4ZSLA

Mitogen activated protein kinase 7 in complex with inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
341
structure length
341
Chain Sequence
DEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 7
publication title Discovery of a novel allosteric inhibitor-binding site in ERK5: comparison with the canonical kinase hinge ATP-binding site.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 341
sequence length 341
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zslA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zslA01
1BX6A 3POZA 4IZYA 4Y72A 5HVYA 1LEWA 1QPJA 3IQ7A 4U45A 5EFQA 2X9EA 5LMAA 4AN3A 4FVPA 1NW1A 1PYXA 2J4ZA 2JBOA 2E9VA 4K1BA 4EYMA 3M1SA 3Q52A 4BKJA 5H3QA 4F7NA 2VX3A 1ZAOA 3BKBA 4M68A 4XJ0A 2QONA 1LPUA 5HIBA 2WOTA 3NNUA 2OK1A 3TKIA 4F9AA 4ZIMA 3LFEA 5DMZA 2C5XA 5C27A 3NZ0A 4GK2A 4FTKA 4WOVA 2NP8A 1PXPA 3LFNA 5IQDA 3UVRA 4FTUA 3WIKA 3PY0A 3F7WA 5E8UA 5LARA 4A4XA 5FG8A 5CVFA 3TNQB 3BE2A 4GV1A 4C3PA 3R01A 4ANBA 3O7LB 3COKA 3DT1A 3ORXA 3UYSA 2ITYA 3OUKA 3C7QA 5CU0A 4DT9A 4XG9A 3ZC6A 4EWQA 3S95A 4RC3A 5JFWA 3FMMA 3ZO4A 2A1AB 3FKLA 1ZARA 5AUZA 4RJ7A 3FV8A 2GU8A 3KKVA 3RVGA 4A4OA 1SVGA 1H1WA 3UOKA 5JRQA 2R64A 3W2SA 5EYMA 4NYEA 4FOCA 1ZOGA 2XIZA 4UV0A 2WTKB 3COHA 4FKWA 4IC8A 4V04A 1PHKA 5AR3A 2ZMCA 3QX2A 4FTOA 4ITJA 4QP8A 4GFOA 1KSWA 3K5VA 2IVUA 3QYZA 2Z2WA 5A3XA 4YHTA 3CQEA 1YXUA 3UQFA 5J7BA 3VS6A 4DGOA 2Y6MA 3O71A 3DB8A 3VS7A 4UALA 3KF7A 5DG5A 4UWCA 4J1RA 3LLTA 4DGGA 3HNGA 3NW5A 3C4FA 3DK6A 3H0YA 4U9AA 3SOAA 2GFCA 4QP3A 3Q6WA 3A7GA 2XK9A 2ZB1A 4G3EA 3HMIA 4XNEA 3W8QA 4PRJA 4JJRA 2XH5A 1URCA 4MD8E 4AT5A 3WI6A 1V1KA 4Q9ZA 1M2QA 2JDVA 5EKOA 3JXWA 1P2AA 2VNWA 5AR7A 4JAIA 2J0MB 2O5KA 3ZEWA 5DWRA 3F5PA 3TV4A 4A07A 3RPYA 5CEIA 4GSBA 4C4GA 3PA5A 5J7HA 3KXXA 1VZOA 5E90A 5HCYA 1OIUA 4Y73A 5TO8A 2B9JA 1W82A 3GT8A 4BICA 4TT7A 2WMXA 4PDSA 3ZRMA 2NPQA 2J51A 5F4NA 2C5VA 3FEGA 3BLRA 2P4IA 1OBGA 3NVMB 3FL4A 4AZSA 5CAUA 4C8BA 3LW0A 3A4OX 2XKDA 3R6XA 4EQMA 4XV2A 2DWBA 4S31A 4BZOA 2X4FA 5C4KA 3TN8A 2XNOA 5IDPA 1OUYA 4UZDA 3GQIA 3HECA 3D5UA 3FHRA 4CFVA 1QL6A 2QG7A 3GFEA 2XIRA 3NIZA 2PVRA 1J3HA 5M55A 3P7CA 5IUIA 4KBKA 4O0XA 5BX0A 4GG7A 4NKSA 4PF4A 2CNQA 4F1OA 3V04A 3D0EA 2C6KA 2YDKA 4CKIA 3QFVA 4FKRA 4X0MA 5CU4A 3DOGA 3TTIA 2H6DA 3LFDA 4BIBA 3E64A 3P23A 4LOPA 4DGMA 1Y8GA 4PDYA 3P08A 4FTIA 4BTMA 4JG6A 2IZRA 3QRIA 4MQ2A 3U4WA 2VTJA 4E6QA 3KMUA 2BUJA 4XLVA 3U6HA 3FL5A 3OWJA 2GHLA 3H9RA 3HP2A 4O7ZA 3TZ7A 1H0WA 1YRPA 3NYVA 4X2GA 3UIUA 2WKMA 4B8MA 3F5GA 3NWWA 2JDSA 2OFVA 4AGDA 3DJ7A 4O84A 4P5QA 4Q5HA 2RGPA 4IM3A 4RT7A 2CPKE 4QP6A 1P4FA 4PDPA 5T68A 2IZTA 4YZMA 4IAFA 5KKRB 4JBVA 4RVLA 2BKKA 2JDOA 3WF5A 4MKCA 2PU8A 2EU9A 2VWZA 3GCVA 4FKVA 2IW8A 3ID6C 5ANIA 1JKSA 4X6RA 1OKVA 4F70A 3NX8A 4ZMEA 2YIQA 2YERA 3ZS5A 3FWQA 4U0IA 4UBAA 1PMEA 3DAEA 3HYHA 4KBAA 3DFCB 4G3DA 4YTHA 3D7TA 4IE9A 4QMMA 4QMWA 4KSQA 2ERZE 5LWMA 4UYAA 3QD4A 3I5NA 3AD5A 4JDHA 3NYXA 4XG4A 1KUTA 3AGLA 1WBSA 2I0HA 3TJCA 5AAEA 4XRJA 3DY7A 3L9NA 4EJNA 1BKXA 4RFMA 1WAKA 2KULA 1ZLTA 3QD0A 2QU6A 4AXAA 4AE6A 4E8AA 5LMKA 2R3LA 2PVYA 2BZIB 3UG2A 1YWVA 4GYGA 1U54A 2R3QA 3LQ5A 4U8ZA 4ZY6A 2R3MA 3QQJA 2C6MA 3O2MA 4AG8A 3CJGA 2GFSA 2VWWA 4DF3A 3MH1A 4BBMA 3EN6A 4USDA 4RWJA 4Z16A 3CXWA 4FEQA 1HCLA 2OZAA 4QNYA 3GCUA 3VJNA 3KK9A 4LUDA 4AQCA 3T9TA 3ITZA 4O81A 3V8WA 2ITVA 2GNIA 5AJQA 2J0KA 4D4RA 4EH2A 4FK6A 5ICPA 1WVXA 4U81A 5HD4A 1FMOE 3DQWA 2P2HA 4FIGA 3UNJA 5FGKA 1IEPA 4X2FA 1JWHA 4YBJA 4NM0A 4YNOA 4CTCA 2QOBA 1NVSA 3II5A 2I40A 1Q3WA 2JFLA 2XA4A 4LYNA 3AGMA 3QALE 3R0TA 3EN5A 3SLSA 2B52A 1X8BA 2YA9A 4K2RA 4F4PA 1Q41A 2ESMA 4CKRA 1OL5A 4QP2A 3UYTA 2EB2A 1ZWSA 2UVXA 2QO9A 4AE9A 3DLZA 5C9CA 4DEBA 4X6QC 3PVUA 3FBVA 3G33A 3NLBA 3WZDA 4DFXE 1FVRA 1Q8TA 4IH8A 1U5QA 3R9HA 3I6WA 2HY81 1Q97A 3R2BA 4H39A 4C2VA 4ANMA 3NGAA 1WZYA 4C59A 4I23A 4L68A 5AP6A 5CSPA 2QC6A 4IX4A 4S30A 2B9IA 4Y95A 1ZYDA 5DFPA 1Z57A 3LJ1A 1PYEA 4E5AX 5EQEA 3OTVA 4NJDA 4DTKA 4CT2A 5ETIA 3A8WA 4FX3A 4YSJA 1Q4LA 4ANOA 5DBXA 1L8TA 4XV9A 3UC3A 4IWQA 4IANA 3ZU7A 4AFEA 4KSPA 4PNIA 4RC2A 4CTBA 5M56A 4H3BA 3Q6UA 4F7JA 3GVUA 3HRBA 4FKGA 3AT2A 4D55A 3NEWA 4ZP5A 1QPDA 3FZPA 3PG1A 4AW1A 3L9MA 2UZWE 3C4XA 2B0QA 5AP5A 4BKZA 2AC5A 4EBVA 4XG6A 2OIQA 4RIYB 3JUHA 4ALWA 5E8TA 2J0IA 4L44A 3W2PA 4BRXA 1W0XC 2GHGA 2WQMA 4XP0A 4WD5A 3PE1A 4PWNA 4L46A 4F1TA 4QP7A 2CNUA 3KULB 3W2RA 3P78A 2W5BA 3I81A 4IZ7A 3C0GA 3HUCA 4D4VA 3VS2A 2F7ZE 4CFXA 4E5BA 1REKA 4X3FC 4UWYA 1ZY5A 4EOMA 2ETRA 4JIKA 1NVRA 4ENXA 3DXPA 4J53A 2QI8A 3FDNA 5FRIA 3VIDA 3EB0A 5KMKA 3OT8A 5CVGA 4EK8A 2P55A 3QQHA 3AC5A 4FZDB 4BIEA 2F57A 1P14A 4BDCA 2J90A 5I3RA 4HGSA 2B54A 5LVPA 4RWLA 4C33A 3OD6X 5AP2A 2ITTA 4N70A 2BDWA 4B99A 2RFDA 4YJQA 5AV4A 2PVFA 3KF4A 4AN2A 4E1ZA 2CSNA 2VTMA 4MXOA 5LCJA 2XCHA 4OTDA 4FV2A 4RJ5A 1XHAA 3DDPA 5A4LA 5A9UA 4RX5A 4Y46A 3BE9A 1JVPP 2WMWA 4MXYA 5EW9A 3BYUA 4M14A 4YO6A 4FUYA 2YDJA 4XUFA 3OUNB 4S33A 3BHUA 1GY3A 3Q96A 5CAQA 2HY0A 4RC4A 4YP8A 3HVCA 3UVPA 2FSLX 2WXVA 2C0OA 4BC6A 4M67A 1A06A 4M15A 4NM3A 2YM5A 4BDFA 4IFGA 4A9YA 1H27A 3HMMA 2VWYA 4PTCA 3TNWA 2X7FA 4OTWA 4ZTQA 3BU3A 3SXRA 4EYJA 2E9NA 3A7HA 3R1YA 4QMOA 4LRJA 4F0GA 5CASA 3W2QA 3SV0A 4U3YA 5HU9A 5JK3A 5KMMA 5EDPA 2VTSA 1H1QA 2OI4X 1GAGA 2WTDA 1PKDA 3NMUF 3PP0A 3O51A 5C1QB 2XNEA 3F2AA 4EI4A 1I09A 2PHKA 3IONA 5LVOA 4HCUA 3CGOA 4YLKA 2PWLA 4BCJA 4ASEA 3FLZA 4FV8A 5KMLA 3SKCA 3UO5A 3MB7A 3KA0A 4S2ZA 2G15A 4YSMA 3BYOA 1W83A 3MGYA 4BDAA 3S1HA 4EOQA 2HYYA 4TXCA 3RPSA 3CS9A 4JBOA 4MF1A 2VWUA 5A6OA 4ZXTA 4EQUA 2OJJA 4IEBA 5M4FA 3QUDA 5HICA 4FTJA 4RWIA 4AFJA 4J71A 4NWMA 2BZHB 4QOXA 1MRVA 3V6SA 4ZTMA 2GPHA 3BLQA 4APPA 1OIYA 3GOPA 4KINA 4U7ZA 4E5WA 4DFYA 3UIXA 3RKBA 1GIHA 3CEKA 3LZBA 4EH3A 4W4XA 3KFAA 4QTDA 2IG7A 4FV4A 1JPAA 2XBJA 4YC3A 2UVZA 4HJOA 4CMOA 3VUDA 4X21A 3V01A 4WG4A 3UTOA 5D7VA 5KUPA 2FA2A 3FHIA 2QODA 1RQQA 4U6RA 5EQYA 2H96A 4X2NA 2GNHA 4BDKA 3EQGA 5IQIA 2VTIA 2VWIA 2VX0A 3AMAA 4FG8A 5DGZA 3TI1A 3N4UA 1OB3A 2UZDA 3PXKA 4DBNA 3ATTA 4AP7A 4EKKA 1V0OA 3VW8A 1MRYA 4CXAA 2WMAA 3LFFA 1RDQE 5BUJA 2J2IB 4XP3A 1KE5A 2WTWA 4IX5A 1CTPE 4H1JA 4GUBA 3VBTA 4DGNA 3B8QA 4QMUA 3MFUA 5CXZA 5AAFA 2JKQA 1GIIA 2BVAA 2VU3A 5CI6A 4B6LA 4FSMA 3HGKA 2FSMX 3A8XA 2EB3A 4A06A 4MXXA 5EYCA 3SG9A 1XH7A 1OM1A 3FLQA 4ZJVA 3DBDA 2BFYA 1S9JA 1Y91A 2VWXA 1BL7A 3EWHA 4MWIA 4QYGA 1ZYJA 4RVMA 4PTEA 1UV5A 2VTRA 4PUZA 2RF9A 4BBFA 4P4CA 2R7BA 5I9WA 1XJDA 2IW9A 3MW1A 1BUHA 4FNXA 2YCQA 2WQNA 4TL0A 4JG8A 4G3FA 4XS2A 3BU5A 5E4HA 2YM3A 1A9UA 3R2YA 5AUUA 2X7GA 2EXMA 3KEXA 3DV3A 5KZ0A 3DXQA 4DBXA 3G2FA 4QTAA 4M12A 4D2SA 2XKCA 2VTTA 4PY1A 2CN5A 4WSYA 3AG9A 4BB4A 3KXNA 4BDJA 4DG0E 1ZMWA 2RFNA 2R3JA 3VAPA 5CF8A 4ANSA 5J9LA 5CENA 3FY2A 3ZFYA 1OL2A 1PXJA 4YU2A 4A4LA 3QGWA 1QPCA 4G17A 5DVRA 4BCNA 5M4UA 2X2MA 4DE4A 4OR5A 1B38A 5IEXA 4KB8A 4USFA 3FSFA 3SGCA 4HYSA 4I5MA 3RWQA 5HHWA 1OECA 4B9DA 3BEAA 3WF8A 3P0MA 5IH6A 1K2PA 1OPJA 3QTXA 5KZIA 4LUEA 3UO4A 4ASDA 5D9HA 2UZBA 3L1SA 3O8UA 2PL0A 3V6RA 4C4EA 2JBPA 4KIKB 4I4FA 4LOQA 3FZ1A 3OCGA 5I9VA 3B8RA 4MNFA 4HVHA 3ORKA 3D5WA 4M66A 5C01A 1BI8A 4JBQA 2X1NA 4EOIA 4FL2A 5A14A 2XS0A 4FIJA 5DA3A 1REJA 3LVPA 3M11A 1Y57A 3HAVA 3OG7A 4KKHA 4YPSA 4LL0A 4C4HA 4O22A 4ZY5A 4ONAA 2W1IA 3A7JA 1JSTA 4U5JA 4BDHA 3C0HA 3ZLSA 2AC3A 4O7TA 4BZDA 1PW2A 4N4SA 4F6SA 4O83A 3PYYA 4O91A 2WO6A 3B2WA 2YWPA 2FB8A 3C1XA 2FH9A 4I94A 5FM3A 2V5QA 2OLCA 2X2LA 3ANRA 2VTQA 3EKKA 4G5JA 5TKDA 4EHVA 2CNVA 4D9TA 1KOAA 2B53A 4L3LA 3KREA 3N4TA 3C4WA 3KULA 5BMMA 2YAKA 4K18A 3TV6A 1PXOA 3LFCA 2UW0A 4IAKA 3U55A 4FV9A 3G90X 4QQ5A 5KCVA 2R3HA 4EK4A 2IVSA 3DBCA 4APCA 3MJ2A 4KWPA 5CALA 4GU6A 1AD5A 3HV3A 2J6MA 3BGZA 2QD9A 2AYPA 2GS6A 3OW4A 4QYYA 3QRUA 5K3YA 4GVAA 4X3JA 4IVDA 1YOMA 2XK3A 4Y85A 1UWJA 4G16A 2BRNA 4CFUA 2WHBA 2ITUA 5TE0A 3ZZEA 3HRCA 3FMLA 4LI5A 4M8TA 5J5SA 2UW9A 4YJSA 2C3LA 4QYEA 1F0QA 2XM8A 3NNVA 4EK3A 3LLAA 4RBLA 4E4MA 3FI8A 4NM7A 1AQ1A 2C3IB 1KE7A 3EQRA 3FMKA 3PPJA 4HGEA 4I41A 1XQZA 5AV1A 1YI6A 3C4EA 3MVLA 4ITIA 1STCE 3TKHA 4BBEA 4TRLA 3R83A 5LJJA 2OW3A 5AP3A 4FTAA 3HX4A 5L2SA 4XP2A 2YEXA 5CU6A 3BWJA 3R7UA 2UV2A 5D7AA 3MPAA 5IG1A 4I6BA 3JYAA 4JOAA 2W1EA 2XF0A 4PPAA 4QMTA 5EM5A 1O6YA 1YDRE 5CEMA 3RK5A 4KIPA 3R7GA 5E7RA 4FV5A 4FV7A 4G9CA 4ASXA 5LVLA 4D2RA 5HNGA 4X3FB 3RZFA 2GSFA 4EORA 4B4LA 2UW7A 4YBKA 5GJDA 1UNLA 4FSQA 5A4CA 3FKNA 3T8OA 4GFGA 3I6UA 1KOBA 3BYMA 3O7LD 3EFWA 4W9XA 3CLYA 1BLXA 3ORNA 3QBNA 4BGHA 3FQEA 5I9YA 2ZOQA 3IOPA 2R3KA 3R9NA 3OWLA 3VQHA 4MXCA 3AD6A 3RM6A 4W4YA 3T3UA 3VS3A 4AX8A 4Y8DA 5CF4A 2BDFA 3ORLA 2WMRA 4M3QA 3PJ3A 5A6NA 4MYGA 5HE1A 3F61A 4PTGA 5HBHA 5L6WL 1KV2A 3VUTA 3BI6A 2WEVA 3DS6A 3IOKA 5IDNA 3HMPA 5LQFA 3ETAA 4GKIA 2O8YA 3PA4A 3R9RA 4PL5A 1OI9A 5KHXA 2QLQA 4UMRA 5B2LA 3PIZA 5IA4A 5IQFA 4R1VA 3P9JA 2WIPA 4FTNA 3LJ0A 1OIRA 5HKMA 5HO8A 4DG2E 3ZO2A 2FUMA 3BHHA 4FNZA 4QPSA 4YZCA 4BWKA 1KE9A 3LMGA 4AGUA 3BQCA 4NM5A 4NW6A 4DHFA 4HW7A 3S0OA 1BMKA 4FUXA 4PP9A 4TPTA 4YTIA 3F7ZA 2A4LA 3TNPC 4AWIA 1IA8A 3E93A 4ACGA 5ANJA 3QD3A 4WBOA 3MBLA 3PFQA 2BRHA 2WU6A 2WMTA 3ZUVA 2R3IA 4BTJA 4IB3A 3R7OA 2GCDA 2QCSA 3KN5A 4CG9A 1M52A 2W4JA 4R5YA 1UU3A 1JSUA 2B55A 3M2WA 4GW8A 5DEWA 3DK3A 4DINA 3FMJA 4G6OA 3RP9A 4RX8A 1H4LA 1U4DA 4EOJA 2LAVA 4IQ6A 4RQVA 2HWOA 5AR4A 4FKOA 3Q3BA 4AOIA 3OS3A 3R71A 3ENHA 3E88A 4M0YA 3QQGA 3L8XA 1B6CB 5B0XA 4HOKA 4EJ7A 5FEQA 1R1WA 3SDJA 3OW3A 2WNTA 1DM2A 1U59A 2BCJA 3HRFA 3MJ1A 3Q60A 4FC0A 4FKUA 4L8MA 5L4QA 2JLDA 4DFBA 3CY3A 3SOCA 5J5TA 4FZ6A 3C5UA 2P33A 3W55A 4U79A 1Q99A 5HG9A 1GZKA 4J95A 2Z02A 3E7VA 3O96A 4J96A 2BDJA 5EYKA 3UMXA 4CEGA 3ERKA 2X39A 4MQ1A 3UZTA 2DYLA 4I6QA 4Y83A 5F9EA 3R04A 2REIA 2VTPA 4FKPA 5E1EA 5M53A 3LXNA 3UNKA 5KX8A 4KKEA 5DI1A 5DH3A 2XZSA 4ZSJA 2PMOX 2V0DA 4FNYA 1XR1A 4JDIA 4CMTA 4BGGA 4EOKA 4IAIA 4NZWB 3NIEA 3DAJA 4K9YA 2BIKB 1ZOHA 5LCKA 3RHKA 4U42A 4EEVA 4ORKA 2UZTA 4QPMA 3QGYA 2ITOA 4OW8A 4IW0A 4KKGA 3ZYAA 5DPVA 3ACJA 2PZPA 2YCRA 3V5TA 3F2NA 2OO8X 2XB7A 1FMKA 3UBDA 5BUIA 4II5A 3VUHA 3OFMA 2ZAZA 4B8LA 5HTIA 2Z60A 4UX9A 4CYJA 4MBJA 4ERWA 1H08A 5JQ8A 4U43A 3E92A 4L67A 1E1VA 1KE6A 5EH0A 3H30A 3V5LA 4USEA 2ETKA 2GS7A 4QYHA 3CE3A 5CNOA 4IAYA 5HGIA 2ITXA 1UU9A 1XBCA 3PLAE 3ZONA 5C8KA 4RJ8A 5CSHA 3THBA 2V22A 5AV3A 3VBXA 5FWKK 3PDTA 1FOTA 2IVVA 3VS5A 1Q8UA 1SNXA 5AWMA 3EL7A 2QOFA 3ORZA 3ZTXA 3QKLA 4XV3A 1O9UA 3KMWA 3PVGA 4NKAA 4HVIA 4JX7A 2VNYA 2W7XA 3EH9A 3IGOA 4BCFA 3VBWA 2JKKA 4XG8A 2VGPA 5A4EA 4O0VA 4LL5A 5L2IA 3R28A 2W99B 1M7QA 3DQXA 4EBWA 5GIOE 3KCKA 4F0IA 2WD1A 3FUPA 4HGTA 2ZMDA 4LM5A 5CWZA 3LIJA 2UZLA 4DH7A 5IKWA 4I92A 2CKEA 4PQNA 4S34A 3MIYA 4J98A 4C7TA 2PVMA 2OSCA 1XH9A 4NCTC 4NW5A 3F3TA 3W32A 5FTQA 3WZEA 2QHNA 5E8SA 3PP1A 2YIRA 4AT3A 3DK7A 3VHEA 4UMUA 1Q8YA 4BDIA 3LM0A 1O6LA 3NW6A 4G3CA 4YZ9A 3B2TA 4OTHA 3OWKA 4UMQA 4DG3E 3E7OA 2HXLA 5J9YA 4FT7A 5IMXA 3JVSA 3U9CA 4L6QA 4D2TA 2FO0A 1UWHA 4BYIA 4R8QA 5CYIA 3VHKA 4O7VA 1XH5A 4DN5A 4L52A 5G6VA 3HMOA 3SRVA 5CLPA 2O2UA 4TYHB 3E8NA 2VD5A 3MS9A 4O0TA 3ZSHA 4Z55A 4HNIA 3VJOA 3KXZA 2JGZA 4R7HA 4CFFA 4AZVA 3CGFA 3CBLA 5FXQA 2P0CA 4XMOA 4OBPA 4O2PA 2YIYA 3EL8A 3FXXA 3LQ3A 2CJMA 2PE1A 3SA0A 5J1WA 2VGOA 5K4IA 3ZO3A 1WCCA 3KVWA 2NNWB 5EQPA 3UIMA 4C0TA 3G6HA 2C1AA 3BGPA 4YJPA 3AQVA 5ANKA 5L8JA 5L8LA 4TW9A 2XKFA 5CSVA 2ZDTA 3WILA 4V05A 1R78A 4HPTE 3NAYA 3QU0A 4FZAB 2WTIA 1E1XA 4OTQA 5CSWA 4NK9A 2QR7A 3RWPA 4AOTA 4BI2A 5FBOA 4DAWA 4DGLC 1LEZA 4R3RA 2OJGA 2PMLX 3MH3A 4AAAA 2WMSA 4FI1A 2F2UA 3QKMA 3UODA 4CZTA 3QYWA 4FMQA 3R02A 1FPUA 1Q61A 2WQOA 4QMVA 5H8BA 4YHFA 1CDKA 5HCXA 2XNMA 3R73A 1NA7A 3QZGA 3QA0A 4Q5EA 2IZUA 4HVSA 4OAUC 3MY0A 3D83A 4YJRA 3O50A 5GINE 2OFUA 3NYOA 3HV5A 4GJ2A 3UP2A 5CEKA 3EZRA 3R7IA 4TTHB 3WYYA 4KRCA 4G5PA 2C6TA 1YHWA 3VUKA 2Q0BA 3MFTA 5EM8A 3GBZA 5EK7A 5IISA 2ONLC 2X0GA 3LFSA 3ULZA 5HBEA 3VF9A 1BYGA 1YI3A 3FZOA 4AA0A 4I24A 2XYUA 3AD4A 3SW7A 3DZQA 5HE0A 4E6DA 2XIKA 3POOA 4UY9A 5IEYA 4S32A 4M97A 3V5JA 4RIXB 4L9IA 2QNJA 4IDTA 4U40A 3FPQA 3RPOA 5FUTA 3EQPA 3GUBA 3FMNA 1VR2A 2W4KA 4LMNA 3FXZA 5EHYA 3HA6A 4X7QA 3W18A 2V62A 5AV2A 1G3NA 3FKOA 2A2AA 4FZ7A 5AV0A 3NUUA 3ZM9A 2RG5A 1PXMA 4FR4A 5M09A 3BQRA 4GK4A 4Q2AA 2VWVA 4XH6A 3EQBA 5AP1A 1CKIA 4MWHA 4ACDA 2I6LA 1J7UA 4LG4A 3COIA 4WUAA 5IQHA 5L6PA 4FSYA 3GCSA 4U41A 5D12A 3EQIA 1APME 3S00A 2BMCA 4FICA 1ZRZA 2SRCA 5JGBA 4RLKA 3ROYA 3E87A 5HNIX 2IWIA 4CV8A 3KVXA 2YACA 4MCVA 3SXFA 4BCMA 3GC9A 3CKXA 4AGCA 5FP5A 4K0YA 4F1MA 1M17A 4HYIA 4DFNA 3CPCA 3R00A 4DTBA 2UZOA 2PTKA 2X2KA 3D4QA 3NUSA 1WBWA 4O38A 3TV7A 5I9XA 3G15A 1OUKA 5FTOA 4JDKA 5I0BA 3Q53A 3NUXA 3ORMA 5E8YA 3VBVA 3GOKA 3A60A 5GIPE 4GL9A 4YGAA 4H36A 1GZNA 4XCUA 3MPMA 1M7NA 4JRNA 5EDQA 4QRCA 4AF3A 3CIKA 3GENA 4IB5A 4ZTNA 3OMVA 3PWDA 4HYHA 3I7CA 3IG7A 4IVCA 3KY2A 3LAUA 4DFLA 3A2CA 5J1VA 3LJ2A 3CCNA 1GIJA 3RINA 3H0ZA 3ANQA 3CTQA 4GYIA 2YJRA 1PF8A 2BRGA 4GIIA 2JFMA 5JFSA 3BPRA 2J0LA 3IW8A 3PVBA 4CV9A 2BFXA 1TKIA 4RWKA 4FYOA 3V5WA 3AMYA 5AX3A 1Y8YA 3ZUUA 2GQSA 3Q9ZA 2ITWA 5FM2A 4AT4A 3UOJA 3MVHA 3BCEA 3QAME 4EH4A 1XWSA 3F3UA 1P4OA 3R8UA 3TUCA 2H9VA 3ZFXA 1ERKA 3KC3A 3RZBA 1ZZ2A 3AC4A 2OF2A 4KABA 2PUPA 4TKSA 3MVMA 2JKOA 5T3QA 4AW2A 4PMTA 5HO7A 4YR8A 2CKOA 1UU8A 3HUBA 2JKMA 3VS4A 4KUJA 3ZLYA 5L2QA 3UDBA 1R0PA 3QXOA 3BHYA 4I0TA 4C57A 2B4SB 4UYNA 1T45A 2WEIA 3MN3A 4EH6A 4FKIA 5M07A 3HKOA 4Z7GA 3U6JA 4PMSA 2BTRA 4BCQA 2WTJA 2XNBA 4YURA 3TUBA 4G31A 5CNNA 4D1ZA 3E8EA 5FXRA 2WB8A 4QP4A 5BNJA 4BR3A 3AC2A 1OVEA 4RMZA 3GU5A 3RAHA 2VTNA 2XNPA 2JC6A 3ATSA 5AADA 3ZRLA 4FT9A 4O7SA 3DBEA 4M69B 2CN8A 4ZOGA 5CAVA 2YITA 4P7EA 1OL1A 4D4YA 3ZM4A 4MXZA 3MA6A 3NUAA 5E8ZA 3HV4A 2A0CX 5DEYA 1Y6AA 4FZFB 4BHZA 2EUFB 4O0RA 4AZFA 1UVRA 3ODZX 4WBBB 4OTRA 4UMTA 3S3IA 5JT2A 3SQQA 3FJQE 4H1MA 1WFCA 3F9NA 4HZSA 3OOGA 5DOSA 2C0IA 2C69A 2W9FB 2X81A 3R21A 4J8NA 2YM6A 3BX5A 4ZSEA 3NR9A 4A9SA 3R8PA 5G1XA 3A62A 4GMYA 4WRGA 3JR1A 5GJFA 2VTHA 2JAVA 4JQ8A 2WPAA 4DITA 4FA2A 3E3PA 3BIZA 5AR5A 4LRMA 2OJFE 1LUFA 3QZHA 4GG5A 2ZDUA 2ACXA 3HP5A 2NO3A 3JVRA 2C4GA 5D10A 5GNKA 1OPKA 3QUPA 1ZMVA 4TYHA 4UN0C 2C3KA 2RIOA 3LCSA 4QQJA 5AUYA 3SVVA 4BCKA 1G8SA 5BVKA 3UVQA 2GNLA 4F9CA 3BV2A 4ZJJA 3HEGA 2WQEA 4WNMA 1TQMA 4HVDA 4ANLA 2ITPA 3GP0A 2YIWA 3EN4A 1Y6BA 4IXPA 5DT0A 1H07A 2QLUA 2RKUA 2W96B 4GIHA 4EH8A 3KXMA 4ZSGA 3C0IA 4EZ3A 3Q4ZA 3G6GA 4F99A 4LGGA 3QL8A 4FSTA 5LMKC 5GZ9A 5LOHA 5DN3A 4O86A 4WO5A 1JBPE 1DAWA 3G5DA 5KMOA 3QTRA 1PJKA 4B7TA 2Y8OA 4E6AA 5AP4A 4EHGA 3TM0A 1WVWA 2C1BA 3QCXA 3U51A 5T6KA 4ZZMA 3DDQA 5TT7A 2BR1A 2PZYA 4N6YA 2I1MA 3JY9A 4JR7A 2BRMA 5ANEA 5BUEA 1H01A 2XJ2A 2V55A 2Y9QA 4MBLA 5DE2A 4K6ZA 4ZLOA 3N51A 2XMYA 4Z3VA 3CD3A 3I0QA 3HDNA 3ZOSA 4EHZA 3PJ8A 4ZTLA 3VUIA 3HMNA 3F66A 3LM5A 5KHWA 4TYIA 4EK5A 3ZSGA 2Y7JA 5DNRA 4XG2A 2QG5A 3GU6A 2XK8A 1ZZLA 3O8TA 3WIGA 3C50A 2QKRA 5I4NA 4QMXA 5CF5A 4QMNA 4MD7E 5EOLA 3WOWA 2XRWA 1H26A 2UW5A 4H05A 3LKMA 5IQGA 4ZY4A 2C47A 3NYNA 5HG8A 2OICA 3EQCA 3P4KA 3R7YA 3WF6A 4F08A 3TDWA 4LGDA 3T3VA 4EOSA 3PJ1A 3LXPA 2R3RA 3GEQA 1J91A 3Q4UA 2NRUA 4EH7A 4ZMFA 1FGKA 5H8EA 3EMGA 2R0UA 5EM7A 3VF8A 2ZM3A 4GFMA 3UNZA 3ZZWA 5BQ0A 1MQ4A 3HV6A 4FV6A 3PE2A 1LR4A 4WG5A 4XV1A 5AP7A 5FXSA 3VVHA 4BI1A 4CZUA 4DEHA 4EOPA 1IAJA 2EVAA 2W1CA 3QLFA 4L7SA 2WAJA 4RJ3A 3C4ZA 3LCOA 4FBXA 2BKZA 4WT6A 1Q3DA 5J8IA 4PX6A 4UZHA 3SG8A 4GJ3A 4IJPA 4QMZA 3SC1A 4A9TA 4C02A 4W4WA 4CLIA 3A61A 4OTIA 3PSDA 5HO6A 4O0SA 1YXVA 4CG8A 2UZEA 4TN6A 1JNKA 4KIQA 4YJOA 4OGRA 5CQWA 1YQJA 5E91A 4AGWA 4CCUA 3QF9A 1UNHA 1VJYA 2UUEA 3QWJA 5HI2A 4IWPA 4O7RA 1OKYA 3LOKA 1HOWA 2JIUA 1FVVA 2HZ0A 2XBAA 3EYHA 4GK3A 1IR3A 1OPLA 3V5QA 3G0FA 3Q5IA 1H1PA 3UZRA 3OCTA 3Q9YA 4LQMA 5EI2A 2F2CB 4YTCA 4MEDA 2WELA 2R3GA 3IKAA 5IA0A 3BGQA 4JBPA 4U3ZA 4ZTRA 4BZNA 4WG3A 5GZAA 2WTKC 3VUGA 3EFJA 3QTSA 1IG1A 4ANNA 2X6DA 1SNUA 2CCIA 3V8SA 4FSRA 3T9IA 3DXNA 3MPTA 4QD6A 2E9OA 3P7BA 3EQHA 3ZSIA 4IZAA 4E20A 2DQ7X 1CKJA 3KRRA 3QQKA 2NRYA 4L45A 3TUDA 3Q4TA 2CLXA 1R0EA 1YDSE 1PRYA 3KXGA 5IPJA 5C8MA 3KQ7A 3OC1A 2HK5A 1Q5KA 4TY1A 4DEDA 3UOLA 2PZIA 3HV7A 3RAIA 2BAKA 5AM6A 4NT4A 2WIHA 5M08A 3JPVA 4G34A 2PUIA 4OBOA 2VUWA 4FKQA 4NL0A 4C35A 4CZYB 3NCGA 4CD0A 5CU3A 5M57A 2YDIA 5J95A 2J9MA 4FG9A 4RIYA 5BPYA 3H9FA 3VS1A 3PG3A 5JZNA 4DFZE 2X4ZA 4JR3A 4Z7HA 1J7IA 2W17A 4DEIA 2WMUA 3PY1A 2YIXA 3F3WA 3BV3A 4RIWB 2ERKA 3DTWA 3FYKX 4H58A 4J99A 4E6CA 5FQDC 5CANA 4G3GA 4W4VA 3G51A 3MVJA 5H2UA 2JIIA 2OZOA 5HLPA 4IHPA 5EOBA 5IZFA 2FSOX 2Z7RA 5KBRA 3RBWA 3OEZA 5I3OA 4FE2A 3WARA 4UMPA 3EJ1A 4FSUA 4FTTA 2C30A 1GNGA 3DJ5A 2R7IA 4IC7A 4M0ZA 1UU7A 4WUNA 1KE8A 2EWAA 3WYXA 3DA6A 4M69A 3KRJA 4FIIA 2ZB0A 4YHJA 4RLLA 4YZDA 4BWPA 2WMVA 3IK3A 2BROA 1YKRA 4PPBA 2HZIA 2BZJA 3R8MA 1L3RE 4FEVA 3EKNA 5ETCA 4RIOA 3TXOA 3BYVA 2DS1A 3SX9A 3NUPA 3ZLWA 4KAOA 2RFEA 4L43A 2RSVA 2Q83A 1V0PA 1JAMA 2Z8CA 5ITAA 2F49A 3PPKA 2RFSA 5ETFA 5HCZA 5HTCA 3GCPA 3IDPA 3AOXA 4PL4A 4RGJA 3W1FA 4BFMA 2W05A 1Q24A 5J79A 2ZV7A 5KKRC 1DS5A 4ZZNA 2ZJWA 3LFAA 1URWA 2UW6A 3OF0A 4GUEA 2Y6OA 3P5KA 3IDBA 3D5XA 4NTSA 2PE2A 4AU8A 2CDZA 5CT0A 4FGRA 1YXXA 5JH6A 1AGWA 3IS5A 4FT5A 2I7QA 3LQ8A 4IACA 5HU3A 4CNHA 2W06A 1YWNA 2O0UA 3QRTA 5IA5A 4D28A 4O0UA 2OG8A 4I1ZA 5EHLA 4A7CA 5TOZA 3PJCA 4FKJA 3TDVA 2HIWA 1PXLA 1XH6A 3AXWA 3D5VA 4YZNA 4CFMA 5EW8A 4LRKA 1IA9A 4YMJA 3TNIA 1OITA 1BI7A 4YJNA 4YLLA 1G5SA 4FOBA 2YZLA 3QKKA 3R1QA 5E92A 5F95A 3TZMA 3FQSA 2IVTA 4QO9A 2BRBA 1YDTE 3G9LX 4D1SA 3ORTA 4L7FA 5AUWA 2Y4PA 4N6ZA 1MUOA 5CEQA 3OY1A 2F7EE 4CGAA 5TF9A 4ALUA 3DGKA 3ZRKA 2R5TA 5HG5A 3A7IA 4GT3A 4JDJA 4D58A 2BIYA 1HCKA 3Q4CA 1ZXEA 4FEUA 5AR8A 1WBNA 4ZTSA 3KMMA 1S9IA 2PULA 3MTFA 3OZ6A 2BHHA 5FDXA 2CMWA 1DAYA 2YCFA 3K54A 1Q62A 2OF4A 3I0OA 3P86A 3F3ZA 2BILB 3EOCA 3IDCA 1JKKA 4FSZA 3KU2A 4TWCA 5IQAA 1XH8A 2XVDA 4IX3A 3PTGA 2XYNA 4C3FA 4TYGA 5EHOA 4EWHA 4EQCA 2GQRA 3RNIA 1YWRA 3QCYA 4CQGA 4YPDA 2VV9A 3IGGA 2ZV2A 5DRBA 2HCKA 1VEBA 5LVNA 3KXHA 5HZNA 1A48A 3PA3A 4OTGA 4RVTA 3CKWA 2H8HA 4AA4A 2I0YA 5DR2A 4GH2A 4AACA 4FKSA 2I0EA 2QQ7A 4IBMA 5E8WA 5IA2A 2C3JA 2UW3A 2PYWA 3QC9A 4CKJA 2W4OA 5CX9A 3MIAA 3MB6A 2CLQA 3MH2A 1ZYSA 2AUHA 5BVEA 3V8TA 4CQEA 3GCQA 3QQFA 3R63A 4LFIA 4WNOA 5EM6A 3ROCA 5BVFA 3HL7A 3UZPA 5JZJA 4UB7A 3UOHA 4CFNA 5EW3A 4C2WA 4K33A 3I79A 5LMBA 1F3MC 1LP4A 3L8SA 4DEGA 5KBQA 2X6EA 4CRLA 2HW7A 4JRVA 4CT1A 3DKOA 4J8MA 4ZSAA 4C38A 4IDVA 1PXNA 3SXSA 5GHVA 3KL8A 3NDMA 5E1SA 5FTGA 4F7SA 2PUNA 3NPCA 2OBJA 2PSQA 3TL8A 4BF2A 3LCKA 3OY3A 4EZ5A 3AC1A 4L53A 1UNGA 1E9HA 2O65A 3EYGA 2FSTX 3DBQA 3QTWA 4YZBA 5HOAA 4AUAA 4FL3A 4PNKA 3TIYA 2GDOA 3RNYA 4DLIA 2PMNX 3ZBXA 1SYKA 4MHAA 5ANGA 3MY1A 1IAHA 3RMFA 3WZJA 2KTYA 2XK6A 1G8AA 3UC4A 4MVFA 5H8GA 1M14A 3EQFA 4U97A 2IO6A 5IH4A 4KIKA 3REPA 2OJIA 5JN2A 2IW6A 5GJGA 5AX9A 4RQKA 2XIXA 3W16A 4QTBA 4WNPA 4N0SA 4EH9A 2YM4A 3WF9A 4KS8A 1W8CA 3HA8A 5HORA 1I44A 3OBGA 2QO2A 1PKGA 3NCZA 3AC8A 1W7HA 2B9FA 3PPZA 4IM2A 3C51A 4NJ3A 5ACKA 5F94A 4EUTA 1QCFA 4NFMA 2JDRA 4C3RA 2YM7A 5E8XA 2Z7SA 3PIYA 2WZJA 5EDRA 5IA3A 3TTJA 4B0GA 4XHKB 4JQEA 3QA8A 2ZVAA 5IEVA 2HWPA 3PXFA 3VN9A 2VX1A 5M51A 2R9SA 3FMDA 2JAMA 2HZ4A 2V7OA 3BHTA 3RK7A 3GC8A 3C5IA 1YI4A 4RIWA 3OXZA 2BAJA 5H9BA 4DH5A 3DKGA 4D2VA 2QKWB 4NIFB 3ENMA 4X2JA 4H3PA 4FIHA 4RVKA 4YJUA 3ACKA 3QWKA 1XO2B 2UZNA 5JRSA 4BI0A 3ALNA 3TEIA 5I9ZA 2ITZA 2OH0E 2XCKA 2OJ9A 2P3GX 3MY5A 4IVBA 4J7BA 4HCVA 3FY0A 4KA3A 2XEYA 3U4UA 3BELA 3CTJA 3I1AA 4EUUA 3PZEA 5LXMA 2V7AA 2J5FA 3FZSA 1JKTA 1J7LA 5ACBC 2J5EA 4AW0A 4P5ZA 3QLGA 5BYLA 2W1ZA 3E8CA 3S4QA 3EFKA 3W10A 3R9DA 3U8WA 3QD2B 4I5CA 2A27A 4MD9E 5CXHA 2JITA 3R7VA 4WKQA 5AMNA 5DR9A 1BL6A 3TNHA 1XH4A 1FVTA 2XIYA 4ID7A 3OP5A 4JVGA 2UW8A 4J97A 4EONA 3GQLA 4FL1A 2QVSE 5HIEA 4RA4A 2GHMA 4BCGA 3RM7A 5I5ZA 3LMIA 1YHSA 1FBNA 4QYFA 4RJ4A 4R3CA 5EG3A 3DAKA 5C03A 3CQWA 5AM7A 4OLIA 3VW6A 2FYSA 2CKQA 5DT4A 4C34A 3EHAA 2PZ5A 3W2CA 2W9ZB 2VO3A 3KCFA 4X3FA 4DH1A 3RTPA 5AFVA 1W84A 2G2IA 1NY3A 2I0VA 3KN6A 4QPAA 3G0EA 1SZMA 1ND4A 4BGQA 3LMHA 4QP1A 4L01A 3JY0A 4AZEA 4RX7A 3OEFX 1R3CA 3ZEPA 5AUTA 1ATPE 2OWBA 2PZRA 5CZHA 4DCEA 4TNDA 4IZ5A 5AA9A 4I93A 2WTCA 3BWFA 1YW2A 1SVHA 2XKEA 3L9LA 4JQ7A 4C58A 5CS6A 3MESA 1UKHA 3UIBA 1GJOA 1ZMUA 2VO0A 5TR6A 1QPEA 2O64A 5CEPA 3Q5ZA 3RHXA 4DEEA 4O21A 5CI7A 1IASA 4QT1A 3MSSA 2J50A 4E4NA 4O27B 3VRYA 4JG7A 3NUNA 5IQBA 3VNTA 4MTAA 2C68A 2QOLA 3C4CA 3QUEA 4ENYA 3RI1A 4QMYA 1U46A 3CC6A 3TIZA 4BCHA 1QMZA 5LVMA 3UPZA 3Q04A 3IW7A 3O8PA 4EC8A 4FNWA 1H24A 4GT4A 3RAKA 4P2KA 3UE4A 4UEUA 1PMUA 4I0RA 4ACCA 1OIQA 3KRLA 5B2KA 4CSVA 3GC7A 1KWPA 3L9PA 4TYEA 5AUXA 3OOMA 2ITQA 4JT3A 4MNEB 5JEBA 3W33A 3JS2A 4RX9A 3RK9A 4I0SA 4F9WA 4L3JA 4AS0A 2R3FA 3VRZA 1RE8A 1DI8A 4IAAA 3FZTA 1M2PA 4IMYA 4M7IA 3FLNC 2YJSA 2JEDA 3FE3A 5M4CA 4YC6A 2WMQA 4MX9A 3AMBA 3MFRA 3R8ZA 5BYZA 3DZOA 2ZYBA 4RFYA 2C6IA 3NNXA 4FV0A 2C6EA 4C62A 3H3CA 3K2LA 4KS7A 2GNGA 4LGHA 4XOZA 4XOYA 3ET7A 4YTFA 5M4IA 1CMKE 5C26A 3ZBFA 1M2RA 3LXKA 2C6LA 4BCOA 3ZFMA 4ZS0A 1XKKA 3QZFA 5L8KA 4JXFA 1WVYA 4IWDA 4XRLA 2B7AA 5DT3A 2W1DA 4M84A 2B9HA 4XLIA 2FVDA 4ZSLA 5M06A 3M42A 3IO7A 4CLJA 4K11A 1OGUA 3W2OA 4HYUA 5HG7A 5K4JA 3GXLA 4I6FA 3WE8A 1EH4A 2WGJA 3DJ6A 3DBFA 3OXIA 4J52A 4BTKA 4DH8A 5K0XA 4BY9E 4RSSA 4QMSA 3U87A 1H1SA 3ULIA 3LPBA 3RGFA 3FMHA 4O96A 3PJ2A 2ZV9A 3NUYA 4DCAA 3C9WA 4W9WA 2PUUA 3FPMA 4IB0A 3IW4A 4Q9SA 4JX3A 2XNNA 4TZRA 4AZTA 5DIAA 3Q2JA 3WF7A 2BPMA 3UQGA 3NVKI 2XJ0A 5KMNA 4IX6A 5JGDA 4FK3A 1O6KA 3FMEA 3P1AA 1PMNA 4QMLA 3UO6A 5HD7A 4MBIA 2G9XA 4OTPA 2W0JA 5BVOA 1OL6A 2QR8A 2VN9A 3E5AA 4CYIA 5JGAA 2H34A 1IRKA 4HNFA 1WBVA 4WSQA 2OIDA 4AA5A 2BAQA 4YUQA 3LE6A 3DB6A 3MWUA 2XEZA 1FGIA 3CR0A 4DT8A 2CHLA 2C5NA 3NNWA 3QCSA 3VO3A 5B2MA 5FDPA 2PPQA 2QURA 2W5HA 4ARKA 1H1RA 5JFXA 4G1WA 2GNFA 1P5EA 1WBTA 4NUSA 5CT7A 3FI3A 5AA8A 4I5HA 5CAOA 5HIDA 2HW6A 1YOJA 3AT4A 3F82A 4EOOA 3FC2A 4TYJA 5CAPA 4FTCA 2HXQA 4WNKA 1Z9XA 2GTMA 3FZRA 5L3AA 4E7WA 3ZCLA 1JQHA 3E62A 3IECA 4I20A 3OCSA 4JLCA 1NXKA 5LWNA 5BMSA 5A46A 3LFQA 3MI9A 3F6XA 5HQ0A 2ZM1A 2CGUA 3H4JA 3OT3A 5EYDA 4OT6A 5AP0A 4C61A 4ZAUA 3MV5A 3NAXA 2XP2A 3EIDA 4NIFA 5ANOA 3P79A 4EOLA 5EKNA 4KD1A 4FSNA 4OTFA 4RZVA 2B1PA 2XJ1A 3PRIA 1TVOA 5L2TA 4TWPA 3DNEA 1J1BA 1PXKA 5FD2A 1YXTA 1ZY4A 3PXRA 4TNBA 3COMA 3FLYA 1OL7A 2XK7A 3QZIA 3PXQA 3DNDA 4NSTA 3CJFA 4LV8A 3Q9XA 4FGBA 2RL5A 4O2ZA 4Y5QA 5CZIA 3V51A 3OROA 1PMVA 4YJVA 1V0BA 1H00A 1YXSA 4BKYA 2IPXA 4RRVA 3A99A 3O17A 3H10A 2C6DA 2CGXA 3U9NA 4HPUE 4I21A 3ZXZA 4BWXA 2WU7A 3IW5A 4MXAA 3FAAA 1Q8ZA 3GU4A 4FG7A 2Y4IC 4FV1A 3ZHPC 1YVJA 3Q2MA 4ZLYA 2VZ6A 1CM8A 4IJ9A 4CVAA 5JSMA 3LHJA 5KMIA 4FTRA 3RCDA 4BHNA 2G01A 3GNIB 4U44A 3GI3A 5JKGA 3GFWA 4K8AA 4FYNA 3QTIA 3DCVA 3E63A 5HLWA 2W5AA 4L00A 4Z9LA 2DUVA 3GGFA 4P90A 5HVJA 5CVHA 4ERKA 1GZ8A 1SVEA 5IF1A 4D5HA 4XYFA 4OBQA 4QQTA 4JL9A 3KRXA 3ZC5A 3R22A 5IU2A 4DYMA 1ZYCA 3QTUA 1UA2A 3DKFA 4KIOA 2LGCA 5AIRA 3N9XA 3QRJA 3BLHA 2JD5A 2G1TA 3UMWA 4BIDA 2YM8A 4BVUA 3CSVA 3CD8A 4FT0A 5K9IA 2QOOA 3KRWA 4YLJA 3VQUA 2A19B 2OXDA 4QTCA 4A9UA 4PMMA 3EFLA 4ZEGA 4DH3A 4E4LA 4PP7A 5K0KA 4R77A 2YLEA 4D0XA 4GT5A 3NW7A 4QTEA 4HGLA 4FVQA 2W1GA 3SHEA 5F20A 2OGVA 2JIVA 3RPRA 2PMIA 5D1JA 5CTPA 5ANDA 2ETMA 3IPHA 3Q9WA 4KBCA 2C5YA 3GU8A 5FP6A 1H25A 4WRSA 4AOJA 5IUGA 2UZUE 4E26A 2PVHA 3D14A 4D4SA 5C8NA 4N57A 1YHVA 3ZO1A 1H0VA 4ZK5A 2QOQA 4ASZA 4FKLA 3FI2A 4NEUA 3PSBA 4C4JA 4BCIA 4R3PA 1WMKA 4UXQA 2QHMA 3L8PA 1U5RA 4E93A 3GU7A 3K3IA 4G9RA 4FEWA 5EI6A 4NH1A 5JMSA 3TCPA 4CMUA 4V0GB 3UGCA 4DC2A 2OKRA 2O3PA 3F88A 3PXYA 4FODA 5AIKA 3R8VA 4QMPA 3V3VA 4JAJA 5IH5A 3AT3A 3IW6A 4L3PA 2X7OA 3TT0A 2HAKA 1OZ1A 3OTUA 1NT2A 3UJGA 3PLSA 3R30A 4I4EA 3KB7A 4ZZOA 3FSKA 4FVRA 4LV5A 3Q32A 4MH7A 4DTAA 1KV1A 4PDOA 4D5KA 3ELJA 4IM0A 1TQIA 4MNEA 4O7WA 1WBOA 4RIXA 4F63A 3DFAA 5A4TA 3LCDA 4MAOA 1OKWA 5DYJA 3PXZA 3QHWA 1RW8A 2IN6A 3HAMA 1H8FA 3F69A 1ZYLA 4NTTA 3OVVA 4EL9A 3SD0A 4GVJA 4BN1A 1WBPA 2O63A 5HX8A 4GU9A 4YNEA 3NS9A 1XBAA 3D9VA 5JQ5A 4O1PA 3O0GA 4F09A 2GTNA 4CFWA 4ACHA 3TZ9A 3KGAA 3PUPA 4PV0A 4U80A 1J1CA 2Z7QA 2VAGA 5D11A 4EC9A 4IWOA 1W98A 5J87A 2YWVA 4AW5A 4C36A 4IB1A 5B7VA 2OH4A 4I6HA 4HCTA 2YABA 5EI8A 4BL1A 2XUUA 3I5ZA 4GCJA 5DRDA 3GC0A 3MA3A 2PE0A 4H3QA 5HX6A 5AR2A 3OWPA 4F9YA 2UW4A 4I5PA 4RPVA 3ZH8A 5BYYA 3QQLA 2WOUA 4RJ6A 5C4LA 3L8VA 4FTLA 3QCQA 5KNJA 3VUMA 3PIXA 3HZTA 4CRSA 4O1OA 2ZM4A 3ORPA 4AZWA 4L42A 3CP9A 3PRFA 4RG0A 4D1XA 3RALA 1F5QA 2Q0NA 4O6EA 5DHJA 3FLWA 4CCBA 4C4FA 3R9OA 5KO1A 4BDDA 2OU7A 2EXEA 5CQUA 3QX4A 5AEPA 1K3AA 1MRUA 3FYJX 4FT3A 3BZ3A 3VC4A 2Z7LA 3GB2A 4D0WA 2GQGA 2QOIA 1MP8A 3F3VA 1GZOA 1K9AA 4XBRA 3VULA 3P7AA 3FQHA 4F6WA 4F6UA 2QOCA 3DKCA 2R2PA 4BDGA 3SAYA 5CSXA 3VWAA 2WQBA 5L6OA 3CY2A 3EN9A 3I60A 3MDYA 3D7ZA 4R6VA 4ANQA 4R5SA 2P2IA 1SM2A 2XK4A 1TQPA 4FIFA 2F9GA 2PY3A 2J7TA 3QXPA 4HZRA 4TWOA 4W8DA 4X2KA 3ZDIA 2W1FA 3UG1A 3PZHA 2CGVA 4ZLZA 4JIAA 3O23A 2UZVA 1VYWA 3I7BA 3MH0A 5IMEA 4JS8A 1PY5A 4D2PA 2YZAA 3WZKA 2CKPA 5BVWA 2VO6A 2GS2A 3BBWA 5KE0A 2HOGA 4JI9A 4BTFA 4HVGA 2R0IA 3TG1A 1JSVA 3EQDA 2ITNA 2QO7A 2C6OA 2VTLA 5HVKA 2X8EA 3FXWA 1OKZA 4IFCA 2YHVA 3TWJA 3QTZA 4O6LA 3ZXTA 1H28A 1VYZA 1NVQA 5KMJA 2R3PA 2YAAA 3RJCA 2E2BA 3ZMMA 3BHVA 3RCJA 4ITHA 3UP7A 2XM9A 5AUVA 3UPXA 4RZWA 4C4IA 2WFYA 5FEEA 5HNBA 4BDBA 3PVWA 5J9ZA 1OMWA 2VTAA 3D2KA 3LFBA 3W8LA 1RJBA 3OCBA 3CTHA 4Y5HA 2PVKA 4DLJA 4LMUA 5F1ZA 3EZVA 2X8IA 4K77A 3ALOA 4G6LA 4GRBA 4D9UA 5BVDA 5HLNA 2F4JA 1JKLA 4C37A 4F64A 2HZNA 2G2HA 3R1SA 3FI4A 5HBJA 3NSZA 5BVNA 4IAZA 3D94A 3D15A 4R7IA 3R8LA 3BEGA 2UVYA 2J0JA 3DTCA 3HDMA 5CEOA 4FF8A 2R3OA 4FIEA 1R39A 3VS0A 4O7NA 4DFUA 2E9UA 3VBQA 3ZLXA 4EK6A 2HELA 2QU5A 4OUCA 5K5NA 5D41A 5L2WA 2EXCX 4NU1A 1UKIA 3QRKA 2CGWA 4EHEA 5GZ8A 4ZTHA 3BU6A 3R1NA 4E3CA 4WHZA 4QNAA 2R3NA 5DLSA 2YISA 4ZS4A 5FLFA 4QMQA 3OHTA 1ZOEA 4GS6A 4I22A 4BYJA 3WZUA 5E9EA 3RAWA 3N4VA 3PWYA 4E73A 4AN9A 4F65A 2VTOA 3BBTB 2Y0AA 2GMXA 3FC1X 3ORIA 4XX9A 4A9RA 4EH5A 3CPBA 4KRDA 3A7FA 3OBJA 3MFSA 5K5XA 5E8VA 4ACMA 3E8DA 3RPVA 5A54A 3SRVB 4E4XA 4I3ZA 3K3JA 2IJMA 4R7BA 1Z5MA 4DA5A 4G6NA 2G2FA 3TKUA 4BCPA 4R78A 2X8DA 3TZ8A 2E9PA 3F2RA 2OXYA 1MQBA 2XRUA 4LOOA 2OIBA 3BRBA 4W8EA 5AAGA 4ALVA 2C0TA 2VO7A 3DPKA 3KK8A 4OT5A 3SW4A 3ZDUA 5JFVA 3U54A 4V01A 4NCTA 4UXLA 4WA9A 4O0YA 3WE4A 1CSNA 3I4BA 5FBNC 2BALA 1XBBA 2VWBA 2WTVA 2PVLA 2Y4IB 4IIRA 3CQUA 4D2WA 4EKLA 4NFNA 3U6IA 5CF6A 4IVAA 3R7EA 2PVJA 3F5UA 3MYGA 2ZV8A 4FTQA 4MK0A 4PMPA 1FINA 4O7YA 3E3BX 4V0GA 3LXLA 3PSCA 5IA1A 2GNJA 4FKTA 4XEYA 4F9BA 4IADA 4M13A 3QTQA 2CCHA 2YFXA 4DEAA 2R4BA 3C13A 4XG3A 5DR6A 4BDEA 4YO4A 1JOWB 4FV3A 4FTMA 5HE2A 3VBYA 3ZUTA 4F0FA 4FEXA 4O7LA 3DLSA 3OXTA 3EN7A 4JNWA 4YJTA 1FQ1B 2X9FA 4YC8A 4FSWA 2YLFA 3QC4A 3D7TB 4PPCA 3S2PA 2PK9A 4EZ7A 4R1YA 2BZKB 4UWBA 5HTBA 3K5UA 3NRMA 5HE3A 3WBLA 4F7LA 2FGIA 4O0WA 3A4PA 1JLUE 1T46A 2C5OA 2HENA 5CU2A 2BHEA 4G2FA 2QOKA 3G9NA 1PXIA 5HEZA 5M44A 4QQCA 4XBUA 1CKPA 5ETAA 4KNBA 3F5XA 2JDTA 2PVNA 5FEDA 4GKHA 2QOHA 3V5PA 5IQCA 3H9OA 1U54B 2XNGA 3HLLA 5A4QA 3TACA 1Q8WA 3UQCA 5IQEA 4MF0A 4PL3A 4RFZA 4XG7A 2OXXA 2W1HA 4RA5A 5I9UA 2IZSA 2F7XE 2YN8A 4O82A 2OZAB 4GEOA 5HESA 3ODYX 3PY3A 4OAVB 2WMBA 4ZJIA 3QHRA 3DU8A 5IUHA 1YOLA 3D2IA 3TJDA 3FLSA 2RG6A 1SMHA 2BTSA 4QP9A 1OBDA 5CY3A 2VRXA 3LCTA 3MTLA 1GOLA 2ONLA 3AC3A 1DI9A 2YCSA 3BYSA 4TWNA 4WIHA 1B39A 3QQUA
chains in the Genus database with same CATH superfamily
1BX6A 3POZA 4IZYA 4Y72A 5HVYA 1LEWA 1QPJA 3IQ7A 4U45A 5EFQA 2X9EA 5LMAA 4AN3A 4FVPA 1NW1A 1PYXA 2J4ZA 2JBOA 2E9VA 4K1BA 4EYMA 3M1SA 3Q52A 4BKJA 5H3QA 4F7NA 2VX3A 1ZAOA 3BKBA 4M68A 4XJ0A 2QONA 1LPUA 5HIBA 2WOTA 3NNUA 2OK1A 3TKIA 4F9AA 4ZIMA 3LFEA 5DMZA 2C5XA 5C27A 3NZ0A 4GK2A 4FTKA 4WOVA 2NP8A 1PXPA 3LFNA 5IQDA 3UVRA 4FTUA 3WIKA 3PY0A 3F7WA 5E8UA 5LARA 4A4XA 5FG8A 5CVFA 3TNQB 3BE2A 4GV1A 4C3PA 3R01A 4ANBA 3O7LB 3COKA 3DT1A 3ORXA 3UYSA 2ITYA 3OUKA 3C7QA 5CU0A 4DT9A 4XG9A 3ZC6A 4EWQA 3S95A 4RC3A 5JFWA 3FMMA 3ZO4A 2A1AB 3FKLA 1ZARA 5AUZA 4RJ7A 3FV8A 2GU8A 3KKVA 3RVGA 4A4OA 1SVGA 1H1WA 3UOKA 5JRQA 2R64A 3W2SA 5EYMA 4NYEA 4FOCA 1ZOGA 2XIZA 4UV0A 2WTKB 3COHA 4FKWA 4IC8A 4V04A 1PHKA 5AR3A 2ZMCA 3QX2A 4FTOA 4ITJA 4QP8A 4GFOA 1KSWA 3K5VA 2IVUA 2XANA 3QYZA 2Z2WA 5A3XA 4DDIA 4YHTA 3CQEA 1YXUA 3UQFA 5J7BA 3VS6A 4DGOA 2Y6MA 3O71A 3DB8A 3VS7A 4UALA 3KF7A 5DG5A 4UWCA 4J1RA 3LLTA 4DGGA 3HNGA 3NW5A 3C4FA 3DK6A 3H0YA 4U9AA 3SOAA 2GFCA 4QP3A 3Q6WA 3A7GA 2XK9A 2ZB1A 4G3EA 3HMIA 4XNEA 3W8QA 4PRJA 4JJRA 2XH5A 1URCA 4MD8E 4AT5A 3WI6A 1V1KA 4Q9ZA 1M2QA 2JDVA 5EKOA 3JXWA 1P2AA 2VNWA 5AR7A 4JAIA 2J0MB 2O5KA 3ZEWA 5DWRA 3F5PA 3TV4A 4A07A 3RPYA 5CEIA 4GSBA 4C4GA 3PA5A 5J7HA 3KXXA 1VZOA 5E90A 5HCYA 1OIUA 4Y73A 5TO8A 2B9JA 1W82A 3GT8A 4BICA 4TT7A 2WMXA 4PDSA 3ZRMA 2NPQA 2J51A 5F4NA 2C5VA 3FEGA 3BLRA 2P4IA 1OBGA 3NVMB 3FL4A 4AZSA 5CAUA 4C8BA 3LW0A 3A4OX 2XKDA 3R6XA 4EQMA 4XV2A 2DWBA 4S31A 4BZOA 2X4FA 5C4KA 3TN8A 2XNOA 5IDPA 1OUYA 4UZDA 3GQIA 3HECA 3D5UA 3FHRA 4CFVA 1QL6A 2QG7A 1TZDA 3GFEA 2XIRA 3NIZA 2PVRA 1J3HA 5M55A 3P7CA 5IUIA 4KBKA 1ST4A 4O0XA 5BX0A 4GG7A 4NKSA 4PF4A 2CNQA 4F1OA 3V04A 3D0EA 2C6KA 2YDKA 4CKIA 3QFVA 4FKRA 4X0MA 5CU4A 3DOGA 3TTIA 2H6DA 3LFDA 4BIBA 3E64A 3P23A 4LOPA 4DGMA 1Y8GA 4PDYA 3P08A 4FTIA 4BTMA 4JG6A 2IZRA 3QRIA 4MQ2A 3U4WA 2VTJA 4E6QA 3KMUA 2BUJA 4XLVA 3U6HA 3FL5A 3OWJA 2GHLA 3H9RA 3HP2A 4O7ZA 3TZ7A 1H0WA 1YRPA 3NYVA 4X2GA 3UIUA 2WKMA 4B8MA 3F5GA 3NWWA 2JDSA 2OFVA 4AGDA 3DJ7A 4O84A 4P5QA 4Q5HA 2RGPA 4IM3A 4RT7A 2CPKE 4QP6A 1P4FA 4PDPA 5T68A 2IZTA 4YZMA 4IAFA 5KKRB 4JBVA 4RVLA 2BKKA 2JDOA 3WF5A 4MKCA 2PU8A 2EU9A 2X0QA 2VWZA 3GCVA 4FKVA 2IW8A 3ID6C 5ANIA 1JKSA 4X6RA 1OKVA 4F70A 3NX8A 4ZMEA 2YIQA 2YERA 3ZS5A 3FWQA 4U0IA 4UBAA 1PMEA 3DAEA 3HYHA 4KBAA 3DFCB 4G3DA 4YTHA 3D7TA 4IE9A 4QMMA 4QMWA 4KSQA 2ERZE 5LWMA 4UYAA 3QD4A 3I5NA 3AD5A 4JDHA 3NYXA 4XG4A 1KUTA 3AGLA 1WBSA 2I0HA 3TJCA 5AAEA 4XRJA 3DY7A 3L9NA 4EJNA 1BKXA 3AKLA 4RFMA 1WAKA 2KULA 1ZLTA 3QD0A 2QU6A 4AXAA 4AE6A 4E8AA 5LMKA 2R3LA 2PVYA 2BZIB 3UG2A 1YWVA 4GYGA 1U54A 2R3QA 3LQ5A 4U8ZA 4ZY6A 2R3MA 3QQJA 2C6MA 3O2MA 2NYAA 4AG8A 3CJGA 2GFSA 2VWWA 4DF3A 3MH1A 4BBMA 3EN6A 4USDA 4RWJA 4Z16A 3CXWA 4FEQA 1HCLA 2OZAA 4QNYA 3GCUA 3VJNA 3KK9A 4LUDA 4AQCA 3T9TA 3ITZA 4O81A 3V8WA 2ITVA 2GNIA 5AJQA 2J0KA 4D4RA 4EH2A 4FK6A 5ICPA 1WVXA 4U81A 5HD4A 1FMOE 3DQWA 2P2HA 4FIGA 3UNJA 5FGKA 1IEPA 4X2FA 1JWHA 4YBJA 4NM0A 4YNOA 4CTCA 2QOBA 1NVSA 3II5A 2I40A 1Q3WA 2JFLA 2XA4A 4LYNA 3AGMA 3QALE 3R0TA 3EN5A 3SLSA 2B52A 1X8BA 2YA9A 4K2RA 4F4PA 1Q41A 2ESMA 4CKRA 1OL5A 4QP2A 4LDTA 3UYTA 2EB2A 1ZWSA 2UVXA 2QO9A 4AE9A 3DLZA 5C9CA 4DEBA 4X6QC 3PVUA 3FBVA 3G33A 3NLBA 3WZDA 4DFXE 1FVRA 1Q8TA 4IH8A 4O4DA 1U5QA 3R9HA 3I6WA 2HY81 1Q97A 3R2BA 4H39A 4C2VA 4ANMA 3NGAA 1WZYA 4C59A 4I23A 4L68A 5AP6A 5CSPA 2QC6A 4IX4A 4S30A 2B9IA 4Y95A 4BJJA 1ZYDA 5DFPA 1Z57A 3LJ1A 1PYEA 4E5AX 5EQEA 3OTVA 4NJDA 4DTKA 1OGYA 4CT2A 5ETIA 3A8WA 4FX3A 4YSJA 1Q4LA 4ANOA 5DBXA 1L8TA 4XV9A 3UC3A 4IWQA 4IANA 3ZU7A 4AFEA 4KSPA 4PNIA 4RC2A 4CTBA 5M56A 4H3BA 3Q6UA 4F7JA 3GVUA 3HRBA 4FKGA 3AT2A 4D55A 3NEWA 4ZP5A 1QPDA 3FZPA 3PG1A 4AW1A 3L9MA 2UZWE 3C4XA 2B0QA 5AP5A 4BKZA 2AC5A 4EBVA 4XG6A 2OIQA 4RIYB 3JUHA 4ALWA 5E8TA 2J0IA 4L44A 3W2PA 4BRXA 1W0XC 2GHGA 2WQMA 4XP0A 4WD5A 3PE1A 4PWNA 4L46A 4F1TA 4QP7A 2CNUA 3KULB 3W2RA 3P78A 2W5BA 3I81A 4IZ7A 3C0GA 3HUCA 4D4VA 3VS2A 2F7ZE 4CFXA 4E5BA 1REKA 4X3FC 4UWYA 1ZY5A 4EOMA 2ETRA 4JIKA 1NVRA 4ENXA 3DXPA 4J53A 2QI8A 3FDNA 5FRIA 3VIDA 3EB0A 5KMKA 3OT8A 5CVGA 4EK8A 2P55A 3QQHA 3AC5A 4FZDB 4BIEA 3VONA 2F57A 1P14A 4BDCA 2J90A 5I3RA 4HGSA 2B54A 5LVPA 4RWLA 4C33A 3OD6X 5AP2A 2ITTA 4N70A 2BDWA 4B99A 2RFDA 4YJQA 5AV4A 2PVFA 3KF4A 4AN2A 4E1ZA 2CSNA 2VTMA 4MXOA 5LCJA 2XCHA 4OTDA 4FV2A 4RJ5A 1XHAA 3DDPA 5A4LA 5A9UA 4RX5A 4Y46A 3BE9A 1JVPP 2WMWA 4MXYA 5EW9A 3BYUA 4M14A 4YO6A 4FUYA 2YDJA 4XUFA 3OUNB 4S33A 3BHUA 1GY3A 3Q96A 5CAQA 2HY0A 4RC4A 4YP8A 3HVCA 3UVPA 2FSLX 2WXVA 2C0OA 4BC6A 4M67A 1A06A 2XARA 4M15A 4NM3A 2YM5A 4BDFA 4IFGA 4A9YA 1H27A 3HMMA 2VWYA 4PTCA 3TNWA 2X7FA 4OTWA 4ZTQA 3BU3A 3SXRA 4EYJA 1W2FA 2E9NA 3A7HA 3R1YA 4LRJA 4QMOA 4F0GA 3W2QA 3SV0A 4U3YA 5CASA 5HU9A 5JK3A 5KMMA 5EDPA 2VTSA 1H1QA 2OI4X 1GAGA 2WTDA 1PKDA 3NMUF 3PP0A 3O51A 5C1QB 2XNEA 3F2AA 4EI4A 1I09A 2PHKA 3IONA 5LVOA 4HCUA 3CGOA 4YLKA 2PWLA 4BCJA 4ASEA 3FLZA 3NFFB 4FV8A 4QEBA 5KMLA 3SKCA 3UO5A 3MB7A 3KA0A 4S2ZA 2G15A 4YSMA 3BYOA 1W83A 3MGYA 4BDAA 3S1HA 4AXFA 4EOQA 2HYYA 4TXCA 3RPSA 3CS9A 4JBOA 4MF1A 2VWUA 5A6OA 4ZXTA 4EQUA 2OJJA 4IEBA 5M4FA 3QUDA 5HICA 4FTJA 4RWIA 4AFJA 4J71A 4NWMA 3W0SA 2BZHB 4QOXA 1MRVA 3V6SA 4ZTMA 2GPHA 3BLQA 4APPA 1OIYA 3GOPA 4KINA 4U7ZA 4E5WA 4DFYA 3UIXA 3RKBA 1GIHA 3CEKA 3LZBA 4EH3A 4W4XA 3KFAA 4QTDA 2IG7A 4FV4A 1JPAA 2XBJA 4YC3A 2UVZA 4HJOA 4CMOA 3VUDA 4X21A 3V01A 4WG4A 3UTOA 5D7VA 5KUPA 2FA2A 3FHIA 2QODA 1RQQA 4U6RA 5EQYA 2H96A 4X2NA 2GNHA 4BDKA 3EQGA 5IQIA 2VTIA 2VWIA 2VX0A 3AMAA 4FG8A 5DGZA 3TI1A 3N4UA 1OB3A 2UZDA 3PXKA 4DBNA 3ATTA 4AP7A 4EKKA 1V0OA 3VW8A 1MRYA 4CXAA 2WMAA 3LFFA 1RDQE 5BUJA 2J2IB 4XP3A 1KE5A 2WTWA 4IX5A 1CTPE 4H1JA 4GUBA 3VBTA 4DGNA 3B8QA 4QMUA 3MFUA 5CXZA 5AAFA 2JKQA 1GIIA 2BVAA 2VU3A 5CI6A 4B6LA 4FSMA 3HGKA 2FSMX 3A8XA 2EB3A 4A06A 4MXXA 5EYCA 3SG9A 1XH7A 1OM1A 3FLQA 4ZJVA 3DBDA 2BFYA 1S9JA 1Y91A 2VWXA 1BL7A 3EWHA 4MWIA 4QYGA 1ZYJA 4RVMA 1W2CA 4PTEA 1UV5A 2VTRA 4PUZA 2RF9A 4BBFA 4P4CA 2R7BA 5I9WA 1XJDA 2IW9A 3MW1A 1BUHA 4FNXA 2YCQA 2WQNA 4TL0A 4JG8A 1XMLA 4G3FA 4XS2A 3BU5A 5E4HA 2YM3A 1A9UA 3R2YA 5AUUA 2X7GA 2EXMA 3KEXA 3DV3A 5KZ0A 3DXQA 4DBXA 3G2FA 4QTAA 4M12A 4D2SA 2XKCA 2VTTA 4PY1A 4JMQA 2CN5A 4WSYA 3AG9A 4BB4A 3KXNA 4BDJA 4DG0E 1ZMWA 2RFNA 2R3JA 3VAPA 5CF8A 4ANSA 5J9LA 5CENA 3FY2A 3ZFYA 1OL2A 1PXJA 4YU2A 4A4LA 3QGWA 1QPCA 4G17A 5DVRA 4BCNA 5M4UA 2X2MA 4DE4A 4OR5A 1B38A 5IEXA 4KB8A 4USFA 3FSFA 3SGCA 4HYSA 4I5MA 3RWQA 5HHWA 1OECA 4B9DA 3BEAA 3WF8A 3P0MA 5IH6A 1K2PA 1OPJA 3QTXA 5KZIA 4LUEA 3UO4A 4ASDA 5D9HA 2UZBA 3L1SA 3O8UA 2PL0A 3V6RA 4C4EA 2JBPA 4KIKB 4I4FA 4LOQA 3FZ1A 3OCGA 3UDTA 5I9VA 3B8RA 4MNFA 4HVHA 3ORKA 3D5WA 4M66A 5C01A 1BI8A 4JBQA 2X1NA 4EOIA 4FL2A 5A14A 2XS0A 4FIJA 5DA3A 1REJA 3LVPA 3M11A 1Y57A 4O4FA 3OG7A 4KKHA 4YPSA 4LL0A 4C4HA 4O22A 4ZY5A 4ONAA 2W1IA 3A7JA 1JSTA 4U5JA 4BDHA 3C0HA 3ZLSA 2AC3A 4O7TA 4BZDA 1PW2A 4N4SA 4F6SA 4O83A 3PYYA 4O91A 2WO6A 3B2WA 2YWPA 2FB8A 3C1XA 2FH9A 4I94A 5FM3A 2V5QA 2OLCA 2X2LA 3ANRA 2VTQA 3EKKA 4G5JA 4LV7A 5TKDA 4EHVA 2CNVA 4D9TA 1KOAA 2B53A 4L3LA 3KREA 3N4TA 3C4WA 3KULA 5BMMA 2YAKA 4K18A 3TV6A 1PXOA 3LFCA 2UW0A 4IAKA 3U55A 4FV9A 3G90X 4QQ5A 5KCVA 2R3HA 4EK4A 2IVSA 3DBCA 4APCA 3MJ2A 4KWPA 5CALA 4GU6A 1AD5A 3HV3A 1TFFA 2J6MA 3BGZA 2QD9A 2AYPA 2GS6A 3OW4A 4QYYA 3QRUA 5K3YA 4GVAA 4X3JA 4IVDA 1YOMA 2XK3A 4Y85A 1UWJA 4G16A 2BRNA 4CFUA 2WHBA 2ITUA 5TE0A 3ZZEA 3HRCA 3FMLA 4LI5A 4M8TA 5J5SA 2UW9A 4YJSA 2C3LA 4QYEA 1F0QA 2XM8A 3NNVA 4EK3A 3LLAA 4RBLA 4E4MA 3FI8A 4NM7A 1AQ1A 2C3IB 1KE7A 3EQRA 3FMKA 3PPJA 4HGEA 4I41A 1XQZA 5AV1A 1YI6A 3C4EA 3MVLA 4ITIA 1STCE 3TKHA 4BBEA 4TRLA 3R83A 5LJJA 2OW3A 5AP3A 4FTAA 3HX4A 5L2SA 4XP2A 2YEXA 5CU6A 3BWJA 3R7UA 2UV2A 5D7AA 3MPAA 5IG1A 4I6BA 3JYAA 4JOAA 2W1EA 2XF0A 4PPAA 4QMTA 5EM5A 1O6YA 1YDRE 5CEMA 3RK5A 4KIPA 3R7GA 5E7RA 4FV5A 4FV7A 4G9CA 4ASXA 5LVLA 4D2RA 5HNGA 4X3FB 3RZFA 2GSFA 4EORA 4B4LA 2UW7A 4YBKA 5GJDA 1UNLA 4FSQA 5A4CA 3FKNA 3T8OA 4GFGA 3I6UA 1KOBA 3BYMA 3O7LD 3EFWA 4W9XA 3CLYA 1BLXA 3ORNA 3QBNA 4BGHA 3FQEA 5I9YA 2ZOQA 3IOPA 2R3KA 3R9NA 3OWLA 3VQHA 4MXCA 3AD6A 3RM6A 4W4YA 3T3UA 3VS3A 4AX8A 4Y8DA 5CF4A 2BDFA 3ORLA 2WMRA 4M3QA 3PJ3A 5A6NA 4MYGA 5HE1A 3F61A 4PTGA 5HBHA 5L6WL 1KV2A 3VUTA 3BI6A 2WEVA 3DS6A 3IOKA 5IDNA 3HMPA 5LQFA 3ETAA 4GKIA 2O8YA 3PA4A 3R9RA 4PL5A 1OI9A 5KHXA 2A98A 3BL7A 2QLQA 4UMRA 5B2LA 3PIZA 5IA4A 5IQFA 4R1VA 3P9JA 2WIPA 4FTNA 3LJ0A 1OIRA 5HKMA 5HO8A 4DG2E 3ZO2A 2FUMA 3BHHA 4FNZA 4QPSA 4YZCA 4BWKA 1KE9A 3LMGA 4AGUA 3BQCA 4NM5A 4NW6A 4DHFA 4HW7A 3S0OA 1BMKA 4FUXA 4PP9A 4TPTA 4YTIA 3F7ZA 2A4LA 3TNPC 4AWIA 1IA8A 3E93A 4ACGA 5ANJA 3QD3A 4WBOA 3MBLA 3PFQA 2BRHA 2WU6A 2WMTA 3ZUVA 2R3IA 4BTJA 4IB3A 3R7OA 2GCDA 2QCSA 3KN5A 4CG9A 1M52A 2W4JA 4R5YA 1UU3A 1JSUA 2B55A 3M2WA 4GW8A 2X0OA 3DK3A 5DEWA 4DINA 3FMJA 4G6OA 3RP9A 4RX8A 1H4LA 1U4DA 4EOJA 2LAVA 4IQ6A 4RQVA 2HWOA 5AR4A 4FKOA 3Q3BA 4AOIA 3OS3A 3R71A 3ENHA 3E88A 4M0YA 3QQGA 3L8XA 1B6CB 5B0XA 4HOKA 4EJ7A 5FEQA 1R1WA 3SDJA 3OW3A 2WNTA 1DM2A 1U59A 2BCJA 3HRFA 3MJ1A 3Q60A 4FC0A 4FKUA 4L8MA 5L4QA 2JLDA 4DFBA 3CY3A 3SOCA 5J5TA 4FZ6A 3C5UA 2P33A 3W55A 4U79A 1Q99A 5HG9A 1GZKA 4J95A 2Z02A 3E7VA 3O96A 4J96A 2BDJA 5EYKA 3UMXA 4CEGA 3ERKA 2X39A 4MQ1A 3UZTA 2DYLA 4I6QA 4Y83A 5F9EA 3R04A 2REIA 2VTPA 4FKPA 5E1EA 5M53A 3LXNA 3UNKA 5KX8A 4KKEA 5DI1A 5DH3A 2XZSA 4ZSJA 2PMOX 2V0DA 4FNYA 1XR1A 4JDIA 4CMTA 4BGGA 4EOKA 4IAIA 4NZWB 3NIEA 3DAJA 4K9YA 2BIKB 1ZOHA 5LCKA 3RHKA 4U42A 4EEVA 4ORKA 2UZTA 4QPMA 3QGYA 2ITOA 3AKJA 4OW8A 4IW0A 4KKGA 3ZYAA 5DPVA 3ACJA 2PZPA 2YCRA 3V5TA 3F2NA 2OO8X 2XB7A 1FMKA 3UBDA 5BUIA 4II5A 3VUHA 3OFMA 2ZAZA 4B8LA 5HTIA 2Z60A 4UX9A 4CYJA 4MBJA 4ERWA 1H08A 5JQ8A 4U43A 3E92A 4L67A 1E1VA 1KE6A 5EH0A 3H30A 3V5LA 4USEA 2ETKA 2GS7A 4QYHA 3CE3A 5CNOA 4IAYA 5HGIA 2ITXA 1UU9A 1XBCA 3PLAE 3ZONA 5C8KA 4RJ8A 5CSHA 3THBA 2V22A 5AV3A 3VBXA 5FWKK 3PDTA 1FOTA 2IVVA 3VS5A 1Q8UA 1SNXA 5AWMA 3EL7A 2QOFA 3ORZA 3ZTXA 3QKLA 4XV3A 3UDSA 1O9UA 3KMWA 3PVGA 4NKAA 4HVIA 4JX7A 2VNYA 2W7XA 3EH9A 3IGOA 4BCFA 3VBWA 2JKKA 4XG8A 2VGPA 5A4EA 4O0VA 4LL5A 5L2IA 3R28A 2W99B 1M7QA 3DQXA 4EBWA 5GIOE 3KCKA 4F0IA 2WD1A 3FUPA 4HGTA 2ZMDA 4LM5A 5CWZA 3LIJA 2UZLA 1W2DA 4DH7A 5IKWA 4I92A 2CKEA 4PQNA 4S34A 3MIYA 4J98A 4C7TA 2PVMA 2OSCA 1XH9A 4NCTC 4NW5A 3F3TA 3W32A 5FTQA 3WZEA 4I6LA 2QHNA 5E8SA 3PP1A 2YIRA 4AT3A 3DK7A 3VHEA 4UMUA 1Q8YA 4BDIA 3LM0A 1O6LA 3NW6A 4G3CA 4YZ9A 3B2TA 4OTHA 3OWKA 4UMQA 4DG3E 3E7OA 2HXLA 5J9YA 4FT7A 5IMXA 3JVSA 3U9CA 4L6QA 4D2TA 2FO0A 1UWHA 4BYIA 4R8QA 5CYIA 3VHKA 4O7VA 1XH5A 4DN5A 4L52A 5G6VA 3HMOA 3SRVA 5CLPA 3W0NA 2O2UA 4TYHB 3E8NA 2VD5A 3MS9A 4O0TA 3ZSHA 4Z55A 4HNIA 3VJOA 3KXZA 2JGZA 4R7HA 4CFFA 4AZVA 3CGFA 3CBLA 5FXQA 2P0CA 4XMOA 4OBPA 4O2PA 2YIYA 3EL8A 3FXXA 3LQ3A 2CJMA 2PE1A 3SA0A 5J1WA 2VGOA 5K4IA 3ZO3A 1WCCA 3KVWA 2NNWB 5EQPA 3UIMA 4C0TA 3G6HA 2C1AA 3BGPA 4YJPA 3AQVA 5ANKA 5L8JA 5L8LA 3BLAA 4TW9A 2XKFA 5CSVA 2ZDTA 3WILA 4V05A 1R78A 4HPTE 3NAYA 3QU0A 4FZAB 2WTIA 1E1XA 4OTQA 5CSWA 4NK9A 2QR7A 3RWPA 4AOTA 4BI2A 5FBOA 4DAWA 4DGLC 1LEZA 4R3RA 2OJGA 2PMLX 3MH3A 4AAAA 2WMSA 4FI1A 2F2UA 3QKMA 3UODA 4CZTA 3QYWA 4FMQA 3R02A 1FPUA 1Q61A 2WQOA 4QMVA 5H8BA 4YHFA 1CDKA 5HCXA 2XNMA 3R73A 1NA7A 3QZGA 3QA0A 4Q5EA 2IZUA 4HVSA 4OAUC 3MY0A 3D83A 4YJRA 3O50A 5GINE 2OFUA 3NYOA 3HV5A 4GJ2A 3UP2A 5CEKA 3EZRA 3R7IA 4TTHB 3WYYA 4KRCA 4G5PA 2C6TA 1YHWA 3VUKA 2Q0BA 3MFTA 5EM8A 3GBZA 5EK7A 5IISA 2ONLC 2X0GA 3LFSA 3ULZA 5HBEA 3VF9A 1BYGA 1YI3A 3FZOA 4AA0A 4I24A 2XYUA 3AD4A 3SW7A 3DZQA 5HE0A 4E6DA 1G8JA 2XIKA 3POOA 4UY9A 5IEYA 4S32A 4M97A 3V5JA 4RIXB 4L9IA 2QNJA 4IDTA 4U40A 3FPQA 3RPOA 5FUTA 3EQPA 3GUBA 3FMNA 1VR2A 2W4KA 4LMNA 3FXZA 5EHYA 3HA6A 4X7QA 3W18A 2V62A 5AV2A 1G3NA 3FKOA 2A2AA 4FZ7A 5AV0A 3NUUA 3ZM9A 2RG5A 1PXMA 4FR4A 5M09A 3BQRA 4GK4A 4Q2AA 2VWVA 4XH6A 3EQBA 5AP1A 1CKIA 4MWHA 4ACDA 2I6LA 1J7UA 4LG4A 3COIA 4WUAA 5IQHA 5L6PA 4FSYA 3GCSA 4U41A 5D12A 3EQIA 1APME 3S00A 2BMCA 4FICA 1ZRZA 2SRCA 5JGBA 4RLKA 3ROYA 3E87A 5HNIX 2IWIA 4CV8A 3KVXA 2YACA 4MCVA 3SXFA 4BCMA 3GC9A 3CKXA 4AGCA 5FP5A 4K0YA 4F1MA 1M17A 4HYIA 4DFNA 3CPCA 3R00A 4DTBA 2UZOA 2PTKA 2X2KA 3D4QA 3NUSA 1WBWA 4O38A 3TV7A 5I9XA 3G15A 1OUKA 5FTOA 4JDKA 5I0BA 3Q53A 3NUXA 3ORMA 5E8YA 3VBVA 4DHJA 3GOKA 3A60A 5GIPE 4GL9A 4YGAA 4H36A 1GZNA 4XCUA 3MPMA 1M7NA 4JRNA 5EDQA 4QRCA 4AF3A 3CIKA 3GENA 4IB5A 4ZTNA 3OMVA 3PWDA 4HYHA 3I7CA 3IG7A 4IVCA 3KY2A 4DHZA 3LAUA 4DFLA 3A2CA 5J1VA 3LJ2A 3CCNA 1GIJA 3RINA 3H0ZA 3ANQA 3CTQA 4GYIA 2YJRA 1PF8A 2BRGA 4GIIA 2JFMA 5JFSA 3BPRA 2J0LA 3IW8A 3PVBA 4CV9A 2BFXA 1TKIA 4RWKA 4FYOA 3V5WA 3AMYA 5AX3A 1Y8YA 3ZUUA 2GQSA 3Q9ZA 2ITWA 5FM2A 4AT4A 3UOJA 3MVHA 3BCEA 3QAME 4EH4A 1XWSA 3F3UA 1P4OA 3R8UA 3TUCA 2H9VA 3ZFXA 1ERKA 3KC3A 3RZBA 1ZZ2A 3AC4A 2OF2A 4KABA 2PUPA 4TKSA 3MVMA 2JKOA 5T3QA 4AW2A 4PMTA 5HO7A 4YR8A 2CKOA 1UU8A 3HUBA 2JKMA 3VS4A 4KUJA 3ZLYA 5L2QA 3UDBA 1R0PA 3QXOA 3BHYA 4I0TA 4C57A 2B4SB 4UYNA 1T45A 2WEIA 3MN3A 4EH6A 4FKIA 5M07A 3HKOA 4Z7GA 3U6JA 4PMSA 2BTRA 4BCQA 2WTJA 2XNBA 4YURA 3TUBA 4G31A 5CNNA 4D1ZA 3E8EA 5FXRA 2WB8A 4QP4A 5BNJA 4BR3A 3AC2A 1OVEA 4RMZA 3GU5A 3RAHA 2VTNA 2XNPA 2JC6A 3ATSA 5AADA 3ZRLA 4FT9A 4O7SA 3DBEA 4M69B 2CN8A 4ZOGA 5CAVA 2YITA 4P7EA 1OL1A 4D4YA 3ZM4A 4MXZA 3MA6A 3NUAA 5E8ZA 3HV4A 2A0CX 5DEYA 1Y6AA 4FZFB 4BHZA 2EUFB 4O0RA 4AZFA 1UVRA 3ODZX 4WBBB 4OTRA 4UMTA 3S3IA 5JT2A 3SQQA 3FJQE 4H1MA 1WFCA 3F9NA 4HZSA 3OOGA 5DOSA 2C0IA 2C69A 2W9FB 2X81A 3R21A 4J8NA 2YM6A 3BX5A 4ZSEA 3NR9A 4A9SA 3R8PA 5G1XA 3A62A 4GMYA 4WRGA 3JR1A 5GJFA 2VTHA 2JAVA 4JQ8A 2WPAA 4DITA 4FA2A 3E3PA 3BIZA 5AR5A 4LRMA 2OJFE 1LUFA 3QZHA 4GG5A 2ZDUA 2ACXA 3HP5A 2NO3A 3JVRA 2C4GA 5D10A 5GNKA 1OPKA 3QUPA 1ZMVA 4TYHA 4UN0C 2C3KA 2RIOA 3LCSA 4QQJA 5AUYA 3SVVA 4BCKA 1G8SA 5BVKA 3UVQA 2GNLA 4F9CA 3BV2A 4ZJJA 3HEGA 2WQEA 4WNMA 1TQMA