4ZSLA

Mitogen activated protein kinase 7 in complex with inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
341
structure length
341
Chain Sequence
DEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 7
publication title Discovery of a novel allosteric inhibitor-binding site in ERK5: comparison with the canonical kinase hinge ATP-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 116
structure length 341
sequence length 341
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zslA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zslA01
4IB0A 3FMDA 4AAAA 3G15A 5HO8A 3BBTB 3KCKA 2ZV7A 2X4FA 2BILB 4HZSA 2LGCA 2BTSA 2O64A 4FMQA 5CYIA 3MS9A 2CDZA 2BROA 3GU7A 3ZFMA 4GCJA 5LARA 4FTMA 2XMYA 4BDDA 4EYJA 5HZNA 2EXCX 2J0JA 4N70A 2YWVA 2VO3A 2YITA 4GU6A 4J97A 1JKSA 1FMOE 4JJRA 3OW3A 5T6KA 4E5AX 3PJ3A 4DG0E 3V04A 4KRCA 3D4QA 3JYAA 4IB5A 4WNKA 5FTOA 3SW4A 1GAGA 2OZAB 1SNUA 3KXMA 4IZAA 5AUTA 5DH3A 5HVYA 3ZLSA 3Q4TA 2NNWB 4EKLA 5BX0A 2PVJA 3R22A 3VS7A 3QQFA 5AA8A 1IRKA 2BZIB 4XNEA 4WO5A 2WOTA 1YHVA 5DLSA 3MFRA 4CMTA 3E62A 1CDKA 2ZDUA 1O6YA 1W82A 3IW8A 3MSSA 5L6PA 3DQWA 5C8MA 4FTRA 3KXZA 1QCFA 3HA6A 4TPTA 2ETRA 4YJOA 4ZSEA 3SKCA 4IVCA 3RGFA 3GC9A 4OTFA 3ZC5A 3FZ1A 2VD5A 3AC1A 5JT2A 4DH5A 4K33A 5FLFA 4L46A 4BTJA 4Y46A 4X2KA 1H00A 3QTRA 3H0ZA 4E3CA 3HRBA 4FSYA 4YJTA 3R8MA 1OL5A 3CY2A 3BGZA 2Y6MA 4FC0A 2WHBA 3DFAA 4X0MA 5EHLA 3U8WA 3VS6A 3EMGA 3IO7A 5I3OA 3W16A 3ACKA 5CU4A 3BHVA 3IKAA 4G1WA 1H26A 3RK9A 5HO7A 3F82A 3POZA 3P7BA 3FQEA 4A9TA 3T8OA 5KHXA 4CFFA 3PVBA 3C4CA 4FZFB 5AP2A 3IK3A 3QAME 2BZKB 3JY0A 4YC8A 5AJQA 3BELA 4M68A 3Q04A 1OKZA 3MH0A 4DH7A 4R7IA 4ZS0A 1J7IA 2DQ7X 2HWOA 5DT4A 4BKJA 2OKRA 1I09A 4FTTA 4FZDB 4RWIA 4X7QA 5D10A 3NWWA 5E91A 3ZZEA 4D0XA 4K11A 4F9BA 4CLJA 1H1QA 5HD7A 2GFCA 3OWJA 1UKIA 3NYNA 3Q5IA 4A9UA 3Q5ZA 3W33A 1YDSE 3TEIA 5KKRB 4FGBA 4CYJA 5HTCA 4LL5A 2CNQA 4MCVA 5J9YA 5A4CA 2YEXA 3VQHA 5DPVA 2OXDA 4XV3A 3K2LA 3QQLA 4HYHA 5IA5A 3TNWA 4IJPA 4DGMA 3ZM9A 2R7IA 3BI6A 2YABA 3PXZA 4NU1A 5T68A 3ZOSA 4R6VA 2CN8A 2JAMA 3UE4A 4IAIA 3RPSA 1M2RA 4AW1A 4I6QA 3R9DA 4BCOA 5IEXA 3LKMA 3VJNA 1NW1A 3QWKA 3R00A 3EYGA 3ZRLA 3EQCA 2QLQA 3SGCA 2W99B 3JY9A 3ZUUA 2JEDA 1B39A 4UXQA 4Y72A 1WFCA 4BWPA 5IUGA 4ACGA 4DH8A 4EQCA 3DK3A 3D2KA 2OU7A 5CS6A 3TTIA 5TF9A 3ORTA 1EH4A 5JEBA 4MX9A 5H8BA 4FL2A 2J5FA 4XRLA 5M4IA 3NIZA 2B9JA 2YM5A 3FZPA 4OW8A 5AP0A 4RIYB 2WTDA 3KVWA 2G2IA 4FSWA 1KUTA 2J0LA 3SXFA 3P79A 1GNGA 2PVRA 5CF6A 3MESA 4ZXTA 3AC4A 4D2VA 2VWBA 3D0EA 5I9ZA 1JNKA 2GNIA 4XBRA 4D0WA 2ITOA 3KKVA 2UVXA 4YNEA 1O6KA 4G9CA 5TO8A 5KBQA 1OI9A 4BTKA 4K18A 4U5JA 2J50A 4FZAB 5TE0A 3NX8A 2W9ZB 5DA3A 1OECA 2ERKA 5L6WL 2OH0E 2WKMA 5GIOE 3RINA 2CGXA 3DAJA 3PPZA 2XEYA 3BHUA 5E8SA 3QQHA 4XMOA 2HAKA 3MH3A 2A4LA 2W1EA 4RVKA 3KQ7A 1XH7A 4TT7A 5IDNA 4GK3A 3NNWA 1FVVA 2QNJA 4S2ZA 3ROCA 2XNGA 2FB8A 3TM0A 4UN0C 1AD5A 2BMCA 5FDXA 2V7AA 4JDHA 4F1TA 4XBUA 4G3GA 4IBMA 3EYHA 5DOSA 1YOLA 5K3YA 2E9PA 3MA3A 2DYLA 2R4BA 1B6CB 3O2MA 3O8UA 4KSQA 5M09A 3UIMA 5I9WA 2VTLA 3DT1A 3LZBA 4KKEA 4EUTA 3L8SA 4I23A 1QPDA 3MN3A 5IMXA 3A99A 3OEZA 4QT1A 4FIEA 3UDBA 4E7WA 5M56A 5EOBA 5IH6A 4JBQA 2XS0A 3UGCA 2OGVA 2C3JA 2VTPA 3HDNA 3O51A 4PTGA 4QMTA 3Q60A 3QA0A 3NUSA 5AP5A 1NY3A 2PHKA 4FOCA 5AR5A 4D4VA 2REIA 1GZ8A 4D2WA 4FV9A 2OJGA 5CNNA 3ZRKA 4D2TA 4OBOA 4FTUA 4YO6A 2RL5A 3DZOA 2HCKA 3D2IA 3FL5A 2JAVA 3KULB 2C4GA 2R9SA 3GENA 3Q4CA 4B9DA 2J0KA 5DBXA 1A48A 2JLDA 4LI5A 5D7VA 4MXYA 2I0YA 2OJIA 4RFZA 2JDOA 2BDWA 5CEIA 4KD1A 4CTBA 4AACA 2FH9A 3DA6A 3VN9A 5FM3A 4I0RA 4DCAA 3KU2A 3WYYA 5GJDA 3ELJA 3O0GA 3S4QA 3V8SA 1M52A 3W32A 4G9RA 3QU0A 1PYXA 5LXMA 4AE6A 4A4XA 3KMUA 4JRVA 2ETMA 4L53A 2QU6A 4WSYA 4ZIMA 5BNJA 3F7WA 4IEBA 4G5JA 1Q3DA 4O6EA 2BHEA 4BDGA 2OW3A 3CJGA 4QP6A 1SM2A 1E1XA 3OBJA 3GQIA 3RAKA 2X7OA 3PYYA 3KVXA 4AUAA 5M08A 3OBGA 5CLPA 5ANOA 4IVDA 2J6MA 4JDKA 3HV3A 2XYUA 4RWJA 4Y5HA 3VNTA 4EQMA 5CEMA 3AOXA 5F9EA 5L6OA 2OF4A 3D83A 3RHKA 3LFCA 3TKUA 5KMNA 4PDPA 3D5UA 2CLQA 5ANDA 2VZ6A 4XV2A 1ZZLA 2WQEA 3PY1A 3FWQA 3AT3A 5IUIA 2BAKA 5J7BA 3WF7A 4CCUA 1OIRA 1R39A 3GQLA 4GUEA 3FHRA 4CMUA 3JXWA 4R8QA 3R8VA 4AGUA 4EK6A 1FGKA 3UVPA 4H3PA 5EDQA 1UVRA 1WVYA 3DOGA 2ITYA 2C68A 5KMLA 2GQGA 5AV3A 4QTBA 5TR6A 4HCTA 3AXWA 4AZTA 2PMLX 2WTVA 5C27A 3RNYA 2WMSA 5HE2A 3H9FA 4RFYA 2QHMA 1K9AA 3FLYA 3QALE 4CSVA 3M11A 5DMZA 3MVLA 4QYYA 3CEKA 3M42A 4NM5A 2YAAA 3DKCA 3LOKA 1WBTA 3LFNA 5JK3A 3QFVA 2HIWA 3IW4A 4HYUA 1U54A 3BBWA 3FY2A 3UODA 5I4NA 1WBWA 3R7YA 5HU9A 5EQPA 4G6OA 3BX5A 4FSMA 4R7HA 3PVGA 2P2IA 3QZHA 3GEQA 3V5LA 4MD8E 4K1BA 4PX6A 4S30A 4EHZA 5HBHA 1O9UA 3L9LA 2PZPA 4WBOA 4ZEGA 1PXNA 2OIBA 3F69A 4M67A 3S00A 1M7NA 1ZLTA 3GCVA 4FKVA 4IQ6A 3W8LA 5L4QA 4IHPA 1W0XC 5A9UA 4KRDA 4U43A 4BY9E 2I1MA 2BAQA 3ZONA 4AA5A 3DKFA 4RWLA 4A07A 2OBJA 2XNEA 4EHEA 2FSOX 3BQCA 3PJ1A 5TKDA 2Z7LA 4NT4A 4YJPA 4A9YA 4MBJA 1WBOA 2JKKA 3LFFA 4KABA 4YP8A 3FAAA 4YGAA 3RAWA 4C33A 4OBPA 5M44A 3AMAA 5CF8A 3RJCA 4TNBA 3QCYA 3DK7A 3G33A 3SXSA 4PF4A 4BICA 2J4ZA 3GU4A 3R63A 5IDPA 4IWDA 3R30A 5AX9A 4AFEA 3EN5A 4W4XA 4KS7A 4FIGA 3OVVA 5B2MA 2WD1A 3P4KA 3FKOA 4RJ4A 4PUZA 4F0FA 5JSMA 2NRYA 3QZGA 4JG6A 5KMIA 3LVPA 1XKKA 5CF4A 2C47A 3DJ7A 2VTTA 3QRTA 4DEAA 4F08A 2B0QA 3NLBA 4C3PA 3ZO4A 4ERWA 4RVTA 4QP4A 3D14A 4A7CA 4CZYB 3CPCA 5AAGA 5BUJA 2UV2A 1FVTA 4K2RA 1WMKA 2PK9A 2XF0A 4JR7A 4BKZA 4FTNA 2I0VA 3Q96A 4ZOGA 5FEQA 4KNBA 3ZO1A 2BKKA 3D7TA 4FTIA 3FKLA 4FKSA 3GB2A 2R3NA 3GC0A 4R3PA 2QR8A 4WUNA 4HVHA 5J79A 3GBZA 5FP6A 2W1DA 4ITIA 2HZIA 3FEGA 4ANSA 4XH6A 3QC4A 4G3CA 3NYVA 4FKLA 3RPVA 4DF3A 5EDPA 4FICA 1J7UA 3GOPA 3M2WA 4FYNA 4KBKA 4DH1A 5DEWA 5A6NA 1OIYA 4CYIA 4I5CA 4D4SA 3G6GA 5AP6A 4BTFA 4M84A 2X81A 2HW6A 3HNGA 3THBA 3ZLYA 1M2QA 4ACMA 3NEWA 4EK5A 1OGUA 3PXFA 3GC7A 4MKCA 4BCKA 4NUSA 3O17A 3AC2A 2QOCA 3QX2A 5CEKA 3C4EA 4IZ5A 3ZXTA 3BV2A 4DEBA 3SHEA 4O96A 4GVJA 2UZVA 3QRUA 3U9NA 1PXKA 3ZUTA 4EOOA 4X2FA 4O1OA 3WILA 3H4JA 2BALA 3DB6A 3EWHA 3KC3A 4J53A 4CT1A 4D1SA 5JGBA 3LMHA 1IG1A 2BHHA 3BWFA 3BGQA 4XHKB 5JMSA 1YQJA 1QPEA 2IW6A 5K5XA 5EQEA 2C0TA 3GI3A 1MQ4A 4KIPA 4USDA 5IUHA 2QO9A 5D41A 2UZDA 5J9ZA 5LVNA 3F3WA 1KE9A 2PVMA 2QOBA 5D7AA 3TXOA 2QG7A 5AR4A 3WE4A 4EONA 4LOOA 4M12A 5L8LA 5EW3A 4EJNA 5M4CA 5IQBA 2E9UA 2GHLA 4M69A 2YAKA 2YM3A 2Z7RA 2R64A 4PTCA 5FQDC 3EOCA 1OPKA 3PFQA 2KULA 4C59A 3AGMA 2YDKA 3Q52A 4RX9A 2YN8A 3R28A 3FQHA 5AAEA 3TDWA 2CCIA 4O21A 4B6LA 4PDOA 1Q8YA 1YDTE 3NSZA 4H3QA 4FL1A 4H3BA 4EJ7A 4GSBA 3D15A 4D58A 2C3IB 3LLAA 2WXVA 4K8AA 3I6WA 4MD9E 3TKIA 5JZJA 3V8TA 5BVDA 4IB3A 2W96B 4PTEA 2Q0BA 5HCYA 3WZJA 4EH3A 4O27B 5EM6A 5C4KA 5AFVA 2W9FB 1YVJA 4AZWA 3VWAA 4FIHA 4CFVA 2GDOA 1H1SA 3FZSA 5HVKA 2FSTX 4APPA 4WG4A 5C8KA 2X1NA 3EB0A 3MVJA 4IADA 5E8YA 4J7BA 5L8JA 2H6DA 3FSKA 4DH3A 3OCBA 3U51A 1UWHA 2B52A 1Q99A 3JS2A 3Q53A 3CR0A 3ORZA 2XKFA 4U40A 5HICA 4EORA 3T3UA 3I0OA 5J7HA 4FEVA 3ZEWA 4E93A 2QOOA 3F3UA 4AGCA 4RVLA 1J1CA 1H24A 3ZUVA 3H30A 4L00A 4LGHA 3SVVA 2XEZA 4YHTA 3W8QA 1DAWA 3CLYA 1Q8ZA 2WO6A 5EOLA 5CASA 3LM5A 3UO4A 4W9XA 4D9UA 2UVZA 4BCNA 5I3RA 1ERKA 5J5TA 3LJ1A 3BIZA 4TY1A 2GFSA 2XP2A 3ODYX 3PTGA 1Q8TA 3QTZA 3OOMA 1YKRA 4IX6A 3BQRA 4U42A 2IW8A 4F64A 3EFJA 4BI0A 2JBOA 4L67A 1WVWA 3MDYA 4QQJA 3RM7A 3P7CA 3MV5A 1W98A 4RBLA 1S9JA 2BVAA 2C5XA 2JBPA 3TNQB 4FEWA 2DWBA 3IONA 5GZ9A 3OCTA 4IE9A 2Y6OA 4F1OA 4ZJVA 2JIIA 2X8EA 3VW8A 1U59A 4I20A 3BYUA 4J1RA 4MAOA 3DCVA 3QX4A 3TNHA 4FTQA 3Q32A 4BDKA 4HW7A 2ITNA 2O8YA 4JIKA 4NWMA 4DGGA 1Q24A 2IPXA 3OHTA 4AP7A 3OT3A 2YM6A 1PHKA 4D5KA 5KHWA 3POOA 4UY9A 4GJ2A 2JD5A 5AAFA 4TWPA 1A06A 4BGGA 3KA0A 2ETKA 4ZY5A 4XG8A 5DT0A 5BVFA 5AP1A 1JKKA 2V55A 3C4XA 2PY3A 4XP2A 2QG5A 3IDCA 5IPJA 3A7FA 3DLSA 3FZRA 4FT0A 3EIDA 3DAEA 4G6LA 4RT7A 1ZMUA 3LCDA 4TW9A 3SX9A 1Y8YA 3FMNA 3VBWA 4ZS4A 3PXRA 1JKTA 1Y91A 2B55A 4ZSJA 5CXZA 4FG9A 5AP4A 3UOJA 2BDFA 2UUEA 2R3KA 5GHVA 1P2AA 4LMNA 1YI3A 5FUTA 2QC6A 3GCQA 4PMTA 1WBVA 4TZRA 2GNHA 4RFMA 4YJRA 3R71A 4RVMA 4I4FA 1PJKA 3MFTA 5CI6A 2VTHA 1A9UA 1LUFA 3DBCA 4J8NA 3S1HA 5IQDA 2VTNA 3CXWA 4FTCA 3KULA 3A7IA 2PMNX 2YIQA 2GU8A 3I79A 3G9LX 3OY1A 4XG9A 4FA2A 5K5NA 4U44A 2C3KA 2R3GA 4PMSA 2GTNA 2QOKA 5KO1A 4E20A 2BRGA 3QCSA 3VW6A 1GZKA 4AN3A 4YTFA 4QQ5A 2P33A 5ANJA 4D4RA 4EH8A 4U6RA 2IVTA 4F99A 2B54A 1REJA 1U54B 3FLWA 4FSUA 1JSTA 4M15A 4MXXA 4O0TA 5CAQA 3MGYA 3BPRA 1RE8A 2FGIA 2VX1A 4GIHA 5C26A 3E92A 1IASA 4NIFA 4CFWA 1G8SA 1H0WA 3NZ0A 4BKYA 4QQCA 3K5VA 4BN1A 4V04A 4QPSA 4RLKA 1OL7A 4WA9A 1FINA 1BYGA 5JGAA 4QMZA 2BAJA 1YXTA 4TRLA 4AE9A 3DTCA 4ANMA 1OIQA 4E26A 4XUFA 3U6HA 3LAUA 3WF8A 3PA4A 3RVGA 3ORPA 3NNVA 2G9XA 5LMAA 3ULIA 3V51A 4DN5A 4DA5A 4DTAA 5CNOA 3CS9A 5AA9A 3HX4A 5HE1A 1ZY5A 4FNYA 1OITA 2F7ZE 4GT4A 4XX9A 4CFMA 2H34A 1RJBA 3OY3A 5IMEA 3LE6A 2RG5A 2QOLA 1YHSA 4EH7A 1Q8UA 4YPDA 4IAFA 3MWUA 2ZDTA 5AR3A 5L2WA 4I6BA 3ZMMA 3E8EA 2YISA 4F7JA 3FC1X 4E6AA 4FKTA 4AGDA 4CRLA 3NW6A 1L3RE 4LOQA 4MK0A 3R8ZA 4O86A 5EI8A 4WOVA 1CM8A 5CX9A 3WOWA 2ITXA 4FKOA 3H9OA 1G8AA 4JBPA 1FPUA 4IM0A 4AZEA 4KAOA 3FXXA 2VGOA 4ZTMA 1JAMA 3TL8A 4JDJA 4QYEA 2XBJA 2WEVA 3QQGA 2R3IA 4BF2A 4JBOA 4ASDA 4BB4A 1QMZA 2H8HA 4H36A 5CEQA 3VHEA 4AZFA 3IOPA 3G90X 3D7TB 3DQXA 4C58A 3UOHA 5CU3A 4X3FC 5FP5A 1ZYJA 2RG6A 4FEUA 3UO6A 3PY0A 3U87A 3FSFA 1CKJA 2RFSA 3FLSA 3P86A 4MXCA 5E90A 4QNAA 4RZWA 3BYMA 5CZHA 4KA3A 2VWZA 4CQGA 4FK6A 3LCSA 3R7IA 4AOJA 5A46A 2UVYA 4UMRA 3TIYA 3UZPA 4AA0A 1OZ1A 4JG8A 3LFAA 3EN9A 3RAIA 2GHMA 3S0OA 4DE4A 5I9UA 5A4EA 2BPMA 3OWKA 4A9SA 4B4LA 4CKIA 5BYZA 2PVNA 3VVHA 1ZXEA 3GNIB 5E8XA 1LR4A 4FI1A 1CSNA 3UMWA 1BL7A 3VO3A 2W05A 4C34A 2ZVAA 4LGGA 2F7XE 3PVWA 2XNNA 4G34A 5AP3A 5EW8A 4X21A 4IFGA 3C13A 4CZTA 1Y6AA 4U41A 4JAIA 4ZSGA 3RALA 2EXEA 5LCJA 3BHTA 3CTJA 5LQFA 3VUDA 4BI2A 5HLPA 4BYJA 2GTMA 2UW3A 2W5HA 2ZB0A 4H39A 4J96A 3VUGA 2C69A 3PE1A 3KXNA 3TJCA 3SA0A 4ZMEA 2OH4A 4QYFA 3C4FA 2XB7A 3V5JA 3WZKA 4RRVA 3EQIA 4XG7A 2VAGA 3BHYA 2F9GA 5D11A 4PWNA 1BMKA 3MY5A 4GRBA 4V0GA 4IM2A 2UW5A 4HVGA 3O71A 4L9IA 1QPCA 2C30A 4NTTA 3R04A 4X2JA 4R1VA 4C2WA 2J7TA 2PE0A 3VUKA 3U55A 4O6LA 3MPAA 2XKDA 4F1MA 4KSPA 3PWDA 4GEOA 2IG7A 3V01A 3EFWA 4D55A 1OUYA 5BVOA 4FKQA 4OT6A 5EYCA 2I40A 4NTSA 3QYZA 5J8IA 3C9WA 5EK7A 1OMWA 4M69B 4YJSA 4C0TA 5JFWA 1STCE 3CKWA 3E3PA 4YLJA 1RQQA 4CKRA 2QKRA 4D2PA 2ITWA 3QUDA 4XJ0A 3H3CA 4ORKA 3LCKA 3N4VA 4G16A 4FGRA 3RCDA 2OJ9A 1Y57A 2BIKB 3CPBA 4KUJA 5KUPA 4ZZMA 3MH2A 4I93A 1Q41A 4FZ6A 3ZDUA 2G15A 4IIRA 3UNZA 4HGTA 2WELA 3B2TA 4EOIA 2ITTA 5JQ5A 3RPOA 4FV4A 2ZMCA 4C37A 3PLSA 3DDQA 3SOAA 4EZ5A 2RFEA 2QU5A 2WAJA 4L3PA 3DY7A 3AC3A 4YR8A 3AD4A 2WZJA 3P78A 3LQ5A 4JG7A 4PL3A 4A06A 3PPJA 3ZSHA 2XH5A 3E5AA 4UMPA 3QL8A 1MP8A 4IMYA 2ITQA 4PMMA 4NSTA 4YLKA 1FGIA 3ORMA 4GFMA 2WU6A 5CEOA 3LMGA 2YDIA 5J1WA 1WAKA 4IXPA 4IVBA 5CSVA 5AUWA 4IFCA 2LAVA 3I81A 3VBTA 4ASXA 4F70A 4EOKA 4RPVA 1NVSA 3ETAA 2XIKA 2UZUE 1DI8A 2VWWA 4ANOA 4BDEA 3FYKX 3IW6A 4QQTA 3O8TA 2WFYA 5HESA 3OT8A 5EM5A 3FKNA 4MXZA 3QC9A 3VS1A 2PZ5A 1XH5A 3G51A 4D28A 2IZTA 5LVMA 4XV1A 5M57A 4J8MA 2IVUA 3FHIA 1GZNA 4RJ6A 5E1SA 4FG8A 4LRMA 2QKWB 1PW2A 2QI8A 2YLFA 4M13A 2F57A 4OTWA 4PRJA 3EL8A 3GVUA 5C4LA 3OC1A 4I0TA 4YJNA 4JQEA 3VBQA 2ZAZA 4F9YA 2W1ZA 3SG8A 3KEXA 5JFXA 4GL9A 3SAYA 5HVJA 3LCOA 1XH9A 1S9IA 2Z02A 4DCEA 5LVOA 1BL6A 3ORIA 3OOGA 4O0XA 1LEWA 1TVOA 3F9NA 3BRBA 2R0IA 1JSVA 2W1GA 3E88A 3IOKA 1TQMA 2CMWA 3CY3A 3Q9ZA 1H27A 5EM7A 2HY0A 3MIYA 3PP1A 5JKGA 5K0XA 1IAJA 4HCUA 4NL0A 3MW1A 4P5ZA 5HG9A 2FUMA 2WMBA 4GJ3A 4S34A 4AN9A 4G3FA 4IC8A 3ATSA 5IQHA 3GFWA 2PPQA 2YJRA 3ERKA 4PPBA 4IWOA 3OEFX 5DRBA 3CSVA 5ANIA 5LMKC 2YJSA 3ORXA 5IH4A 3ID6C 3VF9A 2CN5A 3HV4A 4QTCA 1BUHA 4ZAUA 5HEZA 2JDSA 3DFCB 5HBEA 4JS8A 3WE8A 2I0HA 4C4EA 3L9PA 2VUWA 1V0OA 5EW9A 2GQSA 1U5RA 3R1SA 4R1YA 1YXUA 1ZWSA 4EQUA 4KB8A 3MPMA 3KGAA 4QMNA 1OL2A 5ACBC 5FRIA 2ITPA 4BBFA 3UQGA 4HVIA 3ZU7A 4CEGA 5KMMA 5EQYA 2GS6A 3KXXA 4YTIA 3DJ6A 3PXKA 4Y95A 3VS3A 4F4PA 1RW8A 2SRCA 5CVGA 4ZSLA 4ENXA 3PY3A 2VTRA 4IZYA 2Q0NA 5DFPA 3U9CA 2CJMA 4AW5A 5JFVA 2R3PA 2YCRA 4IANA 2RSVA 2YWPA 5DT3A 3RWQA 1Q62A 4ZZOA 4G2FA 1OM1A 4D1XA 5BYYA 3DNDA 2X6EA 3GU6A 5HBJA 4FE2A 4CV9A 4DHFA 5HCXA 4AZSA 2HW7A 5IEYA 2WIHA 4QPAA 3I5ZA 5ETAA 3C0IA 1CKIA 3MTFA 4JIAA 2QQ7A 1AGWA 1UWJA 4RG0A 2NRUA 1FVRA 3KF4A 3U4UA 4BBEA 4B8LA 3E7OA 1RDQE 4YHFA 3OUKA 3MFUA 4QP7A 4LMUA 1P14A 2UZEA 3I1AA 3TV7A 2IZRA 4BFMA 4EK8A 3C4WA 2HELA 3EQPA 4NFNA 3BLQA 3V5TA 4ACCA 3QRJA 3R83A 4AX8A 3LXKA 3ZSIA 2OXYA 4K9YA 4GU9A 3DXPA 4UMUA 3SDJA 4F0IA 2WTKC 4MWHA 2XNMA 5H3QA 5D9HA 4NIFB 5CU6A 1H1WA 2WEIA 4R5SA 3W1FA 1UKHA 2X8IA 4EH9A 2Y4IC 4C3RA 3RPYA 3WI6A 4JQ7A 4EWQA 4Y85A 3WF9A 2XKEA 4R3CA 3DBEA 4U45A 2ITUA 4FV1A 4BC6A 4ERKA 4I3ZA 4R7BA 3R01A 2Z7QA 3CGFA 4FVPA 4L3LA 1UU3A 3L8PA 2WNTA 3DU8A 4XOYA 3EFLA 3UYSA 2E9OA 4FNXA 4CV8A 1R3CA 4O0VA 4Z7GA 2XIYA 5IU2A 4L7FA 3SV0A 4HGSA 3PA3A 3RHXA 4CRSA 2WTJA 4TYHA 3UQCA 4NZWB 5A14A 2YHVA 2Y9QA 2HY81 3QGWA 4FYOA 1PXIA 3A7HA 2IW9A 3R02A 4FOBA 3II5A 1BKXA 2XJ0A 3W55A 2Y8OA 1YOJA 4N0SA 3QTSA 4QTDA 3WBLA 1KV1A 4QRCA 4CXAA 3HUCA 5E7RA 4CTCA 3R8PA 4DFXE 4F9AA 5LWMA 4X3FA 5AIKA 3PZEA 1YDRE 5BVNA 1QL6A 3DTWA 3VUIA 3HL7A 5FEDA 4EOJA 3MYGA 5IQEA 3DBQA 2BIYA 3QD2B 3ALOA 3UIBA 3RZFA 3ZYAA 4L45A 2O2UA 5J95A 1ZOHA 2JDRA 2O63A 4FT7A 4ZLZA 5E8TA 4L3JA 3UG1A 3V5QA 4QYGA 1TKIA 3Q2JA 2VWIA 5IQIA 2CPKE 3DK6A 4IX4A 4IZ7A 4TN6A 5FBOA 5JGDA 2PZIA 4I6HA 4NM0A 2W4KA 5CENA 4ALUA 5F95A 3DXQA 1NA7A 2XJ1A 4HPUE 2VTMA 4Z55A 3U6IA 2VGPA 3AMYA 3CD3A 3TUCA 3OTUA 3TZ8A 5E4HA 2BCJA 1DM2A 2OIQA 3PE2A 3QCXA 4O7ZA 4FSRA 1ZYSA 3HA8A 3EFKA 3I60A 2VX3A 3P1AA 4E4MA 4Q2AA 2DUVA 4MHAA 3IGOA 4OLIA 3LXPA 4J52A 5HQ0A 4H05A 2BZJA 4MXOA 3C7QA 4OT5A 1PMVA 2DS1A 3BWJA 2VTIA 1JOWB 4FUXA 3VS0A 5LVPA 4RJ3A 3RPRA 4EH4A 4DGLC 4X2NA 3VRZA 2ZM3A 4BL1A 5DWRA 4YU2A 5ANKA 3BYOA 2W1FA 3BCEA 1M7QA 2XA4A 2W7XA 4UX9A 1YW2A 3ZLWA 2YCFA 1YXVA 4FSQA 3D5XA 2R3HA 4L42A 4A9RA 3JR1A 3KXGA 2GNFA 4WNMA 3UJGA 1L8TA 2HZ0A 2CSNA 3JPVA 4CVAA 4YO4A 4GH2A 5HCZA 1M14A 2WTIA 3FPQA 4EZ3A 4TWOA 2F2UA 5JZNA 4ZJIA 3PIYA 4QP9A 1XJDA 2KTYA 4FKUA 2RFDA 4IACA 4TWNA 4Z9LA 5AWMA 1KWPA 4KS8A 4AOTA 4BCPA 4LM5A 5J5SA 3BYSA 4Z7HA 4V0GB 4LUDA 3ZFYA 3FV8A 3BGPA 3C0HA 1KE5A 4J98A 2HWPA 5DNRA 4LOPA 2J90A 2OFUA 1U4DA 3DKGA 3OFMA 4DTKA 3L9MA 1PXJA 1ZMWA 3Q6UA 4S32A 4BIBA 2UZOA 4XS2A 2R0UA 4YBJA 3FZOA 3TZ9A 3MY1A 5K0KA 2Q83A 2WOUA 3OWLA 3NPCA 4E8AA 3Q3BA 3BU3A 2VV9A 2F4JA 2Z2WA 4PQNA 3TKHA 4O82A 1M17A 2XNOA 3HMOA 2HZ4A 3R7VA 2BRMA 5AM7A 3DBDA 3NCGA 1WCCA 1OPLA 4HPTE 3RKBA 3WZUA 1UA2A 5M51A 1H8FA 3DPKA 4JX3A 3IW5A 2QHNA 4IH8A 3QTQA 5HGIA 3LQ8A 4Q5EA 2UW8A 2IZUA 3A62A 4PMPA 5IH5A 3SRVA 5GIPE 3ZCLA 5J9LA 2QODA 3L8VA 4JLCA 2BRNA 1OVEA 5IQCA 4HGEA 3KMWA 2R3MA 3ZRMA 3FC2A 4XP3A 3GXLA 2XUUA 4BHNA 5KZIA 2Z7SA 3E7VA 2VN9A 4FX3A 2JDVA 5CXHA 1OUKA 2OXXA 3KY2A 4PNKA 3VS4A 3AMBA 3KXHA 2QURA 3NUXA 2QR7A 4L44A 5ETFA 5C9CA 4G5PA 2HZNA 4F7NA 5LMBA 2IZSA 3G0EA 4AA4A 5L2IA 2PYWA 1U46A 2XK3A 1URCA 4PV0A 4O7RA 3HMMA 1WBSA 4IWPA 5KNJA 3H0YA 3V6RA 3F66A 2GCDA 4R5YA 1JBPE 1PMEA 4FF8A 4P5QA 4WRGA 5D1JA 5FTQA 3R8LA 3A7GA 4QYHA 5E1EA 4MXAA 2I6LA 3R21A 4BZNA 4EOPA 2JC6A 4AT5A 4DTBA 3HKOA 1IEPA 1YWNA 3FE3A 4FSTA 4W8DA 5DIAA 4IX3A 2JGZA 3NCZA 4OTHA 3GCPA 4QP3A 3M1SA 3ZC6A 4DEGA 1J3HA 4JL9A 4NFMA 3RWPA 4EZ7A 4NJDA 5L8KA 2C6IA 4NEUA 3TDVA 5HG5A 4JVGA 5DVRA 4AWIA 3W2QA 4O91A 4O7WA 2EB3A 3RBWA 3MY0A 4BCMA 3WIGA 3KREA 1VJYA 2WMWA 4O2PA 3IS5A 5JRQA 3FMLA 4GG5A 4ID7A 2EXMA 4AZVA 5L3AA 4QP2A 2XM9A 4UXLA 4BRXA 4FT5A 4CQEA 5AUVA 4W8EA 1XH6A 2UZNA 2UZTA 4UWBA 2QCSA 4BDFA 5BUIA 4J95A 4EK4A 3F6XA 5HE0A 5LMKA 1YHWA 3QTXA 3QQUA 3TCPA 5C01A 5M06A 3QHRA 4AS0A 1YOMA 4HZRA 4RX8A 5M55A 2G01A 4PP7A 5KBRA 3R1QA 2A27A 2VTAA 3V3VA 5JN2A 1T46A 3F5PA 4MQ2A 2PMIA 3SC1A 2HXLA 2VTJA 4E6DA 3OG7A 4F6WA 1ZZ2A 2UZWE 2UW6A 3PPKA 4L8MA 2XK8A 3OMVA 5CAPA 2IN6A 3HLLA 2XCHA 3K3IA 4O7LA 3L9NA 4BCQA 3W18A 3LQ3A 1R78A 3CCNA 3O7LD 4HJOA 4PNIA 4B0GA 3TUDA 3A4PA 4IAKA 5C8NA 2C0IA 2GMXA 4ALWA 4ANQA 2Z60A 3Q9XA 3A61A 3NUUA 4EOLA 2X8DA 4E1ZA 2CGWA 4B99A 3QZFA 2EUFB 3E64A 5FG8A 5DGZA 5BPYA 3FI3A 3I7BA 3LXLA 4RIOA 5HKMA 4KIKA 2PE2A 5AR2A 4QMPA 1YXSA 3FJQE 2BFYA 2YA9A 3HUBA 4JRNA 3F3ZA 3BZ3A 2UW7A 2WMUA 2Y7JA 5ACKA 4JNWA 3I7CA 4HYIA 3COIA 2WMXA 4C57A 2CHLA 3COMA 4ASEA 3QLFA 4YMJA 4BZDA 2E9NA 4M0YA 3LFDA 4ZLYA 3EHAA 3IDBA 3PXYA 3ITZA 3UP7A 2R3RA 5FM2A 3Q9YA 5BYLA 2YLEA 5F20A 3MVHA 4O38A 3BU5A 4Y8DA 4Y83A 3KRWA 4KIQA 2ITVA 5H8EA 3Q4ZA 3ROYA 5HX8A 5ITAA 4LGDA 2NP8A 5IQFA 3CBLA 4LG4A 4OTPA 4MD7E 3V5PA 1OKWA 1R1WA 3RZBA 4M0ZA 4XG3A 1B38A 2UZBA 3IG7A 3V8WA 2YM8A 4H58A 4TYIA 4XG6A 1ND4A 1YI6A 4C3FA 3NYXA 2YIYA 3UG2A 3EH9A 4FTAA 5CANA 1PMNA 2XIRA 4RX7A 2X9FA 5IA2A 4WD5A 1Q61A 3FMJA 3GP0A 1BX6A 4HOKA 4PP9A 4RC2A 2BUJA 4EHVA 4USFA 4O7NA 4D2RA 1YI4A 3SOCA 2A19B 4IX5A 1NVQA 5K4IA 4C4HA 2RF9A 1KOBA 3DV3A 4N4SA 5DRDA 4J71A 2ZB1A 3FXZA 2AUHA 2R2PA 4GK4A 2G1TA 4IM3A 3W2OA 2IVVA 3FLQA 2CNVA 3GC8A 4ACDA 5DEYA 5HG7A 1Q8WA 4QMVA 4YTHA 3WIKA 3TIZA 3QYWA 5DE2A 3G6HA 2WU7A 3H10A 3I4BA 3PIZA 4NH1A 3UP2A 2YCQA 1ZY4A 5AP7A 3P5KA 4B8MA 4TYHB 4ITHA 4ZJJA 2W17A 4BZOA 1KSWA 4ENYA 3HP2A 3MIAA 2FA2A 4ZZNA 3VUMA 1SVGA 5HTBA 4IDTA 5ETCA 4M97A 5GZAA 3G2FA 4CCBA 2CLXA 4QMQA 3QTIA 1FQ1B 2VO6A 2OJJA 2X6DA 3BLHA 4FV7A 4NM7A 4QP8A 4X3FB 3OF0A 2Y0AA 1ZAOA 2HXQA 4DBNA 1XWSA 3V5WA 4O7VA 1VEBA 2W1HA 3EQDA 2QOIA 3NW7A 3I0QA 3PJ2A 4C2VA 4O22A 3AT4A 4UZDA 1J1BA 3L1SA 3P23A 3U4WA 1PXPA 1PRYA 3NR9A 4O7YA 2J51A 2WQNA 4EI4A 4P2KA 2ACXA 3CTQA 4FV5A 2AC3A 3GU5A 3FZTA 5FD2A 1MRUA 1Q97A 3OD6X 1Z9XA 3QQKA 2JIVA 3F3TA 4EK3A 4JOAA 3ORLA 2BR1A 4R3RA 4RA4A 4E4LA 5AADA 3CQEA 1Z5MA 2YFXA 3QHWA 4FEQA 4M8TA 1PKGA 4OTDA 4A4LA 5CQWA 2XK6A 2YM4A 3Q9WA 4DITA 1H0VA 4WBBB 5HHWA 2RFNA 3QF9A 1KOAA 3W2PA 4DGNA 1W84A 2CKOA 3NS9A 1ZARA 4LL0A 4GFGA 2C5OA 4MBIA 2J0IA 2H9VA 4DFNA 2PVHA 1Z57A 3E3BX 4RSSA 2XBAA 3GOKA 1MRVA 1SYKA 4NKAA 3TNPC 3R9OA 3DLZA 4BWXA 4FEXA 4R77A 1DS5A 2C1BA 3LXNA 3SLSA 4NM3A 5A4TA 5FGKA 3F5GA 3FYJX 3L8XA 4EKKA 2ZMDA 5DYJA 4F9WA 4G6NA 2ZV2A 3Q6WA 5CTPA 4XLIA 5TOZA 2B9FA 3TN8A 5B2LA 5CT0A 3BE2A 1FOTA 4BVUA 4RJ8A 4GT5A 4USEA 4O0WA 4ANLA 4JI9A 4J99A 4C7TA 1PYEA 2C6EA 3C5UA 3V6SA 3CQUA 2NPQA 2PUIA 4UMTA 1URWA 2ZJWA 2P0CA 2VWVA 3OWPA 2ZM1A 3T3VA 4ZTQA 4AFJA 3GFEA 4I1ZA 2F49A 4FV8A 4NK9A 3I5NA 5D12A 5BVEA 4DEEA 1GOLA 4EHGA 1OKYA 3GCUA 5EDRA 5IA4A 5IF1A 2QO7A 4PPCA 3UQFA 3FMEA 2R3LA 4H1JA 3KRJA 4MVFA 1H07A 4CT2A 4YZ9A 4BDBA 1F0QA 3ZBFA 4FKRA 4PL5A 3KB7A 4FIJA 3ZXZA 4AW2A 3VUHA 2W1CA 4M7IA 1ZYCA 1GIJA 3GGFA 3HGKA 1UU7A 5FXRA 2OLCA 3ATTA 5H9BA 2YZAA 4TTHB 3BEAA 3OTVA 4RJ5A 2I7QA 2HYYA 3KF7A 2J0MB 4QMUA 3BV3A 3TJDA 3VBYA 3SRVB 4KINA 2C5VA 2YDJA 4FV3A 2AC5A 3C5IA 4DFZE 5A3XA 5DG5A 2GSFA 3UNKA 3ORNA 2ESMA 2OZOA 2VTQA 4I94A 4EWHA 3MA6A 4ZTSA 3KRRA 2X2MA 3R9HA 3EQHA 3FMHA 3R1YA 3UOKA 4U8ZA 3EZRA 4RA5A 5IA0A 3SG9A 4F0GA 4FV2A 4WT6A 5E8ZA 4GUBA 5CAOA 2XM8A 5E8VA 1YWVA 3KN6A 3HV7A 3ZZWA 5F1ZA 4PDYA 3N4UA 4NW6A 4ZP5A 5F4NA 3ORKA 4BDAA 2EVAA 5I9VA 2C1AA 4RZVA 1XH8A 3LMIA 3REPA 3COKA 4EC8A 1LPUA 1V1KA 4WIHA 4B7TA 3R7GA 5K4JA 5L2QA 3O7LB 3NAYA 4E6CA 4F65A 4GIIA 4OAUC 3AT2A 5T3QA 4L43A 3ALNA 4FV0A 5HORA 4BCHA 2ONLC 1WBPA 5EI2A 4CFNA 3LCTA 3VBXA 5EKNA 5EHYA 2OSCA 4RIXA 5IZFA 5CU0A 2WQBA 4KKGA 2XNBA 3S3IA 3BEGA 5CQUA 2ERZE 3F2RA 1E1VA 4LQMA 3UTOA 3HMNA 3QZIA 5BQ0A 3PRFA 4C62A 3I6UA 3ZLXA 4YURA 3MH1A 1OKVA 1X8BA 2G2FA 4XLVA 1W8CA 2Z8CA 3PRIA 4RX5A 1V0BA 5EYMA 4L7SA 3BE9A 4M3QA 3DJ5A 4DT9A 4GVAA 4W4WA 5CSXA 2JKQA 5HNIX 3TT0A 1TQIA 4IW0A 4CGAA 3GUBA 4ALVA 3ULZA 3QQJA 1WBNA 5FXSA 3WF6A 3PDTA 2B7AA 1H01A 2BDJA 3C4ZA 1H4LA 1P4FA 3CC6A 3R1NA 4K6ZA 4QMXA 5AV4A 4DFUA 4MQ1A 3RTPA 4CZUA 4QMSA 4I5HA 4LRJA 4UV0A 4UB7A 5IEVA 3VF8A 1U5QA 1JPAA 4EH2A 1Q3WA 2QOHA 4QTEA 1XQZA 4YJUA 5HO6A 4ZK5A 1OB3A 5TT7A 4ZMFA 4XYFA 3CKXA 3FLZA 3HEGA 1CTPE 4APCA 1JQHA 3EQRA 4BDIA 2XRUA 3EKNA 4BTMA 3DGKA 4RIWA 3FI2A 4E4NA 4DLJA 4Q9ZA 4WSQA 3AC5A 4MNEA 3KFAA 2CGVA 3T9IA 4S33A 5LJJA 4S31A 3QA8A 3KK8A 3MTLA 4BBMA 5GZ8A 3ZM4A 4O0UA 2IJMA 2OIDA 3QTUA 4FUYA 5LVLA 4FODA 3G9NA 3HAMA 3CIKA 3LM0A 4YUQA 4KIKB 2RKUA 3UOLA 4WHZA 2PUNA 4AF3A 4C61A 1H28A 4QO9A 2YIXA 2OI4X 2OK1A 1R0EA 1Q4LA 2WQOA 3FLNC 5AUYA 3FMMA 3R7EA 4DEDA 2C6MA 3W2CA 1APME 4O2ZA 1VZOA 4KBAA 2BRHA 3EKKA 3A4OX 1UU9A 3UYTA 1GIIA 3S2PA 3P7AA 5HNBA 4PL4A 3UNJA 2W4JA 2WTKB 4XRJA 3SQQA 3VBVA 2GHGA 5CAUA 4FL3A 4FR4A 2J5EA 5CVFA 5DR9A 1K2PA 5IA3A 3UC3A 3NW5A 4FVRA 2Y4IB 4LUEA 4QMOA 4CFUA 5B0XA 4RMZA 4DEIA 4ZTHA 2VRXA 3FPMA 5E8UA 4IC7A 4YTCA 3CP9A 3DDPA 2JKOA 4M14A 3SW7A 4U0IA 3BHHA 3COHA 1O6LA 2UW4A 1JLUE 5M4FA 2X2LA 2C0OA 5AX3A 5M4UA 5G6VA 1UNLA 1UU8A 4JQ8A 2JKMA 4FK3A 4BHZA 5I5ZA 4GK2A 3MVMA 3VULA 4CD0A 5EYDA 4ASZA 3LJ2A 2FYSA 5EI6A 4EOMA 5FBNC 3F3VA 4ONAA 2VNYA 4EH6A 2BFXA 3LJ0A 4Q5HA 1MUOA 3WARA 3B8QA 4EBVA 4LRKA 2XK4A 2HOGA 1Y6BA 2PZYA 3QUPA 3WZDA 2EWAA 2P3GX 2QOFA 3C50A 3FXWA 5GJGA 2EU9A 4G31A 4BIDA 3VC4A 5AM6A 3A8WA 4GV1A 5KMKA 2W5BA 4FVQA 3R6XA 3K54A 4QMLA 4N57A 4JX7A 4QD6A 3C51A 5KKRC 3PLAE 4HVDA 5M07A 4K0YA 1BLXA 1I44A 3P0MA 1IR3A 4DG2E 3PJ8A 4MBLA 4BCGA 1JKLA 2CKPA 1PKDA 4U7ZA 4D5HA 5FWKK 4TKSA 3FL4A 1J91A 2PVKA 2ITZA 4GYGA 3AQVA 4I5PA 2PZRA 5G1XA 4I6FA 3ZDIA 3O23A 5AV0A 4AU8A 4FSNA 3TV6A 4E4XA 1IA9A 1SZMA 2VTSA 2OWBA 3UIUA 1YWRA 3GCSA 4BDHA 2C6TA 3HRCA 4D1ZA 1GY3A 4HYSA 4PPAA 3ZSGA 2PVFA 3E8DA 4FG7A 1NXKA 2GS7A 4V01A 3NGAA 1FMKA 3N51A 4WNOA 2FSMX 3RAHA 3VS5A 4YSJA 4UBAA 3MPTA 3OP5A 4JXFA 3JVSA 1KE8A 3W2SA 3LFQA 1SVHA 4BWKA 2XJ2A 3QD0A 5IG1A 2PTKA 3EJ1A 4IJ9A 5DR2A 5ANGA 3UZTA 4AGWA 1W83A 3DKOA 4Z3VA 4W4VA 3NAXA 5FEEA 2XKCA 5CI7A 2OG8A 4P90A 4V05A 2X7GA 3NMUF 4BCIA 2R5TA 2PMOX 1Y8GA 3R9NA 3ZS5A 5KX8A 4CKJA 5CEPA 1W7HA 2P2HA 3F88A 3A2CA 4O0SA 4PDSA 5FDPA 1NVRA 3C1XA 3R73A 2PWLA 4QP1A 4RQKA 1LP4A 1IAHA 2CCHA 1WZYA 5A54A 4U79A 4AOIA 5EKOA 3H9RA 2V5QA 3QRIA 3LW0A 3R2BA 3W2RA 1TQPA 4OAVB 2P55A 4BGHA 2XRWA 4YC6A 3PUPA 3FI4A 4YZMA 2C6DA 4DFLA 3HP5A 2CKQA 4JT3A 1UV5A 5B2KA 2OF2A 4OR5A 4C38A 2C6OA 4MWIA 2GNJA 4X3JA 5CAVA 3PG3A 4YSMA 5ETIA 3IGGA 1KE6A 4FTOA 2QLUA 5EYKA 2PU8A 4LYNA 1XBBA 2PUPA 3HMIA 2ZYBA 2OFVA 4GYIA 1ZOEA 5K9IA 2C3LA 3MFSA 3HZTA 4IDVA 4JR3A 1MQBA 5EHOA 5KZ0A 3FI8A 4YBKA 3ZFXA 4WKQA 2VTOA 5CF5A 5CY3A 3NUPA 4JAJA 4MTAA 1SNXA 3B8RA 4TNDA 3ZH8A 4L52A 3ZHPC 3BU6A 4BCJA 2B53A 4O81A 4K77A 4DINA 4NKSA 5GINE 1CKPA 4FTLA 4ACHA 4GS6A 5DN3A 4NCTC 4TYEA 2QD9A 3PSCA 5AEPA 1KV2A 5IKWA 4CG9A 3QKLA 3UIXA 4F7SA 4BI1A 3ZBXA 1PF8A 2V62A 5CSPA 4RWKA 4YZNA 1ZOGA 1IA8A 5I0BA 4FT3A 4O0YA 4GKHA 3RMFA 2B1PA 3OXIA 3R9RA 2R3JA 5I9XA 4FKIA 3PP0A 4YZDA 5E9EA 2XIZA 1E9HA 4FZ7A 3LIJA 5DR6A 3OCGA 2YCSA 3R7UA 3PSDA 4FTKA 5EFQA 2O65A 3K5UA 2AYPA 4EYMA 2QONA 3EQBA 2I0EA 4XOZA 2ONLA 5CU2A 4EBWA 1H1PA 5JH6A 5JQ8A 2FO0A 3LHJA 1CMKE 4AN2A 2GQRA 3U6JA 2J9MA 3QCQA 3WYXA 4D9TA 3CE3A 5HTIA 5KMJA 2O3PA 3F61A 1GIHA 4ITJA 1OIUA 4QMYA 2YERA 3O50A 4UYAA 4O84A 4DG3E 2E9VA 4TYJA 4YJVA 5EG3A 3KRXA 3TACA 3N4TA 3PA5A 5AR8A 3VQUA 5HD4A 2O5KA 4Y5QA 4UALA 4C4GA 4ARKA 4AW0A 4DAWA 1H25A 4TYGA 4HNFA 3F5XA 3RCJA 4AT3A 3OCSA 1F5QA 2A1AB 4QTAA 4BIEA 3PSBA 4F09A 4RIXB 3EQFA 4I22A 2C6LA 3KRLA 2E2BA 4RJ7A 5AR7A 4BGQA 3IPHA 4F6SA 5A4LA 3OUNB 3LFEA 1KE7A 1QPJA 5KE0A 5HU3A 4FTJA 5M53A 4C8BA 2PUUA 3IECA 3G5DA 4O7SA 3HDMA 4CG8A 1JVPP 4DGOA 4L68A 2G2HA 4E6QA 2YIRA 3E8CA 2NO3A 2RIOA 2O0UA 2EB2A 3F5UA 3QXOA 4BCFA 3DAKA 1GJOA 3ET7A 3C0GA 3ODZX 4UEUA 5DI1A 4ZY4A 3WZEA 2CNUA 2R3QA 3EL7A 3QRKA 4EEVA 3NYOA 3AG9A 2GNGA 3JUHA 5ICPA 2VNWA 4O1PA 4R78A 3AGLA 4EH5A 2VO0A 2BRBA 2WMTA 5HLNA 3GU8A 1JSUA 3JVRA 5C1QB 3P08A 4L6QA 1VYZA 2V22A 5IQGA 1H08A 3MJ1A 5HIDA 3MI9A 3N9XA 3VUTA 2XIXA 3F2NA 4FKWA 4OUCA 4ZLOA 2C6KA 1BI8A 2UZLA 2OZAA 4I92A 4P4CA 2WMQA 5E92A 1UNHA 1YXXA 1GZOA 3DBFA 3KK9A 3LLTA 4W9WA 2XYNA 3UPXA 5L2SA 3TZMA 3PZHA 4X6RA 3B2WA 4RIWB 1ZYLA 4KIOA 4OTIA 4U81A 4MNEB 1PXLA 1REKA 3CJFA 4ZTRA 4OTRA 4DT8A 3NNUA 3TV4A 3HVCA 4FKGA 3ENHA 4C4IA 3MB6A 4E73A 3Q4UA 3NVKI 2WMAA 3FY0A 4G3DA 3ACJA 1LEZA 3MBLA 3RK5A 4X6QC 4IAAA 3UVQA 4YHJA 4Z16A 3OXTA 2OO8X 4O7TA 5H2UA 2W5AA 4XG2A 3ZO3A 4MEDA 3IDPA 4RC3A 2A0CX 1R0PA 3DNEA 4Y73A 4YZBA 1P4OA 5CZIA 3TI1A 4G3EA 4F7LA 1V0PA 1BI7A 4IAYA 2FSLX 4DFBA 2YZLA 3UMXA 1VYWA 3TTJA 4DEHA 3Q2MA 2IWIA 3WF5A 4FBXA 5I9YA 2BTRA 2YIWA 2BZHB 2WPAA 5CVHA 5LCKA 3HYHA 4MH7A 2V0DA 5LOHA 1K3AA 2WTCA 3PVUA 4D2SA 2HENA 1XHAA 3E87A 4GFOA 3G0FA 4M66A 4XV9A 3VAPA 3FDNA 2ZV8A 2FVDA 5BUEA 1WVXA 2WB8A 5BVWA 5H8GA 4O83A 4CFXA 2P4IA 4WRSA 3UO5A 3LFBA 4YJQA 4TXCA 5A6OA 5LWNA 2PSQA 4OTQA 5FXQA 3OZ6A 2Y4PA 4JDIA 4FKPA 3QUEA 4MF1A 2XZSA 3RP9A 5F94A 2XCKA 4GMYA 3D5WA 3K3JA 4ANNA 5HX6A 4LV8A 1HCKA 4TL0A 3D9VA 2VU3A 4AQCA 3QD3A 3FMKA 3NUYA 4TWCA 4U9AA 4AT4A 4W4YA 3UBDA 2ZV9A 3MB7A 2R3OA 2CGUA 1YRPA 2B9HA 3EQGA 2X7FA 2BKZA 4JBVA 4PY1A 4IB1A 5KCVA 1UNGA 4HVSA 3QGYA 4FKJA 4OTGA 2ZOQA 3QLGA 4UYNA 2GS2A 3QD4A 4C4JA 3EN7A 4RQVA 4UMQA 4LV5A 2PULA 1ZYDA 1XH4A 3NNXA 3LFSA 2C5NA 2CKEA 3PWYA 3SD0A 1XBCA 2V7OA 4IAZA 1HOWA 4XCUA 1OBDA 4II5A 3T9TA 3R2YA 4KKHA 1SMHA 3UVRA 1P5EA 4LFIA 4RLLA 4U80A 5CT7A 3UPZA 4CLIA 4MYGA 3CTHA 2W0JA 2X0GA 2WTWA 4FIFA 3SXRA 3DS6A 4IWQA 2GPHA 3ENMA 3O96A 5GNKA 5AUXA 4E5BA 4RIYA 5BVKA 5BMMA 4NYEA 5CSWA 4Q9SA 1G5SA 4DBXA 5HLWA 1XR1A 2HK5A 2QVSE 2WQMA 3A7JA 4KBCA 4O0RA 4QPMA 5HOAA 5JRSA 1DAYA 3PXQA 3UC4A 4FT9A 5AUUA 1G3NA 2QO2A 3GT8A 4IVAA 2IO6A 2W1IA 3VIDA 3HAVA 3KL8A 3EN6A 2WIPA 3NUNA 1F3MC 3ANQA 1PY5A 2XNPA 5B7VA 5IQAA 5AUZA 3OXZA 1ZMVA 2OICA 3RNIA 1NT2A 3NRMA 3BKBA 4XP0A 4I5MA 2PVLA 2R3FA 3RK7A 4DC2A 1PXOA 4WNPA 4C36A 2VWXA 2WMRA 4FNWA 3E8NA 3R7OA 4FSZA 1Q5KA 3OS3A 3CD8A 4AG8A 4MF0A 1JWHA 4F63A 4EUUA 2JDTA 4CNHA 2B4SB 2X39A 3F7ZA 1FBNA 3DZQA 3QTWA 4C02A 3E63A 2H96A 4DFYA 1ATPE 3IQ7A 4ANBA 4WG3A 5AIRA 4UWCA 2YACA 4QNYA 5JFSA 2X4ZA 4QMMA 4U3ZA 5HIEA 3TWJA 4YLLA 4GT3A 4BYIA 3MJ2A 2YM7A 2W4OA 4XG4A 3TUBA 3HRFA 5IISA 3VS2A 5CSHA 3ZTXA 2WGJA 3HECA 4YC3A 3KMMA 2VWYA 5KMOA 3PIXA 4GW8A 3HV6A 4A4OA 5ANEA 4BDJA 3TG1A 4YPSA 2J2IB 3UZRA 2X9EA 3ANRA 3D94A 4NCTA 3NUAA 5L2TA 3HMPA 3FBVA 3BYVA 4N6YA 2XK9A 3CQWA 1DI9A 3R0TA 3LPBA 4I24A 4HNIA 3KCFA 4YZCA 4CMOA 4ZTLA 5AMNA 2WMVA 3RI1A 1J7LA 2B9IA 4G17A 3IW7A 5EH0A 4GG7A 2XK7A 5AV2A 5C03A 3BLRA 4C35A 1ZRZA 2ZM4A 4RGJA 3S95A 1T45A 4HCVA 1PMUA 3AC8A 1M2PA 3A8XA 5CALA 3P9JA 3PJCA 4ZTNA 3ZO2A 3QXPA 3O8PA 1VR2A 3QKMA 4ZY6A 3QWJA 4UZHA 4E5WA 3PG1A 1PXMA 5HE3A 4EC9A 3DB8A 1SVEA 2JFLA 2RGPA 4DYMA 3D5VA 3VRYA 2XVDA 4NW5A 4GKIA 5E8WA 1OL1A 2PVYA 5HNGA 1MRYA 1XBAA 4EOQA 4AXAA 5HIBA 2IVSA 3DXNA 3OROA 4I0SA 4N6ZA 4UWYA 5A4QA 4I41A 3CGOA 5IA1A 4FIIA 3KN5A 4DLIA 3NIEA 4YNOA 3TNIA 4P7EA 4WG5A 5CWZA 2VWUA 3U54A 2R7BA 2OJFE 3AD5A 3R8UA 4F6UA 1H1RA 2JITA 3RM6A 4C4FA 2JIUA 2QOQA 3VHKA 4HGLA 4XEYA 3FQSA 1OL6A 5HG8A 1OPJA 4FNZA 4MNFA 1XO2B 4EL9A 4H1MA 2PL0A 3AD6A 2GNLA 3VJOA 3F2AA 5J1VA 2X2KA 3NVMB 4NJ3A 3HV5A 4KWPA 5BMSA 5HI2A 5FTGA 3QBNA 5DHJA 4OBQA 3A60A 3FUPA 4I21A 4F9CA 4OGRA 5AV1A 2F7EE 5J87A 4ZSAA 3TZ7A 2JFMA 3ZEPA 2W06A 4I4EA 3EN4A 4QMWA 3QKKA 4QOXA 3E93A 4D4YA 2UW0A 2VO7A 2VX0A 3D7ZA 4U97A 5EM8A 3EZVA 1AQ1A 5GJFA 3NDMA 3OW4A 2UW9A 1OBGA 2C5YA 2F2CB 4FV6A 4BDCA 4BR3A 2A2AA 4RC4A 4X2GA 4U3YA 3W10A 4L01A 4WUAA 2PE1A 1HCLA 4EOSA
chains in the Genus database with same CATH superfamily
4IB0A 3FMDA 4AAAA 3G15A 5HO8A 3BBTB 3KCKA 2ZV7A 2X4FA 2BILB 4HZSA 2LGCA 2BTSA 2O64A 4FMQA 5CYIA 3MS9A 2CDZA 2BROA 3GU7A 3ZFMA 4GCJA 5LARA 4FTMA 2XMYA 4BDDA 4EYJA 5HZNA 2EXCX 2J0JA 4N70A 2YWVA 2VO3A 2YITA 4GU6A 4J97A 1JKSA 1FMOE 4JJRA 3OW3A 5T6KA 4E5AX 3PJ3A 4DG0E 3V04A 4KRCA 3D4QA 3JYAA 4IB5A 4WNKA 5FTOA 3SW4A 1GAGA 2OZAB 1SNUA 3KXMA 4IZAA 5AUTA 5DH3A 5HVYA 3ZLSA 3Q4TA 2NNWB 4EKLA 5BX0A 2PVJA 3R22A 3VS7A 3QQFA 5AA8A 1IRKA 2BZIB 4XNEA 4WO5A 4FJVA 2WOTA 1YHVA 5DLSA 3MFRA 4CMTA 3E62A 1CDKA 2ZDUA 1O6YA 1W82A 3IW8A 3MSSA 5L6PA 3DQWA 5C8MA 4FTRA 3KXZA 1QCFA 3HA6A 4TPTA 2ETRA 4YJOA 4ZSEA 3SKCA 4IVCA 3RGFA 3GC9A 4OTFA 3ZC5A 3FZ1A 2VD5A 3AC1A 5JT2A 4DH5A 4K33A 5FLFA 4L46A 4BTJA 4Y46A 4X2KA 1H00A 3QTRA 3H0ZA 4E3CA 3HRBA 4FSYA 4YJTA 3R8MA 1OL5A 3CY2A 3BGZA 2Y6MA 4FC0A 2WHBA 3DFAA 4X0MA 5EHLA 3U8WA 3VS6A 3EMGA 3IO7A 5I3OA 3W16A 3ACKA 5CU4A 3BHVA 3IKAA 4G1WA 1H26A 3RK9A 5HO7A 3F82A 3POZA 3P7BA 4DHZA 3FQEA 4A9TA 3T8OA 5KHXA 4CFFA 3PVBA 3C4CA 4FZFB 5AP2A 3IK3A 3QAME 2BZKB 3JY0A 4YC8A 5AJQA 3BELA 4M68A 3Q04A 3VONA 1OKZA 3MH0A 4DH7A 4R7IA 4ZS0A 1J7IA 2DQ7X 2HWOA 5DT4A 4BKJA 2OKRA 1I09A 4FTTA 4FZDB 4RWIA 4X7QA 5D10A 3NWWA 5E91A 3ZZEA 4D0XA 4K11A 4F9BA 4CLJA 1H1QA 3AKKA 5HD7A 2GFCA 3OWJA 1UKIA 3NYNA 3Q5IA 4A9UA 3Q5ZA 3W33A 1YDSE 3TEIA 5KKRB 4FGBA 4CYJA 5HTCA 4LL5A 2CNQA 4MCVA 5J9YA 5A4CA 2YEXA 3VQHA 2XARA 5DPVA 2OXDA 4XV3A 5BV3A 3K2LA 3QQLA 4HYHA 5IA5A 3TNWA 4IJPA 4DGMA 3ZM9A 2R7IA 3BI6A 2YABA 3PXZA 4NU1A 5T68A 3ZOSA 4R6VA 2CN8A 2JAMA 3UE4A 4IAIA 3RPSA 1M2RA 4AW1A 4I6QA 3R9DA 4BCOA 5IEXA 3LKMA 3VJNA 1NW1A 3QWKA 3R00A 3EYGA 3ZRLA 3EQCA 2QLQA 3SGCA 2W99B 3JY9A 3ZUUA 2JEDA 1B39A 4UXQA 4Y72A 1WFCA 4BWPA 5IUGA 4ACGA 4DH8A 4EQCA 3DK3A 3D2KA 2OU7A 5CS6A 3TTIA 5TF9A 3ORTA 1EH4A 5JEBA 4MX9A 5H8BA 4FL2A 2J5FA 4XRLA 5M4IA 3NIZA 2B9JA 2YM5A 3O5AA 3FZPA 4OW8A 5AP0A 4RIYB 2WTDA 3KVWA 2G2IA 4FSWA 1KUTA 2J0LA 3SXFA 3P79A 1GNGA 2PVRA 3PFYA 5CF6A 3MESA 4ZXTA 3AC4A 4D2VA 2X0PA 2VWBA 3D0EA 5I9ZA 1JNKA 1G8KA 2GNIA 4XBRA 4D0WA 2ITOA 3KKVA 2UVXA 4YNEA 1O6KA 4G9CA 5TO8A 5KBQA 1OI9A 4BTKA 4K18A 4U5JA 2J50A 4FZAB 5TE0A 3NX8A 2W9ZB 5DA3A 1OECA 2ERKA 5L6WL 2OH0E 2WKMA 5GIOE 3RINA 2CGXA 3DAJA 3PPZA 2XEYA 3BHUA 5E8SA 3QQHA 4XMOA 2HAKA 3MH3A 2A4LA 2W1EA 4RVKA 3KQ7A 1XH7A 4TT7A 5IDNA 4GK3A 3NNWA 1FVVA 2QNJA 4S2ZA 3ROCA 2XNGA 2FB8A 3TM0A 4UN0C 1AD5A 2BMCA 5FDXA 2V7AA 4JDHA 4F1TA 4XBUA 4G3GA 4IBMA 3EYHA 5DOSA 1YOLA 5K3YA 2E9PA 3MA3A 2DYLA 2R4BA 1B6CB 3O2MA 3O8UA 4KSQA 5M09A 3UIMA 5I9WA 2VTLA 3DT1A 3LZBA 4KKEA 4EUTA 3L8SA 4I23A 1QPDA 3MN3A 5IMXA 3A99A 3OEZA 4QT1A 4FIEA 3UDBA 4E7WA 5M56A 5EOBA 5IH6A 4JBQA 2XS0A 3UGCA 2OGVA 2C3JA 2VTPA 3HDNA 3O51A 4PTGA 4QMTA 3Q60A 3QA0A 3NUSA 5AP5A 1NY3A 2PHKA 4FOCA 5AR5A 4D4VA 2REIA 1GZ8A 4D2WA 4FV9A 2OJGA 5CNNA 3ZRKA 4D2TA 4OBOA 4FTUA 4YO6A 2RL5A 3DZOA 2HCKA 3D2IA 3FL5A 2JAVA 3KULB 2C4GA 2R9SA 3GENA 3Q4CA 4B9DA 2J0KA 5DBXA 1A48A 2JLDA 4LI5A 5D7VA 3BL7A 4MXYA 2I0YA 2OJIA 4RFZA 2JDOA 2BDWA 5CEIA 4KD1A 4CTBA 4AACA 2FH9A 3DA6A 3VN9A 5FM3A 4I0RA 4DCAA 3KU2A 3WYYA 5GJDA 3ELJA 3O0GA 3S4QA 3V8SA 1M52A 3W32A 4G9RA 3QU0A 1PYXA 5LXMA 4AE6A 4A4XA 3KMUA 4JRVA 2ETMA 4L53A 2QU6A 4WSYA 4ZIMA 5BNJA 3F7WA 4IEBA 4G5JA 1Q3DA 4O6EA 2BHEA 4BDGA 2OW3A 3CJGA 4QP6A 1SM2A 1E1XA 3OBJA 3GQIA 3RAKA 2X7OA 3PYYA 2AEGA 3KVXA 4AUAA 5M08A 3OBGA 5CLPA 5ANOA 4IVDA 2J6MA 4JDKA 3HV3A 2XYUA 4RWJA 4Y5HA 3VNTA 4EQMA 5CEMA 3AOXA 5F9EA 5L6OA 2OF4A 3D83A 3RHKA 3LFCA 3TKUA 5KMNA 4PDPA 3D5UA 2CLQA 5ANDA 2VZ6A 4XV2A 1ZZLA 2WQEA 3PY1A 3FWQA 3AT3A 5IUIA 2BAKA 5J7BA 3WF7A 4CCUA 1OIRA 1R39A 3GQLA 4GUEA 3FHRA 4CMUA 3JXWA 4R8QA 3R8VA 4AGUA 4EK6A 1FGKA 3UVPA 4H3PA 5EDQA 1UVRA 1WVYA 3DOGA 2ITYA 2C68A 5KMLA 2GQGA 1G8JA 5AV3A 4QTBA 5TR6A 3AKJA 4HCTA 3AXWA 4AZTA 2PMLX 2WTVA 5C27A 3RNYA 2WMSA 5HE2A 3H9FA 4RFYA 2QHMA 1K9AA 3FLYA 3QALE 4CSVA 2XAOA 3M11A 5DMZA 3MVLA 4QYYA 3W0OA 3CEKA 3M42A 4NM5A 2YAAA 3DKCA 3LOKA 1WBTA 3LFNA 5JK3A 3QFVA 2HIWA 3IW4A 4QDVA 4HYUA 1U54A 3BBWA 3FY2A 3UODA 5I4NA 3UDTA 1WBWA 3R7YA 5HU9A 5EQPA 4G6OA 3BX5A 4FSMA 4R7HA 3PVGA 2P2IA 3QZHA 3GEQA 3V5LA 4MD8E 4K1BA 4PX6A 4S30A 4EHZA 5HBHA 1O9UA 3L9LA 2PZPA 4WBOA 4ZEGA 1PXNA 2OIBA 3F69A 4M67A 3S00A 1M7NA 1ZLTA 3GCVA 4FKVA 4IQ6A 3W8LA 5L4QA 4IHPA 1W0XC 5A9UA 4KRDA 4U43A 4BY9E 2I1MA 2BAQA 3ZONA 4AA5A 3DKFA 4RWLA 4A07A 2OBJA 2XNEA 4EHEA 2FSOX 3BQCA 3PJ1A 5TKDA 2Z7LA 4NT4A 4YJPA 4A9YA 4MBJA 1WBOA 2JKKA 3LFFA 4KABA 4YP8A 3FAAA 4YGAA 3RAWA 1XMMA 4C33A 4OBPA 5M44A 3AMAA 5CF8A 3RJCA 4TNBA 3QCYA 3DK7A 3G33A 3SXSA 4PF4A 4BICA 2J4ZA 3GU4A 3R63A 5IDPA 4IWDA 3R30A 5AX9A 4AFEA 3EN5A 4W4XA 4KS7A 4FIGA 3OVVA 5B2MA 2WD1A 3P4KA 3FKOA 4RJ4A 4PUZA 4F0FA 5JSMA 2NRYA 3QZGA 4JG6A 5KMIA 3LVPA 1XKKA 5CF4A 2C47A 3DJ7A 2VTTA 3QRTA 4DEAA 4F08A 2B0QA 3NLBA 4C3PA 3ZO4A 4ERWA 4RVTA 4QP4A 3D14A 4A7CA 4CZYB 3CPCA 5AAGA 5BUJA 2UV2A 1FVTA 4K2RA 1WMKA 2PK9A 2XF0A 4JR7A 4BKZA 4FTNA 2I0VA 3Q96A 4ZOGA 5FEQA 4KNBA 3ZO1A 2BKKA 3D7TA 4FTIA 3FKLA 4FKSA 3GB2A 2R3NA 3GC0A 4R3PA 2QR8A 4WUNA 4HVHA 5J79A 3GBZA 5FP6A 2W1DA 4ITIA 2HZIA 3FEGA 4ANSA 4XH6A 3QC4A 4G3CA 3NYVA 4FKLA 3RPVA 4DF3A 5EDPA 4FICA 1J7UA 3GOPA 3M2WA 4FYNA 4KBKA 4DH1A 5DEWA 5A6NA 1OIYA 4CYIA 4I5CA 4D4SA 3G6GA 5AP6A 4BTFA 4M84A 2X81A 2HW6A 3HNGA 3THBA 3ZLYA 1M2QA 4ACMA 3NEWA 4EK5A 1OGUA 3PXFA 3GC7A 4MKCA 4BCKA 4NUSA 3O17A 3AC2A 2QOCA 3QX2A 5CEKA 3C4EA 4IZ5A 3ZXTA 3BV2A 4DEBA 3SHEA 4O96A 4GVJA 2UZVA 3QRUA 3U9NA 1PXKA 3ZUTA 4EOOA 4X2FA 4O1OA 3WILA 3H4JA 2BALA 3DB6A 3EWHA 3KC3A 4J53A 4CT1A 4D1SA 5JGBA 3LMHA 1IG1A 2BHHA 3BWFA 3BGQA 4XHKB 5JMSA 1YQJA 1QPEA 2IW6A 5K5XA 5EQEA 2C0TA 3GI3A 1MQ4A 4KIPA 4USDA 5IUHA 2QO9A 3P5JC 5D41A 2UZDA 5J9ZA 5LVNA 3F3WA 1KE9A 2PVMA 2QOBA 5D7AA 3TXOA 2QG7A 5AR4A 3WE4A 4EONA 4LOOA 4M12A 5L8LA 5EW3A 4EJNA 5M4CA 5IQBA 2E9UA 2GHLA 4M69A 2YAKA 2YM3A 2Z7RA 2R64A 4PTCA 5FQDC 3EOCA 1OPKA 3PFQA 2KULA 4C59A 4F78A 3AGMA 2YDKA 3Q52A 4RX9A 2YN8A 3R28A 3FQHA 5AAEA 3TDWA 2CCIA 4O21A 4B6LA 4PDOA 1Q8YA 1YDTE 3NSZA 4H3QA 4FL1A 4H3BA 4EJ7A 4GSBA 3D15A 4D58A 2C3IB 3LLAA 2WXVA 4K8AA 3I6WA 4MD9E 3TKIA 5JZJA 3V8TA 5BVDA 4IB3A 2W96B 4PTEA 2Q0BA 5HCYA 3WZJA 4EH3A 4O27B 5EM6A 5C4KA 5AFVA 2W9FB 1YVJA 4AZWA 3VWAA 4FIHA 4CFVA 2GDOA 1H1SA 3FZSA 5HVKA 2FSTX 4APPA 4WG4A 5C8KA 2X1NA 3EB0A 3MVJA 4IADA 5E8YA 4J7BA 5L8JA 2H6DA 3FSKA 4DH3A 3OCBA 3U51A 1UWHA 2B52A 1Q99A 3JS2A 3Q53A 3CR0A 3ORZA 2XKFA 4U40A 5HICA 4EORA 3T3UA 3I0OA 5J7HA 4FEVA 3ZEWA 4E93A 2QOOA 1VLRA 3F3UA 4AGCA 4RVLA 1J1CA 1H24A 3ZUVA 3H30A 4L00A 4LGHA 3SVVA 2XEZA 4YHTA 3W8QA 1DAWA 3CLYA 1Q8ZA 2WO6A 5EOLA 5CASA 3LM5A 3UO4A 4W9XA 4D9UA 2UVZA 4BCNA 5I3RA 1ERKA 5J5TA 3LJ1A 3BIZA 4TY1A 2GFSA 2XP2A 3ODYX 3PTGA 1Q8TA 3QTZA 3OOMA 1YKRA 4IX6A 3BQRA 4U42A 2IW8A 4F64A 3EFJA 4BI0A 2JBOA 4L67A 1WVWA 3MDYA 4QQJA 3RM7A 3P7CA 3MV5A 1W98A 4RBLA 1S9JA 2BVAA 2C5XA 2JBPA 3TNQB 4FEWA 2DWBA 3IONA 5GZ9A 3OCTA 4IE9A 2Y6OA 4F1OA 4ZJVA 2JIIA 2X8EA 3VW8A 1U59A 4I20A 3BYUA 4J1RA 4MAOA 3DCVA 3QX4A 3TNHA 4FTQA 3Q32A 4BDKA 4HW7A 2ITNA 2O8YA 4JIKA 4NWMA 4DGGA 1Q24A 2IPXA 3OHTA 4AP7A 3OT3A 2YM6A 1PHKA 4D5KA 5KHWA 3POOA 4UY9A 4GJ2A 2JD5A 5AAFA 4TWPA 1A06A 4BGGA 3KA0A 2ETKA 4ZY5A 4XG8A 5DT0A 5BVFA 5AP1A 1JKKA 2V55A 3C4XA 2PY3A 4XP2A 1TFFA 2QG5A 3IDCA 5IPJA 3A7FA 3DLSA 3FZRA 4FT0A 3EIDA 3DAEA 4G6LA 4RT7A 1ZMUA 3LCDA 4TW9A 3SX9A 1Y8YA 3FMNA 3VBWA 4ZS4A 3PXRA 1JKTA 1Y91A 2B55A 4ZSJA 5CXZA 4FG9A 5AP4A 3UOJA 2BDFA 2UUEA 2R3KA 5GHVA 1P2AA 4LMNA 1YI3A 5FUTA 2QC6A 3GCQA 4PMTA 4MUQA 1WBVA 4TZRA 2GNHA 4RFMA 4YJRA 3R71A 4RVMA 4I4FA 1PJKA 3MFTA 5CI6A 2VTHA 1A9UA 1LUFA 3DBCA 4J8NA 3S1HA 5IQDA 2VTNA 3CXWA 4FTCA 3KULA 3A7IA 2PMNX 2YIQA 2GU8A 3I79A 3G9LX 3OY1A 4XG9A 4FA2A 5K5NA 4U44A 2C3KA 2R3GA 4PMSA 2GTNA 2QOKA 5KO1A 4E20A 2BRGA 3QCSA 3VW6A 1GZKA 4AN3A 4YTFA 4QQ5A 2P33A 5ANJA 4D4RA 4EH8A 4U6RA 2IVTA 4F99A 2B54A 1REJA 1U54B 3FLWA 4FSUA 1JSTA 4M15A 4MXXA 4O0TA 5CAQA 3MGYA 3BPRA 1RE8A 1W2DA 2FGIA 2VX1A 4GIHA 5C26A 3E92A 1IASA 4NIFA 4CFWA 1G8SA 1H0WA 3NZ0A 4BKYA 4QQCA 3K5VA 4BN1A 4V04A 4QPSA 4RLKA 1OL7A 4WA9A 1FINA 1BYGA 5JGAA 4QMZA 2BAJA 1YXTA 4TRLA 4AE9A 3DTCA 4ANMA 1OIQA 4E26A 4XUFA 3U6HA 3LAUA 3WF8A 3PA4A 3RVGA 3ORPA 3NNVA 2G9XA 5LMAA 3ULIA 3V51A 4DN5A 4DA5A 4DTAA 5CNOA 3CS9A 5AA9A 3HX4A 5HE1A 1ZY5A 4FNYA 1OITA 2F7ZE 4GT4A 4XX9A 4CFMA 2H34A 1RJBA 3OY3A 5IMEA 3LE6A 2RG5A 2QOLA 1YHSA 4EH7A 1Q8UA 4YPDA 4IAFA 3MWUA 2ZDTA 5AR3A 5L2WA 4I6BA 3ZMMA 3E8EA 2YISA 4F7JA 3FC1X 4E6AA 4FKTA 4AGDA 4CRLA 3NW6A 1L3RE 4LOQA 4MK0A 4O4CA 3R8ZA 4O86A 5EI8A 4WOVA 1CM8A 5CX9A 3WOWA 2ITXA 4FKOA 3H9OA 1G8AA 4JBPA 1FPUA 4IM0A 4AZEA 4KAOA 3FXXA 2VGOA 4ZTMA 1JAMA 3TL8A 4JDJA 4QYEA 2XBJA 2WEVA 3QQGA 2R3IA 4BF2A 4JBOA 4ASDA 4BB4A 1QMZA 2H8HA 4H36A 5CEQA 3VHEA 4AZFA 3IOPA 3G90X 3D7TB 3DQXA 4C58A 3UOHA 4QEBA 5CU3A 4X3FC 5FP5A 1ZYJA 2RG6A 4FEUA 3UO6A 3PY0A 3U87A 3FSFA 1CKJA 2RFSA 3FLSA 3P86A 4MXCA 5E90A 4QNAA 4RZWA 3BYMA 5CZHA 4KA3A 2VWZA 4CQGA 4FK6A 3LCSA 3R7IA 4AOJA 5A46A 2UVYA 4UMRA 3TIYA 3UZPA 4AA0A 1OZ1A 4JG8A 3LFAA 3EN9A 3RAIA 2GHMA 3S0OA 4DE4A 5I9UA 5A4EA 2BPMA 3OWKA 4A9SA 4B4LA 4CKIA 5BYZA 2PVNA 3VVHA 1ZXEA 3GNIB 5E8XA 1LR4A 4FI1A 1CSNA 3UMWA 1BL7A 3VO3A 2W05A 4C34A 2ZVAA 4LGGA 2F7XE 3PVWA 2XNNA 4G34A 5AP3A 5EW8A 4X21A 4IFGA 3C13A 4CZTA 1Y6AA 4U41A 4JAIA 4ZSGA 3RALA 2EXEA 5LCJA 3BHTA 3CTJA 5LQFA 3VUDA 4BI2A 5HLPA 4BYJA 2GTMA 2UW3A 2W5HA 2ZB0A 4H39A 4J96A 3VUGA 2C69A 3PE1A 3KXNA 3TJCA 3SA0A 4ZMEA 2OH4A 4QYFA 3C4FA 2XB7A 3V5JA 3WZKA 4RRVA 3EQIA 4XG7A 2VAGA 3BHYA 2F9GA 5D11A 3W0NA 4PWNA 1BMKA 3MY5A 4GRBA 4V0GA 4IM2A 2UW5A 4HVGA 3O71A 4L9IA 1QPCA 2C30A 4NTTA 3R04A 4X2JA 4R1VA 4C2WA 2J7TA 2PE0A 3VUKA 3U55A 4O6LA 3MPAA 2XKDA 4F1MA 4KSPA 3PWDA 4GEOA 2IG7A 3V01A 3EFWA 4D55A 1OUYA 5BVOA 4FKQA 4OT6A 5EYCA 2I40A 4NTSA 3QYZA 5J8IA 3C9WA 5EK7A 1OMWA 4M69B 4YJSA 4C0TA 5JFWA 1STCE 3CKWA 3E3PA 4YLJA 1RQQA 4CKRA 2QKRA 4D2PA 2ITWA 3QUDA 4XJ0A 3H3CA 4ORKA 3LCKA 3N4VA 4G16A 4FGRA 3RCDA 2OJ9A 1Y57A 2BIKB 3CPBA 4KUJA 5KUPA 4ZZMA 3MH2A 4I93A 1Q41A 4FZ6A 3ZDUA 2G15A 4IIRA 3UNZA 4HGTA 4QDEA 2WELA 3B2TA 4EOIA 2ITTA 5JQ5A 3RPOA 4FV4A 2ZMCA 4C37A 3PLSA 3DDQA 3SOAA 4EZ5A 2RFEA 2QU5A 2WAJA 4L3PA 3DY7A 3AC3A 4YR8A 3AD4A 2WZJA 3P78A 3LQ5A 4JG7A 4PL3A 4A06A 1W2CA 3PPJA 3ZSHA 2XH5A 3E5AA 4UMPA 3QL8A 1MP8A 4IMYA 2ITQA 4PMMA 4NSTA 4YLKA 1FGIA 3ORMA 4GFMA 2WU6A 5CEOA 3LMGA 2YDIA 5J1WA 1WAKA 4IXPA 4IVBA 5CSVA 5AUWA 4IFCA 2LAVA 3I81A 3VBTA 4ASXA 4F70A 4EOKA 4RPVA 1NVSA 3ETAA 2XIKA 2UZUE 1DI8A 2VWWA 4ANOA 4BDEA 3FYKX 3IW6A 4QQTA 3O8TA 2WFYA 5HESA 3OT8A 5EM5A 3FKNA 4MXZA 3QC9A 3VS1A 2PZ5A 1XH5A 3G51A 4D28A 2IZTA 5LVMA 4XV1A 5M57A 4J8MA 2IVUA 3FHIA 1GZNA 4RJ6A 5E1SA 4FG8A 4LRMA 2QKWB 1PW2A 2QI8A 2YLFA 4M13A 2F57A 4OTWA 4PRJA 3EL8A 3GVUA 5C4LA 3OC1A 4I0TA 4YJNA 4JQEA 3VBQA 2ZAZA 4F9YA 2W1ZA 3SG8A 3KEXA 5JFXA 4GL9A 3SAYA 5HVJA 3LCOA 1XH9A 1S9IA 2Z02A 4DCEA 5LVOA 1BL6A 3ORIA 3OOGA 4O0XA 1LEWA 1TVOA 3F9NA 3BRBA 2R0IA 1JSVA 2W1GA 3E88A 3IOKA 1TQMA 2CMWA 3CY3A 3Q9ZA 1H27A 5EM7A 2HY0A 3MIYA 3PP1A 5JKGA 5K0XA 2X0OA 4HCUA 1IAJA 4NL0A 3MW1A 4P5ZA 5HG9A 1TZDA 2FUMA 2WMBA 4GJ3A 4S34A 4AN9A 4G3FA 4IC8A 3ATSA 5IQHA 3GFWA 2PPQA 2XALA 2YJRA 3ERKA 4PPBA 4IWOA 3OEFX 5DRBA 3CSVA 5ANIA 5LMKC 2YJSA 3ORXA 5IH4A 3ID6C 3VF9A 2CN5A 3HV4A 4QTCA 1BUHA 4ZAUA 5HEZA 2JDSA 3DFCB 5HBEA 1OGYA 4JS8A 2XAMA 3WE8A 2I0HA 4C4EA 3L9PA 2VUWA 1V0OA 5EW9A 2GQSA 1U5RA 3R1SA 4R1YA 1YXUA 1ZWSA 4EQUA 4KB8A 3MPMA 3KGAA 2XANA 4QMNA 1OL2A 5ACBC 5FRIA 2ITPA 4BBFA 3UQGA 4HVIA 3ZU7A 4CEGA 5KMMA 5EQYA 2GS6A 3KXXA 4YTIA 3DJ6A 3PXKA 4Y95A 3VS3A 4F4PA 1RW8A 2SRCA 5CVGA 4ZSLA 4ENXA 3PY3A 2VTRA 4IZYA 2Q0NA 5DFPA 3U9CA 2CJMA 4AW5A 5JFVA 2R3PA 2YCRA 4IANA 2RSVA 2YWPA 5DT3A 3RWQA 1Q62A 4ZZOA 4G2FA 1OM1A 4D1XA 5BYYA 3DNDA 2X6EA 3GU6A 5HBJA 4FE2A 4CV9A 4DHFA 5HCXA 4AZSA 2HW7A 5IEYA 2WIHA 4QPAA 3I5ZA 5ETAA 3C0IA 1CKIA 3MTFA 4JIAA 2QQ7A 1AGWA 1UWJA 4RG0A 2NRUA 1FVRA 3KF4A 3U4UA 4BBEA 4B8LA 3E7OA 1RDQE 4YHFA 3OUKA 3MFUA 4QP7A 4LMUA 1P14A 2UZEA 3I1AA 3TV7A 2IZRA 4BFMA 4EK8A 3C4WA 2HELA 3EQPA 4NFNA 3BLQA 3V5TA 4ACCA 3QRJA 3R83A 4AX8A 3LXKA 3ZSIA 2OXYA 4K9YA 4GU9A 3DXPA 4UMUA 3SDJA 4DDIA 4F0IA 2WTKC 4MWHA 2XNMA 5H3QA 5D9HA 4NIFB 5CU6A 1H1WA 2WEIA 4R5SA 3W1FA 1UKHA 2X8IA 4EH9A 2Y4IC 4C3RA 3RPYA 3WI6A 4JQ7A 4EWQA 4Y85A 3WF9A 2XKEA 4R3CA 3DBEA 4U45A 2ITUA 4FV1A 4BC6A 4ERKA 4I3ZA 4R7BA 3R01A 2Z7QA 3CGFA 4FVPA 4L3LA 1UU3A 3L8PA 2WNTA 3DU8A 4XOYA 3EFLA 3UYSA 2E9OA 4FNXA 4CV8A 1R3CA 4O0VA 4Z7GA 2XIYA 5IU2A 4L7FA 3SV0A 4HGSA 3PA3A 3RHXA 4CRSA 2WTJA 4TYHA 3UQCA 4NZWB 5A14A 2YHVA 2Y9QA 2HY81 3QGWA 4FYOA 1PXIA 3A7HA 2IW9A 3R02A 4FOBA 3II5A 1BKXA 2XJ0A 3W55A 2Y8OA 1YOJA 4N0SA 3QTSA 4QTDA 3WBLA 1KV1A 4QRCA 4CXAA 3HUCA 5E7RA 4CTCA 3R8PA 4DFXE 4F9AA 5LWMA 4X3FA 5AIKA 3PZEA 1YDRE 5BVNA 1QL6A 3DTWA 3VUIA 3HL7A 5FEDA 4EOJA 3MYGA 5IQEA 3DBQA 2BIYA 3QD2B 3ALOA 3UIBA 3RZFA 3ZYAA 4L45A 2O2UA 5J95A 1ZOHA 2JDRA 2O63A 4FT7A 4ZLZA 5E8TA 4L3JA 3UG1A 3V5QA 4QYGA 1TKIA 3Q2JA 2VWIA 5IQIA 2CPKE 3DK6A 4IX4A 4IZ7A 4TN6A 5FBOA 5JGDA 2PZIA 4I6HA 4NM0A 2W4KA 5CENA 4ALUA 5F95A 3DXQA 1NA7A 2XJ1A 4HPUE 2VTMA 4Z55A 3U6IA 2VGPA 3AMYA 3CD3A 3TUCA 3OTUA 3TZ8A 5E4HA 2BCJA 1DM2A 2OIQA 3PE2A 3QCXA 4O7ZA 4FSRA 1ZYSA 3HA8A 3EFKA 3I60A 2VX3A 3P1AA 4E4MA 4Q2AA 2DUVA 4MHAA 3IGOA 4OLIA 3LXPA 4J52A 5HQ0A 4H05A 2BZJA 4MXOA 3C7QA 4OT5A 1PMVA 2DS1A 3BWJA 2VTIA 1JOWB 4FUXA 3VS0A 5LVPA 4RJ3A 3RPRA 4EH4A 4DGLC 4X2NA 3VRZA 2ZM3A 4BL1A 5DWRA 4YU2A 5ANKA 3BYOA 2W1FA 3BCEA 1M7QA 2XA4A 2W7XA 4UX9A 4LDTA 1YW2A 3ZLWA 2YCFA 1YXVA 4FSQA 3D5XA 2R3HA 4L42A 4A9RA 3JR1A 3KXGA 2GNFA 4WNMA 3UJGA 1L8TA 2HZ0A 2CSNA 3JPVA 4CVAA 4YO4A 4GH2A 5HCZA 1M14A 2WTIA 3FPQA 4EZ3A 4TWOA 2F2UA 5JZNA 4ZJIA 3PIYA 4QP9A 1XJDA 2KTYA 4FKUA 2RFDA 4IACA 4TWNA 4Z9LA 5AWMA 1KWPA 4KS8A 4AOTA 4BCPA 4LM5A 5J5SA 3BYSA 4Z7HA 4V0GB