4GIIA

Tyk2 (jh1) in complex with 2,6-dichloro-4-cyano-n-{2-[(cyclopropylcarbonyl)amino]pyridin-4-yl}benzamide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
TVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Lead Optimization of a 4-Aminopyridine Benzamide Scaffold To Identify Potent, Selective, and Orally Bioavailable TYK2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 289
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4giiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4giiA01
1ZOEA 4UX9A 2BKZA 2R3NA 4BYJA 3QKLA 4RWJA 3NCGA 5EYCA 5IQHA 2BIKB 4EHVA 5BUIA 1FVRA 2FA2A 4YO4A 3ORTA 4U9AA 3HMOA 3HECA 4ZY6A 4G1WA 1O6LA 2YZAA 3IKAA 5KMOA 3COKA 2QOIA 4U41A 5HD4A 2Z7QA 4AGDA 3IK3A 3D7TA 3ENMA 4GG5A 1M52A 1W98A 3E8DA 2UZOA 4K77A 4GV1A 4L67A 5EM5A 4ACCA 3EFKA 4QOXA 5KBRA 1PJKA 1ZOGA 3LQ3A 3LCKA 2XP2A 2XA4A 1IG1A 3PP0A 2YDJA 4LUDA 4R1VA 5HVJA 4XP0A 4QNAA 4ZJJA 5JFWA 3FHRA 3ORLA 4NCTC 4FUXA 4AOTA 4EH6A 3KF4A 4QMSA 3TJCA 2WB8A 2UW4A 5EDRA 3PSCA 5J5SA 3R9HA 5ETCA 1ZZLA 3C4CA 4ZSAA 2FSOX 4OTHA 2BRNA 4CG9A 4Y83A 4O6EA 4U40A 3MFSA 4FV8A 2Z8CA 2IZTA 4PP7A 2XYUA 3IG7A 4IZAA 4L52A 3WYYA 1UKHA 2CPKE 2XNNA 2O2UA 4P7EA 4YHFA 5F1ZA 1CKPA 4TPTA 3DKGA 2WGJA 4FV0A 4NEUA 2R3JA 3PJ1A 3ZLXA 2OSCA 4R3CA 2UZWE 4CKIA 4ITHA 2WU7A 4XRJA 3RAWA 3JVRA 3QRJA 4BTFA 2OZAA 3ELJA 4FT3A 3TZ7A 3FXXA 4PTEA 1Q3DA 3IW4A 3PIYA 1JBPE 3U8WA 2XUUA 3RK5A 4YLLA 2PVNA 4TYEA 3S4QA 2B9FA 5A4EA 3W8LA 2Y6MA 3GB2A 5KE0A 4BHNA 3MV5A 3OWLA 2X6EA 3PJCA 3SOCA 4HVIA 4U0IA 4D5HA 3FI4A 1J7LA 5DEWA 4JX3A 3UOKA 4OTPA 3A4OX 4RRVA 3UO6A 3SOAA 4FKJA 4CFVA 1O6YA 2G2IA 4TWNA 4F1MA 3R8MA 4BDBA 3EQBA 3MY0A 5M55A 1XH6A 2HW7A 5A6OA 5CF5A 4TTHB 4L3JA 4XBRA 2HZNA 3GT8A 2HOGA 4MXZA 2F49A 3R9OA 4PX6A 4NZWB 1SVEA 4EQUA 3F5PA 4IAYA 3MVMA 3PUPA 4PPBA 5HO6A 4AX8A 4GSBA 2C6LA 4NJDA 4BCQA 5CXZA 4NL0A 4YBJA 4C4GA 4GU9A 3Q04A 5E8YA 2AC5A 4JOAA 5EM8A 3P08A 4QQTA 4NSTA 3QALE 4NFMA 5J9YA 4ZY4A 2ZMDA 4BRXA 1KV2A 3HDMA 3V01A 3TUBA 3EYGA 2BDWA 4RIOA 1M7NA 1YI3A 3ORKA 3OXTA 4RZWA 4MTAA 4XJ0A 3T9TA 5FDPA 3UQFA 4NW6A 3TNQB 3EQCA 3TTIA 3ZO1A 3T3VA 4FF8A 4IHPA 3QZFA 4FKGA 3V5QA 2C5XA 3PRIA 2V5QA 4IMYA 1Q8YA 3VJOA 2IVSA 3Q6UA 1NVRA 3FUPA 5B7VA 4EOIA 2VWUA 3HP2A 3PVUA 2UW5A 4D28A 5CSWA 5EYDA 5LVMA 1KSWA 5DBXA 4Z16A 2GDOA 2WHBA 3NCZA 4NKSA 3QKKA 1XBBA 4U3YA 4ZY5A 3COIA 2GNIA 2ITXA 4PPAA 4KWPA 4MNFA 1KOAA 1W83A 2PTKA 2UW9A 1XKKA 2W06A 2PE0A 4CGAA 1XBCA 1H08A 5GNKA 2ETKA 2XK4A 3R7YA 4IZYA 1WCCA 1Y8YA 4R5YA 4YNOA 1KV1A 5BQ0A 3COHA 2JEDA 4PTCA 4FUYA 2PVFA 4XG6A 4F70A 5CSHA 4AA5A 4AWIA 4J96A 4JG8A 1QL6A 2X4FA 3DKCA 4CQEA 4ZLYA 3BHYA 4E6QA 1XH8A 2X39A 5CEIA 3A7JA 3G9NA 5FUTA 3CP9A 3UTOA 3P7AA 4PDPA 5TO8A 4TRLA 1KE6A 3GU6A 3ALOA 3KFAA 4EJ7A 4MQ2A 4MQ1A 3P23A 4FKOA 4WG5A 2ITQA 4R7HA 1YW2A 4BTJA 2QU6A 2WMWA 4IB5A 4XH6A 1H1SA 2EB3A 5GHVA 4RJ5A 4GK4A 4ZS0A 3ZH8A 4CQGA 5CF6A 4PMMA 4ANQA 3QTXA 5AAGA 5CQUA 2X7GA 3I7BA 4YHJA 4RFYA 4CD0A 2R3MA 4CKRA 5JQ5A 5CI7A 3QTIA 2PULA 4NTTA 4USFA 4LOPA 5HHWA 2CMWA 1JOWB 3FMKA 4O81A 5J7BA 3MTLA 3HZTA 5FG8A 3UZPA 4C38A 1H1RA 3DCVA 3PYYA 4AGCA 1PRYA 4M67A 1PXPA 3KQ7A 5L2WA 2OFVA 3C0GA 3AC8A 2UZTA 2C6MA 4IVDA 3ZLYA 4IWDA 4AT4A 5LMKA 3U54A 2IPXA 3PXKA 2QD9A 4IVCA 2F57A 4KIOA 4A9RA 2OICA 5BMSA 4BDIA 4C37A 3BU5A 4K11A 4BHZA 4BWPA 2ZM4A 3PPJA 3IDBA 4EC9A 3FMJA 4K6ZA 5H2UA 4CLIA 5AADA 1UV5A 1DS5A 5ANKA 4D2PA 2QURA 2VTRA 2QONA 5B2LA 3K3IA 4EYJA 3Q4UA 3P1AA 3EYHA 4F99A 3P86A 3TZ8A 5C26A 5IPJA 5GZAA 4YZ9A 4ITJA 1LEZA 3SRVA 3A4PA 1H1PA 2PMLX 4FT7A 5DVRA 5HKMA 4FGRA 3WBLA 4J95A 4C0TA 5LOHA 4KNBA 3IW5A 1M2RA 2YDIA 3PJ3A 1GAGA 2W5AA 2CNVA 2OZAB 3GCVA 4B8LA 4I5PA 4DINA 4TL0A 2PY3A 3BBTB 3S2PA 3ZDIA 4EK5A 2FSTX 4TNDA 5C4KA 4HOKA 3NLBA 4Y85A 4UYNA 1WBPA 3BYUA 2JDVA 1OL5A 3CTJA 1BX6A 4I92A 4DFBA 3B2TA 5EYMA 2CNUA 5HQ0A 3REPA 3LXKA 3F88A 4I1ZA 4ZXTA 2XNGA 4UALA 3PPZA 2VTMA 3UIMA 3COMA 4GK2A 5CNNA 4IB3A 4F7LA 5JZJA 4XV9A 2JFLA 2W4KA 4NM5A 4FIJA 4EEVA 4RIXA 4LRKA 1YOJA 4YU2A 4XHKB 2YJSA 3GU5A 4GG7A 3RM6A 4PV0A 4C33A 3DQXA 5AX9A 1WFCA 5L6PA 1A48A 2OIDA 1XQZA 1YXTA 2C3JA 2SRCA 3BE2A 3SG8A 3UOJA 3HMNA 4OTRA 3G0EA 4EH5A 2WEVA 4BR3A 2RFEA 3IO7A 5CS6A 4AF3A 3OS3A 4AT3A 2OH4A 2YAAA 2JKMA 4BDEA 3DBFA 4PDYA 3V3VA 3DGKA 5CEPA 2WD1A 4M13A 3O50A 5HEZA 1H26A 3AC5A 4IX4A 3PPKA 1WBOA 4FEUA 5D9HA 5IZFA 2PU8A 3VBWA 3DAJA 2QI8A 3DTWA 3BQCA 2XKFA 1F0QA 3HA6A 4OAVB 4LG4A 2XKDA 4QYHA 5DWRA 4I6QA 2V22A 2VV9A 5HGIA 3Q5IA 5E7RA 2R7BA 4YURA 2WO6A 1QPDA 2JAVA 2WMBA 5E1EA 4BDFA 2YIYA 4MCVA 3SAYA 1F3MC 2YWVA 2BFXA 4GL9A 2CCHA 1H28A 3ODZX 5L8LA 5K3YA 4FL3A 4FIGA 2IN6A 4I22A 2PZYA 3ORZA 2QC6A 5EG3A 2PE2A 4E73A 4EI4A 5AP1A 3LFSA 5ETIA 4KUJA 4R7BA 4ZTSA 1UWHA 5AUWA 2ITOA 3BGQA 4TWOA 4AQCA 2C68A 4P4CA 2O64A 3CGOA 3SXFA 2XNOA 5CU3A 4ERKA 4DG2E 4H58A 3FLSA 4LL0A 5DI1A 5LARA 2CKEA 4EL9A 4UY9A 3EZRA 4FV1A 5HIBA 4JDKA 3QZHA 2J5FA 5HOAA 4UMRA 3ZSHA 3BKBA 3RZBA 4ZTHA 3PTGA 3W2PA 5AUVA 5D7AA 5LVOA 1YDSE 2R3RA 4BI0A 3KULA 5DN3A 1R0PA 4ZZNA 5I9VA 4IWOA 2UV2A 4G17A 4YJSA 3FI2A 3SGCA 2EWAA 1Q62A 2XNMA 4EWQA 4JG6A 3R7IA 4F65A 4EHEA 4O0YA 4TXCA 2ZB0A 4L7FA 3HV4A 1PKGA 4MD7E 5A9UA 3KVWA 3GCPA 2X8IA 3EQRA 4FV2A 4LGDA 4M68A 3T8OA 3VHEA 3DU8A 3R1NA 5JMSA 4I93A 3P78A 4E5AX 1A06A 3JS2A 3DK6A 3VS5A 2GHGA 3UQCA 3BZ3A 1URWA 4OTQA 2X81A 1M2QA 4AE6A 3RPYA 3QTWA 2IWIA 3Q6WA 3O17A 3WF9A 4L53A 1QMZA 3KGAA 1Q8UA 4IJPA 5JH6A 3EFWA 3E88A 3R30A 2NP8A 1ZYSA 3PA3A 3IW6A 5IQCA 5LMKC 4IAIA 2VO7A 4AG8A 3VRZA 2C6KA 5DIAA 3UC3A 3LFQA 3Q2JA 5LCJA 3NVMB 5IA3A 5ITAA 4JQ7A 4E20A 5JGDA 3VS7A 4H3PA 4YJUA 1R39A 3AMAA 5E8TA 2B55A 4CFFA 3D9VA 4O27B 4E93A 2HXQA 2PVKA 3DJ6A 4O82A 4MXOA 3BV2A 3SHEA 2JC6A 4FA2A 1XWSA 2GQSA 4BWKA 5HU9A 3QCQA 3WZUA 2ZAZA 2WAJA 3AD5A 4PL4A 3SA0A 2OF4A 3L8SA 3LFFA 2QNJA 3CD3A 3HV6A 3O2MA 3AGLA 3Q5ZA 4FKSA 4L6QA 4QP7A 3SRVB 3BYSA 2GHMA 3R6XA 3EQPA 3KU2A 4ANMA 4AW0A 1NVSA 3QQFA 4DTBA 3KRLA 3VVHA 4OR5A 2JD5A 5TR6A 4S32A 4O0SA 2VX3A 2C3LA 3BPRA 4WG3A 4YZDA 1Z5MA 1V0PA 4JNWA 5E8VA 4U3ZA 5CALA 3GGFA 4EQMA 2ZV2A 3FMNA 3QD4A 5LXMA 3FKNA 1HCLA 4H3BA 2WU6A 2P55A 1YOLA 3QGYA 4WNOA 5AP2A 5EI8A 5FXSA 2C69A 3VS1A 4GW8A 2Y4PA 4IWQA 4AN9A 3D7ZA 1KE9A 4G3EA 4QMNA 3GC9A 3H9FA 4JDHA 2YFXA 4UZDA 2HIWA 3UNZA 1YWNA 4X7QA 2G9XA 3OD6X 4GH2A 4ACGA 3HV5A 2BZKB 1XBAA 4G3DA 1Y6BA 4RIXB 2C0OA 5F9EA 5L2IA 1FBNA 2ZOQA 3FZOA 3ZLSA 4C4HA 2W1EA 4M69A 1DI9A 4FTOA 4RVKA 4YMJA 4WBBB 4XG2A 3WOWA 4CFXA 3QQJA 1V0BA 1J1BA 3THBA 5CSPA 4L45A 3LFEA 2YHVA 5CT0A 4H1JA 1TQMA 4XOYA 4KABA 5HI2A 5AWMA 2RIOA 4YJOA 2V55A 5AV2A 3EKKA 4EK6A 2B9JA 4FSZA 5AJQA 3UJGA 5AIRA 5F4NA 4A9YA 4HVDA 5IEVA 4YUQA 5A54A 2FGIA 4AOIA 3WIKA 4S33A 3TEIA 2OJJA 4AZEA 3QLGA 2BRHA 3E63A 2VO3A 2VGPA 3UVPA 4QYYA 5HIDA 3OOMA 3C5UA 4G3FA 2X2LA 2UVYA 4QRCA 4YTCA 3O96A 4C2WA 2Q83A 4XUFA 3ZSGA 5CAVA 2BROA 4MXXA 4C35A 4JJRA 5KX8A 4PNIA 3IONA 4OBQA 3IOKA 2W1IA 5GZ9A 3PJ8A 3FMHA 4E26A 4TYJA 4HVSA 5KHWA 2UZVA 5FQDC 4YTFA 4GKHA 4MXAA 3CEKA 2UZUE 4L46A 4FZ7A 4CVAA 4R7IA 2VO6A 3QAME 3V51A 5FRIA 3HGKA 4FGBA 3BLQA 1G5SA 5J8IA 3U4UA 3WZEA 2PMNX 2B0QA 3MYGA 2BILB 4EOJA 3FZSA 3Q53A 2WMXA 4RLKA 4BN1A 5DE2A 3U4WA 3HRCA 4G31A 4XRLA 1ZZ2A 3E7VA 1IA9A 4FSRA 2J5EA 1V1KA 1J7UA 4LRMA 4Y8DA 3OWKA 2YDKA 4FVPA 3S1HA 2XKCA 5BYLA 2VWWA 3P79A 3WIGA 2REIA 3OHTA 3H0ZA 2FH9A 3SW4A 4RZVA 4M3QA 5LVPA 3C51A 3E93A 4KS8A 2WFYA 4MH7A 3VIDA 2GTMA 4UMUA 3OVVA 4X6QC 5IMEA 3KULB 5D41A 3DB8A 3QF9A 5J5TA 4DFZE 1KWPA 3FYKX 2B7AA 2QOKA 3UYTA 3HP5A 1P4FA 5A6NA 3ID6C 4EH2A 1PXNA 3C0IA 5AV4A 4C34A 1ZOHA 1UA2A 5IEYA 2CKQA 5AEPA 5EQEA 4YZMA 2R7IA 4HYHA 3HMIA 1AGWA 4HJOA 4BCGA 5J1WA 4I20A 1P4OA 2HAKA 4XMOA 4IZ7A 3DS6A 3NUSA 4FKLA 4Q5HA 4M8TA 5D1JA 3TKHA 5E8ZA 1NY3A 3PXYA 3NUUA 2BZIB 1BKXA 3KKVA 3SD0A 2RGPA 3ETAA 5FP6A 1YHWA 3A8WA 4CYJA 2ERKA 3H3CA 5LWMA 3R73A 1H25A 2VTNA 1ZYCA 2A0CX 4QPAA 3RP9A 3Q9ZA 3UYSA 3LFBA 4HYUA 3GU4A 3LQ5A 3EL8A 2FSMX 1VR2A 4IAFA 4J53A 4C8BA 3MESA 3GFEA 5KHXA 4WRSA 3NX8A 4YSMA 3GBZA 5HO8A 3L9MA 5AR7A 3U6IA 3AQVA 2XK9A 2VD5A 3RCJA 4MYGA 5M53A 2J0MB 2VTLA 3I6WA 5L6OA 3A61A 3SXSA 2A1AB 4GJ2A 1Q99A 4RFZA 3WF5A 2QKRA 4WG4A 4HYSA 2GNLA 2I0YA 4ENYA 4WT6A 4C3RA 2J50A 2RFNA 1ZYJA 5BVKA 3L8VA 3GUBA 3B8RA 4KKEA 1ZMVA 4EBWA 4EOMA 4Z7GA 5IQGA 4UWCA 3HUCA 4FT9A 4CMUA 1JSUA 2QO7A 1A9UA 1W0XC 4R3PA 3D5XA 4I6BA 4H39A 5EK7A 2QOFA 2YLEA 3DZOA 3GC8A 4F7NA 3JR1A 1U46A 3TUDA 2PZPA 3PA5A 2Y0AA 4O7TA 2QOCA 4EH8A 4MEDA 2W9FB 5IG1A 3FAAA 4QP8A 5HD7A 4UMTA 2PVYA 1G8AA 4EK3A 3MH1A 3GU7A 3MGYA 1LP4A 4XP3A 5DT4A 2IW9A 4HCTA 2R3OA 1WAKA 4EZ3A 5K0KA 4ZTMA 3FSFA 4MHAA 2J0JA 4YPDA 4R1YA 2PUUA 2VU3A 2WMRA 4XBUA 2J0KA 2WQNA 4AP7A 5EKOA 4MBJA 2GTNA 4E5WA 5I9UA 5HTBA 5IA2A 5EOBA 4CCBA 4X3FA 1RDQE 1S9JA 5CQWA 3TTJA 4BZDA 2JDSA 2XH5A 2H8HA 4IM2A 4QP4A 3F3ZA 3RAKA 1O9UA 5EI6A 3B8QA 4XLVA 1V0OA 2UZEA 3FY2A 1RW8A 2WXVA 4FSYA 5C9CA 3VS0A 4ZZOA 1JSVA 4XG8A 2C30A 3N4UA 5TE0A 1YRPA 5CVHA 3NSZA 5EH0A 1PXOA 3F66A 3I6UA 2XIZA 4LUEA 5FD2A 3EN7A 1OM1A 3MA3A 3ROCA 5IA1A 2WELA 4YSJA 2WZJA 2GNJA 2X1NA 3F7ZA 4BIDA 3KREA 5IQBA 4ALUA 3QYZA 2C0IA 4FEWA 3RK9A 3D2KA 2QR7A 4N6ZA 3D5VA 4AUAA 3FI8A 5TT7A 1DM2A 4FV3A 3KRJA 3WI6A 4EUUA 1UU9A 4FTNA 4O22A 3D14A 1PY5A 5A4TA 3SLSA 2W1FA 3BE9A 2WEIA 1K9AA 2YCSA 4M7IA 2Y9QA 1JQHA 1WVXA 3R8ZA 3W2QA 1J1CA 3FPQA 3UIBA 3PIZA 3BBWA 4CFWA 3MY5A 1K3AA 5C4LA 1HCKA 5L3AA 1YHSA 3RVGA 3LMIA 5BNJA 2WMVA 2DYLA 2YIQA 3R71A 4EH7A 4U45A 1W8CA 5DH3A 4ZEGA 5IMXA 1OIUA 4R5SA 3TIYA 2FB8A 4IDVA 3VS6A 4BCFA 5IH6A 5J9ZA 2FVDA 3F69A 3QD3A 3AC4A 2XF0A 3MH3A 4JBQA 5CI6A 1TQPA 5JSMA 3S3IA 4QTCA 4JQEA 5K5NA 2I0HA 3MWUA 3RMFA 3I5NA 5AP6A 3BWJA 3ZBFA 1OZ1A 3S0OA 3LJ0A 5ETAA 3MSSA 2UW8A 2BR1A 2VNWA 4O1OA 3N9XA 3R7EA 2X0GA 3HRBA 2YM7A 4X3JA 5DT0A 5HG9A 3ODYX 2RG5A 4FZFB 5IUIA 1GIHA 3V8WA 1Z57A 1YKRA 2YM3A 3OF0A 4QPMA 4AS0A 2QLUA 3VF8A 3EN4A 4NIFA 4MAOA 4FT0A 1H00A 4W8EA 3SC1A 4FX3A 2GMXA 2JDRA 3ZLWA 2QVSE 4AZSA 5CEKA 3G6HA 3Q4ZA 5CLPA 4EKKA 2VTTA 4GYIA 3ZZEA 4XG4A 3EH9A 4G3CA 2OJ9A 5HG7A 3NUPA 1R78A 2GNHA 3LQ8A 3NUYA 3AOXA 4KD1A 4RLLA 2ITNA 2HWPA 3QQLA 3SV0A 2BTRA 1U5QA 4ZS4A 5T68A 3E5AA 2XM8A 3TNWA 4G6OA 4E4MA 4BBMA 4USDA 2CKOA 4CYIA 3MN3A 3OWJA 3N51A 4KB8A 3RK7A 3R7GA 1ZMWA 2O63A 2XB7A 4YO6A 1UU8A 2IZSA 4LFIA 2RL5A 4O6LA 4DTKA 1J3HA 2IVUA 2HZ4A 3ZUTA 4D5KA 3GOKA 4J97A 4LMUA 3UG1A 3C4WA 5DR6A 3ZM4A 4E6CA 1JNKA 1Q97A 4I41A 4MD9E 1Q3WA 3OCTA 4IIRA 4L42A 4FKWA 4BF2A 2OKRA 3DLZA 3OUKA 4FNZA 1U59A 2GNFA 3WZJA 5JKGA 5FBOA 2FYSA 3OP5A 1WBWA 4FT5A 4LGHA 2OU7A 2JBOA 4EZ5A 3NAYA 4FTQA 4XP2A 2BDJA 3MIAA 5AUTA 4BIEA 5JRQA 4P2KA 2O0UA 4ZJVA 4TYHB 4UWYA 3CQEA 3Q9WA 4FV9A 2C3KA 5IQDA 1E9HA 2WMQA 3HAMA 3EN6A 2W1ZA 3BHTA 3CPCA 5I3OA 3SDJA 5FTQA 1XR1A 1YVJA 2IO6A 2ZJWA 1JKTA 2BHHA 3PVWA 4FR4A 4KSPA 5AR5A 2XRUA 2C5VA 4Y46A 3L9PA 1W84A 3VUKA 3W2OA 5GJFA 5LMAA 4K0YA 5I9ZA 4RWKA 3ZO4A 3OZ6A 3BU6A 4RC4A 2P0CA 3LZBA 3ZS5A 3QHRA 4BTKA 4BTMA 3LM5A 5AA8A 3RHXA 3U9CA 5E8UA 3QZGA 4J8NA 1M14A 5B0XA 3C9WA 1MUOA 2NPQA 4ID7A 4G5JA 5CF8A 2NRYA 3QA8A 4Y73A 4X3FB 2BIYA 4X3FC 4Y5HA 3R8LA 4ZLZA 5HZNA 2PYWA 2OXDA 1KE7A 5CU2A 2PWLA 3BGPA 4W4YA 5IDNA 2YZLA 4G3GA 4G9RA 2OFUA 5HE0A 2J9MA 4F63A 4ANNA 3JY0A 2XRWA 4B9DA 3GXLA 3NNUA 4TYGA 3UOHA 4YTIA 2Q0NA 2YEXA 1FVTA 1TKIA 2JKQA 4YGAA 3HMPA 3FLZA 4RVLA 4C61A 5TOZA 4RX9A 5KMNA 4W4XA 5JGAA 4GFOA 3ZFMA 4FKIA 4FOCA 4BCJA 2PSQA 2X2KA 4BCKA 1ZWSA 4UMQA 5AR3A 3ANRA 5D11A 3MJ1A 4ITIA 3EQGA 4AZWA 4IQ6A 2RKUA 3BRBA 3WF8A 5IQEA 3TCPA 3QL8A 4BICA 1AQ1A 4IFGA 4F1OA 5IA0A 2C5NA 4CLJA 4LOQA 4C2VA 4KIKA 3AC1A 4ZSLA 3UPXA 1X8BA 3NYVA 4RMZA 4K18A 4W9XA 3NUXA 2XVDA 2PVLA 3HV3A 5BMMA 5T3QA 3AT2A 3V6SA 4HGEA 5CWZA 4ACMA 3V5LA 5IUGA 3KEXA 4AU8A 3KCKA 1VZOA 3QD2B 4AE9A 5AA9A 2PVMA 4ZSJA 4C58A 3VBTA 3RGFA 3QLFA 4YJRA 4KSQA 4RX8A 3UMXA 4I6HA 4KAOA 3CR0A 3EL7A 3F61A 1OKYA 3D7TB 3EHAA 1FGKA 3CBLA 4EQCA 2YCRA 3K5UA 3G5DA 4AXAA 3R8PA 4BVUA 3FZPA 5E91A 3NVKI 4I0SA 4YC8A 4TNBA 1PMNA 1CM8A 4G9CA 4NFNA 4HVGA 5JK3A 4DFUA 2Y6OA 4JDIA 3MB7A 3NRMA 3F2NA 4CRSA 3OG7A 1CSNA 3GOPA 4YJQA 4IADA 2P4IA 1IRKA 3UZRA 4M12A 4OT6A 4CV9A 5AIKA 4DLIA 1H4LA 5IQFA 4JR3A 3F3VA 3LJ1A 4NIFB 4OBOA 3A7HA 4RG0A 3VJNA 2I40A 3ZZWA 1UNLA 2EXMA 4D0XA 1RQQA 4CFNA 2XIRA 2B53A 3DAKA 2ESMA 3DKOA 1JPAA 2ITTA 4AW1A 5DR9A 5AUYA 2XM9A 5CSXA 2PUPA 3OUNB 4FVQA 1OITA 2ZDTA 3K2LA 3NW6A 3FKOA 4IB0A 5CTPA 5J95A 4AN2A 2VWIA 1L8TA 4AZTA 3MW1A 3D94A 2HY81 3UBDA 4F0IA 1PHKA 3AMYA 4YJVA 4AFEA 3RALA 2VGOA 3LXLA 4JG7A 5H8GA 4XEYA 4YLKA 3KXGA 2W5HA 4PMTA 5JFSA 2XEYA 3RJCA 4BGHA 3IDCA 4U79A 4EBVA 4F9WA 3O8UA 5M4UA 3EKNA 3F3UA 3NAXA 4C57A 5LWNA 4H36A 3QKMA 3R2BA 4FKVA 4DFXE 2C5YA 2LGCA 4JX7A 5FDXA 5M57A 5HNBA 4DEEA 1OUKA 5AV1A 3U55A 4QMWA 4YNEA 2IVTA 3KRXA 3R9RA 2QOLA 3LCTA 1CKIA 3G51A 1Z9XA 3NGAA 4EKLA 3HMMA 1B39A 4FIIA 4FIFA 3R7UA 2XKEA 4CFMA 4OTIA 3PWDA 1M2PA 4CFUA 2RG6A 3NZ0A 4MBLA 4FKPA 4FNYA 3CQUA 3T9IA 5FP5A 4U80A 2CNQA 3HAVA 4AN3A 3U6HA 3QRIA 3SXRA 3M11A 4KS7A 2BZJA 5L4QA 4KBCA 2GPHA 3FXWA 4FNXA 3QGWA 4UBAA 3KMUA 4U6RA 1SNUA 3EQIA 3ZYAA 4EH3A 4CEGA 3HYHA 4JXFA 4G2FA 2ZDUA 4WA9A 2ITPA 3DZQA 3MBLA 4QMMA 3BV3A 5AP0A 4EOQA 4FV5A 2PPQA 3OOGA 4U8ZA 4ZMEA 2UZNA 3PG3A 3TKIA 3F82A 3ZU7A 3QRKA 2R0UA 3CJFA 5HG8A 4KIPA 4F4PA 5K4IA 2HXLA 3FLQA 3ANQA 4QTBA 3V5PA 3HVCA 3WZKA 5BYYA 4AT5A 3MTFA 2G15A 4LMNA 3R9DA 4DGLC 1YWRA 3M1SA 4FL2A 5IA4A 3CY2A 4IVAA 3HX4A 1AD5A 4RJ6A 3RTPA 4U7ZA 2CKPA 4ANBA 4AZVA 1GZKA 4IDTA 2IG7A 2JIIA 3UIXA 1PMUA 5HBHA 2UW3A 4RX5A 1Y8GA 2JDTA 4ALVA 4F6WA 4FZDB 2XJ1A 2V62A 4CZTA 5I9WA 2XYNA 4FICA 5J79A 3GU8A 2J7TA 1MP8A 3BHHA 3W2CA 4BKZA 4D2SA 5L6WL 3FV8A 3IOPA 2YIWA 4H1MA 2BAKA 4G6LA 3KA0A 1BMKA 3DT1A 2WIPA 2XK6A 1DAWA 2H6DA 1FOTA 3HLLA 5DR2A 2BHEA 4X0MA 3U9NA 3C4FA 4DN5A 1B38A 5K9IA 4JQ8A 2C6TA 3LPBA 3ATSA 2J0LA 4NJ3A 1IASA 2PMOX 4F0GA 4PDOA 4ASZA 2JLDA 4X2FA 4EH4A 4TW9A 4FEVA 3OCSA 1YXVA 3O51A 1Q8ZA 2XNBA 4XOZA 4I94A 3BQRA 3V8SA 2Y8OA 4GRBA 3DLSA 4JRNA 4DGNA 1P14A 2F2CB 4KIKB 4X2KA 3CTHA 3JYAA 4ERWA 4PNKA 3GQIA 5IQIA 5A4QA 5M4CA 4O21A 3V5JA 1STCE 3QCYA 3QQUA 4RBLA 4RWLA 3O0GA 5CAPA 4B7TA 5BX0A 4C4EA 3V6RA 3BHUA 2C6IA 3OWPA 3GENA 2EU9A 2Y4IB 2W99B 2Y4IC 5EDPA 3NUNA 4Y5QA 1Q8WA 5HCXA 3PWYA 4BGQA 2E9NA 2W5BA 3KN6A 2ZM1A 3FLWA 2YM8A 5BVWA 5LCKA 3ZUUA 5DRDA 2VTHA 3ZO2A 1KUTA 4LV5A 1U4DA 3HKOA 4JT3A 4ANSA 5CENA 2J51A 3GFWA 4OLIA 4ZTRA 2XJ2A 3UGCA 2OLCA 3MH0A 3R1SA 4JDJA 4I0RA 3QTRA 5BVFA 4ALWA 4H05A 4R77A 2I1MA 4FTCA 3EJ1A 3W33A 3CS9A 5AP5A 3WYXA 4TY1A 5M44A 3PLSA 5BVOA 1GOLA 3H4JA 3PVGA 2BMCA 3IQ7A 5EM7A 3PJ2A 3E8CA 4JRVA 1YXUA 2O5KA 3GCSA 4PY1A 4YBKA 4DG0E 4PMPA 1H01A 3LCDA 5HLWA 4ANLA 3O8TA 3OC1A 4BDGA 3FHIA 3K54A 4KKGA 2VTQA 4CKJA 3VUIA 3Q96A 4DE4A 3DA6A 4GUBA 1YDRE 3CIKA 3D0EA 4U81A 5E92A 4U5JA 1IA8A 3AXWA 3UQGA 3BEAA 5HE1A 3PE1A 3S00A 4L3PA 4BDHA 4WSYA 3DFAA 4F9YA 4FK6A 4ZAUA 3NEWA 1MRUA 2GHLA 2WOTA 3AC2A 2VNYA 2OF2A 1XO2B 1JLUE 2DWBA 4CNHA 2JFMA 4FODA 4MWHA 3F6XA 4D4RA 3BLRA 5CU6A 4QMLA 4A9TA 4JS8A 3ENHA 4GT3A 5IF1A 1OVEA 1Q4LA 1YWVA 2EXCX 2G1TA 3GEQA 3POZA 3PRFA 4HPTE 5FBNC 5HE3A 4D0WA 3HUBA 4O7LA 1BL6A 4PL5A 3HDNA 5AAEA 4YJNA 3VF9A 3QX2A 3KXHA 4FG8A 5AAFA 3EZVA 3T3UA 4DH8A 4D58A 3SG9A 3H30A 4FSQA 4RVMA 2GQGA 4ZTQA 1PXMA 3IDPA 4M66A 4L44A 4OTDA 3ZFXA 4V01A 3NWWA 1ZXEA 3LFDA 2YM6A 3D83A 5EW9A 1GIIA 5BVDA 3VNTA 3BYMA 4J1RA 4ZIMA 3DKFA 1WBNA 1W82A 2I0VA 1LR4A 4RWIA 1Q5KA 5H8BA 2CSNA 1SMHA 4D1XA 3MPAA 4KBKA 2XK8A 3D2IA 2XS0A 4BCIA 2DS1A 4YJTA 2XMYA 3VUMA 3VW6A 4DAWA 4DCAA 4BY9E 2C6OA 3KF7A 2WTVA 3OTVA 5E8XA 2GSFA 5JEBA 3N4VA 2OJFE 2B9IA 4PTGA 4GIIA 5DMZA 1VJYA 2JITA 3KL8A 4I21A 3TN8A 2YACA 5KCVA 1B6CB 2VUWA 3ZTXA 3ZXTA 4FL1A 3DNEA 2VWYA 2AYPA 2X7OA 2UW0A 1UNHA 1ZY5A 4O83A 5AMNA 4ZOGA 1E1XA 5C8MA 1OGUA 3VULA 4TT7A 4YC6A 1U5RA 2C3IB 5E8WA 1L3RE 4CT1A 1F5QA 4DG3E 1UVRA 1J7IA 5FGKA 3MB6A 3TZMA 5KO1A 3CGFA 1W7HA 3ERKA 3JUHA 4I5HA 3B2WA 4QMOA 1TVOA 4Z7HA 4MNEA 5T6KA 2E9PA 1U54A 3P7CA 4RA4A 3A7GA 1FMOE 4GT5A 4ZZMA 1REJA 2QCSA 2VX0A 5K4JA 4E8AA 4C36A 4D4SA 3UNKA 5B2MA 5IQAA 1M17A 2OXYA 5IISA 3KMWA 3MVHA 5GIPE 3I60A 1Q41A 2ERZE 4EK8A 4B6LA 1MQBA 3CLYA 4RVTA 2ZB1A 3FKLA 3DDQA 1T45A 4FOBA 4GFGA 5DLSA 3TDWA 2R5TA 5I4NA 4F9CA 5GIOE 3KVXA 3L1SA 5KMIA 2X4ZA 1R3CA 2YITA 2ITYA 4PPCA 3ALNA 2QG7A 4D2TA 2W17A 4FZAB 4GVJA 3TV7A 4QP2A 3CJGA 4I5CA 1BI7A 4ACDA 3DPKA 1K2PA 4EONA 2WKMA 3IW8A 4KRCA 2A19B 5AR8A 1NT2A 2F9GA 4J8MA 5H9BA 1ERKA 4DBXA 4ASXA 4LYNA 3LE6A 5AM6A 1XJDA 4QP9A 4KKHA 3MY1A 4Q9SA 4QMTA 4ASEA 3R1QA 2W7XA 5HNIX 4OTFA 1ZARA 2W1DA 5F95A 5FEDA 2VTAA 3AGMA 4E3CA 3AT3A 3KK9A 3RZFA 4PQNA 3NS9A 3NPCA 4GCJA 4WKQA 4EHGA 4YR8A 5E90A 4F0FA 2XIYA 4F08A 2YAKA 3Q4CA 5M07A 5A3XA 5ACKA 2PK9A 4CV8A 3NW5A 1XH9A 5B2KA 4D1SA 3CSVA 3ZSIA 5BUJA 3PIXA 1S9IA 5KBQA 2HENA 5CYIA 4DEIA 3FY0A 1LPUA 4HNIA 2ZMCA 4JVGA 5M56A 4O7NA 2GU8A 4V04A 4KBAA 3KN5A 1ZAOA 5DEYA 1WVYA 3FBVA 1RE8A 5FXRA 4M14A 3UO4A 2JIUA 5IUHA 4AW5A 4ENXA 4QMYA 4W8DA 4LGGA 4IM3A 1J91A 2JIVA 3MH2A 3JPVA 4YPSA 2GCDA 5EM6A 4JIAA 4WOVA 4FG7A 2ETMA 4LRJA 5JFXA 3CY3A 4HZRA 4XG7A 5DFPA 3NYOA 5CAUA 3FEGA 4QTEA 3I4BA 2WQOA 2GFCA 2PZIA 3ZUVA 4DGGA 4E6DA 4JLCA 4A4OA 2XIKA 2BDFA 3M42A 4FTUA 2VAGA 2F2UA 2VTOA 4FKRA 4IACA 3RAHA 4Q9ZA 2ZV8A 3FZ1A 1OPLA 5HCYA 1DAYA 3BELA 1LEWA 2XNEA 2CJMA 2YM5A 4S30A 3KB7A 3QBNA 4Z9LA 4N70A 4NK9A 3RNYA 3C4ZA 4GT4A 5ANDA 4KIQA 3ZM9A 4DH3A 1OMWA 3MA6A 3BYOA 3TNIA 5EDQA 4HCVA 4BCMA 4AA0A 5K0XA 1SVHA 2YN8A 4NTSA 1JKLA 1OIRA 1XHAA 3K5VA 5G1XA 5GJGA 4DEBA 4FEXA 4I6FA 4K2RA 4D2WA 5CZHA 3FJQE 4L01A 5CASA 1SVGA 5DT3A 3QWKA 5D7VA 1OKZA 1YQJA 3E8NA 2BTSA 3ITZA 2C5OA 4NKAA 4RFMA 4IC8A 5H8EA 2NRUA 4FTMA 1REKA 4O0UA 3VQUA 3NMUF 4FI1A 3BLHA 3LKMA 4X2JA 3C0HA 1GZNA 3EQDA 1FMKA 5L8KA 4CTBA 5C1QB 2CGVA 4M69B 1Y6AA 1XH5A 5GZ8A 1SYKA 2OI4X 5HU3A 4CG8A 3TL8A 4AZFA 4QYEA 3TV4A 4RQVA 3RCDA 5HE2A 4U42A 5CY3A 5KMJA 4JI9A 3QU0A 4A7CA 5HBEA 5J87A 3QCSA 5CU0A 3AD4A 5AX3A 2WTCA 4B99A 2XBAA 3GC0A 3BI6A 3TZ9A 3QRUA 4BCHA 3QWJA 1NVQA 2B54A 5L2TA 5DOSA 3OROA 3WE4A 3RNIA 2E2BA 2GS2A 4AACA 3EMGA 3QQGA 4IW0A 4JAJA 5CEOA 4O7VA 5A4CA 4O0WA 3LIJA 4GUEA 4MNEB 3DJ5A 3FC2A 3O7LD 2CLXA 1U54B 3IPHA 3PE2A 3DTCA 2VWXA 3SQQA 4KINA 4ZP5A 1G3NA 3VS2A 2BVAA 2WMAA 4FIEA 5CF4A 4NWMA 4YZCA 2BAJA 4BCPA 4DH1A 3W55A 2J0IA 4XG9A 4FTTA 4PL3A 4MBIA 4Q2AA 2WTJA 3EN9A 3KC3A 5FWKK 3AMBA 4I4FA 3ZRLA 4BWXA 1H1WA 1H24A 3Q2MA 4GU6A 3DXPA 4IANA 4CTCA 2Z2WA 2X9FA 3PLAE 1Q24A 1TQIA 4DITA 4JR7A 5HLPA 2X8DA 2YWPA 5LMBA 2DQ7X 3QX4A 3EWHA 2OBJA 2YISA 3F5UA 3TNPC 4CZYB 4HZSA 4FK3A 3VS3A 4F7SA 2ZV9A 2X6DA 2JBPA 3PFQA 3E64A 3RBWA 3E3BX 2A4LA 5M06A 5E4HA 4PP9A 3WARA 3HA8A 3DAEA 2BKKA 3QTUA 3C7QA 3DBQA 3PZEA 4R78A 3M2WA 4BI1A 4O7WA 4C62A 2R3QA 4M97A 3NDMA 4XNEA 3LXNA 3L9NA 4K33A 4L3LA 4RSSA 2RSVA 3OT8A 4MWIA 3MDYA 2PZRA 5FM2A 1UWJA 4QP3A 4IM0A 2R3HA 4QYFA 3LFNA 4RJ7A 1H27A 4QNYA 3WF7A 1BLXA 3FMMA 3ORNA 4KRDA 3DY7A 4NYEA 3EIDA 5HX8A 3LFCA 3ZCLA 5M51A 2OZOA 2QKWB 5KNJA 4RIWA 4LI5A 3V5WA 4BL1A 5CVGA 5D10A 5EQPA 4EK4A 2X9EA 1YXXA 3QXPA 4FTKA 4Y95A 4M0ZA 4NW5A 2AUHA 4FV4A 4C4FA 4CCUA 3BWFA 2WQBA 3ORIA 3V5TA 1ZMUA 4QQJA 1FVVA 4UXQA 3ZC5A 5ICPA 3U6JA 5AV3A 3R28A 4U44A 1UU3A 2WTWA 1GZOA 2QO9A 4XYFA 2CLQA 2UUEA 2GFSA 2CGWA 5IEXA 4BCNA 5LVLA 1OKVA 3KCFA 2UW6A 3ZEWA 3R22A 3KXXA 4HCUA 2QU5A 4UZHA 1FQ1B 2ZV7A 4GKIA 2QG5A 4AOJA 2E9OA 3VUGA 3ZO3A 3SVVA 3QA0A 2I6LA 2ZYBA 4O38A 2KTYA 1IR3A 5AUUA 1GJOA 3ACKA 2BPMA 4FIHA 4II5A 3FI3A 4FTAA 3P0MA 3OW4A 1ATPE 3ZHPC 4BFMA 1ZY4A 2XK7A 4IBMA 3VBXA 3ZFYA 3R1YA 5AP3A 4QYGA 3A99A 4QMUA 4FVRA 3RKBA 3LOKA 3ACJA 4AW2A 3A8XA 3EQFA 3O7LB 5H3QA 5I5ZA 2J2IB 2X8EA 4YZNA 4ZMFA 2ONLA 4NM0A 2CGXA 2R3FA 4A06A 4A4XA 3GCUA 3POOA 3DBEA 3Q9YA 2X2MA 3IGGA 3FXZA 1PYXA 1UNGA 4OTGA 1FINA 3VRYA 3L8PA 3UMWA 5EQYA 2VTJA 4O96A 4NU1A 5CVFA 5EW8A 5HX6A 3OT3A 3RWQA 4FTLA 5CANA 3HEGA 2BRGA 4I4EA 4TN6A 5HVYA 2IJMA 3I7CA 4S2ZA 2VTPA 3R7OA 4NM3A 3FL5A 1OIQA 2G2FA 3PXFA 4QD6A 4FSWA 5ACBC 5HVKA 5FTGA 1ND4A 4WNMA 1OL6A 2C1BA 4HVHA 3VUTA 3ORPA 2PVRA 3PXRA 2Y7JA 4IX6A 4TWPA 1PMVA 3G33A 3RWPA 3UDBA 3ZOSA 2WNTA 4QPSA 3O23A 2R0IA 4QQCA 4E4NA 4FSTA 3OCGA 4HNFA 3QQKA 2O3PA 2XNPA 3L8XA 4O0TA 1XH7A 5DA3A 2H96A 5C8KA 4USEA 2H34A 1E1VA 3DK7A 4P90A 3UP7A 4FSMA 3CKXA 3TG1A 3BCEA 4WUAA 3CE3A 3LVPA 3TNHA 1NXKA 1KOBA 3UIUA 1APME 3BYVA 3PSBA 4MF1A 4P5QA 4C4JA 2V7OA 2W05A 4YP8A 2O65A 4MX9A 1BI8A 2CHLA 3DDPA 1BL7A 1VEBA 4RQKA 5ANJA 3VC4A 5JFVA 3K3JA 4S34A 4NUSA 3DXQA 3PDTA 5E9EA 2G01A 4IC7A 4MXCA 4HGSA 5F20A 3PA4A 2R3PA 5GJDA 2XZSA 3WZDA 4ASDA 4FE2A 4NH1A 1GNGA 5JZNA 4F7JA 2UZBA 1OB3A 5FXQA 4V0GA 4ARKA 2QOOA 3BX5A 4IX3A 3W32A 3QC4A 2AC3A 3VW8A 5JGBA 3R8UA 4IVBA 2A27A 4N6YA 2UW7A 1OI9A 2GNGA 3G0FA 4DH7A 3BIZA 1OKWA 5C01A 3EQHA 4IEBA 4XV1A 4OT5A 2OGVA 4PWNA 4IAAA 5TKDA 2BUJA 1CTPE 4DCEA 5FEEA 5CEMA 3D5WA 4BB4A 2C6EA 3PP1A 2EVAA 3P9JA 3TJDA 2ZM3A 3F3TA 4ZSGA 4FMQA 1T46A 1XH4A 4DFNA 3VS4A 5A4LA 3IS5A 4GYGA 5EW3A 5BYZA 3UODA 5J9LA 4A9SA 4QMPA 1I09A 2ITUA 3MIYA 4F1TA 4IX5A 1SNXA 2JDOA 3FSKA 5KMMA 4D55A 2C47A 3CCNA 3DK3A 3DOGA 4BI2A 4F9BA 4L00A 3GI3A 3VWAA 5HIEA 3P5KA 1H0VA 5CX9A 2GS6A 2IW6A 5AP4A 1O6KA 3FZRA 1H0WA 4WD5A 4N4SA 2WIHA 4XV3A 5HNGA 3OW3A 3MFTA 1QPCA 3TUCA 4PRJA 4IXPA 5DHJA 2F7XE 4UMPA 3NYNA 4RIYA 2QOQA 4E5BA 4F9AA 2BFYA 3FMEA 3FDNA 4ZK5A 3KY2A 4ZJIA 3C4XA 4XLIA 3RINA 5HTCA 2PZ5A 3QXOA 3E8EA 4BBEA 4E4LA 3RPSA 4YC3A 4BYIA 3II5A 3I0OA 4WHZA 1UKIA 3SW7A 4RIWB 3P7BA 3Q4TA 5HCZA 4AGUA 1OBDA 3RPOA 4OAUC 5E1SA 3W16A 3W18A 3EN5A 4PMSA 3JY9A 4D2VA 3RPRA 3IECA 4UYAA 2Z7SA 5CT7A 4YHTA 3VUDA 1SZMA 3F5XA 5LVNA 1M7QA 4DEAA 4DEGA 4LV8A 3QRTA 3DJ7A 4I24A 3QUPA 3H9OA 4FBXA 3I0QA 4IWPA 2RFDA 3C1XA 3DXNA 2B9HA 4C3PA 4BDCA 4IE9A 4TZRA 1VYWA 4U97A 5ANEA 3V8TA 3OMVA 4BCOA 4X2NA 1QPJA 5IKWA 3H9RA 2XIXA 4YZBA 1Y91A 5EI2A 1JKSA 3WILA 4Z3VA 3DB6A 2IZRA 2XEZA 4FNWA 1YI4A 3UC4A 5BVNA 5DYJA 1JKKA 1MRVA 3VBVA 1DI8A 3RPVA 4JL9A 2CN5A 3RHKA 3NIEA 3TACA 3CXWA 4BIBA 3W1FA 5C27A 3U51A 4O0XA 5CXHA 5HO7A 2CDZA 3W10A 2YLFA 2Z60A 3F2RA 4D4VA 2NNWB 4ANOA 4WNKA 3EFLA 5ANOA 2WPAA 3WE8A 2PE1A 2PHKA 2ONLC 4L43A 4O7SA 4EOSA 2QHNA 1JVPP 4FV6A 1FGIA 3DV3A 3ZDUA 3ORMA 5J1VA 5ANGA 3KRRA 3MVLA 3NNXA 1WVWA 2V7AA 3VO3A 2R3KA 4LOOA 3R83A 4BDJA 5CEQA 4BDKA 4X2GA 2CN8A 2XBJA 3PY1A 2OH0E 4LQMA 4V05A 3ZC6A 1BUHA 5JT2A 1I44A 3QUDA 3UVRA 3H0YA 4C4IA 2G2HA 2HK5A 5EYKA 2VX1A 3SKCA 4FSUA 3HL7A 3TT0A 1GY3A 3KK8A 1EH4A 2R9SA 1PXIA 2YA9A 3LFAA 3MJ2A 4I23A 4MF0A 3VHKA 5HBJA 1RJBA 4X6RA 2QLQA 4HPUE 5D12A 3DBCA 1H8FA 4WRGA 3G9LX 2J90A 3NR9A 3IGOA 5JN2A 1CMKE 4GS6A 2FSLX 4O2PA 4QP6A 4RGJA 4NT4A 4C59A 2E9VA 4QP1A 4AFJA 2X7FA 4LM5A 2QR8A 2C6DA 1PXKA 3PG1A 2OW3A 2R4BA 5HG5A 3ULIA 4BC6A 4D9UA 5CAOA 1Y57A 4DF3A 4G34A 2RF9A 5CZIA 4A07A 4QMXA 1CKJA 2HY0A 2J4ZA 4RC3A 4N0SA 2W1GA 2XCKA 5AV0A 4RA5A 4APPA 3CQWA 3R8VA 3VUHA 2HZIA 4V0GB 2ITVA 4F64A 3QQHA 5KZ0A 2PUIA 4O7ZA 4NM7A 5L8JA 4IZ5A 3ET7A 3F3WA 2UVZA 3LW0A 2VO0A 4R6VA 4L7SA 5M4FA 2P2IA 2FO0A 3I81A 4BKYA 2BRMA 2W96B 2R3IA 3P4KA 4E7WA 5CAQA 3BGZA 2I7QA 4EORA 3ORXA 3MS9A 2ITZA 1QPEA 2PMIA 3OEZA 4XS2A 3CKWA 2OWBA 3CTQA 3OXZA 3R21A 3PZHA 4FEQA 4FKQA 3W2RA 4W4WA 4CMOA 4F6UA 3VBYA 4P5ZA 2GQRA 2CCIA 1GZ8A 1Q8TA 4UEUA 3ROYA 3FPMA 4F09A 4A9UA 3QZIA 5LQFA 3VQHA 3PY0A 3F9NA 3OY1A 4HYIA 3ZONA 4O2ZA 4BKJA 3TI1A 3CD8A 4W9WA 3HRFA 4DLJA 4QT1A 5LJJA 3W8QA 5A46A 4GVAA 5L2QA 4HW7A 4XV2A 3QC9A 4H3QA 5C8NA 3OBJA 1WZYA 2YM4A 4YTHA 4IAKA 4J7BA 4PUZA 4C02A 5HTIA 3NNVA 5BPYA 3AG9A 4RPVA 1IAJA 3N4TA 3RI1A 4RIYB 2XCHA 3IW7A 2W4JA 3R04A 4XG3A 2CGUA 4D1ZA 3AD6A 4O1PA 1WMKA 2HYYA 4GJ3A 3JVSA 4RJ4A 2UVXA 4CSVA 2VZ6A 3D5UA 4O86A 3E3PA 4LL5A 2QODA 1ZLTA 4DTAA 2WOUA 2W9ZB 3AT4A 5DRBA 4EWHA 4JBOA 3DBDA 3MI9A 2WTDA 4GIHA 1WBTA 3L9LA 4G16A 3GP0A 5HICA 1SM2A 2JKKA 4K9YA 4B8MA 3D15A 2ETRA 2OO8X 2XK3A 3OXIA 3GVUA 3LCSA 2QOBA 4IJ9A 4JBPA 3Q52A 3E87A 2RFSA 3LM0A 4FYOA 4PDSA 3OEFX 1PF8A 4J98A 1NA7A 4JIKA 4WO5A 2DUVA 4EZ7A 4BZNA 5I9XA 3QTQA 4DEHA 2UZLA 1R0EA 3E92A 3F2AA 1H07A 3OBGA 4U43A 1VYZA 4RJ8A 4CMTA 3KXNA 2QO2A 3MPTA 3TV6A 3C5IA 3QD0A 3FYJX 4C7TA 3GQLA 2I0EA 3LMGA 3PXZA 5AFVA 2OJIA 2YABA 2F4JA 2EB2A 1OPJA 4QMVA 3CC6A 3GCQA 4AGWA 4CRLA 2QHMA 1YXSA 4G6NA 2QOHA 4A4LA 5AR2A 4CZUA 3LMHA 3FL4A 4R3RA 4DBNA 3UO5A 5HLNA 5KKRB 1JWHA 2R64A 2J6MA 5DG5A 3OFMA 3R2YA 1GIJA 3V04A 5KKRC 2P3GX 3TWJA 1JSTA 5AR4A 4ZTLA 2OK1A 5EHYA 3I5ZA 2C1AA 4EC8A 4O91A 3LAUA 2VRXA 4L9IA 4O0VA 1Q61A 3G2FA 4I0TA 4K8AA 4IFCA 4PF4A 4YJPA 2E9UA 3OY3A 3R02A 3BU3A 3PXQA 3ULZA 3ZBXA 4QTAA 4DA5A 1OBGA 3G6GA 4M15A 1IAHA 2YIRA 2W4OA 4UWBA 1FPUA 2QQ7A 4M0YA 4EHZA 2B4SB 4OUCA 5FM3A 3ZRMA 3VN9A 5K5XA 2W0JA 5KZIA 3TKUA 4D4YA 2IVVA 5AP7A 5FTOA 2JGZA 3R7VA 3C50A 5DPVA 2VN9A 4O0RA 2JKOA 5BVEA 4D2RA 3C4EA 3U87A 2C4GA 2VWVA 3KXZA 4FV7A 4DFLA 2PL0A 1WBSA 4GK3A 1OUYA 4FSNA 4CXAA 3LJ2A 4M84A 4D9TA 3FE3A 3BHVA 5ANIA 3E62A 2YERA 3HV7A 3FMLA 3R63A 2UZDA 4F6SA 3FQSA 3QFVA 4OGRA 3AC3A 3GC7A 4FZ6A 3C13A 3EFJA 2YIXA 4FTRA 2ACXA 3ZXZA 1OPKA 2VWZA 4FKUA 4ZSEA 2O8YA 2WMSA 5L2SA 3HNGA 4L8MA 4MVFA 2YCFA 2ZVAA 5IA5A 3FMDA 2F7ZE 2OG8A 2OIQA 4RT7A 3WF6A 4X21A 2VTIA 2P2HA 4NCTA 3ZMMA 2BRBA 3QYWA 1PXLA 4WUNA 3LHJA 1PYEA 4TWCA 5AUZA 3FLNC 4TKSA 1OL1A 3FZTA 1OIYA 4IH8A 4OW8A 5IU2A 2VWBA 3GNIB 4TYIA 2B1PA 5I3RA 3R0TA 3VAPA 4GMYA 4G5PA 5F94A 4ZLOA 2IW8A 4FTIA 3R00A 3QTZA 4JBVA 4DHFA 4DC2A 3O8PA 4DH5A 4AAAA 4ORKA 3D4QA 3S95A 1ZYDA 2B52A 2OJGA 2W1HA 3Q9XA 3I1AA 4HGTA 4I5MA 4YLJA 1WBVA 4EOLA 3MFRA 4L68A 1HOWA 4WBOA 2C0TA 4KA3A 4B4LA 4GEOA 3VBQA 3JXWA 3MVJA 5EHLA 1MQ4A 4XCUA 5EHOA 3UPZA 3FQEA 1IEPA 1KE8A 3QUEA 4MD8E 1JAMA 3ZEPA 4BBFA 2W1CA 4O84A 4J71A 3UZTA 5CSVA 3LCOA 4UXLA 1MRYA 4C3FA 3W2SA 2LAVA 1PXJA 4QMQA 4BGGA 3FC1X 2R3LA 3PY3A 3A7IA 1YOMA 4DGOA 3FLYA 2ITWA 3OCBA 4WIHA 3A62A 4QMZA 2WTIA 3RAIA 1CDKA 5IH4A 3Q32A 2Z02A 1OL7A 4GFMA 4W4VA 3Q60A 5FEQA 3CPBA 4EOOA 5CU4A 5I0BA 1YI6A 5HORA 5M09A 3F7WA 3EB0A 1ZRZA 4QTDA 1YDTE 4UN0C 4EOPA 3MFUA 3OTUA 1LUFA 5E8SA 2BALA 2A2AA 2Z7RA 4K1BA 1PMEA 5KMLA 1NW1A 4DYMA 3TM0A 3F5GA 3I79A 2KULA 2YCQA 4DEDA 2BZHB 4BDAA 4UV0A 4AA4A 4TYHA 2OIBA 1ZYLA 4DT8A 4FC0A 5AUXA 4OTWA 5BUEA 3RM7A 3LLTA 3R01A 4ACHA 5HESA 5EOLA 3PSDA 3G90X 4B0GA 3QTSA 1P5EA 5JRSA 1P2AA 2HW6A 3DNDA 3E7OA 4J52A 2V0DA 5AM7A 4ONAA 1KE5A 4UB7A 3NYXA 2H9VA 3TIZA 5TF9A 4APCA 4DFYA 1H1QA 3KXMA 5DGZA 4CT2A 5J7HA 5JQ8A 3G15A 3A2CA 4RX7A 5EFQA 3NNWA 4S31A 3LLAA 3ZRKA 4EH9A 3UE4A 2WMUA 4R8QA 4EJNA 2XJ0A 4FYNA 2HCKA 3NIZA 3DFCB 5KMKA 4N57A 2HZ0A 4EUTA 1YHVA 1PW2A 3FQHA 2PVJA 2BAQA 2R2PA 5ETFA 5IH5A 5KUPA 3UP2A 4DT9A 4Y72A 4QQ5A 2BCJA 3NW7A 4Z55A 3Q3BA 5EKNA 4EYMA 2NO3A 4IAZA 3QHWA 3A60A 1OL2A 2HWOA 3DQWA 3KRWA 4Q5EA 3O71A 2FUMA 1OECA 2WTKB 2WTKC 3BEGA 4HGLA 2OXXA 3UOLA 4RC2A 4IB1A 4E6AA 5CNOA 2PVHA 4MXYA 5IDPA 3EOCA 3NUAA 1PKDA 4ZTNA 4WNPA 3UG2A 5GINE 2P33A 1BYGA 4I3ZA 2JAMA 2VTSA 3QCXA 4DGMA 3SX9A 3KMMA 2Z7LA 5FLFA 4E4XA 4E1ZA 1G8SA 4OBPA 5DNRA 4BDDA 4O7RA 4FKTA 5C03A 1URCA 3MPMA 5A14A 3FWQA 2PUNA 4J99A 5G6VA 4XX9A 4JAIA 4MK0A 1R1WA 2GS7A 2YJRA 4FG9A 5I9YA 3TDVA 2EUFB 3UNJA 5M4IA 4O7YA 2F7EE 2WQEA 4WSQA 3UVQA 2WQMA 3A7FA 4QO9A 3PVBA 2WMTA 2HELA 4BZOA 2IZUA 4MKCA 1UU7A 3R9NA 3H10A 2EXEA 4FTJA 2Q0BA 3LXPA 4EOKA 5M08A 1QCFA 3ATTA 3TXOA 4RJ3A 2R3GA
chains in the Genus database with same CATH superfamily
1ZOEA 4UX9A 2BKZA 2R3NA 4BYJA 3QKLA 4RWJA 3NCGA 5EYCA 5IQHA 2BIKB 4EHVA 5BUIA 1FVRA 2FA2A 4YO4A 3ORTA 4U9AA 3HMOA 3HECA 4ZY6A 2AEGA 4G1WA 1O6LA 2YZAA 3IKAA 5KMOA 3COKA 2QOIA 4U41A 5HD4A 2Z7QA 4AGDA 3IK3A 3D7TA 3ENMA 4GG5A 1M52A 4DDIA 1W98A 3E8DA 2UZOA 4K77A 4GV1A 4L67A 5EM5A 4ACCA 3EFKA 4QOXA 5KBRA 1PJKA 1ZOGA 3LQ3A 3LCKA 2XP2A 2XA4A 1IG1A 3PP0A 2YDJA 4LUDA 4R1VA 5HVJA 4XP0A 4QNAA 4ZJJA 5JFWA 3FHRA 3ORLA 4NCTC 4FUXA 4AOTA 4EH6A 3KF4A 4QMSA 3TJCA 2WB8A 2UW4A 5EDRA 3PSCA 5J5SA 3R9HA 5ETCA 1ZZLA 3C4CA 4ZSAA 2FSOX 4OTHA 2BRNA 4CG9A 4Y83A 4O6EA 4U40A 3MFSA 4FV8A 2Z8CA 2IZTA 4PP7A 2XYUA 3IG7A 4IZAA 4L52A 3WYYA 1UKHA 2CPKE 2XNNA 2O2UA 4P7EA 4YHFA 5F1ZA 1CKPA 4TPTA 3DKGA 2WGJA 4FV0A 4NEUA 2R3JA 3PJ1A 3ZLXA 3O5AA 2OSCA 4R3CA 2UZWE 4CKIA 4ITHA 2WU7A 4XRJA 3RAWA 3JVRA 3QRJA 4BTFA 2OZAA 3ELJA 4FT3A 3TZ7A 3FXXA 4PTEA 1Q3DA 3IW4A 3PIYA 1JBPE 3U8WA 2XUUA 3RK5A 4YLLA 2PVNA 4TYEA 3S4QA 2B9FA 5A4EA 3W8LA 2Y6MA 3GB2A 5KE0A 4BHNA 3MV5A 3OWLA 2X6EA 3PJCA 3SOCA 4HVIA 4U0IA 4D5HA 3FI4A 1J7LA 5DEWA 4JX3A 3UOKA 4OTPA 3A4OX 4RRVA 3UO6A 3SOAA 4FKJA 4CFVA 1O6YA 2G2IA 4TWNA 4F1MA 3R8MA 4BDBA 3EQBA 3MY0A 5M55A 1XH6A 2HW7A 5A6OA 5CF5A 4TTHB 4L3JA 4XBRA 2HZNA 3GT8A 2HOGA 4MXZA 2F49A 3R9OA 4PX6A 4NZWB 1SVEA 4EQUA 3F5PA 4IAYA 3MVMA 3PUPA 4PPBA 5HO6A 2IEWA 4AX8A 4GSBA 2C6LA 4NJDA 4BCQA 5CXZA 4NL0A 4YBJA 4C4GA 4GU9A 3Q04A 5E8YA 2AC5A 4JOAA 5EM8A 3P08A 4QQTA 4NSTA 3QALE 4NFMA 5J9YA 3BL9A 4ZY4A 2ZMDA 4BRXA 1KV2A 3HDMA 3V01A 3TUBA 3EYGA 2BDWA 4RIOA 1M7NA 1YI3A 3ORKA 3OXTA 4RZWA 4MTAA 4XJ0A 3T9TA 5FDPA 3UQFA 4NW6A 3TNQB 3EQCA 3TTIA 3ZO1A 3T3VA 4FF8A 4IHPA 3QZFA 4FKGA 3V5QA 2C5XA 3PRIA 2V5QA 4IMYA 1Q8YA 3VJOA 2IVSA 3Q6UA 1NVRA 3FUPA 5B7VA 4EOIA 2VWUA 3HP2A 3PVUA 2UW5A 4D28A 5CSWA 5EYDA 3W0SA 5LVMA 4DHJA 1KSWA 5DBXA 4Z16A 2GDOA 2WHBA 3NCZA 4NKSA 3QKKA 1XBBA 4U3YA 4ZY5A 3COIA 2GNIA 2ITXA 4PPAA 4KWPA 4MNFA 1KOAA 1W83A 2PTKA 2UW9A 1XKKA 2W06A 2PE0A 4CGAA 1XBCA 1H08A 5GNKA 2ETKA 2XK4A 3R7YA 4IZYA 1WCCA 1Y8YA 4R5YA 4YNOA 1KV1A 5BQ0A 3COHA 2JEDA 4PTCA 4FUYA 2PVFA 4XG6A 4F70A 5CSHA 4AA5A 4AWIA 4J96A 4JG8A 1QL6A 2X4FA 3DKCA 4CQEA 4ZLYA 3BHYA 4E6QA 1XH8A 2X39A 5CEIA 3A7JA 3G9NA 5FUTA 3CP9A 3UTOA 3P7AA 4PDPA 5TO8A 4TRLA 1KE6A 3GU6A 3ALOA 3KFAA 3AKLA 4EJ7A 4MQ2A 4MQ1A 3P23A 4FKOA 4WG5A 2ITQA 4R7HA 1YW2A 4BTJA 2QU6A 2WMWA 4IB5A 4XH6A 1H1SA 2EB3A 5GHVA 4RJ5A 4GK4A 4ZS0A 3UDTA 3ZH8A 4CQGA 5CF6A 4PMMA 4ANQA 3QTXA 5AAGA 5CQUA 2X7GA 3I7BA 4YHJA 4RFYA 4CD0A 2R3MA 4CKRA 5JQ5A 5CI7A 3QTIA 2PULA 4NTTA 4USFA 4LOPA 5HHWA 2CMWA 1JOWB 3FMKA 4O81A 5J7BA 3MTLA 3HZTA 5FG8A 3UZPA 4C38A 1H1RA 3DCVA 3PYYA 4AGCA 1PRYA 4M67A 1PXPA 3KQ7A 5L2WA 2OFVA 3C0GA 3AC8A 2UZTA 2C6MA 4IVDA 3ZLYA 4IWDA 4AT4A 5LMKA 3ML1A 3U54A 2IPXA 3PXKA 2QD9A 4IVCA 2F57A 4KIOA 4A9RA 2OICA 5BMSA 4BDIA 4C37A 3BU5A 4K11A 4BHZA 4BWPA 2ZM4A 3PPJA 3IDBA 4EC9A 3FMJA 4K6ZA 5H2UA 4CLIA 5AADA 1UV5A 1DS5A 5ANKA 4D2PA 2QURA 2VTRA 2QONA 5B2LA 2XALA 3K3IA 4EYJA 3Q4UA 3P1AA 3EYHA 4F99A 3P86A 3W0OA 3TZ8A 5C26A 5IPJA 5GZAA 4YZ9A 4ITJA 1LEZA 3SRVA 3A4PA 1H1PA 2PMLX 4FT7A 5DVRA 5HKMA 4FGRA 3WBLA 4J95A 4C0TA 1G8JA 4AXCA 5LOHA 4KNBA 3IW5A 1M2RA 2YDIA 3PJ3A 1GAGA 2W5AA 2CNVA 2OZAB 3GCVA 4B8LA 4I5PA 4DINA 4TL0A 2PY3A 3BBTB 3S2PA 3ZDIA 4EK5A 2FSTX 4TNDA 5C4KA 4HOKA 3NLBA 4Y85A 4UYNA 1WBPA 3BYUA 2JDVA 1OL5A 3CTJA 1BX6A 4I92A 4DFBA 3B2TA 5EYMA 2CNUA 5HQ0A 3REPA 3LXKA 3F88A 4I1ZA 4ZXTA 2XNGA 4UALA 3PPZA 2VTMA 3UIMA 3COMA 4GK2A 5CNNA 4IB3A 4F7LA 5JZJA 4XV9A 4BJJA 2JFLA 2W4KA 4NM5A 4FIJA 4EEVA 4RIXA 4LRKA 1YOJA 4YU2A 4XHKB 2YJSA 3GU5A 4GG7A 3RM6A 4PV0A 4C33A 3DQXA 5AX9A 1WFCA 5L6PA 1A48A 2OIDA 1XQZA 1YXTA 3BL7A 2C3JA 2SRCA 3BE2A 3SG8A 3UOJA 3HMNA 4OTRA 3G0EA 4EH5A 2WEVA 4BR3A 2RFEA 3IO7A 5CS6A 4AF3A 3OS3A 4AT3A 2OH4A 2YAAA 2JKMA 4BDEA 3DBFA 4PDYA 3V3VA 3DGKA 5CEPA 2WD1A 4M13A 3O50A 5HEZA 1H26A 3AC5A 4IX4A 3PPKA 1WBOA 4FEUA 5D9HA 5IZFA 2PU8A 3VBWA 3DAJA 3AKJA 2QI8A 3DTWA 3BQCA 2XKFA 1F0QA 3HA6A 4OAVB 4LG4A 4F78A 2XKDA 4QYHA 5DWRA 4I6QA 2V22A 2VV9A 5HGIA 3Q5IA 5E7RA 2R7BA 4YURA 2WO6A 1QPDA 2JAVA 2WMBA 5E1EA 4BDFA 2YIYA 4MCVA 3SAYA 1F3MC 2YWVA 2BFXA 4GL9A 2CCHA 1H28A 3ODZX 5L8LA 5K3YA 4FL3A 4FIGA 2IN6A 4I22A 2PZYA 3ORZA 2QC6A 5EG3A 2PE2A 4E73A 4EI4A 5AP1A 3LFSA 5ETIA 4KUJA 4R7BA 4ZTSA 1UWHA 5AUWA 2ITOA 3BGQA 4TWOA 4AQCA 2C68A 4P4CA 2O64A 3CGOA 3SXFA 2XNOA 5CU3A 4ERKA 4DG2E 4H58A 3FLSA 4LL0A 5DI1A 5LARA 2CKEA 4EL9A 4UY9A 3EZRA 4FV1A 5HIBA 4JDKA 3QZHA 2J5FA 5HOAA 4UMRA 3ZSHA 3BKBA 3RZBA 4ZTHA 3PTGA 3W2PA 5AUVA 5D7AA 5LVOA 1YDSE 2R3RA 4BI0A 3KULA 5DN3A 1R0PA 4ZZNA 5I9VA 4IWOA 2UV2A 4G17A 4YJSA 3FI2A 3SGCA 2EWAA 1Q62A 2XNMA 4EWQA 4JG6A 3R7IA 4F65A 4EHEA 4O0YA 4TXCA 2ZB0A 4L7FA 4O4BB 3HV4A 1PKGA 4MD7E 5A9UA 3KVWA 3GCPA 2X8IA 3EQRA 4FV2A 4LGDA 4M68A 3T8OA 3VHEA 3DU8A 3R1NA 5JMSA 4I93A 3P78A 4E5AX 1A06A 3JS2A 3DK6A 3VS5A 2GHGA 3UQCA 3BZ3A 1URWA 4OTQA 2X81A 1M2QA 4AE6A 3RPYA 3QTWA 2IWIA 3Q6WA 3O17A 3WF9A 4L53A 1QMZA 3KGAA 1Q8UA 4IJPA 5JH6A 3EFWA 3E88A 3R30A 2NP8A 1ZYSA 3PA3A 3IW6A 5IQCA 5LMKC 4IAIA 2VO7A 4AG8A 3VRZA 2C6KA 5DIAA 3UC3A 3LFQA 3Q2JA 5LCJA 3NVMB 5IA3A 5ITAA 4JQ7A 4E20A 5JGDA 3VS7A 4H3PA 4YJUA 1R39A 3AMAA 5E8TA 2B55A 4CFFA 3D9VA 4O27B 4E93A 2HXQA 2PVKA 3DJ6A 4O82A 4MXOA 3BV2A 3SHEA 2JC6A 4FA2A 1XWSA 2GQSA 4BWKA 5HU9A 3QCQA 3WZUA 2ZAZA 2WAJA 3AD5A 4PL4A 3SA0A 2OF4A 3L8SA 3LFFA 2QNJA 3CD3A 3HV6A 3O2MA 3AGLA 3Q5ZA 4FKSA 4L6QA 4QP7A 3SRVB 3BYSA 2GHMA 3R6XA 3EQPA 3KU2A 4ANMA 4AW0A 1NVSA 3QQFA 4DTBA 3KRLA 3VVHA 4OR5A 2JD5A 5TR6A 4S32A 4O0SA 2VX3A 2C3LA 3BPRA 4WG3A 4YZDA 1Z5MA 1V0PA 4JNWA 5E8VA 4U3ZA 5CALA 3GGFA 4EQMA 2ZV2A 3FMNA 3QD4A 5LXMA 3FKNA 1HCLA 4H3BA 2WU6A 2P55A 1YOLA 3QGYA 4WNOA 5AP2A 5EI8A 5FXSA 2C69A 3VS1A 4GW8A 2Y4PA 4IWQA 4AN9A 3D7ZA 1KE9A 4G3EA 4QMNA 3GC9A 3H9FA 4JDHA 2YFXA 4UZDA 2HIWA 3UNZA 1YWNA 4X7QA 2G9XA 3OD6X 4GH2A 4ACGA 3HV5A 4BJJB 2BZKB 1XBAA 4G3DA 1Y6BA 4RIXB 2C0OA 5F9EA 5L2IA 1FBNA 2ZOQA 3FZOA 3ZLSA 4C4HA 2W1EA 4M69A 1DI9A 4FTOA 4RVKA 4YMJA 4WBBB 4XG2A 3WOWA 4CFXA 1OGYA 3QQJA 1V0BA 1J1BA 3THBA 5CSPA 4L45A 3LFEA 2YHVA 5CT0A 4H1JA 1TQMA 4XOYA 4KABA 5HI2A 5AWMA 2RIOA 4YJOA 2V55A 5AV2A 3EKKA 4EK6A 2B9JA 4FSZA 5AJQA 3UJGA 5AIRA 5F4NA 4A9YA 4HVDA 5IEVA 4YUQA 5A54A 2FGIA 4AOIA 3WIKA 4S33A 3TEIA 2OJJA 4AZEA 3QLGA 2BRHA 3E63A 2VO3A 2VGPA 3UVPA 4QYYA 5HIDA 3OOMA 3C5UA 4G3FA 2X2LA 2UVYA 4QRCA 4YTCA 3O96A 4C2WA 2Q83A 4XUFA 3ZSGA 5CAVA 2BROA 4MXXA 4C35A 4JJRA 5KX8A 4PNIA 3IONA 4OBQA 3IOKA 2W1IA 5GZ9A 3PJ8A 3FMHA 4E26A 4TYJA 4HVSA 5KHWA 2UZVA 5FQDC 4YTFA 4GKHA 4MXAA 3CEKA 2UZUE 4L46A 4FZ7A 4CVAA 4R7IA 2VO6A 3QAME 3V51A 5FRIA 3HGKA 4FGBA 3BLQA 1G5SA 5J8IA 3U4UA 3WZEA 2PMNX 2B0QA 3MYGA 2BILB 4EOJA 3FZSA 3Q53A 2WMXA 4RLKA 4BN1A 5DE2A 3U4WA 3HRCA 4G31A 4XRLA 1ZZ2A 3E7VA 1IA9A 4FSRA 2J5EA 1V1KA 1J7UA 4LRMA 4Y8DA 3OWKA 2YDKA 4FVPA 3S1HA 2XKCA 5BYLA 2VWWA 3P79A 3WIGA 2REIA 3OHTA 3H0ZA 2FH9A 3SW4A 4RZVA 4M3QA 5LVPA 3C51A 3E93A 4KS8A 2WFYA 4MH7A 3VIDA 2GTMA 4UMUA 3OVVA 4X6QC 5IMEA 3KULB 5D41A 3DB8A 3QF9A 5J5TA 4DFZE 1KWPA 3FYKX 2B7AA 2QOKA 3UYTA 3HP5A 1P4FA 5A6NA 3ID6C 4EH2A 1PXNA 3C0IA 5AV4A 4C34A 1ZOHA 1UA2A 5IEYA 2CKQA 5AEPA 5EQEA 4YZMA 2R7IA 4HYHA 3HMIA 1AGWA 4HJOA 4BCGA 5J1WA 4I20A 1P4OA 2HAKA 4XMOA 4IZ7A 3DS6A 3NUSA 4FKLA 4Q5HA 4M8TA 5D1JA 3TKHA 5E8ZA 1NY3A 3PXYA 3NUUA 2BZIB 1BKXA 3KKVA 3SD0A 2RGPA 3ETAA 5FP6A 1YHWA 3A8WA 4CYJA 2ERKA 3H3CA 5LWMA 3R73A 1H25A 2VTNA 1ZYCA 2A0CX 4QPAA 4AAYA 3RP9A 3Q9ZA 3UYSA 3LFBA 4HYUA 3GU4A 3LQ5A 3EL8A 2FSMX 1VR2A 4IAFA 4J53A 4C8BA 3MESA 3GFEA 5KHXA 4WRSA 3NX8A 4YSMA 3GBZA 5HO8A 3L9MA 5AR7A 3U6IA 3AQVA 2XK9A 2VD5A 3RCJA 4MYGA 5M53A 2J0MB 2VTLA 3I6WA 5L6OA 3A61A 3SXSA 2A1AB 4GJ2A 1Q99A 4RFZA 3WF5A 2QKRA 4WG4A 4HYSA 2GNLA 2I0YA 4ENYA 4WT6A 4C3RA 2J50A 2RFNA 1ZYJA 5BVKA 3L8VA 3GUBA 3B8RA 4KKEA 1ZMVA 4EBWA 4EOMA 4Z7GA 5IQGA 4UWCA 3HUCA 4FT9A 4CMUA 1JSUA 2QO7A 1A9UA 1W0XC 4R3PA 3D5XA 4I6BA 4H39A 5EK7A 2QOFA 2YLEA 3DZOA 3GC8A 4F7NA 3JR1A 1U46A 3TUDA 2PZPA 3PA5A 2Y0AA 4O7TA 2QOCA 4EH8A 4MEDA 2W9FB 5IG1A 3FAAA 4QP8A 5HD7A 4UMTA 2PVYA 1G8AA 4EK3A 3MH1A 3GU7A 3MGYA 1LP4A 4XP3A 5DT4A 2IW9A 4HCTA 2R3OA 1WAKA 4EZ3A 5K0KA 4ZTMA 3FSFA 4MHAA 2J0JA 4YPDA 4R1YA 2PUUA 2VU3A 2WMRA 4XBUA 2J0KA 2WQNA 4AP7A 5EKOA 4MBJA 2GTNA 4E5WA 5I9UA 5HTBA 5IA2A 5EOBA 4CCBA 4X3FA 1RDQE 1S9JA 5CQWA 3TTJA 4BZDA 2JDSA 2XH5A 2H8HA 4IM2A 3PFYA 4QP4A 3F3ZA 3RAKA 1O9UA 5EI6A 3B8QA 4XLVA 1V0OA 2UZEA 3FY2A 1RW8A 2WXVA 4FSYA 5C9CA 3VS0A 4ZZOA 1JSVA 4XG8A 2C30A 3N4UA 5TE0A 1YRPA 5CVHA 3NSZA 5EH0A 1PXOA 3F66A 3I6UA 2XIZA 4LUEA 5FD2A 3EN7A 1OM1A 3MA3A 3ROCA 5IA1A 2WELA 4YSJA 2WZJA 2GNJA 2X1NA 3F7ZA 4BIDA 3KREA 5IQBA 4ALUA 3QYZA 2C0IA 4FEWA 3RK9A 3D2KA 2QR7A 4N6ZA 3D5VA 4AUAA 3FI8A 5TT7A 1DM2A 4FV3A 3KRJA 3WI6A 4EUUA 1UU9A 4FTNA 4O22A 3D14A 1PY5A 5A4TA 3SLSA 2W1FA 3BE9A 2WEIA 1K9AA 2YCSA 4M7IA 2X0QA 1JQHA 1WVXA 2Y9QA 3R8ZA 3W2QA 1J1CA 3FPQA 3UIBA 3PIZA 3BBWA 4CFWA 3MY5A 1K3AA 5C4LA 1HCKA 5L3AA 1YHSA 3RVGA 3LMIA 5BNJA 2WMVA 1W2FA 2DYLA 2YIQA 3R71A 4EH7A 4U45A 1W8CA 5DH3A 4ZEGA 5IMXA 1OIUA 4R5SA 3TIYA 2FB8A 4IDVA 3VS6A 4BCFA 5IH6A 5J9ZA 2FVDA 3F69A 3QD3A 3AC4A 2XF0A 3MH3A 4JBQA 5CI6A 1TQPA 5JSMA 3S3IA 4QTCA 4JQEA 5K5NA 2I0HA 3MWUA 3RMFA 3I5NA 5AP6A 3BWJA 3ZBFA 1OZ1A 3S0OA 2IF8A 3LJ0A 5ETAA 3MSSA 2UW8A 2BR1A 2VNWA 4O1OA 3N9XA 3R7EA 2X0GA 3HRBA 2YM7A 4X3JA 5DT0A 5HG9A 3ODYX 2RG5A 4FZFB 5IUIA 1GIHA 3V8WA 1Z57A 1YKRA 2YM3A 3OF0A 4QPMA 4AS0A 2QLUA 3VF8A 3EN4A 4NIFA 4MAOA 4FT0A 1H00A 4W8EA 3SC1A 4FX3A 2GMXA 2JDRA 3ZLWA 2QVSE 4AZSA 5CEKA 3G6HA 3Q4ZA 5CLPA 4EKKA 2VTTA 4GYIA 3ZZEA 4XG4A 3EH9A 4G3CA 2OJ9A 5HG7A 3NUPA 1R78A 2GNHA 3LQ8A 3NUYA 3AOXA 4KD1A 4RLLA 2ITNA 2HWPA 3QQLA 3SV0A 2BTRA 1U5QA 4ZS4A 5T68A 3E5AA 2XM8A 3TNWA 4G6OA 4E4MA 4BBMA 4USDA 2CKOA 4CYIA 3MN3A 3OWJA 3N51A 4KB8A 3RK7A 3R7GA 1ZMWA 2O63A 2XB7A 4YO6A 1UU8A 2IZSA 4LFIA 2RL5A 4O6LA 4DTKA 1J3HA 2IVUA 2HZ4A 3ZUTA 4D5KA 3GOKA 4J97A 4LMUA 3UG1A 3C4WA 5DR6A 3ZM4A 4E6CA 1JNKA 1Q97A 4I41A 4MD9E 1Q3WA 3OCTA 4IIRA 4L42A 4FKWA 4BF2A 2OKRA 3DLZA 3OUKA 4FNZA 1U59A 2GNFA 3WZJA 5JKGA 5FBOA 2FYSA 3OP5A 1WBWA 4FT5A 4LGHA 2OU7A 2JBOA 4EZ5A 3NAYA 4FTQA 4XP2A 2BDJA 3MIAA 5AUTA 4BIEA 5JRQA 4P2KA 2O0UA 4ZJVA 4TYHB 4UWYA 3CQEA 3Q9WA 4FV9A 2C3KA 5IQDA 1E9HA 2WMQA 3HAMA 3EN6A 2W1ZA 3BHTA 3CPCA 5I3OA 3SDJA 5FTQA 1XR1A 1YVJA 2IO6A 2ZJWA 1JKTA 2BHHA 3PVWA 4FR4A 4KSPA 5AR5A 2XRUA 2C5VA 4Y46A 3L9PA 1W84A 3VUKA 3W2OA 5GJFA 5LMAA 4K0YA 5I9ZA 4RWKA 3ZO4A 3OZ6A 3BU6A 4RC4A 2P0CA 3LZBA 3ZS5A 3QHRA 4BTKA 4BTMA 3LM5A 5AA8A 3RHXA 3U9CA 5E8UA 3QZGA 4J8NA 1M14A 5B0XA 3C9WA 1MUOA 2NPQA 4ID7A 4G5JA 5CF8A 2NRYA 3QA8A 4Y73A 4X3FB 2BIYA 4X3FC 4Y5HA 3R8LA 4ZLZA 5HZNA 2PYWA 2OXDA 1KE7A 4DHZA 5CU2A 2PWLA 3BGPA 4W4YA 5IDNA 2YZLA 4G3GA 4G9RA 2OFUA 5HE0A 2J9MA 4F63A 4ANNA 4MUQA 3JY0A 2XRWA 4B9DA 3GXLA 3NNUA 4TYGA 3UOHA 4YTIA 2Q0NA 2YEXA 1FVTA 1TKIA 2JKQA 4YGAA 3HMPA 3FLZA 4RVLA 4C61A 5TOZA 4RX9A 5KMNA 4W4XA 5JGAA 4GFOA 3ZFMA 4FKIA 4FOCA 4BCJA 2PSQA 2X2KA 4BCKA 1ZWSA 4UMQA 5AR3A 3ANRA 5D11A 3MJ1A 4ITIA 3EQGA 2XANA 4AZWA 4IQ6A 2RKUA 3BRBA 3WF8A 5IQEA 3TCPA 3QL8A 4BICA 1AQ1A 4IFGA 4F1OA 5IA0A 2C5NA 4CLJA 4LOQA 4C2VA 4KIKA 3AC1A 4ZSLA 3UPXA 1X8BA 3NYVA 4RMZA 4K18A 4W9XA 3NUXA 2XVDA 2PVLA 3HV3A 5BMMA 5T3QA 3AT2A 3V6SA 4HGEA 5CWZA 4ACMA 3V5LA 5IUGA 3KEXA 4AU8A 3KCKA 1VZOA 3QD2B 4AE9A 5AA9A 2PVMA 4ZSJA 4C58A 3VBTA 3RGFA 3QLFA 4YJRA 4KSQA 4RX8A 3UMXA 4I6HA 4KAOA 3NFFB 3CR0A 3EL7A 3F61A 1OKYA 3D7TB 3EHAA 1FGKA 3CBLA 4EQCA 2YCRA 3K5UA 3G5DA 4AXAA 3R8PA 4BVUA 3FZPA 5E91A 4DDGA 4I0SA 3NVKI 4YC8A 4TNBA 1PMNA 1CM8A 4G9CA 4NFNA 4HVGA 5JK3A 4DFUA 2Y6OA 4JDIA 3MB7A 3NRMA 3F2NA 4CRSA 3OG7A 1CSNA 3GOPA 4YJQA 4IADA 2P4IA 1IRKA 3UZRA 4M12A 4OT6A 4CV9A 5AIKA 4DLIA 1H4LA 5IQFA 4JR3A 3F3VA 3LJ1A 4NIFB 4OBOA 3A7HA 4RG0A 3VJNA 2I40A 3ZZWA 1UNLA 2EXMA 4D0XA 1RQQA 4CFNA 2XIRA 2B53A 3DAKA 2ESMA 3DKOA 1JPAA 2ITTA 4AW1A 5DR9A 5AUYA 2XM9A 5CSXA 2PUPA 3OUNB 4FVQA 1OITA 2ZDTA 3K2LA 3NW6A 3FKOA 4IB0A 5CTPA 5J95A 4AN2A 2VWIA 1L8TA 4AZTA 3MW1A 3D94A 2HY81 3UBDA 4F0IA 1PHKA 3AMYA 4YJVA 4AFEA 3RALA 2VGOA 3LXLA 4JG7A 5H8GA 4XEYA 3VONA 4YLKA 3KXGA 2W5HA 4PMTA 5JFSA 2XEYA 3RJCA 4BGHA 3IDCA 4U79A 4EBVA 4F9WA 3O8UA 5M4UA 3EKNA 3F3UA 3NAXA 4C57A 5LWNA 4H36A 4BDKA 3QKMA 3R2BA 4FKVA 4DFXE 2C5YA 2LGCA 4JX7A 5FDXA 5M57A 5HNBA 4DEEA 1OUKA 5AV1A 3U55A 4QMWA 4YNEA 2IVTA 3KRXA 3R9RA 2QOLA 3LCTA 1CKIA 3G51A 1Z9XA 3NGAA 4EKLA 3HMMA 1B39A 4FIIA 4FIFA 3R7UA 2XKEA 4CFMA 4OTIA 3PWDA 1M2PA 4CFUA 2RG6A 3NZ0A 4MBLA 4FKPA 4FNYA 3CQUA 3T9IA 5FP5A 4U80A 2CNQA 3HAVA 4AN3A 3U6HA 3QRIA 3SXRA 3M11A 4KS7A 2BZJA 5L4QA 4KBCA 2GPHA 3FXWA 4FNXA 3QGWA 4UBAA 3KMUA 4U6RA 1SNUA 3EQIA 3ZYAA 4EH3A 2NYAA 4CEGA 3HYHA 4JXFA 4G2FA 2ZDUA 4WA9A 2ITPA 3DZQA 3MBLA 4QMMA 3BV3A 5AP0A 4EOQA 3BLAA 4FV5A 2PPQA 3OOGA 4U8ZA 4ZMEA 2UZNA 3PG3A 3TKIA 3F82A 3ZU7A 3QRKA 2R0UA 3CJFA 5HG8A 4KIPA 4F4PA 5K4IA 2HXLA 3FLQA 3ANQA 4QTBA 3V5PA 3HVCA 3WZKA 5BYYA 4AT5A 3MTFA 2G15A 4LMNA 3R9DA 4DGLC 1YWRA 3M1SA 4FL2A 5IA4A 3CY2A 4IVAA 3HX4A 1AD5A 4RJ6A 3RTPA 4U7ZA 2CKPA 4ANBA 4AZVA 1GZKA 4IDTA 2IG7A 2JIIA 3UIXA 1PMUA 5HBHA 2UW3A 4RX5A 1Y8GA 2JDTA 4ALVA 4F6WA 4FZDB 2XJ1A 2V62A 4CZTA 5I9WA 2XYNA 4FICA 5J79A 3GU8A 2J7TA 1MP8A 3BHHA 3W2CA 4BKZA 4D2SA 5L6WL 3FV8A 3IOPA 2YIWA 4H1MA 2BAKA 4G6LA 3KA0A 1BMKA 3DT1A 2WIPA 2XK6A 1DAWA 2H6DA 1FOTA 3HLLA 5DR2A 2BHEA 4X0MA 3U9NA 3C4FA 4DN5A 1B38A 5K9IA 4JQ8A 2C6TA 3LPBA 3ATSA 2J0LA 4NJ3A 1IASA 2PMOX 4F0GA 4PDOA 4ASZA 2A98A 2JLDA 2AQXA 4X2FA 4TW9A 4EH4A 3OCSA 1YXVA 3O51A 1Q8ZA 2XNBA 4XOZA 4FEVA 4I94A 3BQRA 3V8SA 2Y8OA 4GRBA 3DLSA 4JRNA 4DGNA 1P14A 2F2CB 4KIKB 4X2KA 3CTHA 3JYAA 4ERWA 4PNKA 3GQIA 5IQIA 5A4QA 5M4CA 4O21A 3V5JA 1STCE 3QCYA 3QQUA 4RBLA 4RWLA 3O0GA 5CAPA 4B7TA 5BX0A 4C4EA 3V6RA 3BHUA 2C6IA 3OWPA 3GENA 2EU9A 2Y4IB 2W99B 2Y4IC 5EDPA 3NUNA 4Y5QA 1Q8WA 5HCXA 3PWYA 4BGQA 2E9NA 2W5BA 3KN6A 2ZM1A </