4GYGA 3ZO2A 4B99A 3FZ1A 2PK9A 3RCDA 3ZZWA 4BKYA 3VRZA 3O7LB 3W32A 4BKJA 5IEXA 2RSVA 3NYOA 3V51A 3TV6A 4O7TA 1REKA 1UVRA 4G2FA 5F20A 4E26A 5CEKA 2E2BA 5D41A 3GU5A 1IR3A 5C03A 3K2LA 1TQPA 1OIUA 4IX3A 4L00A 3SXFA 5BMMA 2GTMA 4EUUA 4D1XA 5EYMA 4E5WA 4C2WA 5JRSA 3TZMA 3LXNA 4K1BA 4I94A 2GDOA 4RX9A 5JN2A 3GCVA 3H9RA 3A62A 3MSSA 1WVYA 2ITUA 4ITIA 3CPCA 5AR8A 3V6RA 4F09A 2X7GA 2OJJA 4ANLA 1GZOA 3UGCA 2OG8A 4FTAA 4YJTA 2GNGA 5ETCA 4D5KA 4U40A 3AQVA 3U51A 4EKLA 4BDDA 2VU3A 4FKPA 2C6MA 4IAYA 5E4HA 4R1VA 3R8UA 4O81A 2QOOA 2R3PA 4ZY5A 5AV4A 4ASXA 2XJ0A 3CP9A 3JY0A 3QWKA 4N6YA 4EJ7A 1UU7A 5TE0A 1Z57A 2C4GA 2OH4A 3DAJA 3ENHA 3ZXTA 1M17A 3UPZA 5I5ZA 3NNWA 3OW4A 2UZWE 3HX4A 1OIRA 3THBA 4DLJA 2I40A 3VJOA 4ONAA 3MJ2A 3UC4A 3TIYA 5FLFA 2VX0A 5ETIA 5K0KA 2VTPA 4XV3A 4BCKA 2X1NA 4S31A 2E9UA 4BIDA 2EUFB 4F65A 4TWCA 3TUCA 5DWRA 1YHVA 4PTCA 5AUZA 3GNIB 3PPZA 5K5XA 1DAYA 4UWBA 4G5JA 2HIWA 5IUIA 4K0YA 4EH2A 2PMIA 4YZCA 4FV4A 3HV3A 3GC7A 1UNGA 1RW8A 3IW7A 4M84A 3RBWA 4BCFA 2CNQA 5C8MA 3IOKA 3PWYA 5K4IA 4ZJIA 4WBBB 5DT0A 4FNYA 2J5FA 5M4CA 4PMSA 4AAAA 2C0TA 4I22A 4EOQA 3RK9A 4BDFA 5EDPA 4BCIA 4YUQA 5CX9A 2R3LA 3QTXA 2PHKA 1YXSA 2R64A 5ETFA 3U9CA 3BPRA 3QD4A 4FKGA 3U54A 4RIXA 3QCSA 4BDCA 3N4TA 2XYUA 4X2NA 4DITA 4Z7GA 5HQ0A 3FMMA 3ZMMA 1P4OA 1MP8A 4IFGA 3TJCA 4USEA 3PXFA 5L8JA 4EH6A 4FG7A 2I1MA 4EUTA 3WIKA 5J1VA 2ERZE 4YP8A 3MH0A 2YFXA 2JAVA 3HUBA 4YJRA 3GGFA 3GU7A 3OCGA 3EN9A 3R8LA 2FYSA 3DFAA 3EZVA 5E8ZA 4C3PA 4I3ZA 4FTCA 3KN5A 2XNGA 2PL0A 4BCQA 3TV4A 3E64A 3COMA 2GNFA 3LFBA 4DN5A 5C8KA 3KXNA 1ND4A 5CVGA 3UIBA 4YSMA 3FQHA 2Z2WA 5A4TA 3R2YA 4EK5A 2PVLA 2WMQA 2G2IA 4J1RA 1WBNA 2EB3A 2ETRA 4K33A 5HE2A 3FMKA 3K3IA 4FUXA 4O0VA 3UDBA 5I4NA 5CVHA 2B55A 3WF7A 1H0VA 4DEHA 4NW6A 3ZDUA 1E1XA 3QQGA 4FTOA 5F9EA 4IZAA 1O9UA 3CJFA 2PVFA 2WXVA 4QRCA 2IW8A 3RI1A 3JXWA 3E5AA 4WNMA 4IWDA 4EHZA 4OGRA 2QOIA 4QQ5A 4XG9A 1B39A 1NVSA 4TWNA 4ZTMA 5E91A 5IEVA 4AOTA 4D2PA 3R7IA 3UMXA 4WA9A 2J0KA 4ZOGA 4RWJA 4D28A 1LUFA 4ZSAA 4OT5A 4F1TA 4C35A 3L9PA 3ZUUA 2ERKA 3F88A 4BF2A 2PMOX 1UV5A 5IQIA 4NM5A 2JBOA 3RTPA 3MVMA 2ITWA 3F3UA 4CV8A 2QG7A 2PVMA 3Q4UA 3UPXA 4MXYA 1H25A 4CRSA 4PDSA 2R3MA 4GUEA 4TWPA 2FVDA 2ITOA 2IZUA 3MESA 5DFPA 1WBPA 4GCJA 1J1CA 4G1WA 3R9NA 2O2UA 2QI8A 4NCTC 3F2AA 5E8XA 3F69A 2X7OA 4IAIA 5JFVA 4AW5A 3PYYA 4QP3A 5E8UA 4BGGA 4IIRA 2HW6A 2JKOA 5AR4A 5B7VA 3BLQA 4FL2A 3AGLA 3I0QA 3ZDIA 4MVFA 1KE5A 5LOHA 2XK6A 2Y4IB 2XK9A 3BU6A 3Q4CA 3FHIA 3HRFA 2GFSA 3WILA 3LCDA 2PUPA 4TW9A 4E4LA 4F70A 1PXMA 4ZP5A 1OL2A 4AE6A 2ETKA 3TNPC 2CMWA 1RQQA 3ORPA 4BBFA 3MV5A 3PSDA 4B8MA 4RFZA 4AT5A 3KXZA 2IVTA 4EK3A 3ID6C 2BZJA 1XBAA 4CZYB 2HXLA 3C7QA 4EH9A 4V01A 4ERKA 2CSNA 3QA0A 4IJPA 3PSCA 3A7HA 3BYMA 2W1EA 3TZ8A 4HVIA 2C6TA 4UZHA 3IW6A 5AV0A 4IVDA 4NKAA 3Q4TA 5A9UA 4CNHA 2ITZA 4XEYA 4LMUA 2G2FA 5LMKA 3O7LD 4FIJA 4CKJA 3QQFA 1YXXA 5L2QA 4DFZE 1ZY5A 3ENMA 4D4RA 1Q61A 2VGOA 2OSCA 2BRNA 2Z8CA 5ANIA 2PYWA 3VW8A 3GU6A 5D7AA 4WUNA 2BHEA 5FEQA 1T45A 2YITA 4C7TA 4RWLA 5T68A 5I3RA 1LR4A 3QUDA 2YA9A 4R77A 2WTKB 3MWUA 3BX5A 5EDRA 3FLZA 3BBTB 3A7JA 3OW3A 4O7WA 2UW6A 4I21A 2Y6MA 5AP3A 3BEAA 4FIFA 3PE1A 2YLEA 1ZMWA 4CKRA 3RPRA 4HVSA 3WZDA 3QD3A 3R7OA 1Q8WA 4J52A 3DK7A 2ZM1A 1PMVA 3RINA 1XH6A 3MFTA 3UYSA 1K3AA 3Q96A 4W4XA 4DGNA 2QKRA 3TIZA 3RHXA 3EH9A 4EYMA 2WMUA 5KHWA 1XH9A 3HV6A 4E4NA 4CLJA 3DBEA 5I9XA 4ZTHA 3CCNA 2B9IA 3LJ0A 4U41A 4GL9A 4DGLC 1M2PA 4CFXA 5JKGA 3PDTA 1CM8A 3U87A 3I81A 1XKKA 4WG5A 2G1TA 2W99B 4JI9A 4UMQA 4IAZA 4DFYA 4OTWA 3QTIA 5DMZA 5JFSA 3ACJA 1WFCA 2I0EA 4GYIA 5EYKA 2F57A 4K6ZA 1ZY4A 4EI4A 3KB7A 4FKLA 4P5QA 1Z9XA 1OGUA 4BCJA 2FUMA 3OCBA 4MXAA 2B9FA 4OBPA 2UVZA 4FA2A 3Q52A 4U5JA 5ETAA 5EW3A 5EQYA 2WKMA 2WMWA 1OL1A 2BR1A 5L3AA 3ETAA 3BKBA 4C4GA 1KOBA 2XNBA 5D1JA 5EYDA 5AUWA 2WAJA 3PG3A 1O6YA 4JG7A 2CKQA 5TT7A 4QTCA 4NJDA 2VTIA 5IA4A 3NIEA 2W5HA 3A8WA 4AS0A 2R3RA 4UX9A 4F4PA 3R04A 4M7IA 3F5GA 1DS5A 3DT1A 4OTFA 4C8BA 3GCUA 5A3XA 3EN7A 5FBOA 3VS5A 4G9CA 5CEOA 5CU2A 5JQ5A 3CPBA 2PWLA 3O71A 4MTAA 3LFCA 3DKGA 3WYXA 3UBDA 4C33A 4O0WA 4YMJA 3QKKA 4PUZA 3S95A 3E8EA 3AD5A 4NIFA 5ANDA 3UVRA 3HDMA 4E73A 4O0UA 1Q8YA 4R5YA 3PE2A 2WZJA 1X8BA 4MYGA 1UU8A 2DS1A 4YJQA 3GQLA 4NEUA 3BRBA 2XNMA 4FT0A 4Z9LA 3VS0A 3N4VA 4BI2A 2X8IA 5AP6A 1PXNA 2HY0A 2V7AA 4ACMA 4CZTA 1XQZA 2HZ4A 3Q9YA 3QZFA 4UEUA 2YWVA 3HECA 1OUKA 3BELA 3DCVA 2ZM3A 3DS6A 3FYJX 2RFNA 3DQXA 4F9BA 3DLSA 4RJ6A 4FI1A 2R9SA 2UW5A 4UXQA 5FP6A 1YW2A 4WO5A 4CSVA 4J95A 3AC3A 5IA1A 3P78A 4AE9A 2JIVA 1Y8GA 2XP2A 3DBDA 1Y6BA 4JR7A 4RVTA 4D4VA 5EQPA 3G6GA 3KXGA 4FSNA 3OG7A 3V04A 3IKAA 4GRBA 4IB1A 2WMRA 4GT3A 4UB7A 2UZEA 3PIYA 3ALNA 4MKCA 1OITA 4QQJA 4AF3A 5AUTA 2YM5A 4WNOA 1ZMUA 5TF9A 4E3CA 3FI4A 3QZIA 2ZV9A 5FXSA 2WTJA 2RF9A 2VWBA 3OTUA 4ASEA 3CQWA 1PRYA 2WQOA 4QMQA 5M4IA 2BKKA 4QMYA 3DNEA 3O0GA 3G0EA 4JG8A 4QMOA 5A14A 5K3YA 5J9LA 4H1MA 2C5YA 2ZDTA 3L8SA 1WBWA 4FTRA 4YTHA 3OD6X 4FSWA 3F3VA 5LMKC 3FLSA 4LRKA 4C4IA 1UKIA 3ZRKA 5KX8A 3I6UA 4RJ3A 4CMUA 5EH0A 3F3WA 2W96B 5M51A 1URWA 4AGUA 5AM7A 2JGZA 3LJ1A 5ACKA 3H3CA 2UZNA 3C4EA 3EJ1A 4JBOA 4G6NA 4YPDA 5L4QA 2R3KA 1UU9A 3QBNA 4YC6A 2WTCA 2G2HA 4FNZA 4YHFA 5AM6A 4ZLYA 2JDVA 3E3BX 4KKHA 3RPSA 4O27B 4CV9A 4OTRA 1PXJA 3VS3A 4EC8A 4PDPA 2E9VA 3LOKA 3QTQA 3K5VA 5HIDA 2OFVA 1MRVA 3GCPA 4DHFA 5JGAA 5CT0A 3OEZA 3PJ3A 3PP1A 4DH8A 3GFEA 4CFMA 4O96A 3D7TA 2VO6A 3RAHA 2FGIA 3VBVA 4XV1A 2OKRA 4WG3A 4C58A 4RLKA 3GU4A 4WKQA 4CFNA 4EH4A 3OP5A 4IWQA 5C9CA 4P5ZA 5KO1A 2YABA 3POZA 3Q2JA 4ACHA 3EQDA 3EKKA 3G15A 3ORIA 1V0BA 3IW5A 3LMHA 3GEQA 1UNLA 1YKRA 1UNHA 4Y5QA 3RNIA 3ZSHA 4CTBA 2R3NA 3PFQA 3BU3A 4FV9A 4U43A 3FLWA 4YZ9A 3LFAA 3T9IA 4ANSA 3G9LX 3VBTA 5CEMA 1H1PA 1OKVA 4IVCA 3PXRA 5ACBC 5D10A 5AX3A 3BI6A 5C1QB 3R1NA 3H30A 4IJ9A 4HPTE 2V7OA 5DR9A 4LGGA 4DT9A 3KCKA 2BKZA 5HVKA 2OU7A 2C5XA 3BGQA 3DJ6A 4FV8A 2GQRA 5AA9A 3QZHA 3AD4A 3QWJA 2OFUA 2C69A 5KMIA 2BHHA 2QONA 4QMZA 2BMCA 4XP2A 2UVYA 2ZV2A 2DUVA 2UVXA 5HEZA 2XCKA 4RJ8A 2OK1A 4C4FA 2YJSA 3B2WA 3FV8A 3PVBA 3IQ7A 3HZTA 4OAVB 4EOOA 2RFSA 3AC1A 4JBVA 2GFCA 4JIAA 2HCKA 1SVEA 3FC1X 1ZYSA 3QX4A 3R7EA 2CLQA 3DXPA 5J9YA 4CYJA 4K18A 2J90A 2XNEA 5A54A 3ZYAA 2OJ9A 4GV1A 4AA0A 3ZO4A 2BIYA 1M2RA 2ZJWA 4B4LA 3TZ9A 3D5VA 5L6PA 5M07A 3QXPA 5CYIA 5KMKA 4ZMFA 2VX1A 3EB0A 4I0RA 2E9PA 5IQDA 1BI8A 2IVVA 4TYIA 2QOQA 3BLRA 3DOGA 5HO8A 2BZIB 3FE3A 4UN0C 4YSJA 5BNJA 2C5VA 2YIQA 2A19B 4FX3A 4JRVA 4ANOA 4OTGA 3MPAA 3ZM9A 5JFWA 4APCA 3CKXA 2YCFA 3C0GA 2NPQA 1K9AA 3FMLA 3HMIA 5DPVA 5AUUA 3SV0A 4YC8A 4S30A 4XBRA 5HBEA 2FH9A 5FEDA 1A06A 4GW8A 3ITZA 4DLIA 3OOGA 2PUNA 3RJCA 2BDWA 3PPJA 3UQCA 4HCVA 3R02A 5IH6A 4M69B 3F3TA 1VEBA 4PPBA 3DA6A 3GOKA 5CZHA 4CCUA 4M13A 4BTFA 3R8ZA 2DQ7X 5EK7A 3CC6A 4HVDA 1XJDA 2C3LA 4BBEA 1UWHA 5J1WA 1H28A 3BHHA 1YOLA 4FGRA 4RA5A 4MD7E 4AN3A 5E7RA 1PXIA 1LEWA 1GJOA 4X3JA 3RPOA 5IQCA 4C57A 4DEEA 3HKOA 3DDPA 3OXTA 2GPHA 5CVFA 5A4CA 2Z60A 2B7AA 4J8MA 1QPDA 5AP7A 4BHNA 3NUNA 3H9FA 2XIKA 2BAQA 2RGPA 3TM0A 4OLIA 2GCDA 1PMEA 5DH3A 4ACDA 5DR6A 4YJPA 1PKGA 3ZLYA 1J1BA 4DC2A 3K3JA 1Q8ZA 4CFFA 3Q5ZA 4DFBA 4RWIA 2RFDA 5KHXA 2CCIA 4R7HA 2RIOA 4BDIA 2QHNA 3PJCA 4IMYA 4QNAA 2UUEA 4XUFA 2EB2A 3OTVA 2PMLX 3R01A 2HWPA 2YZAA 4G31A 2V5QA 4OTDA 4Y95A 3VULA 3MIYA 2OJFE 4U7ZA 2Y8OA 5HOAA 3KULB 4PMPA 4G3FA 5CY3A 1KUTA 1LPUA 3BE9A 3AT2A 5IQHA 2B4SB 3HA8A 2J0MB 3OCSA 3PXZA 3ZUVA 5KBRA 2WQMA 3P0MA 1R3CA 3FL4A 4M68A 4I93A 4ZS0A 5BYLA 3VHKA 4EHEA 3V8TA 3F5PA 4KSPA 5L6OA 2V62A 1O6KA 3LJ2A 5FQDC 3QFVA 5HVYA 4FT5A 1BL7A 5HE0A 3R7YA 1DI8A 1ZARA 3QKLA 3RK5A 4L8MA 4AOJA 5AA8A 2XIYA 2YCRA 3G51A 4OTQA 4IXPA 5CU6A 5DIAA 4CGAA 3BV2A 3E8CA 3Q4ZA 1ZZLA 3OT3A 4U3ZA 3CY3A 2UW4A 5FBNC 5CF5A 5DT3A 4DA5A 3CD3A 4GKIA 3BGPA 1ZYLA 2UW9A 4D2TA 4ZY6A 3S00A 2C6KA 3KKVA 3PG1A 4NU1A 4UWCA 4AW0A 1ZOHA 2JD5A 4BTKA 4F9YA 1BKXA 3HLLA 4D2RA 3QX2A 2OZAB 3DY7A 2J5EA 2WU7A 3SW4A 3O8TA 2NRYA 2ESMA 3DBFA 2C0IA 3MDYA 2LGCA 2ZOQA 2H6DA 4FC0A 2O63A 3NX8A 3PY1A 4R7BA 3FJQE 4Z7HA 1TVOA 5LCKA 5F95A 3R8MA 3I7CA 4FEVA 4JAIA 3FL5A 2PVRA 5GZ9A 4RZVA 1P4FA 3PIXA 4YO6A 2WMVA 4IB3A 3V8SA 4A06A 4DFLA 2B0QA 4DCEA 4HYSA 5J7HA 4NKSA 4E6CA 4ZZOA 3SC1A 4J96A 3H0ZA 3VUDA 4DAWA 4O7ZA 3PRIA 4O0XA 3LQ3A 5M06A 1L8TA 2VWYA 4O2PA 4XG8A 5JGBA 1G5SA 1PXLA 3FMHA 3UVQA 3VNTA 5E92A 1U4DA 3MB7A 4G5PA 3NZ0A 2VWWA 4MNEA 2C6EA 4PPCA 3UP2A 1H24A 1OBGA 2VTQA 1OIYA 1LEZA 3ZFYA 3KXHA 2X9EA 2ITVA 5HVJA 2YIXA 4I4FA 4YPSA 3KRWA 4EOIA 2WO6A 2C1AA 2XM9A 4IVBA 4WG4A 3GVUA 3QLFA 4U97A 1KWPA 5FD2A 5GNKA 4ALUA 4BRXA 1Q3DA 3LE6A 4C0TA 4D1ZA 1YXTA 5BUEA 4XV2A 2YIYA 3HEGA 3I0OA 3LCKA 4AT3A 3KMUA 3BWFA 3KL8A 3CR0A 4NTTA 5I3OA 4KNBA 5BYYA 3NCGA 1WCCA 2IPXA 1L3RE 4A9TA 3NVMB 3ZRMA 4XG2A 4CCBA 4KKEA 3E92A 3BV3A 5AAGA 4ENYA 4ZLZA 4E6AA 2WB8A 3PSBA 1JBPE 4FEQA 3HP5A 5D9HA 2X2LA 3OBJA 4MXCA 4B7TA 1HCLA 2WU6A 3O2MA 3ODZX 3R8VA 4KABA 4FSUA 1BI7A 3E62A 4AGCA 2XH5A 5A4QA 2PZ5A 1PW2A 1MQ4A 2FSLX 5EOLA 3W1FA 1VYZA 4XG6A 3F2RA 3QTUA 4IZYA 4ZEGA 2J9MA 1H4LA 3EKNA 3MY1A 2PULA 4JIKA 3KC3A 4Q5HA 1OMWA 4WNPA 2GHLA 3ZU7A 2EWAA 4WIHA 5IH4A 4JDHA 3C50A 5JT2A 3NIZA 5EHLA 4FSMA 3KVXA 2I7QA 4XV9A 4MCVA 1P2AA 2VTLA 4RT7A 3ZLWA 3DXQA 2CGWA 5IMXA 3RAIA 2X8EA 3M2WA 5IQGA 5M4FA 4DEBA 5IEYA 1V1KA 5FP5A 3WZKA 4FTLA 4IHPA 2BZKB 3I5ZA 1ZYDA 3MA3A 2QOLA 4TPTA 2PZIA 2W1IA 3UE4A 4LMNA 5GHVA 4IZ5A 4YJOA 3QD0A 4RC4A 2Q0NA 4X2KA 4FKQA 4N6ZA 4J97A 4IB5A 3W2OA 4JLCA 1XR1A 1E9HA 2HZNA 4FKUA 4FG8A 4MD9E 1SNUA 4ARKA 2JKQA 3O8UA 2VTOA 1H1QA 2ONLC 3ZSIA 3UP7A 4ZZMA 5IQBA 4IX4A 4QP8A 4W4YA 4BZNA 4W8EA 4FKWA 4O0TA 2CLXA 5HG7A 3GBZA 4E1ZA 3OXZA 4HGSA 3UMWA 1R0EA 3PWDA 1B6CB 4GEOA 4RMZA 5AP4A 4M15A 4MEDA 3NUUA 4AP7A 4CG8A 4HNFA 2F7ZE 4BYIA 4EZ3A 4IM2A 5T6KA 3WBLA 3FQEA 3VRYA 4LV8A 4FSZA 3F82A 3QL8A 1OPJA 4EBVA 4BBMA 4MNFA 5A4EA 1V0OA 3P86A 3PLSA 3VW6A 4WUAA 5IQAA 2FB8A 3A7IA 4RIYA 5EM6A 3KMMA 3BHYA 4NYEA 1I09A 3COHA 3NGAA 4QMTA 2Y0AA 2VNWA 4YNEA 4ACGA 2KULA 5CSWA 4YTFA 1GZNA 2O5KA 1W98A 4RG0A 4TY1A 3E3PA 5CLPA 3AXWA 5HIEA 3R1SA 4GU9A 3R9HA 4FL1A 4BCOA 4O38A 4TWOA 3H9OA 5JRQA 5IU2A 4P4CA 2W1FA 3CSVA 1YVJA 3ERKA 1U54B 1YOMA 2VWVA 3R63A 4FNWA 4QPMA 2QNJA 3IECA 3F6XA 2PVYA 2BTRA 4JRNA 4BWXA 4L3PA 4MBJA 3KU2A 4AZSA 3S4QA 2X0GA 2AUHA 4HZRA 4L6QA 2UW0A 2H8HA 4L42A 5HU9A 3ORXA 2QOBA 3FMNA 5BVDA 3IONA 4EHVA 3D15A 4F1MA 4TL0A 2OXYA 4RIXB 1AD5A 1U59A 4JJRA 3TJDA 5HD4A 5AJQA 2FA2A 3F7ZA 4ZTNA 1XH5A 3D9VA 3NCZA 2BTSA 4HGLA 3DKOA 3B2TA 3W2PA 2F2CB 4U45A 3JS2A 4H1JA 3TNIA 5HESA 4O84A 3CTJA 2X8DA 2HZIA 2W1CA 2YERA 3FC2A 3DNDA 1F0QA 4KRDA 4L7SA 2DWBA 5FG8A 4BDEA 3VBXA 3WE4A 1CMKE 4LI5A 4DFXE 5IG1A 4O1PA 2C3JA 4A4LA 4AZVA 1DAWA 4L9IA 5CEIA 3DXNA 4U44A 2PU8A 2W4OA 2XS0A 4S33A 2VN9A 3UOKA 3V5JA 2BCJA 2C0OA 4O0YA 1GIJA 4EOKA 4FE2A 2W7XA 4TYEA 2OIQA 1XO2B 5DBXA 3UODA 4BYJA 3II5A 4PNKA 3W18A 2J2IB 3IK3A 3OMVA 4RBLA 5JSMA 4UY9A 3CQUA 3W2RA 3LQ8A 5EI8A 5EKOA 3ZO3A 5KNJA 4QMUA 2OJGA 4TRLA 3FI3A 3ANRA 5ANKA 4C4JA 1CKIA 1JWHA 3SX9A 4DH3A 5I9UA 2J0LA 3NUAA 4GT4A 1H07A 4AZEA 2HYYA 4G34A 1UKHA 4M0ZA 2HXQA 4FV2A 2BROA 3FY2A 3A8XA 2SRCA 2BZHB 3OOMA 1PXKA 4FKJA 4LGDA 3LMGA 4IAAA 4R3PA 5CU4A 5BVKA 4PDYA 5EFQA 2IG7A 3BYUA 4A9SA 3OT8A 3DBCA 3OC1A 4IAKA 5FRIA 4H36A 5FDPA 3UOJA 3DLZA 2YM3A 4MK0A 2QR7A 3OCTA 4G6OA 2WTWA 1UWJA 3R22A 5CXHA 1PMUA 1QCFA 4P90A 5I9VA 5FGKA 3WZUA 2QLQA 3QRUA 4F1OA 3Q32A 2O64A 3P7CA 3BLHA 1A48A 4XLVA 4ITHA 4BWPA 2HOGA 4X6QC 2GSFA 3VHEA 4ENXA 3BCEA 5GIPE 1VYWA 4HYHA 4BFMA 4DGMA 2JAMA 5HZNA 1JKTA 3FSFA 3JVRA 3Q5IA 4GH2A 2BRBA 1Q8TA 3EYGA 3NW7A 3KK9A 4I41A 4X2GA 3VIDA 2PE2A 5I9ZA 4QD6A 4K11A 5M09A 1T46A 3JR1A 1FVRA 4DF3A 5EYCA 1Q99A 3M1SA 2XUUA 3QD2B 4ANNA 4DFUA 5E8WA 5IF1A 3C0IA 5DEYA 5CEPA 3WI6A 3CIKA 3HVCA 4F08A 5DR2A 3F7WA 3MS9A 3LCOA 2C6IA 1ZMVA 3R83A 4LGHA 4BICA 5GZ8A 4D1SA 3I5NA 3I60A 4XOYA 4G9RA 3NUYA 3C51A 4RLLA 5AP0A 2Y6OA 4U81A 3TNWA 3L1SA 2WQNA 4MF1A 2ZAZA 4HOKA 3D4QA 3W55A 4BCNA 1YI4A 3Q2MA 1U46A 4QP2A 3SOCA 2GQGA 2R4BA 5HCXA 2A2AA 5M53A 4IANA 5FM2A 5IQEA 5EW9A 1F5QA 2PZPA 4KRCA 3KFAA 3PA3A 3VAPA 3ORNA 4HGTA 4FSTA 3HAVA 2BUJA 3QRJA 3BQRA 5L2IA 3WZEA 5AIRA 1Z5MA 2B53A 1M7QA 1YWRA 3HUCA 4HNIA 3SGCA 4MF0A 4IM0A 4EHGA 3CD8A 3A4PA 3BHVA 3Q04A 4CG9A 2P55A 5AR5A 3VUHA 4AW1A 4TYHB 4YLKA 3A2CA 3D0EA 2BVAA 2J7TA 4HCTA 4NM7A 1SYKA 5CXZA 2XK3A 3NYXA 2XM8A 4RFMA 4CRLA 5AAEA 5EKNA 2Q0BA 2WMTA 3RWQA 3MIAA 2WOUA 4QTEA 3P23A 3MJ1A 1URCA 3SHEA 2CGUA 4FZFB 1OECA 3FMJA 4WSYA 4DT8A 5M56A 1IEPA 3QCQA 1WBSA 4CFVA 4EYJA 4RFYA 5IQFA 5DVRA 4FIGA 4EH3A 2YDKA 2R3HA 1H1WA 2G01A 4U42A 3U55A 2ITYA 4FICA 4JR3A 3TCPA 3UZRA 4BKZA 2VD5A 1UU3A 3IDCA 2WFYA 2XK4A 3ZSGA 4O7LA 2W9ZB 5TKDA 1WBVA 4RC2A 3HAMA 1EH4A 5AUXA 4EONA 3UZPA 4OBOA 2ITTA 3KRLA 4YGAA 4I1ZA 5IA2A 5KE0A 3HA6A 4FF8A 3FLNC 3QRTA 3R6XA 3ORTA 5EHOA 4A4OA 2YZLA 5HHWA 3DV3A 4YBJA 2UZDA 4QNYA 3H0YA 5D12A 2JIUA 3LFNA 4BZDA 3Q9XA 2VWXA 3UYTA 4BTJA 3IO7A 2I6LA 4QP4A 2IZSA 4ANBA 4RQVA 3LFEA 5GJFA 4F63A 1TKIA 4YZBA 4JG6A 4NM3A 4QP9A 4JX3A 3I4BA 3SKCA 4B9DA 3LKMA 4UMRA 5CF4A 1KOAA 2CKEA 4XX9A 2C3KA 4JQ8A 4KBKA 4O2ZA 5BX0A 3QLGA 1BYGA 4KBCA 1Q41A 4YHTA 4DGOA 2HWOA 1P5EA 2W0JA 3OF0A 4FTMA 2W5AA 4NIFB 4EOLA 4IVAA 4HCUA 2E9NA 5T3QA 4AFJA 4UMUA 4E5AX 2YISA 1DI9A 3Q53A 4C59A 4NK9A 4D0XA 2EU9A 1K2PA 3HNGA 1PF8A 3C9WA 4U9AA 3CGFA 3BGZA 3G9NA 3V5LA 4I20A 2QC6A 4FVPA 4A07A 1M2QA 4R5SA 4AOIA 4L45A 3LXKA 1FGIA 2CDZA 3ZXZA 3D5WA 3EN5A 4QMMA 5CALA 5KMNA 3FSKA 4FV0A 1H0WA 3Q60A 3VUGA 3KRRA 3V6SA 4B8LA 2Y7JA 2GS6A 3VUKA 3ZBFA 3AOXA 3RM6A 3VS1A 1QPJA 4EBWA 1AGWA 2C5NA 3OWPA 5HX8A 2FO0A 4II5A 2GS7A 4QMPA 4F99A 1Y8YA 5HG8A 3C13A 4AA4A 3DJ5A 3H10A 2HK5A 2IZRA 2X4FA 4I92A 5AAFA 5J5TA 5E1SA 5CQUA 1H01A 1OL5A 3LFFA 1IASA 1WAKA 2OJIA 1H1RA 3U6HA 5CF8A 2UV2A 2AYPA 1OKWA 3Q6UA 3ZLXA 2ETMA 3EYHA 4I6HA 5DI1A 1OBDA 4GFMA 4QMWA 5AEPA 1RDQE 4L3JA 4CZUA 4RC3A 2IN6A 1VJYA 2QVSE 2IZTA 4IADA 3QA8A 2VTSA 2YM8A 3GCSA 2BALA 5DE2A 4ZSJA 3LLAA 4DGGA 2BPMA 3OWLA 4U6RA 3M11A 5DOSA 3BZ3A 3LFDA 3QQJA 3RPYA 3QQLA 1SMHA 3TN8A 3OY1A 3MY5A 4UMTA 3QCXA 4KBAA 4MD8E 4IQ6A 3RGFA 2VX3A 3BYSA 1CKJA 5KUPA 4NJ3A 3MTLA 4OR5A 2R3FA 3ANQA 1KSWA 5GJDA 3HL7A 3QQHA 4OTHA 4J99A 4UXLA 5IUGA 2CN8A 2QCSA 2RKUA 5HTBA 5HORA 3PVWA 3RAWA 3D94A 1R39A 4O7SA 1RE8A 2IW9A 3QUEA 3SVVA 4QYGA 4FV1A 3U8WA 4MBLA 2XCHA 4DBNA 4KS8A 4G3DA 5AFVA 5GIOE 3E8DA 3D7TB 4FIHA 4PL3A 1ZAOA 3F66A 4O91A 3R21A 3L8XA 1J7UA 3IW4A 2CNUA 4PL4A 3WIGA 4O7YA 4KD1A 2J51A 3D7ZA 3WARA 4L01A 5EI2A 3FZTA 5HI2A 4FV5A 4EH5A 5C4LA 3TDWA 5ANOA 1PHKA 1W83A 4AZFA 4GFOA 5C4KA 3LXPA 4ANQA 5E1EA 2PE0A 5EW8A 3MW1A 4FKSA 2XNPA 4DTBA 1J3HA 5AP5A 3CLYA 3KCFA 4D4YA 1WBOA 2WNTA 4GVAA 4FG9A 3D83A 3CS9A 4MH7A 1GZ8A 2R5TA 3AC4A 3C4ZA 4XJ0A 4E6DA 3RWPA 2QU5A 3MY0A 4XG3A 4D58A 4X3FA 2IWIA 4FIEA 4BR3A 2ZMCA 3TKIA 4BI0A 3FXXA 2V55A 4PNIA 4RRVA 3NEWA 3IGGA 3FMDA 1V0PA 4M69A 4FSQA 3E88A 4MX9A 4FODA 3C4CA 5ANJA 4C2VA 4F9AA 4YJUA 1JKKA 4O82A 5LVPA 3QYZA 4S32A 5HNGA 4AZTA 5C26A 2XJ2A 4FTQA 3KQ7A 3W16A 4F64A 5J79A 1PMNA 2W1HA 4RIWB 4XYFA 1BUHA 3TWJA 3UIMA 4BN1A 4G3GA 3OVVA 4O0RA 1GNGA 4YHJA 4DCAA 3G33A 4GFGA 5AR7A 1FVVA 3ZC6A 4AT4A 5L2SA 4F7JA 1H08A 3CJGA 3C4XA 4FOBA 2OICA 4EJNA 4EWQA 2J0JA 1TQIA 2PVJA 1GIHA 2R2PA 3QZGA 4GG5A 4Y5HA 2J6MA 1WVWA 4YJVA 5J9ZA 3K5UA 1PJKA 4NUSA 3R71A 4KIOA 5AMNA 3V01A 4ZS4A 4JT3A 4A9RA 2IO6A 2VWIA 2ZVAA 3KXMA 3NMUF 4DBXA 5HO6A 4NW5A 3JY9A 3RK7A 4KWPA 4BDJA 5HICA 3UIXA 1Y91A 3S3IA 5FDXA 2R3IA 2WELA 3DPKA 4EH7A 3MN3A 2JIIA 3GU8A 1JAMA 3COIA 4C61A 2C47A 2E9OA 3U6IA 3ALOA 2OBJA 5H8GA 3FI8A 4LV5A 2YDJA 4HW7A 5HNBA 3A7GA 3L9LA 4KIPA 4KAOA 4V04A 4EKKA 3PZEA 4X2FA 1YDRE 4YNOA 2REIA 2QOFA 4MXOA 3EFJA 3WE8A 1G8SA 5KMJA 2V22A 3NNVA 2FSMX 2O8YA 3DFCB 4I5MA 5AR2A 4BB4A 2QKWB 5CTPA 1H00A 3KA0A 4K9YA 4ZSLA 4Y8DA 4Y73A 4M67A 3IDBA 1IA8A 1S9IA 4TKSA 4X0MA 3VWAA 4BCHA 3HYHA 2EXEA 4RJ5A 2W1GA 1H8FA 2XJ1A 2RG6A 1QL6A 2R3QA 4W4WA 3EZRA 3IS5A 3C1XA 1YI6A 3UIUA 3PZHA 4CLIA 4V0GB 4EQUA 3TV7A 4CQGA 3HMNA 4FKOA 4H3PA 4D2WA 2OZAA 4I5CA 5I9WA 3BYVA 3WF8A 5KKRC 5HTIA 5E8SA 3FPQA 1YI3A 5IKWA 3CE3A 4GJ3A 2F9GA 1KE7A 4PTEA 2OGVA 4TN6A 3GXLA 5FTOA 3UO6A 4AA5A 5JQ8A 4QPSA 1MRUA 3RALA 5FTQA 3JPVA 4PF4A 4S34A 5LARA 1J7LA 4FEXA 4QP6A 3O50A 4C4EA 5TOZA 2NP8A 3U6JA 4O22A 4LL5A 3R30A 2QO9A 5CASA 1XH4A 2KTYA 4L46A 5M55A 3GUBA 4ZJVA 5FTGA 2PVKA 2A0CX 2OIBA 3AC8A 3UC3A 3VS4A 4KS7A 3ZCLA 4ZMEA 1ZZ2A 3PPKA 3EIDA 5CI7A 3W2CA 4QMSA 4MQ2A 4QT1A 3D2KA 4TTHB 4BIBA 4ITJA 3DTCA 4AN2A 4RGJA 4E20A 3R00A 3Q6WA 4H3BA 4FYNA 5HE3A 1RJBA 4NT4A 4HYIA 3JVSA 4JDKA 3V3VA 5D11A 2ITNA 2YCSA 3G2FA 3SRVA 3PTGA 3TTIA 3CTQA 2O65A 3C5UA 4J7BA 1OZ1A 4L7FA 3RKBA 4I6QA 5BUJA 4KIKB 5B2LA 3PVGA 5J7BA 4XNEA 1M14A 4FEUA 3LW0A 4XOZA 4PDOA 1JSVA 3C0HA 2ZV7A 4XHKB 4U0IA 5CSXA 4B6LA 4AU8A 4YR8A 2PUUA 2XNNA 4NTSA 1JSUA 2F49A 4F0IA 2ITQA 4X3FC 5IA3A 3AC2A 3BIZA 4IW0A 2C3IB 3WF9A 3IOPA 4L3LA 4WBOA 2VTAA 4NWMA 1H26A 4WT6A 5CAOA 2GQSA 3BU5A 5HG9A 4ZTQA 3M42A 4HPUE 3NNXA 3DK6A 3QTSA 4OTPA 5L6WL 4BHZA 3F61A 2BRGA 4L44A 1WBTA 1YWNA 3LCSA 2ZV8A 1W84A 1JVPP 5H3QA 4XH6A 3SW7A 1G8AA 1IRKA 3CXWA 4FL3A 4GG7A 3BWJA 5LMAA 3V5WA 4Z3VA 1KE8A 3QQUA 2VWZA 1GAGA 5F94A 2RL5A 3GC8A 1H27A 2GNJA 5HIBA 4W4VA 3VS6A 5IDNA 4FEWA 3ZRLA 4BDGA 2X6EA 4A9UA 2HENA 1XWSA 3ZOSA 3D2IA 3RHKA 1ZWSA 4MXZA 4C3FA 3P5KA 4CVAA 3NS9A 3SDJA 4WD5A 3PLAE 2F2UA 3OWKA 4MQ1A 4IDVA 5LVNA 3KEXA 4JAJA 1OL6A 5GZAA 3OUNB 2VTTA 4FIIA 4YLLA 4H3QA 1Q5KA 4O6EA 4O7NA 2YM4A 4M14A 4XS2A 2AC3A 3SXRA 4F6WA 3U4WA 1R78A 3VUTA 2R0IA 1J91A 5JK3A 2PSQA 3FQSA 3D5XA 2OZOA 2W05A 3PUPA 4NCTA 4RJ7A 3P79A 2QOHA 3MFSA 4G6LA 2BAKA 3AMYA 3NWWA 2PVHA 2QHMA 4ZSGA 3C4WA 2BILB 5HCZA 5J87A 2XMYA 4XP0A 5LVLA 2GNLA 3CTHA 4WNKA 3MFUA 4PWNA 5CWZA 2UW8A 3ZFXA 4ZK5A 1SVGA 1F3MC 3VS2A 3CEKA 3D14A 1MRYA 4QYYA 4FBXA 5IISA 3NW5A 4E7WA 5HBJA 5EQEA 2ZB0A 4Q2AA 5BVWA 2JDOA 3MYGA 3NDMA 4I23A 4IX5A 4CXAA 3IGOA 5ITAA 3FUPA 5ANEA 4L43A 3NR9A 3A60A 3DU8A 3FZPA 3FYKX 4IC8A 3VO3A 2CKPA 1A9UA 4Z55A 4TZRA 4W9WA 2YLFA 1ZOEA 3DZOA 4JQ7A 1JPAA 5FXRA 4AFEA 2YJRA 3QC9A 3NAXA 4IACA 4DEAA 3ZO1A 3RNYA 3RZBA 5D7VA 1PYEA 4D2VA 4EL9A 4Z16A 4UV0A 4RX8A 5HD7A 4QMVA 5DEWA 5TR6A 3I79A 4CMOA 2X81A 4GUBA 4FT9A 3EQCA 4J71A 2H34A 2QLUA 4OT6A 3QUPA 1H1SA 1KE9A 1CSNA 4FKTA 3KRXA 2C68A 5BPYA 5KBQA 1WMKA 4BWKA 3BE2A 5CNNA 4GU6A 4XRLA 2ZMDA 5K0XA 4IDTA 3P1AA 3UOLA 3PJ8A 3PXQA 4F6SA 4CT1A 5BMSA 5LCJA 1O6LA 3HP2A 2YDIA 3DKCA 4PL5A 4RJ4A 2HELA 3OWJA 3QTWA 4L68A 2F7EE 5DRDA 4BDKA 4E4MA 2R0UA 3UNZA 3VVHA 5KZIA 4TT7A 3NW6A 2JFMA 3QGYA 4JQEA 2CGXA 1QMZA 2XK7A 1HOWA 1U54A 3FLQA 4YTIA 4DEGA 3AMAA 3GCQA 5M57A 5H9BA 1Y57A 5ICPA 2VTMA 3AGMA 3FHRA 4YJNA 5EHYA 3UOHA 4WOVA 3PA4A 5L2WA 4AN9A 5J5SA 3NUPA 5CANA 3ZUTA 4D55A 3CQEA 3TKHA 1PXOA 2WGJA 1YQJA 5AIKA 2XRUA 4F9CA 3UJGA 1M52A 4O83A 1YDSE 4ASZA 3P9JA 2VTJA 3FBVA 2V0DA 4HYUA 3T9TA 1KV2A 5EM5A 5HLNA 5M44A 1JQHA 3O96A 3FEGA 2VO7A 3EQHA 2PPQA 4WHZA 3ACKA 2Z7RA 1XHAA 3F5XA 3FZRA 4NSTA 4Y46A 3TL8A 4BCPA 2X7FA 4FZ7A 4NL0A 1NXKA 4RVLA 3LMIA 3WZJA 3QQKA 2XEYA 4FMQA 4UYNA 3NVKI 4YZMA 4FV3A 4D2SA 2X4ZA 4L52A 4RIYB 3VUIA 5BVFA 2R7IA 5DGZA 1P14A 3DBQA 2LAVA 2BAJA 2GMXA 4FT3A 5ANGA 4UYAA 4EOSA 4FK3A 5HGIA 2PZYA 4ALWA 3FKNA 4CT2A 3JUHA 3LCTA 4IBMA 4E8AA 4A4XA 3GP0A 4EK4A 4M12A 5CSHA 2XIZA 5HCYA 4DH1A 2ZB1A 1STCE 2OIDA 3TNHA 3UQFA 5CI6A 5K9IA 3ZS5A 2XYNA 2NO3A 4M8TA 5IPJA 2OWBA 3GB2A 4XLIA 3LXLA 5CSVA 5DYJA 1NY3A 2CCHA 3FLYA 3HV7A 4QP1A 2YCQA 5A6OA 2ZM4A 4C62A 5JZJA 5K5NA 4FYOA 4AX8A 5BVOA 4YC3A 2C6LA 2QO2A 5HG5A 3UG1A 5DA3A 1VR2A 4RIOA 3EFKA 3DJ7A 3IPHA 3G90X 2W5BA 4CKIA 1W8CA 2W4JA 3F5UA 4LOQA 5KMLA 5IDPA 3GOPA 4M3QA 2JBPA 2YEXA 4IWPA 5E90A 4WRSA 1FQ1B 4OW8A 3RP9A 3TG1A 1ZYCA 3G0FA 4QTAA 3V8WA 4LFIA 3NLBA 4FKVA 4CD0A 2HY81 4JX7A 3HV4A 2JEDA 3BYOA 3SA0A 2QG5A 3MPMA 4D9UA 2XVDA 1MQBA 1W82A 2C6DA 3DGKA 3WF5A 4ZZNA 5JH6A 2VRXA 4DG0E 3GT8A 4EK6A 5KMMA 3KXXA 3R1QA 4FTUA 4FZDB 4FSYA 3MBLA 4QQCA 4JS8A 3FWQA 3AMBA 2Z7SA 2RG5A 4EOMA 4Y83A 3P08A 3FZSA 4U79A 4N0SA 4YZDA 4Q9SA 2WMXA 2VZ6A 2WMSA 4OUCA 4ZXTA 2WIHA 4EQCA 3LPBA 1KV1A 5DHJA 4X2JA 2YHVA 1ZOGA 2HW7A 4AACA 2W06A 4R3CA 1GIIA 3V5TA 2YN8A 2BRMA 3W2QA 4ZY4A 2CNVA 1OIQA 3F9NA 3SXSA 4E6QA 1BX6A 2XKFA 4PY1A 3SAYA 3LQ5A 2XKEA 4EH8A 4Q9ZA 1NW1A 3DB6A 4GS6A 4JL9A 3VBYA 5HNIX 4C37A 4EEVA 2WEIA 2VV9A 5M08A 4FV7A 3ELJA 1YDTE 4UBAA 3R9OA 4FZAB 2DYLA 4BDHA 3QTZA 4FV6A 3T8OA 4DTKA 5JMSA 4BCGA 3OBGA 4EC9A 1CTPE 3W10A 4IFCA 4ZTSA 1B38A 4GVJA 1IAHA 4KUJA 3WF6A 4Y85A 3F2NA 3QHWA 4QP7A 4D9TA 4IEBA 2X2MA 4R6VA 3SQQA 2FSOX 1XBBA 3ORZA 3EOCA 3F3ZA 2YACA 1SVHA 2PMNX 3EHAA 3FAAA 3PP0A 5E8YA 2QOKA 5BYZA 4YZNA 4BCMA 4JOAA 3OROA 3U9NA 1TQMA 4ASDA 4I0SA 5BVNA 1YRPA 1E1VA 5CSPA 1ERKA 4J8NA 3HMPA 2W1ZA 3VF9A 2CN5A 2YIRA 3EQIA 4JBQA 1ATPE 3LFQA 3MH3A 2VO3A 3O23A 3PIZA 4EORA 3PJ1A 4IC7A 2XEZA 3NSZA 4V05A 4QQTA 3UO4A 2BDFA 4PP9A 2PZRA 3SOAA 4RSSA 2X39A 1JKSA 3MH2A 3NAYA 4GMYA 3MTFA 5C01A 3VBQA 2CJMA 3QKMA 3BHUA 3QU0A 2A27A 5B2KA 3KN6A 4DG3E 3HRBA 3ZC5A 2C30A 2QODA 2P0CA 4TYHA 4W9XA 3ZEPA 2W9FB 3HRCA 4GJ2A 2OXXA 2UZOA 3SD0A 3LVPA 3FKLA 4TXCA 1FMOE 2WTDA 2YIWA 3TDVA 4RZWA 4L53A 5H8BA 2I0VA 4UZDA 5BVEA 3ZFMA 1W7HA 3GQIA 3NYNA 4H39A 5I0BA 5HX6A 5JZNA 2UZVA 3E7OA 5JFXA 4XG4A 1BMKA 3CGOA 5F1ZA 3KVWA 3UNJA 4YTCA 5IUHA 3C5IA 4TYJA 4O86A 4FVQA 2OI4X 1IG1A 1Q8UA 4MAOA 4N70A 4CEGA 4USDA 5LWMA 4GK4A 3DAKA 4BGQA 4N57A 3UVPA 2A4LA 4DEDA 4PTGA 4F7NA 5HU3A 1CKPA 2X2KA 2WMBA 4LUDA 3BEGA 3DAEA 4FUYA 3EWHA 4FT7A 4RVMA 3OXIA 5AP2A 4MXXA 1MUOA 5HBHA 4FZ6A 4ERWA 1FMKA 2B1PA 1OL7A 4J98A 3AC5A 1PKDA 3EQFA 3U4UA 5KMOA 3N51A 4O1OA 4O6LA 5EM7A 4DFNA 3LZBA 2AC5A 3RVGA 3H4JA 4B0GA 4PMMA 1NA7A 3SG9A 5DT4A 3RCJA 3DK3A 4UMPA 2XF0A 4R3RA 3ZLSA 4CFUA 4D0WA 3MPTA 2QOCA 4K2RA 4ZTLA 5HTCA 2XK8A 3QCYA 4NFMA 3FY0A 2Y4IC 4LUEA 3L9MA 4D5HA 3ZBXA 3UQGA 3UNKA 4DTAA 4XCUA 3P7AA 3MH1A 3W8QA 4K77A 5FUTA 2B54A 3VN9A 3S2PA 4ZLOA 4X21A 4OTIA 5AR3A 4ZAUA 3EN4A 2WTVA 4BDAA 5CAVA 1XH7A 4BI1A 2OO8X 2A1AB 2W1DA 3SLSA 3G6HA 4FTJA 4KSQA 1YXVA 4FKIA 4LQMA 4NM0A 5AV1A 3A61A 4JVGA 4CYIA 3R0TA 3R2BA 4U8ZA 4I6FA 3HGKA 4XP3A 3MVJA 1Q24A 3OHTA 4NZWB 4AGDA 4OBQA 5EOBA 4RX5A 1XBCA 3HMOA 2I0YA 4BVUA 3REPA 4DYMA 3A7FA 3ORLA 4KB8A 4EWHA 2GHGA 4AG8A 3OEFX 1U5RA 2WQEA 5CAQA 5JEBA 1OVEA 1CDKA 4LM5A 4IAFA 4U3YA 3OY3A 5GJGA 1BLXA 2BRHA 4EOJA 1OPKA 4QYHA 3C4FA 4IM3A 3OZ6A 3RZFA 1R1WA 4DEIA 3IDPA 2UW3A 2EXCX 3DQWA 5GINE 2VTRA 4J53A 4AQCA 3ATTA 4I0TA 5TO8A 3EQPA 4YBKA 2XBAA 2WTKC 5AUYA 3PY0A 5K4JA 2PUIA 2XNOA 2NRUA 2JDTA 2PY3A 2EVAA 3EQRA 4IWOA 1Q62A 2ZYBA 5LVOA 1AQ1A 1QPEA 2B52A 2B9HA 3KGAA 5J8IA 3ZHPC 4E93A 3UO5A 3CBLA 4GT5A 1GY3A 3AG9A 4YURA 2IJMA 3MGYA 4QTDA 2XB7A 3PXKA 4TNDA 5IMEA 1REJA 3TNQB 4GK2A 3MVLA 3OUKA 4QMLA 5E8VA 3Q9WA 5G6VA 4E4XA 5CU3A 3GI3A 4QMXA 3I7BA 2X9FA 3R7GA 4EOPA 4G16A 3E87A 3MFRA 5A6NA 1R0PA 4DH7A 3S1HA 2P2HA 3NUSA 4EQMA 3CKWA 4P2KA 4ORKA 3B8QA 4F7LA 5DN3A 1U5QA 1YHWA 3R28A 2VWUA 3VC4A 3WOWA 1PXPA 5L8KA 4GK3A 3V5QA 2ZDUA 2GS2A 3LFSA 4FGBA 4FTTA 3TUBA 2C1BA 2P3GX 3DTWA 4QO9A 3KRJA 4C34A 2WTIA 3IG7A 3QYWA 3T3UA 4M66A 3G5DA 5F4NA 3QF9A 2VTHA 3ATSA 2BDJA 3Q3BA 4LG4A 2CKOA 3PJ2A 1S9JA 5J95A 3NUXA 1OI9A 3A99A 3KY2A 1VZOA 1NT2A 5M4UA 1JOWB 2O0UA 4USFA 4MHAA 1LP4A 2XZSA 5HLPA 2G15A 4JBPA 2JC6A 4BC6A 2YM7A 4MBIA 1M7NA 4AW2A 3R7VA 5EM8A 1Q3WA 4JDJA 1DM2A 3VQUA 5LJJA 4KINA 2G9XA 2YM6A 4RQKA 4ID7A 4F0GA 3OS3A 3HMMA 1SNXA 3QGWA 1FVTA 4Y72A 3KF4A 3N9XA 1SM2A 3D5UA 1JLUE 3ZONA 2R7BA 5B2MA 3EL7A 5B0XA 3ZH8A 1YOJA 5LMBA 4TYGA 3W8LA 3O8PA 4QMNA 2UZUE 4I5PA 3ZM4A 5FXQA 4CTCA 2IVUA 1G3NA 5DLSA 3ZZEA 4C3RA 3SG8A 3FI2A 2ITPA 2XBJA 2WIPA 3GENA 2IW6A 5EDQA 2FSTX 3EFWA 2YAKA 5KZ0A 4C38A 4YJSA 4EZ7A 2VGPA 4MWHA 5KCVA 4QTBA 4G3EA 2HZ0A 1WZYA 5KKRB 3R73A 2UZLA 3MI9A 5AV3A 1YXUA 4GSBA 4IE9A 5IA5A 4AZWA 1NVRA 4F7SA 5CAPA 3ZEWA 2CPKE 3DDQA 2UZBA 2VNYA 2WHBA 2BIKB 5A46A 4YLJA 4ZIMA 3FXZA 3TTJA 4DE4A 4RWKA 3VS7A 5A4LA 1FBNA 3I1AA 5AUVA 2GNIA 2R3JA 2VTNA 1OUYA
chains in the Genus database with same CATH superfamily
2H96A 2UZTA 3UZTA 5HLWA 4CMTA 2F4JA 4CFWA 4BTMA 1APME 4RIWA 2JFLA 2QD9A 4YU2A 3TUDA 5HKMA 4IX6A 3TEIA 4APPA 2JDSA 2X6DA 4UALA 1Q97A 3QRIA 4FK6A 1JNKA 2X0PA 5FWKK 4P7EA 2OW3A 1IAJA 4ZTRA 3ORKA 1ZLTA 4ALVA 1Q4LA 4QYFA 3VUMA 5AADA 1FGKA 1ZRZA 3TXOA 2P4IA 3NNUA 1JKLA 4FVRA 4M97A 4A7CA 3E8NA 1BL6A 2O3PA 1W2FA 3V5PA 4D4SA 5BQ0A 3W0RA 3KF7A 3QRKA 3R9RA 3BLAA 5CQWA 2XIRA 5EI6A 4KA3A 4ZSEA 4JMQA 3B8RA 4WRGA 3FMEA 2P2IA 4PP7A 4PMTA 3KMWA 3Q9ZA 2CHLA 3OFMA 4S2ZA 4BL1A 1PY5A 4M0YA 3RMFA 2WOTA 3AT4A 3ULIA 3VF8A 2PTKA 2YWPA 4HZSA 4UWYA 5HO7A 4X3FB 3RAKA 1QPCA 4LOOA 1TZDA 3POOA 5E8TA 3KULA 3ULZA 2JDRA 2R3GA 4FTIA 3VBWA 3ET7A 2BFXA 4I6BA 2Y9QA 5E9EA 4R7IA 3VQHA 3UG2A 1YHSA 3EQGA 2W4KA 3O51A 4BY9E 4HGEA 5CS6A 3TI1A 5LVMA 4G3CA 4FTKA 1YWVA 1ZXEA 2P33A 1UA2A 2VAGA 4U80A 4W8DA 3E7VA 4A9YA 3R8PA 4JXFA 2ITXA 1FOTA 3NYVA 5G1XA 3EMGA 4R78A 3W33A 5HE1A 4G17A 4CQEA 3HDNA 4LL0A 3FXWA 3FPMA 1FPUA 4FTNA 3O17A 4I5HA 4LRJA 4RVKA 5DRBA 4ZJJA 4I24A 4O4EA 2JKKA 1ZYJA 3QC4A 4GIIA 4FR4A 4XG7A 4F9WA 4O7RA 5C27A 3S0OA 1FINA 2R3OA 1JSTA 3TKUA 4F6UA 3R9DA 2IVSA 4BGHA 4V0GA 1GOLA 3L8PA 4BDBA 4FSRA 3FDNA 3LM0A 4FKRA 3TACA 4WSQA 4AXAA 2WMAA 2Y4PA 3AKKA 2C5OA 4O21A 4QYEA 3DB8A 3L8VA 4FOCA 2W17A 3E63A 4QPAA 3N4UA 4DINA 5I9YA 5BUIA 1SZMA 4Q5EA 4OAUC 3PXYA 3EFLA 3BQCA 1IA9A 5CT7A 5L2TA 4O0SA 2VUWA 3L9NA 4YO4A 5DG5A 2GU8A 3FZOA 4JDIA 5AP1A 4DH5A 3QALE 4AUAA 4FNXA 4TNBA 3R7UA 3QHRA 3UTOA 1OKYA 1HCKA 2QU6A 3ML1A 2JLDA 2PE1A 3RPVA 2X0QA 2PVNA 3GC0A 3AD6A 2XKDA 3HV5A 2H9VA 4H05A 2ONLA 5H8EA 4ACCA 4C02A 5CF6A 3JYAA 3EL8A 4RPVA 4JNWA 3LIJA 4DG2E 4RA4A 2Z02A 1GZKA 4GKHA 4MWIA 3BBWA 2OF2A 2C6OA 3NPCA 4GIHA 3QTRA 4PRJA 4C4HA 5AWMA 3DKFA 5LQFA 1XMMA 3NRMA 4KIQA 5L8LA 2VO0A 5AX9A 1XH8A 2UW7A 4QOXA 3TT0A 4AWIA 2CGVA 5CENA 1KE6A 2JKMA 5IA0A 3MA6A 3WYYA 2J0IA 3ORMA 3LM5A 3ROYA 4KIKA 4LYNA 3LAUA 4LRMA 4XBUA 2WQBA 4K8AA 3MVHA 1J7IA 5C8NA 4N4SA 5FM3A 2YAAA 2Q83A 4PQNA 4XRJA 3CY2A 2QURA 3BHTA 4HVGA 2J4ZA 2RFEA 4KKGA 4PPAA 3RM7A 4BIEA 2BFYA 3P7BA 5IZFA 2QQ7A 4XMOA 4ANMA 5CU0A 5CAUA 3QXOA 3ZTXA 4C36A 3KK8A 1NVQA 5CEQA 2XA4A 4HVHA 2WPAA 2F7XE 4IB0A 1Y6AA 3GFWA 4NH1A 5AV2A 5H2UA 3K54A 2B9JA 2OH0E 4L67A 2GNHA 2J50A 2QR8A 3GC9A 4PX6A 3PA5A 2WEVA 3W2SA 1OM1A 4NFNA 5FEEA 3DZQA 4O7VA 3PRFA 3AKLA 3I6WA 2OLCA 4O4BB 5EG3A 1OKZA 3TZ7A 5DNRA 1OB3A 2OXDA 4H58A 5LXMA 4EZ5A 4IH8A 2Z7LA 3EQBA 4X7QA 4IZ7A 5CZIA 4AGWA 2QO7A 2WD1A 4RX7A 3VJNA 2GTNA 3MB6A 4R8QA 3A4OX 3FKOA 2Z7QA 2I0HA 3T3VA 1OPLA 1W0XC 3QAME 1I44A 3AT3A 2HAKA 4EK8A 3IW8A 4BZOA 4LOPA 2XRWA 3COKA 2ACXA 1PYXA 2OF4A 2JITA 3LHJA 3R1YA 1WVXA 4X6RA 3SRVB 3EN6A 2NNWB 2A98A 4F0FA 5LWNA 3PVUA 2EXMA 3E93A 4I4EA 4R1YA 2XIXA 2XKCA 5JGDA 3ODYX 5CNOA 3ROCA 2GHMA 3LLTA 4MNEB 4PV0A 5IH5A 3PY3A 4E5BA 4HJOA 3P4KA 4GYGA 3ZO2A 4B99A 3FZ1A 2PK9A 3RCDA 3ZZWA 4BKYA 3VRZA 3O7LB 3W32A 4BKJA 5IEXA 2RSVA 3NYOA 3V51A 4MUQA 3TV6A 4O7TA 1REKA 1UVRA 4G2FA 5F20A 4E26A 5CEKA 2E2BA 5D41A 3GU5A 1IR3A 5C03A 3K2LA 1TQPA 1OIUA 4IX3A 4L00A 3SXFA 5BMMA 4DDIA 2GTMA 4EUUA 4D1XA 5EYMA 4E5WA 4C2WA 5JRSA 3TZMA 3LXNA 4K1BA 4I94A 2GDOA 4RX9A 5JN2A 3GCVA 3H9RA 3A62A 3MSSA 3W0MA 1WVYA 2ITUA 4ITIA 3CPCA 5AR8A 3V6RA 4F09A 2X7GA 2OJJA 4ANLA 1GZOA 3UGCA 2OG8A 4FTAA 4YJTA 2GNGA 5ETCA 4D5KA 4U40A 3AQVA 3U51A 4EKLA 4BDDA 2VU3A 4FKPA 2C6MA 4IAYA 5E4HA 4R1VA 3R8UA 4O81A 2QOOA 2R3PA 4ZY5A 5AV4A 4ASXA 2XJ0A 3CP9A 3JY0A 3QWKA 4N6YA 4EJ7A 1UU7A 5TE0A 1Z57A 2C4GA 2OH4A 3DAJA 3ENHA 3ZXTA 1M17A 3UPZA 5I5ZA 3NNWA 3OW4A 2UZWE 3HX4A 1OIRA 3THBA 4DLJA 2I40A 2XALA 3VJOA 4ONAA 3MJ2A 3UC4A 3TIYA 5FLFA 2VX0A 5ETIA 5K0KA 2VTPA 4XV3A 4BCKA 2X1NA 4S31A 2E9UA 4BIDA 2EUFB 4F65A 4TWCA 3TUCA 5DWRA 1YHVA 4PTCA 5AUZA 3GNIB 3PPZA 5K5XA 1DAYA 4UWBA 4G5JA 2HIWA 5IUIA 4K0YA 4EH2A 2PMIA 4YZCA 4FV4A 3HV3A 3GC7A 1UNGA 1RW8A 3IW7A 3TYKA 4M84A 3RBWA 4BCFA 2CNQA 5C8MA 3IOKA 3PWYA 5K4IA 4ZJIA 4WBBB 5DT0A 4FNYA 2J5FA 5M4CA 4PMSA 4AAAA 2C0TA 4I22A 4EOQA 4AQKA 3RK9A 4BDFA 5EDPA 4BCIA 4YUQA 5CX9A 2R3LA 3QTXA 2PHKA 1YXSA 2R64A 5ETFA 3U9CA 3BPRA 3QD4A 4FKGA 3U54A 4RIXA 3QCSA 4BDCA 3N4TA 2XYUA 4X2NA 4DITA 4Z7GA 5HQ0A 3FMMA 3ZMMA 1P4OA 1MP8A 4IFGA 3TJCA 4USEA 3PXFA 5L8JA 4EH6A 4FG7A 2I1MA 4EUTA 3WIKA 5J1VA 2ERZE 4YP8A 3MH0A 2YFXA 2JAVA 3HUBA 4YJRA 3GGFA 3GU7A 3OCGA 3EN9A 3R8LA 2FYSA 3DFAA 3EZVA 5E8ZA 4C3PA 4I3ZA 4FTCA 3KN5A 2XNGA 2PL0A 4BCQA 3TV4A 3E64A 3COMA 2GNFA 3LFBA 4DN5A 5C8KA 3KXNA 1ND4A 5CVGA 3UIBA 4YSMA 3FQHA 2Z2WA 5A4TA 3R2YA 2ZFYA 4EK5A 2PVLA 2WMQA 2G2IA 4J1RA 1WBNA 2EB3A 2ETRA 4K33A 5HE2A 3FMKA 3K3IA 4FUXA 4O0VA 3UDBA 5I4NA 5CVHA 2B55A 3WF7A 1H0VA 4DEHA 4NW6A 3ZDUA 1E1XA 3QQGA 4FTOA 5F9EA 4IZAA 1O9UA 3CJFA 2PVFA 2WXVA 4QRCA 2IW8A 3RI1A 1ST4A 3JXWA 3E5AA 4WNMA 4IWDA 4EHZA 4OGRA 2QOIA 4QQ5A 4XG9A 1B39A 1NVSA 4TWNA 4ZTMA 5E91A 5IEVA 4AOTA 4D2PA 3R7IA 3UMXA 4WA9A 2J0KA 4ZOGA 4RWJA 4D28A 1LUFA 4ZSAA 4OT5A 4F1TA 4C35A 3L9PA 3ZUUA 2ERKA 3F88A 4BF2A 2PMOX 1UV5A 5IQIA 4NM5A 2JBOA 3RTPA 3MVMA 2ITWA 3F3UA 4CV8A 2QG7A 2PVMA 3Q4UA 3UPXA 4MXYA 1H25A 4CRSA 4PDSA 2R3MA 4GUEA 4TWPA 3NFFB 2FVDA 2ITOA 2IZUA 3MESA 5DFPA 1WBPA 4GCJA 1J1CA 4G1WA 3R9NA 2O2UA 2QI8A 4NCTC 3F2AA 5E8XA 3F69A 2X7OA 4IAIA 5JFVA 4AW5A 3PYYA 4QP3A 5E8UA 4BGGA 4IIRA 2HW6A 2JKOA 5AR4A 5B7VA 3BLQA 4FL2A 3AGLA 3I0QA 3ZDIA 4MVFA 1KE5A 5LOHA 2XK6A 2Y4IB 2XK9A 3BU6A 3Q4CA 3FHIA 3HRFA 4I6LA 2GFSA 3WILA 3LCDA 2PUPA 4TW9A 4E4LA 4F70A 1PXMA 4ZP5A 1OL2A 4AE6A 2ETKA 3TNPC 2CMWA 1RQQA 3ORPA 4BBFA 3MV5A 3PSDA 4B8MA 4RFZA 4AT5A 3KXZA 2IVTA 4EK3A 3ID6C 2BZJA 1XBAA 4CZYB 2HXLA 3C7QA 4EH9A 4V01A 4ERKA 2CSNA 3QA0A 4IJPA 3PSCA 3A7HA 3BYMA 2W1EA 3TZ8A 4HVIA 2C6TA 4UZHA 3IW6A 5AV0A 4IVDA 4NKAA 3Q4TA 5A9UA 4CNHA 2ITZA 4XEYA 4LMUA 2G2FA 5LMKA 3O7LD 4FIJA 4CKJA 3QQFA 1YXXA 5L2QA 4DFZE 1ZY5A 3ENMA 4D4RA 1Q61A 2VGOA 2OSCA 2BRNA 2Z8CA 5ANIA 2PYWA 3VW8A 3GU6A 5D7AA 4WUNA 2BHEA 5FEQA 1T45A 2YITA 4C7TA 4RWLA 5T68A 5I3RA 1LR4A 3QUDA 2YA9A 4R77A 2WTKB 3MWUA 3BX5A 5EDRA 3FLZA 4FEUA 3BBTB 3A7JA 3OW3A 4O7WA 2UW6A 4I21A 2Y6MA 5AP3A 3BEAA 4FIFA 3PE1A 2YLEA 1ZMWA 4CKRA 3RPRA 4HVSA 3WZDA 3QD3A 3R7OA 1Q8WA 4J52A 3DK7A 2ZM1A 1PMVA 3RINA 1XH6A 3MFTA 3UYSA 1K3AA 3Q96A 4W4XA 4DGNA 2QKRA 3TIZA 4F78A 3RHXA 3EH9A 4EYMA 2WMUA 5KHWA 1XH9A 3HV6A 4E4NA 4CLJA 3DBEA 5I9XA 4ZTHA 3CCNA 2B9IA 3LJ0A 4U41A 4GL9A 4DGLC 1M2PA 4CFXA 5JKGA 3PDTA 1CM8A 3U87A 3I81A 1XKKA 3NFGB 4WG5A 2G1TA 2W99B 4JI9A 4UMQA 4IAZA 4DFYA 4OTWA 3QTIA 5DMZA 5JFSA 3ACJA 1WFCA 2I0EA 4GYIA 5EYKA 2F57A 4K6ZA 1ZY4A 4EI4A 3KB7A 4FKLA 4P5QA 1Z9XA 1OGUA 4BCJA 2FUMA 3UDTA 3OCBA 4MXAA 2B9FA 4OBPA 2UVZA 4FA2A 3Q52A 4U5JA 5ETAA 5EW3A 5EQYA 2WKMA 2WMWA 1OL1A 2BR1A 5L3AA 3ETAA 3BKBA 4C4GA 1KOBA 2XNBA 5D1JA 5EYDA 5AUWA 2WAJA 3PG3A 1O6YA 4JG7A 2CKQA 5TT7A 4QTCA 4NJDA 2VTIA 5IA4A 3NIEA 2W5HA 3A8WA 4AS0A 2R3RA 4UX9A 4F4PA 3R04A 4M7IA 3F5GA 4LDTA 1DS5A 3DT1A 4OTFA 4C8BA 3GCUA 5A3XA 3EN7A 5FBOA 3VS5A 4G9CA 5CEOA 5CU2A 5JQ5A 3CPBA 2PWLA 3O71A 4MTAA 3LFCA 3DKGA 3WYXA 3UBDA 4C33A 4O0WA 4YMJA 3QKKA 4PUZA 3S95A 3E8EA 3AD5A 4NIFA 5ANDA 3UVRA 3HDMA 4E73A 4O0UA 1Q8YA 4R5YA 3PE2A 2WZJA 1X8BA 4MYGA 1UU8A 2DS1A 4YJQA 3GQLA 4NEUA 3BRBA 2XNMA 4FT0A 4Z9LA 3VS0A 3N4VA 4BI2A 2X8IA 5AP6A 1PXNA 2HY0A 2V7AA 4ACMA 4CZTA 1XQZA 2HZ4A 3Q9YA 3QZFA 4UEUA 2YWVA 3HECA 1OUKA 3BELA 3DCVA 2ZM3A 3DS6A 3FYJX 2RFNA 3DQXA 4F9BA 3DLSA 4RJ6A 4FI1A 2R9SA 2UW5A 4UXQA 5FP6A 1YW2A 4WO5A 4CSVA 4J95A 3AC3A 5IA1A 3P78A 4AE9A 2JIVA 1Y8GA 2XP2A 3DBDA 1Y6BA 4JR7A 4RVTA 4D4VA 5EQPA 3G6GA 3KXGA 4FSNA 3OG7A 3V04A 3IKAA 4GRBA 4IB1A 2WMRA 4GT3A 4UB7A 2UZEA 3PIYA 3ALNA 4MKCA 1OITA 4QQJA 4AF3A 5AUTA 2YM5A 4WNOA 1ZMUA 5TF9A 4E3CA 3FI4A 3QZIA 2ZV9A 5FXSA 2WTJA 2RF9A 2VWBA 3OTUA 4ASEA 3CQWA 1PRYA 2WQOA 4QMQA 5M4IA 2BKKA 4QMYA 3DNEA 3O0GA 3G0EA 4JG8A 4QMOA 5A14A 5K3YA 5J9LA 4H1MA 2C5YA 2ZDTA 3L8SA 1WBWA 4FTRA 4YTHA 3OD6X 4FSWA 3F3VA 5LMKC 3FLSA 4LRKA 4C4IA 1UKIA 3ZRKA 5KX8A 3I6UA 4RJ3A 4O4FA 4CMUA 5EH0A 3F3WA 2W96B 5M51A 1URWA 4AGUA 5AM7A 2JGZA 3LJ1A 5ACKA 3H3CA 2UZNA 3C4EA 3EJ1A 4JBOA 4G6NA 4YPDA 5L4QA 2R3KA 1UU9A 3QBNA 4YC6A 2WTCA 2G2HA 4FNZA 4YHFA 5AM6A 4ZLYA 2JDVA 3E3BX 4KKHA 3RPSA 4O27B 4CV9A 4OTRA 1PXJA 3VS3A 4EC8A 4PDPA 2E9VA 3LOKA 3QTQA 3K5VA 5HIDA 2OFVA 1MRVA 3GCPA 4DHFA 5JGAA 5CT0A 3OEZA 3PJ3A 3PP1A 4DH8A 3W0SA 3GFEA 4CFMA 4O96A 3D7TA 2VO6A 3RAHA 2FGIA 3VBVA 4XV1A 2OKRA 4WG3A 4C58A 4RLKA 1VLRA 3GU4A 4WKQA 4CFNA 4EH4A 3OP5A 4IWQA 5C9CA 4P5ZA 5KO1A 2YABA 3POZA 3Q2JA 4ACHA 3EQDA 3EKKA 3G15A 3ORIA 1V0BA 3IW5A 3LMHA 3GEQA 1UNLA 1YKRA 1UNHA 4Y5QA 3RNIA 3ZSHA 4CTBA 2R3NA 3PFQA 3BU3A 4FV9A 4U43A 3FLWA 4YZ9A 3LFAA 3T9IA 4ANSA 3G9LX 3VBTA 5CEMA 1H1PA 1OKVA 4IVCA 3PXRA 5ACBC 5D10A 5AX3A 3BI6A 5C1QB 2XAOA 3R1NA 3H30A 4IJ9A 4HPTE 2V7OA 5DR9A 4LGGA 3UDZA 3KCKA 4DT9A 2BKZA 5HVKA 2OU7A 2C5XA 3BGQA 3DJ6A 4FV8A 2GQRA 5AA9A 3QZHA 3AD4A 3QWJA 2OFUA 2C69A 5KMIA 2BHHA 2QONA 4QMZA 2BMCA 4XP2A 2UVYA 2ZV2A 2DUVA 2UVXA 5HEZA 2XCKA 4RJ8A 2OK1A 4C4FA 2YJSA 3B2WA 3FV8A 3PVBA 3IQ7A 3HZTA 4OAVB 4EOOA 2RFSA 3AC1A 4JBVA 2GFCA 4JIAA 2HCKA 1SVEA 3FC1X 1ZYSA 3QX4A 3R7EA 2CLQA 3DXPA 5J9YA 4CYJA 4K18A 2J90A 2XNEA 5A54A 3ZYAA 2OJ9A 4GV1A 4AA0A 3ZO4A 2BIYA 1M2RA 2ZJWA 4B4LA 3TZ9A 3D5VA 5L6PA 5M07A 3QXPA 5CYIA 5KMKA 4ZMFA 2VX1A 3EB0A 4I0RA 2E9PA 5IQDA 1BI8A 2IVVA 4TYIA 2QOQA 3BLRA 3DOGA 5HO8A 2BZIB 3FE3A 4UN0C 4YSJA 5BNJA 2C5VA 2YIQA 2A19B 4FX3A 4JRVA 4ANOA 4OTGA 3MPAA 3ZM9A 5JFWA 4APCA 3CKXA 2YCFA 3C0GA 2NPQA 1K9AA 3FMLA 3HMIA 5DPVA 5AUUA 3SV0A 4YC8A 4S30A 4XBRA 5HBEA 2FH9A 5FEDA 1A06A 4GW8A 3ITZA 4DLIA 3OOGA 2PUNA 3RJCA 2BDWA 3PPJA 3UQCA 4HCVA 3R02A 5IH6A 4M69B 3F3TA 1VEBA 4PPBA 3DA6A 3GOKA 5CZHA 4CCUA 4M13A 4BTFA 3R8ZA 2DQ7X 5EK7A 3CC6A 4HVDA 1XJDA 2C3LA 4BBEA 1UWHA 5J1WA 1H28A 3BHHA 1YOLA 4FGRA 4RA5A 4MD7E 4AN3A 5E7RA 1PXIA 1LEWA 1GJOA 4X3JA 3RPOA 5IQCA 4C57A 4DEEA 3HKOA 3DDPA 3OXTA 2GPHA 5CVFA 5A4CA 2Z60A 2B7AA 4J8MA 1QPDA 5AP7A 4BHNA 3NUNA 3H9FA 2XIKA 2BAQA 2RGPA 1XMLA 4OLIA 2GCDA 1PMEA 5DH3A 4ACDA 3TM0A 5DR6A 4YJPA 1PKGA 3ZLYA 1J1BA 4DC2A 3K3JA 1Q8ZA 4CFFA 3Q5ZA 4DFBA 4RWIA 2RFDA 5KHXA 2CCIA 4R7HA 2RIOA 4BDIA 2QHNA 3PJCA 4IMYA 4QNAA 2UUEA 1ST0A 4XUFA 2EB2A 3OTVA 2PMLX 3R01A 2HWPA 2YZAA 4G31A 2V5QA 4OTDA 4Y95A 3VULA 3MIYA 2OJFE 4U7ZA 2Y8OA 5HOAA 3KULB 4PMPA 4G3FA 5CY3A 1KUTA 1LPUA 3BE9A 3AT2A 5IQHA 2B4SB 3HA8A 2J0MB 3OCSA 3PXZA 3ZUVA 5KBRA 2WQMA 3P0MA 1R3CA 3FL4A 4M68A 4I93A 4ZS0A 4DHJA 5BYLA 3VHKA 4EHEA 3V8TA 3F5PA 4KSPA 5L6OA 2V62A 1O6KA 3LJ2A 5FQDC 3QFVA 5HVYA 4FT5A 1BL7A 5HE0A 3R7YA 1DI8A 1ZARA 3QKLA 3RK5A 4L8MA 4AOJA 5AA8A 2XIYA 2YCRA 3G51A 4OTQA 4IXPA 5CU6A 5DIAA 4CGAA 3BV2A 3E8CA 3Q4ZA 1ZZLA 3OT3A 4U3ZA 3CY3A 2UW4A 5FBNC 5CF5A 5DT3A 4DA5A 3CD3A 4GKIA 3BGPA 1ZYLA 2UW9A 4D2TA 4ZY6A 3S00A 2C6KA 3KKVA 3PG1A 4NU1A 4UWCA 4AW0A 1ZOHA 2JD5A 4BTKA 4F9YA 1BKXA 3HLLA 4D2RA 3TMOA 3QX2A 2OZAB 3DY7A 2J5EA 2WU7A 3SW4A 3O8TA 2NRYA 2ESMA 3DBFA 2C0IA 3MDYA 2LGCA 2ZOQA 2H6DA 4FC0A 2O63A 3NX8A 3PY1A 4R7BA 3FJQE 4Z7HA 1TVOA 5LCKA 5F95A 3R8MA 3I7CA 4FEVA 4JAIA 3FL5A 2PVRA 5GZ9A 4RZVA 1P4FA 3PIXA 4YO6A 2WMVA 4IB3A 3V8SA 4A06A 4DFLA 3W0NA 2B0QA 4DCEA 4HYSA 5J7HA 4NKSA 4E6CA 4ZZOA 3SC1A 4J96A 3H0ZA 3VUDA 4DAWA 4O7ZA 3PRIA 4O0XA 3LQ3A 5M06A 1L8TA 2VWYA 4O2PA 4XG8A 5JGBA 1G5SA 1PXLA 3FMHA 3UVQA 3VNTA 4DHIB 5E92A 1U4DA 3MB7A 4G5PA 3NZ0A 2VWWA 4MNEA 2C6EA 4PPCA 3UP2A 1H24A 1OBGA 2VTQA 1OIYA 1LEZA 3ZFYA 3KXHA 2X9EA 2ITVA 5HVJA 2YIXA 4I4FA 4YPSA 3KRWA 4EOIA 2WO6A 2C1AA 2XM9A 4IVBA 4WG4A 3GVUA 3QLFA 4U97A 1KWPA 5FD2A 5GNKA 4ALUA 4BRXA 1Q3DA 3LE6A 4C0TA 4D1ZA 1YXTA 5BUEA 4XV2A 2YIYA 3HEGA 3I0OA 3LCKA 4AT3A 3KMUA 3BWFA 3KL8A 3CR0A 4NTTA 5I3OA 4KNBA 5BYYA 3NCGA 1WCCA 2IPXA 1L3RE 4A9TA 3NVMB 3ZRMA 4XG2A 4CCBA 4KKEA 3E92A 3BV3A 2NYAA 5AAGA 4ENYA 4ZLZA 4E6AA 2WB8A 3PSBA 1JBPE 4FEQA 3HP5A 5D9HA 2X2LA 3OBJA 4MXCA 4B7TA 1HCLA 2WU6A 3O2MA 3ODZX 3R8VA 4KABA 4FSUA 1BI7A 3E62A 4AGCA 2XH5A 5A4QA 2PZ5A 1PW2A 1MQ4A 2FSLX 5EOLA 3W1FA 1VYZA 4XG6A 3F2RA 3QTUA 4IZYA 4ZEGA 2J9MA 1H4LA 3EKNA 3MY1A 2PULA 4JIKA 3KC3A 4Q5HA 1OMWA 4WNPA 2GHLA 3ZU7A 2EWAA 4WIHA 5IH4A 4JDHA 3C50A 5JT2A 3NIZA 5EHLA 4FSMA 3KVXA 2I7QA 4XV9A 4MCVA 1P2AA 2VTLA 4RT7A 3ZLWA 3DXQA 2CGWA 5IMXA 3RAIA 2X8EA 3M2WA 5IQGA 5M4FA 4DEBA 5IEYA 1V1KA 5FP5A 3WZKA 4FTLA 1W2CA 2BZKB 3I5ZA 4IHPA 1ZYDA 3MA3A 2QOLA 4TPTA 2PZIA 2W1IA 3UE4A 4LMNA 5GHVA 4IZ5A 4YJOA 3QD0A 4RC4A 2Q0NA 4X2KA 4FKQA 4N6ZA 4J97A 4IB5A 3W2OA 4JLCA 1XR1A 1E9HA 2HZNA 4FKUA 4FG8A 4MD9E 1SNUA 4ARKA 2JKQA 3O8UA 2VTOA 1H1QA 2ONLC 3ZSIA 3UP7A 4ZZMA 5IQBA 4IX4A 4QP8A 4W4YA 4BZNA 4W8EA 4FKWA 4O0TA 2CLXA 5HG7A 3GBZA 4E1ZA 3OXZA 4HGSA 3UMWA 1R0EA 3PWDA 1B6CB 4GEOA 4RMZA 5AP4A 4M15A 4MEDA 3NUUA 4AP7A 4CG8A 4HNFA 2F7ZE 4BYIA 4EZ3A 4IM2A 5T6KA 3WBLA 3FQEA 3VRYA 4LV8A 4FSZA 3F82A 3QL8A 1OPJA 4EBVA 4BBMA 4MNFA 5A4EA 1V0OA 3P86A 3PLSA 3VW6A 4WUAA 5IQAA 1G8JA 2FB8A 3A7IA 4RIYA 5EM6A 3KMMA 3BHYA 4NYEA 1I09A 3COHA 3NGAA 4QMTA 2Y0AA 2VNWA 4YNEA 4ACGA 2KULA 5CSWA 4YTFA 1GZNA 2O5KA 1W98A 4RG0A 4TY1A 3E3PA 5CLPA 3AXWA 5HIEA 3R1SA 4GU9A 3R9HA 4FL1A 4BCOA 4O38A 4TWOA 3H9OA 5JRQA 5IU2A 4P4CA 2W1FA 3CSVA 1YVJA 3ERKA 1U54B 1YOMA 2VWVA 3R63A 4FNWA 4QPMA 2QNJA 3IECA 3F6XA 2PVYA 2BTRA 4JRNA 4BWXA 4L3PA 4MBJA 3KU2A 4AZSA 3S4QA 2X0GA 2AUHA 4HZRA 4L6QA 2UW0A 2H8HA 4L42A 5HU9A 3ORXA 2QOBA 3FMNA 5BVDA 3IONA 4EHVA 3D15A 4F1MA 4TL0A 2OXYA 4RIXB 1AD5A 1U59A 4JJRA 3TJDA 5HD4A 5AJQA 2FA2A 3F7ZA 4ZTNA 1XH5A 3D9VA 3NCZA 2BTSA 4HGLA 3DKOA 3B2TA 3W2PA 2F2CB 4U45A 1OGYA 3JS2A 4H1JA 3TNIA 4AAYA 5HESA 4O84A 3CTJA 2X8DA 2HZIA 2W1CA 2YERA 3FC2A 3DNDA 1F0QA 4KRDA 4L7SA 2DWBA 5FG8A 4BDEA 3VBXA 3WE4A 1CMKE 4LI5A 4DFXE 5IG1A 4O1PA 2C3JA 4A4LA 4AZVA 1DAWA 4L9IA 5CEIA 3DXNA 4U44A 4QDEA 2PU8A 2W4OA 2XS0A 4S33A 2VN9A 3UOKA 3V5JA 2BCJA 2C0OA 4O0YA 1GIJA 4EOKA 4FE2A 2W7XA 4TYEA 2OIQA 1XO2B 5DBXA 3UODA 4BYJA 3II5A 4PNKA 3W18A 2J2IB 3IK3A 3OMVA 4RBLA 5JSMA 4UY9A 3CQUA 3W2RA 3LQ8A 5EI8A 5EKOA