4GIIA

Tyk2 (jh1) in complex with 2,6-dichloro-4-cyano-n-{2-[(cyclopropylcarbonyl)amino]pyridin-4-yl}benzamide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
TVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Lead Optimization of a 4-Aminopyridine Benzamide Scaffold To Identify Potent, Selective, and Orally Bioavailable TYK2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 289
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4giiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4giiA01
2DS1A 2XK7A 1ZOHA 2CNUA 4ACCA 1FMKA 2NP8A 4CZYB 3COIA 3HRFA 2J5EA 2WIPA 2YABA 3ZUTA 4F70A 5LCJA 4XV9A 2CGUA 1GIIA 4V05A 1B38A 1SM2A 4DF3A 4FKUA 5ETCA 3ZH8A 4NEUA 3VUMA 3KCKA 3SV0A 5E92A 3KXMA 2QLUA 5BYZA 4CTBA 4GS6A 1K2PA 3OBGA 4DGNA 1Q8WA 4FTKA 3G51A 4GG5A 5GHVA 4EK8A 2YEXA 1OIUA 2BTSA 1R1WA 3G9LX 3UTOA 4BDDA 3OOMA 4G3FA 3VNTA 3R04A 1PJKA 4ALWA 4O7ZA 1BKXA 3M11A 4FSZA 3RWPA 2UW0A 2HZIA 5J5SA 5KMMA 5IMXA 5HVYA 1WZYA 5KZIA 4RJ5A 4FZ6A 4YC6A 4BIEA 3KXGA 3PLSA 3UPZA 4R8QA 4F7JA 5DG5A 4FNYA 5IUGA 3U4UA 4BYIA 2GQRA 4FV0A 3B2TA 3IW7A 4OTWA 3NUAA 4FTIA 3QX2A 3VRYA 3FI2A 4QQJA 1XKKA 3PVGA 4H39A 3ULIA 3AG9A 4R1VA 3CD3A 5EW8A 1GZNA 4LOQA 1F5QA 2C6OA 4H36A 1JSVA 4O0RA 4ASXA 5C03A 3NUPA 3PDTA 2X7FA 4QQ5A 2W4KA 3BX5A 3GCQA 3LCKA 4WUNA 4JLCA 3NSZA 5C9CA 4JDJA 3RPRA 4DTKA 1LPUA 3CCNA 5AUUA 3V5TA 3C13A 3HKOA 3IW5A 4DEIA 1TQIA 5KHXA 2RG5A 2VO0A 2FVDA 2UW6A 1J91A 2VTJA 3G5DA 4Y95A 3I6UA 3N51A 4G3GA 3MB7A 4IWOA 2AC3A 3ZSGA 4C62A 5CAVA 2VWWA 4KIPA 4OTDA 2X2KA 3LQ8A 4A9SA 4H3PA 4BDEA 1OIRA 3I60A 3QTSA 5EDRA 3WF8A 3PIZA 4F65A 3P23A 3DXNA 3DFCB 5CNNA 3ZOSA 5M44A 3C0IA 2VV9A 4FKQA 1XBAA 4MBJA 4A4XA 4UN0C 3Q53A 4EC8A 5JRQA 4KUJA 4GK2A 3RAWA 4CFMA 4YJSA 4YSMA 5E8WA 4IB1A 2UVXA 3P7BA 4U43A 2J7TA 3QGWA 2SRCA 2VGOA 4LL0A 4E5BA 4ZAUA 4MK0A 5BX0A 5D7VA 5KMLA 3HMPA 2F7EE 3KCFA 4ID7A 3FI8A 5FTGA 4IDVA 4R7IA 4CV9A 5E9EA 3NNVA 1YXVA 3DCVA 4G6OA 2C69A 2XNGA 3SRVB 4NKSA 3SQQA 3QYWA 3T3VA 4ANSA 1ERKA 4FGBA 5DYJA 3GCPA 3PWYA 4PQNA 1H24A 1M14A 4J53A 4I0RA 3UNZA 4XBUA 4FX3A 2Y9QA 2VAGA 3AXWA 4I5PA 4DN5A 4I20A 3TUCA 4I41A 5T3QA 3MFTA 4TRLA 3CQWA 4YTIA 2R3GA 3GU8A 4HYSA 2ITWA 3DBDA 3AOXA 4FKOA 4AW2A 3T3UA 4PDYA 4NFNA 4YO6A 3ZRKA 3G9NA 4AZEA 4ZTRA 4IQ6A 1OM1A 5JSMA 1E9HA 3H30A 2Z8CA 3VHKA 3QX4A 3RI1A 2YDIA 3H4JA 3LM0A 2QONA 3PY3A 4PF4A 3MS9A 3QQUA 1YI4A 4BZDA 2G2FA 3VN9A 4OTPA 5DRDA 3C0GA 3UGCA 3LMIA 3ORXA 4QOXA 5DGZA 3WILA 4YC3A 1Q41A 2YISA 1YDRE 2J0LA 3I7BA 3QF9A 4WNKA 2ITOA 5HD7A 3PJ2A 4FT7A 3R9OA 4E5AX 1JKKA 5JGAA 3RZFA 5H8EA 2E9OA 2XNPA 4WO5A 2ZB0A 3T9TA 3LFSA 2ITZA 4M69A 2XIRA 3PXFA 4QMMA 1R3CA 2WEVA 3IGOA 2R5TA 4QYEA 3D2IA 1QPEA 4TNDA 4MKCA 3TZ9A 2Y0AA 2OBJA 3W2OA 5AUZA 4BCKA 2R3IA 3W2SA 2X4FA 4JQEA 3AD4A 2WXVA 4AAAA 2YIRA 4IWDA 2IW8A 5B2KA 3VBWA 5GJFA 1Q61A 2B7AA 4BCIA 4L53A 1OPKA 4H1MA 4IXPA 3D83A 4X6RA 3UOHA 5TKDA 4LQMA 3NUSA 3FMEA 3UIMA 3OWLA 4BDKA 3LJ2A 2YZLA 4E6QA 2XH5A 2IVSA 5HTBA 4YPDA 4O7VA 3BRBA 3CY2A 4DCEA 4A9UA 3HMIA 3HL7A 3Q5IA 2UUEA 5DBXA 4ANQA 3JVRA 2PPQA 1LP4A 2RKUA 4JR3A 3OWPA 4FSRA 4IE9A 5BMMA 4W4WA 1WAKA 4ZOGA 3QHRA 2XJ1A 3CLYA 3QQLA 3TI1A 3ZSHA 3UMXA 3FZTA 5KKRB 2ZVAA 4DLIA 1ZZ2A 4I6BA 4RX7A 4TYEA 3MFRA 3POZA 4IX5A 4BCHA 4QPSA 2C47A 2PVHA 2YITA 4QYYA 3CSVA 1DAYA 3LMGA 4FOCA 5A6NA 3W8QA 5E7RA 4X3FA 2UW9A 4F7SA 4F9AA 1MRVA 2UZEA 3FQSA 2PK9A 3QKKA 4L7SA 4P2KA 4YBJA 2QOFA 4XG2A 3N9XA 4RMZA 5J5TA 5JFWA 3FEGA 2IPXA 4IAZA 3ZEWA 3K2LA 3PG3A 4BDJA 3OFMA 4M7IA 4EOLA 3FI3A 5EM6A 3PWDA 4IM3A 4OT5A 4W8EA 4ENYA 4BWKA 2UV2A 3A99A 4JS8A 4BDAA 2VUWA 4IX6A 4UXQA 4CYJA 3HNGA 3UPXA 3QHWA 1O6LA 2R3NA 4X2JA 5AV4A 4YZDA 4RJ3A 2I7QA 4AGUA 3KN5A 3SX9A 4XG8A 1CTPE 2F7XE 2Z7SA 4W4VA 5CY3A 2DUVA 3OUKA 1WVYA 4J98A 5BVNA 3NCZA 4BI1A 2BIKB 2XNMA 2Q83A 4FZ7A 3CKWA 3GI3A 4OTGA 4HJOA 4MCVA 3LPBA 2O64A 3V5PA 2R3FA 2YIWA 3AT4A 1YKRA 5CX9A 3UVPA 3ZLSA 2YJSA 3LAUA 3DT1A 4AU8A 3PSBA 4FIJA 4QP9A 4RA5A 5FBNC 4RIOA 4OTRA 2JFLA 4N70A 3PJCA 5HICA 3ZYAA 2FSMX 4J96A 4RFMA 3SLSA 4BTFA 3FMNA 3PLAE 5M08A 2XF0A 3LQ5A 4TN6A 4YHJA 5H9BA 3FBVA 4FK3A 4MBLA 3Q52A 5EDPA 4L52A 4LOPA 3R63A 1HCLA 3D7ZA 3Q9ZA 4TY1A 5LQFA 3VBQA 2NO3A 3D7TA 3WZKA 1YWRA 3PFQA 3QLGA 3W8LA 2YERA 1M2RA 5BVKA 2W1FA 4FMQA 4PPCA 2ZMDA 3IW8A 1HCKA 2BRNA 1OITA 2BUJA 3AD6A 3HECA 3IO7A 4FKRA 4FTMA 4ANMA 4EZ5A 4AA5A 2UZNA 3OZ6A 3FY0A 4RVLA 5CU6A 1NW1A 2V55A 3CP9A 4K11A 4D5KA 2ITYA 3MH1A 3NWWA 4TWOA 3BV3A 3CC6A 3QTXA 2X39A 4LG4A 3KY2A 4KS7A 2OLCA 3DXQA 4I5CA 3FI4A 2Q0BA 2XVDA 2BDJA 3DLZA 3FMJA 3QAME 2FSTX 4IVBA 4Q5HA 5A3XA 2YFXA 1WMKA 2YM7A 5HU3A 4MNFA 3QRKA 5E1EA 2VU3A 3IKAA 1IRKA 3NPCA 2XEYA 4L6QA 3KRRA 5LMBA 3E8EA 5TO8A 2GNIA 3A7GA 3ORKA 2J0KA 2PSQA 4KKHA 3U55A 3OOGA 2BKZA 2ZOQA 1BLXA 2WMQA 2WQEA 3FLYA 1ZOGA 4GK4A 4RLKA 4YUQA 2PMLX 3LXPA 4BTKA 3E64A 2JLDA 3ATTA 5AP3A 1LR4A 3RAIA 4ANOA 4C37A 4EH3A 4O7YA 1OBDA 2VWIA 1AGWA 2A1AB 2E9VA 3OTUA 3PSCA 4OGRA 4B4LA 3PZEA 5CAOA 2Y7JA 5LARA 3FLSA 3REPA 5IQAA 2C30A 5LCKA 3BYVA 2W5AA 5ETIA 4W8DA 3SD0A 4C57A 4YGAA 3DB6A 3FAAA 4U5JA 3RVGA 4YBKA 4A9TA 4EOOA 5AM6A 4DA5A 2O3PA 4BGQA 1XHAA 3F61A 2EU9A 4M15A 4ZZNA 3KRXA 3SAYA 1NA7A 2IN6A 1AQ1A 3PPKA 4CFFA 3QKLA 1YW2A 3A7JA 2CN8A 4APPA 3RCDA 2ZMCA 2QR8A 5LVPA 3I1AA 3P0MA 2VRXA 4NTTA 3F66A 2RFSA 3ZDUA 4AA4A 3K54A 4CG9A 4OBQA 3MGYA 4FNWA 5DRBA 2B53A 3UZTA 5JFXA 2H96A 5AIRA 2NRYA 5DPVA 3TEIA 3SW7A 5JFVA 3BLQA 4XP2A 3BELA 3DB8A 3KB7A 5G6VA 3RK9A 3MFSA 5HOAA 4F7NA 4F0IA 4RIXA 1ATPE 4RC3A 3F2RA 2J90A 4KRCA 4AFEA 5E8SA 3V5QA 3IDCA 1CM8A 2X9EA 3HGKA 5FD2A 2YLEA 5A46A 4MXZA 5FTOA 4JL9A 5IEXA 4GT4A 2WTVA 4Y83A 2Y4IB 3MH2A 3GFWA 4P7EA 2QOQA 5DI1A 3R2BA 4IFGA 3WZUA 2VNYA 3F3ZA 5J9LA 2WU7A 3EMGA 3C5IA 4CVAA 2XA4A 4I23A 4RWJA 4E6AA 3MFUA 3WF6A 4I0SA 3RP9A 4RVTA 4PMPA 3PXYA 2CGVA 4DFYA 5J7HA 2PYWA 4K77A 3ZSIA 4CRSA 1WVXA 4USFA 5EFQA 3RPVA 3WF9A 1OIYA 4D4RA 5E8XA 1JKLA 5I4NA 3UC4A 2C4GA 3QUDA 4XV1A 1FQ1B 2PVNA 4DYMA 3F5XA 4FC0A 2B9JA 3F3TA 4HGLA 2OJGA 3P7CA 5AP1A 5HE2A 4E4LA 4ZMEA 3D14A 4I0TA 3W32A 5C8NA 5FLFA 3UJGA 4P4CA 3PA4A 4FYNA 3UODA 1ZOEA 3OEZA 3BE2A 3QGYA 2R3PA 3EKKA 4GVJA 4FV2A 4GYGA 3BHVA 3ZEPA 3GC9A 2R7IA 4EI4A 3N4VA 3I0OA 5AIKA 4N0SA 5KX8A 4BDHA 3OWJA 3F2NA 4BTMA 4NFMA 5DEYA 2RSVA 4C61A 4FIHA 2R3KA 2XUUA 3DOGA 4WSYA 2GFCA 2OJ9A 4ZXTA 4AE6A 2XK4A 2YWPA 3GUBA 3ZM4A 3VUTA 2RGPA 2ETMA 5D41A 3DNDA 4RA4A 3VHEA 3FYKX 2E9NA 4QMUA 4HW7A 3TDWA 4IIRA 2BRHA 4H1JA 1S9JA 3OXTA 4ANBA 3PY1A 4PDSA 4TTHB 4WG3A 5CEIA 4C4EA 3LFAA 1H01A 2ITQA 4PTCA 4IMYA 3TTJA 3MY5A 3OROA 3JYAA 5IA5A 4D4VA 3R0TA 1YHWA 2RFEA 3LW0A 3FUPA 3LOKA 1ZWSA 5CS6A 3KGAA 4BDFA 4N4SA 2ITUA 2WAJA 4YJRA 3COHA 2YWVA 4XEYA 3VS0A 3UBDA 3QQKA 1NVQA 4JAIA 3EQDA 3ZHPC 3LLAA 4O86A 2PVRA 4O81A 1RDQE 2BDWA 2X1NA 3QZIA 1Y6BA 4NW5A 3LXLA 5HTCA 4NSTA 2UZWE 5IDPA 5HORA 1X8BA 3V8TA 3BE9A 4OLIA 1PXIA 2REIA 5EW3A 1M17A 3R21A 2QC6A 4RC4A 4W4XA 5CYIA 5AR5A 5BVWA 4D2SA 4F99A 1BL6A 3O8TA 3GNIB 4QTEA 1J7UA 3C51A 4UY9A 1K3AA 4V01A 3GCUA 3LZBA 5IUHA 3BGZA 3U54A 4JXFA 4EOMA 3HMMA 3AT2A 2C6DA 3PJ3A 1VZOA 4KIOA 3QCYA 3TN8A 4YTFA 4TWNA 2YN8A 2BKKA 3B8RA 3PTGA 2BDFA 1SNUA 4LRMA 4U8ZA 5DE2A 5KCVA 5C4KA 1V1KA 1UWHA 1F0QA 3EFWA 3FLNC 4FODA 3Q6UA 3MVMA 5HG8A 4IAAA 3WZEA 5IQEA 5K5XA 2V0DA 3GU5A 3TWJA 3TZ7A 1H1PA 3FMLA 1XWSA 4UYNA 4OTIA 2EXEA 3QZGA 3SXSA 2WMUA 4FKJA 4HPUE 1IA8A 1YI6A 4Q2AA 3C5UA 3CIKA 2ZJWA 4CGAA 1GZOA 3OTVA 5EW9A 3WE8A 1Z57A 4TWPA 1PXJA 3TZ8A 4Y72A 4RSSA 4ZSEA 4DE4A 3P5KA 4X7QA 3MY0A 4PRJA 3CGFA 3LCOA 4FTUA 4GH2A 4L43A 4II5A 1OKYA 4BR3A 4DH5A 4XRLA 4C4JA 4O7LA 3RNYA 4FIGA 3KRJA 3F3WA 4S30A 3RBWA 4C3RA 3PVUA 4A4LA 3U6HA 1V0BA 4TNBA 5GJGA 4G9CA 5L8KA 3SOAA 4ORKA 3UIXA 3ALOA 5K0XA 4TYJA 5ANOA 4ALUA 1ZRZA 3E87A 3TUDA 3KULB 3QC4A 4CYIA 2Z7RA 5JGBA 1UU3A 2GNGA 3KKVA 5AP5A 4A9YA 4TYGA 4AZVA 3NNUA 3R7OA 4FVPA 1UKIA 3U8WA 2PULA 4ACHA 3DPKA 4NCTC 4UMUA 3UG1A 5IA1A 2ITNA 2VWBA 5IA0A 4DT8A 4HVGA 3F6XA 4MAOA 4JI9A 3R9HA 3DU8A 4EH9A 3L9PA 2RFNA 4FSTA 4M12A 4XS2A 4K8AA 1DAWA 4H3BA 4IZYA 4U42A 3QQFA 3NYOA 3PZHA 4PTGA 3GU7A 4AGCA 3UP2A 5EQEA 3MDYA 3OWKA 5CANA 2WIHA 4KKGA 3KFAA 1OL5A 4MXOA 5AP7A 4M66A 1M52A 4O7RA 1ZY4A 3AC2A 4MXXA 3HRCA 3R1NA 4EOPA 4NUSA 1OL7A 3JR1A 4EEVA 3AC1A 4FTQA 4R3RA 4Z7HA 4FSNA 5HLWA 2XNNA 4EH4A 2XRWA 3UZRA 3QRJA 4BCFA 5HU9A 4F6WA 2QD9A 2ETRA 4C4IA 3GOPA 4U6RA 2BFXA 5AUVA 5DVRA 3ZMMA 4R5SA 3NUUA 2QODA 4YNOA 3A62A 4EHEA 2C5VA 4EOQA 2XKCA 4QTAA 3M42A 4BDGA 4C4GA 3KN6A 3FMHA 4DBNA 3EWHA 4BBFA 5ETAA 2C1BA 5AUYA 4CQGA 1T46A 2FGIA 4BDCA 5BMSA 2WTCA 1S9IA 3WYYA 3FXWA 3V04A 3OW4A 5D1JA 4LMNA 4P5QA 5CTPA 3H0YA 3W1FA 2O2UA 4G2FA 3O71A 4MTAA 5IH5A 3P78A 3R7EA 4V0GA 4YURA 3V8WA 5IU2A 3RALA 4FKVA 1OPJA 3ORZA 4DTAA 2YJRA 2OIQA 5JRSA 3AC5A 3Q4TA 1U54B 3ZO3A 4O2ZA 3ODZX 5FDXA 3W2PA 3QQJA 2O8YA 2IW6A 1V0OA 3PRIA 5HX8A 1KE7A 2GQGA 4ONAA 3ORIA 3PXZA 4MYGA 3ZFXA 1KE5A 3L9LA 4BVUA 5JQ8A 3FHRA 4OR5A 2OU7A 5LVLA 4JBOA 4DAWA 5IH6A 2WMWA 1P4FA 3PP1A 3VO3A 4BDIA 3UO6A 4C7TA 2JDRA 1ZYCA 3WF7A 2X8IA 2BHEA 2Z2WA 3BGQA 3MESA 3ZBFA 3VW6A 4ZP5A 4MXCA 5G1XA 2JKKA 1OECA 3G90X 4ZZMA 1YXUA 4DFNA 4IB3A 3OHTA 5FXRA 4DG2E 4FSQA 3FXZA 4ZK5A 1OUKA 3U6IA 3BHUA 3EQIA 3KVXA 3KXNA 3LFEA 5CEMA 2R2PA 5ITAA 1PRYA 3WIGA 2JC6A 1SZMA 1UWJA 4F09A 2W1EA 3QFVA 2B54A 4MXAA 3NAXA 1E1VA 4PPAA 2VD5A 4R3CA 4AZTA 3R2YA 3BCEA 4P90A 2Z7LA 5E1SA 3T9IA 5LVMA 4O82A 5K9IA 1EH4A 2PUNA 1XO2B 4Y85A 5FEEA 5CF5A 2XB7A 3PRFA 4XG6A 5GZAA 3SXFA 5IF1A 4WT6A 2WQMA 3LCSA 4DG3E 4HVIA 4R6VA 4UMTA 3Q9XA 4FV3A 4JR7A 2IO6A 4TYHA 5FDPA 2R3JA 2XP2A 4QMWA 2P3GX 5AR7A 4ITHA 2WTKB 2JDTA 2UZOA 4I5MA 2HXQA 4M69B 5FG8A 5I9ZA 4EK3A 4PL3A 4IJPA 4A9RA 4LL5A 5BVFA 3I4BA 3QC9A 4UX9A 1A48A 4EK5A 3TM0A 2OXXA 4QMZA 4ZJJA 3QTQA 3RPOA 4ZLZA 4M97A 2CN5A 3O2MA 1XH9A 4WIHA 5EYDA 1GZKA 3GU6A 5H2UA 4AGWA 2ZV7A 4W9WA 4I3ZA 1VEBA 4FTTA 4GUBA 3KF7A 5IQHA 3TNQB 3A2CA 2VWXA 2HCKA 4IAYA 3QTWA 2H6DA 3OXZA 4FZFB 5IA2A 2GMXA 4MNEA 4JVGA 5L6OA 1SYKA 2CSNA 5J9ZA 3HYHA 2H34A 1G3NA 1W7HA 1FGKA 2X2MA 1B39A 2V5QA 2PVMA 3CBLA 4GUEA 4YO4A 1WBSA 2VTPA 3A4OX 5HG5A 5M4UA 2PE2A 2ZDTA 4IC7A 4YU2A 4X2KA 4ZLOA 1YHVA 4KBCA 2G2HA 3I81A 4M0YA 2OIDA 2G15A 3OCSA 3UYTA 5IQIA 3QCQA 4EH8A 3LFNA 2BAQA 3R8LA 4AX8A 3TUBA 3TNWA 2P0CA 4L68A 2HENA 3JUHA 4GYIA 4TWCA 3EHAA 3A61A 4MD9E 5H3QA 3VJNA 2RIOA 4QMQA 5IQFA 5I5ZA 1SMHA 5EHOA 3QL8A 4J97A 1PMUA 1P2AA 2RL5A 2VTOA 3F9NA 4RGJA 5J9YA 4YLLA 4RG0A 1ZMWA 2X2LA 5KKRC 4JNWA 3PP0A 4X3FB 2YCQA 2BILB 2VX1A 3QBNA 4KBKA 3JS2A 3AMAA 4FKTA 5TR6A 2X8DA 3AC4A 2WO6A 2VTNA 2J2IB 2VTLA 3FSKA 1PW2A 2WZJA 1JSUA 3E8DA 2BRBA 4FR4A 4M67A 4R3PA 2Y8OA 2YA9A 3UQGA 1CKJA 2QOCA 5J95A 5ACKA 1H1RA 4H05A 4IX4A 1SVHA 3ZRMA 4GFMA 1UNGA 4CT1A 4CV8A 5JK3A 3QRUA 1YOJA 5AWMA 4QO9A 3UOKA 3SG8A 5CXZA 4TW9A 1H1QA 3QWJA 3UNKA 1P5EA 1RE8A 1JBPE 5CNOA 3V6RA 3HDMA 5DA3A 4ZTMA 4CKJA 1KOBA 3NW5A 3RMFA 3MH3A 5F1ZA 5FP6A 5CASA 3DXPA 3KC3A 4RFYA 2W9ZB 4O1OA 4BZNA 3MIAA 4RIWB 4A07A 5K5NA 2XJ2A 1GAGA 3IS5A 4IZAA 3GENA 2DQ7X 1UV5A 3QCSA 1WBOA 4FICA 1KWPA 4HVHA 2G9XA 2YIYA 3GC8A 4J95A 4C0TA 4QT1A 4FKSA 4DCAA 4FTAA 3EH9A 5EKNA 2OXDA 1PXOA 3IG7A 4C3PA 3PIXA 3BLRA 4CSVA 3V6SA 2YM6A 2WGJA 3MB6A 2QOKA 5ANJA 4XG7A 3U6JA 5DMZA 4BKJA 3L9NA 3MWUA 4G6LA 4BTJA 3ETAA 5CENA 3FLWA 3MJ1A 3EQCA 2QU6A 4KIQA 5ACBC 4QMTA 3VQUA 4L3PA 5BNJA 2WB8A 4FIEA 1Q8TA 3MN3A 5ICPA 3KEXA 4LUEA 3D4QA 5AM7A 4J1RA 3K5UA 3FMMA 4LFIA 4EQUA 3VF8A 1JNKA 1IEPA 3F5PA 4DEAA 4CLIA 2CKPA 5AAGA 4GW8A 2A0CX 2OF4A 4EH5A 4F9YA 2CGXA 3DBFA 2UZBA 2J0JA 4GJ3A 4JG7A 4FZAB 2X8EA 3MPMA 2ACXA 2WMSA 4JG8A 4PY1A 3SC1A 3D5VA 1OUYA 5T68A 5KBQA 4DEBA 5L2TA 4CD0A 4I5HA 1Q24A 2CGWA 1VYWA 5HCYA 3EKNA 4AFJA 3P1AA 4DEHA 2BROA 5C26A 3Q6WA 3QRIA 3PA5A 5FEDA 4C36A 5B7VA 5HG9A 5DT0A 2BZJA 4WD5A 4QPMA 3DJ6A 2QO9A 5HE1A 3TNHA 3HRBA 4ZY6A 3MY1A 3JXWA 2OZOA 4ACGA 4MD7E 5KMJA 3C4EA 5CQUA 4OAVB 2ONLA 2P55A 3EZRA 3ID6C 4E1ZA 2C5OA 5T6KA 5HKMA 5AV3A 3HA6A 1H4LA 3ZRLA 4QYGA 1IA9A 3QA8A 4IVCA 5CVGA 4CTCA 4U3ZA 5HO6A 4FSUA 3UIUA 4DFLA 2CNVA 3PUPA 2JD5A 3NGAA 2UW3A 3NYVA 4J8NA 5E90A 5AAEA 4X21A 1KOAA 4ZTHA 5EM7A 4KNBA 2JKQA 4X2FA 4BBMA 4IM2A 3L9MA 5C8MA 5AEPA 4I4EA 3ITZA 1YOLA 5D9HA 4AT5A 1L3RE 2KULA 3I79A 3VIDA 1FVRA 3U51A 4NL0A 2G01A 4FTCA 3GCSA 4O6EA 4NCTA 3BKBA 4ALVA 3O51A 1NVRA 3RAKA 4YZNA 3ANRA 4FYOA 4FZDB 3SOCA 5AA8A 2C6IA 4GFOA 4AZSA 5A4LA 4NM5A 4BN1A 4CKIA 5EI2A 5BVEA 1J7LA 2BALA 1H08A 4HYHA 4PNIA 5I9XA 5AFVA 3NEWA 3RINA 4DH3A 5AAFA 4IVAA 4U97A 3FC2A 3OT8A 5DN3A 3UDBA 4FTOA 5CSHA 2X7GA 4D2PA 2F57A 3F7ZA 3OVVA 2JIUA 1I09A 3Q3BA 1OL2A 4L00A 2FH9A 3E8NA 4ZIMA 5HCZA 1W84A 2JAMA 3BYMA 3TV7A 1WBNA 3VS1A 5M09A 4JX7A 2WQOA 2VWUA 5TF9A 3WE4A 4BHZA 3ORNA 4CXAA 3KMWA 4E3CA 4DT9A 1M2PA 4G9RA 4YJVA 4OBOA 4C4HA 1GOLA 4KD1A 2HZ4A 3EN5A 1UNLA 1W8CA 1BMKA 1URWA 4WG4A 3RM7A 3OC1A 2P4IA 5C27A 5J1WA 1J7IA 4AOTA 4AW5A 4FEXA 3CTHA 3TV6A 2UZDA 3IOKA 4O0TA 5L8JA 2OJFE 3MPTA 4L46A 5CU4A 5CF8A 4UWYA 4JBPA 1PHKA 4KA3A 1P14A 2OSCA 4CMOA 3HAVA 2IWIA 3R00A 4NYEA 3VRZA 2XIZA 5D7AA 5C8KA 3GU4A 5EDQA 4CT2A 3TZMA 4DFXE 4O7WA 3GGFA 1Y6AA 2GTNA 4U79A 4U80A 3D15A 3S95A 3TKIA 3LLTA 5CEQA 1IG1A 3EL7A 3A4PA 4C3FA 2C1AA 3LCTA 3QD0A 3AC8A 4U41A 4YLKA 5J87A 3MYGA 4DEDA 5GIPE 1A06A 1H8FA 4O1PA 1M7NA 2VTTA 5JZJA 3NW6A 1Q62A 1OPLA 3MVJA 2CKEA 5A9UA 4IAIA 4F1OA 3R73A 1H26A 4RWKA 3NS9A 4D5HA 5L3AA 4IAFA 5BPYA 4DH8A 4BYJA 3EIDA 3RTPA 1YDTE 5IG1A 3E88A 3DQXA 3JVSA 3NMUF 3G6GA 5HE0A 1STCE 4CQEA 4G17A 4X3JA 3ZS5A 1PMEA 5M56A 3SRVA 3HAMA 4JIAA 3OY1A 4KIKA 2OXYA 2UW8A 5EI8A 4FE2A 3FMKA 4RIYB 3EL8A 3EZVA 5HG7A 1QMZA 2WOUA 4FF8A 1YWVA 2IZUA 4YSJA 3EN9A 2FSOX 3HLLA 3LFDA 4KB8A 2WTDA 3II5A 2QO2A 3ANQA 1FINA 2F9GA 2WMTA 4IWQA 4OTFA 2R9SA 2X6EA 4YPSA 5D12A 3ENHA 1YQJA 3HDNA 2WMXA 3FHIA 4B0GA 3NNXA 2X9FA 3DAJA 5IEVA 2J50A 4IWPA 2HXLA 4XG9A 4F1TA 5AV0A 5IA4A 3GP0A 3VAPA 4RX9A 3MW1A 2YACA 2BHHA 1NY3A 3PY0A 5K4IA 4I92A 5FQDC 5HTIA 2WU6A 3GC0A 4FNZA 4GL9A 5CF4A 4APCA 4FTNA 4NU1A 3O50A 1H00A 3FWQA 4PL4A 3M1SA 5JKGA 3SG9A 2GNFA 2VWZA 4JT3A 2R3RA 4KAOA 4A7CA 4JRVA 4KABA 3IQ7A 2G2IA 2J0MB 5GJDA 5C1QB 3QQGA 4JQ7A 4BIDA 4F6SA 2UW7A 1YWNA 3FJQE 2W1CA 1GY3A 3FZOA 4FKGA 3R8UA 5IQBA 5IISA 2HYYA 3W55A 4QYHA 4M0ZA 1XBCA 3C7QA 5HI2A 1R39A 4WG5A 4TYIA 4EOKA 3BQRA 3PJ8A 3DV3A 3TCPA 2NRUA 2XNOA 4OAUC 3ZUUA 2VNWA 3EYGA 5A4EA 3VQHA 4XX9A 4HZRA 4RPVA 5KZ0A 4QMSA 4CFWA 5FM3A 4TXCA 4YJQA 3OUNB 2HW7A 4CMTA 1Y91A 2R3QA 3ORLA 4PL5A 2W1DA 1O6YA 3A60A 3FQHA 1NVSA 3LFCA 3LFFA 4CFUA 2W7XA 2CKOA 2C68A 4ZTQA 4FSWA 2JEDA 3U9NA 5M51A 1O9UA 2QCSA 2QKRA 3K3JA 4RLLA 2OIBA 4O0YA 5HO8A 2FO0A 4F63A 3R28A 4FT3A 1OIQA 1LEZA 2IG7A 2YIXA 4E7WA 2I0YA 5L4QA 5ANEA 5EOBA 1JVPP 3Q4UA 4KBAA 4L9IA 5EHYA 4O96A 5HEZA 4RRVA 3KU2A 3WBLA 3DGKA 4DC2A 3R01A 1GJOA 3DKGA 1PXKA 5AP0A 4IB5A 5JMSA 4CEGA 4EH6A 2OZAB 3R8ZA 2BMCA 4ITJA 3G0FA 4IBMA 2LAVA 4RWIA 4XLVA 4Z3VA 4EJNA 2PMIA 3R7GA 4WUAA 4EHVA 3FKLA 3S00A 1Q5KA 3OF0A 4QRCA 4Q5EA 4ZEGA 2VTIA 4QQCA 4R1YA 4C58A 4IZ5A 5DIAA 2I1MA 4O84A 4V04A 3D2KA 2R3HA 2HY81 2OH0E 2PVJA 4QMPA 3EFJA 4WBBB 5HIBA 4ZZOA 2OGVA 2IZRA 3DBQA 4XH6A 4RFZA 3UP7A 4EWQA 3ZCLA 4BCGA 3EFLA 3P9JA 4M14A 1PXLA 1T45A 3DBCA 4UZHA 4XHKB 3MBLA 5A54A 4AW0A 1KE8A 2HWPA 2YCRA 3TV4A 2QOBA 1WCCA 4AACA 1XBBA 2F2UA 3CQUA 3E93A 4NW6A 3ALNA 4FT9A 3BBTB 5AJQA 2WTIA 4U45A 5A4QA 1IAJA 4UBAA 4CCUA 3Q4CA 3TIZA 2BIYA 2VTQA 3TG1A 4I1ZA 3BYSA 3NIZA 4C4FA 1H1SA 3BU5A 3P08A 5AMNA 4CFXA 4CFVA 4FVRA 5KMKA 3D9VA 5L2IA 4FG7A 3NUXA 4PTEA 4EOSA 1O6KA 3ZONA 4LI5A 4GKIA 3KK8A 2VN9A 1PMVA 4BKZA 4JDKA 2JIVA 4M13A 5DT3A 3DKOA 1PYEA 4HPTE 2YM4A 2QNJA 2JIIA 4CCBA 5JN2A 4I94A 3S2PA 2XKFA 5IH4A 4JRNA 5GIOE 4JBVA 3VBYA 4BZOA 3HV6A 3IW6A 3MIYA 4GMYA 4BBEA 1F3MC 3EN6A 3FXXA 4PDOA 4R7BA 4EKLA 3DZQA 3CJGA 3CEKA 3BEAA 2EB2A 3GQIA 2E2BA 4BRXA 2QR7A 4K1BA 5M4CA 2IW9A 2XJ0A 4NKAA 4HCUA 4QYFA 4XJ0A 2CPKE 5H8BA 2UVYA 2Q0NA 1U46A 3CXWA 2PMOX 2PZPA 3ET7A 3P79A 3S1HA 1JAMA 5CWZA 3Q04A 4D2VA 3DJ7A 3FYJX 4TPTA 4BF2A 3KK9A 4PMMA 4O38A 4QMOA 3WOWA 1ZYLA 2OG8A 3BYOA 4CNHA 3IOPA 2YIQA 1PMNA 3BZ3A 3FLQA 4DH7A 4NH1A 4F08A 3FSFA 1BYGA 1Z9XA 2B1PA 3DK7A 3O7LB 3O8PA 3QUPA 4EYMA 2XK8A 1Q4LA 4F64A 2QO7A 3DLSA 2JFMA 4TT7A 3R9RA 3LQ3A 4D2RA 2J51A 4G16A 1FVTA 3KXZA 4RBLA 3VW8A 3JY0A 4ANNA 5L8LA 3A7IA 4GG7A 4DH1A 2W1IA 2X6DA 4GCJA 4LOOA 3V8SA 3WIKA 4ZY5A 4S33A 4MWHA 3AMYA 1Q99A 3TJDA 5JH6A 4EOIA 4RWLA 3ERKA 4NWMA 3V5JA 5CT0A 4D55A 2B4SB 2FB8A 3QWKA 5BYYA 3GEQA 3EYHA 3DTWA 1BL7A 2VTMA 2ITPA 2PUUA 3TJCA 3VBVA 4L8MA 4D58A 4ACMA 4G5PA 3FZ1A 2WQNA 5A14A 2E9PA 4RJ6A 3TNPC 1NXKA 3IK3A 3NLBA 4FKIA 3KRLA 5FWKK 4BGHA 3HZTA 2Z60A 3IDBA 1H28A 2A19B 2ONLC 4JOAA 3AD5A 5B0XA 1YXXA 2XBAA 4UWCA 4B7TA 1R0PA 2X0GA 1APME 5AR4A 4QP4A 5JEBA 4I6HA 4CG8A 2WTKC 4FEUA 2VWYA 3MTLA 2B9FA 2H8HA 1A9UA 1W0XC 3QD4A 4JIKA 4MXYA 2GPHA 4B8MA 4EWHA 2QURA 1ZZLA 4D4SA 4LM5A 4O27B 3ACKA 3MI9A 5FXQA 3VUHA 2DYLA 4IX3A 4M8TA 1KV2A 4JX3A 4J52A 5HLPA 4R7HA 2JGZA 4RZVA 4HZSA 5I3OA 3UVRA 1KV1A 2R0IA 4GIHA 3CJFA 4LV8A 3QKMA 4O6LA 3V5LA 3Q96A 4IH8A 3FZRA 2OW3A 5IKWA 5J1VA 5F20A 3LJ0A 5HQ0A 4QP7A 4PMTA 5JGDA 2UVZA 5EM5A 4O7TA 5B2LA 3IW4A 2VX3A 4GJ2A 3GQLA 4H58A 3Q32A 4D0WA 4DGOA 1VYZA 5J79A 2Y6MA 4AGDA 4G3EA 4Y46A 4N57A 2OI4X 4D0XA 3UIBA 3KXHA 4O0UA 2IZTA 5AP2A 3LFBA 2W9FB 5CI7A 3GFEA 3V51A 3QZFA 5EM8A 2V7AA 1OL1A 5FEQA 5D10A 3BWJA 4JAJA 5M53A 3NYXA 2V62A 1DI8A 2JDSA 4XNEA 1ND4A 1G8AA 2PTKA 1OB3A 3H0ZA 3CPBA 3EQRA 4G34A 3R8VA 3CQEA 3UOJA 2NPQA 2PHKA 4HGTA 4BCQA 2BFYA 4QQTA 3UNJA 1ZYJA 5ANGA 4ERKA 2XYNA 3FPMA 3ZLXA 2BZHB 2R4BA 4ZSLA 3DAEA 4ZSAA 1W82A 3B2WA 4QMYA 4XP3A 2GCDA 4UB7A 3CY3A 3I5ZA 3TL8A 1ZY5A 1UVRA 2DWBA 4FKPA 3BIZA 3HVCA 4EBVA 4E4NA 2CKQA 4QP2A 4DEGA 1CMKE 5L6PA 4FGRA 2BCJA 4JG6A 1CKIA 4C8BA 4EC9A 5IDNA 5I0BA 4RQKA 2XYUA 3R83A 1XR1A 3NDMA 3TKUA 2JITA 3VS3A 5L2SA 4U3YA 4AP7A 2XNBA 5BVDA 1TQPA 2AC5A 1OKVA 4JJRA 4K0YA 4QMNA 2VTRA 1H25A 2HIWA 2XMYA 3C1XA 1OZ1A 3VS7A 3ORMA 5M55A 4UXLA 3T8OA 4DFZE 4ZLYA 4WA9A 3QTRA 4L3LA 3AC3A 3NRMA 4YJOA 5CZIA 1SVEA 1XJDA 3IECA 4ACDA 5LWNA 1Q8YA 3C4FA 2GTMA 4PP9A 4X2GA 4D1SA 4FBXA 4KWPA 4HYUA 5E4HA 3PVWA 3SXRA 4FTJA 2QHNA 1ZARA 4J7BA 3ZZWA 2XM8A 2BRMA 4BB4A 2GHGA 5HIEA 2UW4A 1OL6A 2UZTA 2ZAZA 3LIJA 4EQMA 3SGCA 2O0UA 2BAJA 1SVGA 3PSDA 4HNIA 4WNMA 5AX3A 4KRDA 3PE2A 4UMQA 2WOTA 4FUXA 3GXLA 5DOSA 3ATSA 3HMNA 5ANDA 1I44A 1GIJA 2WELA 3R22A 2PWLA 2W5HA 2ZDUA 3DKFA 1MQBA 2X4ZA 3DTCA 3NNWA 5HBEA 3TKHA 4E5WA 3UOLA 1XH7A 4IB0A 3NX8A 2WFYA 2YM3A 3C9WA 3KXXA 5IZFA 5HGIA 3RZBA 2PUPA 4XOYA 2F7ZE 3ZZEA 3CS9A 4I6FA 2OKRA 4TKSA 5DLSA 2I40A 3FQEA 4IVDA 3VS4A 3VUKA 1WVWA 3GCVA 1OKWA 2C0IA 2C3LA 2OFVA 4WKQA 4S2ZA 4AT4A 2OO8X 4HGEA 3DJ5A 3HA8A 3PE1A 4C02A 3W33A 4YNEA 4YTHA 1H07A 4BWXA 4AG8A 4FG9A 3KRWA 4IW0A 5A6OA 1BUHA 4AZWA 4CMUA 5CU3A 4DGGA 4BCOA 2C6KA 4EHGA 5K4JA 2O5KA 4TZRA 2CNQA 3DAKA 1PKDA 1GNGA 2J9MA 3RK7A 2YZAA 4EJ7A 1XH4A 3SA0A 3WYXA 3AT3A 3D94A 3TNIA 4EBWA 2YCFA 3WZDA 4QMVA 4GSBA 4F9BA 3WARA 3ZXTA 5DWRA 4E8AA 2CDZA 5GZ8A 2H9VA 5HE3A 1Q8ZA 5L2WA 1UU9A 5CSWA 5AR3A 3QTIA 5HESA 4I24A 1BX6A 4D2WA 4C59A 5B2MA 3DK6A 2XKDA 2WMAA 1PYXA 3EQPA 4MHAA 2C3IB 3QXPA 3KULA 3R1SA 4RX5A 1FBNA 4AF3A 3G15A 2Z02A 4N6ZA 4B9DA 4BI0A 1YXSA 3S3IA 2W99B 4D9UA 5IPJA 3EN4A 1WBWA 2B55A 3LJ1A 4KS8A 4XG4A 1JPAA 4XV2A 3RCJA 3BLHA 4Y5HA 2QQ7A 3DDQA 3SVVA 3QRTA 5HNBA 4KINA 5KMOA 2F49A 2W06A 1MRYA 2CHLA 3F88A 2JBOA 3FZPA 3LFQA 4QP6A 1TQMA 3QQHA 5CU2A 2PMNX 4C2VA 3GOKA 4OUCA 2QOOA 2JKMA 5CVHA 4XP0A 1ZYSA 1SNXA 2W17A 5F94A 1UA2A 3RM6A 3W16A 4FIFA 5HNIX 4GKHA 3NUNA 2OFUA 3E62A 4E20A 1DS5A 5CI6A 4LGGA 5CXHA 4QMLA 5AA9A 3UVQA 2OK1A 3RAHA 4YZMA 3F82A 4EL9A 3O17A 1YVJA 4XRJA 1JQHA 3R30A 4PWNA 4O0XA 4FA2A 2I0HA 2W5BA 2X81A 3SHEA 2ZV8A 2QOIA 5CEPA 4NIFA 3E5AA 4PDPA 3HX4A 4K6ZA 2NNWB 4ZY4A 2XEZA 1JKSA 3ZO2A 1PXNA 2XZSA 4ZS4A 3R9DA 4OT6A 1PY5A 4D1XA 1M7QA 1QPCA 4ITIA 4L01A 4FV1A 4BCNA 3R6XA 3ZLWA 5KHWA 4YJTA 1OBGA 1WBVA 2C0OA 2V7OA 5E91A 1M2QA 3CKXA 2ZM4A 2FA2A 3EJ1A 5LOHA 5IQDA 4I22A 3HP5A 3P4KA 3N4TA 1OI9A 3D7TB 3WI6A 1JSTA 3BGPA 5J8IA 4FTRA 3VS5A 3K3IA 5BUIA 1J3HA 4AOIA 2PVYA 2HK5A 4YHTA 3C4XA 1GIHA 2YDJA 4D28A 5DH3A 1E1XA 2CCHA 1U54A 3IDPA 3ROYA 2E9UA 5CZHA 2CCIA 3P7AA 3V01A 3UQCA 3BI6A 3Q60A 3Q9WA 4IAKA 4AWIA 3UO5A 3FPQA 3NW7A 3Q4ZA 4G3DA 4KIKB 3MVLA 4AXAA 1Z5MA 5EYCA 5CAPA 5JT2A 4KSPA 4LRJA 3NCGA 4FV9A 2XCHA 3O96A 4ZJVA 3VS6A 3FDNA 3VUDA 2ERZE 4YMJA 4BY9E 2J6MA 2ETKA 5FXSA 5FTQA 2VO3A 4BC6A 3BYUA 2BTRA 4GU6A 1HOWA 2WPAA 1REKA 4IANA 5CLPA 4ENXA 3Q2MA 4A4OA 2PZRA 2WKMA 2QG7A 1PXPA 3ZO1A 3ZUVA 3PIYA 5AADA 4YLJA 2A27A 1R78A 4CKRA 1BI8A 1BI7A 2WD1A 1URCA 3L1SA 4IADA 4HVSA 3B8QA 4IACA 5ETFA 3BU6A 3UE4A 4EOJA 2QVSE 5AP6A 3R02A 2PU8A 5F9EA 2HW6A 5IMEA 2XNEA 4NTSA 4EK6A 2IVVA 3LM5A 4BCMA 4NM0A 2HY0A 2XBJA 3EQHA 4O0SA 5EHLA 3EOCA 3TACA 3C4ZA 5K3YA 4D9TA 5F95A 1Q8UA 4G3CA 2HAKA 3HV5A 5EQYA 2QG5A 3OY3A 5HD4A 4O21A 3PJ1A 1J1CA 3O0GA 2V22A 3IPHA 1H1WA 3AGLA 3BPRA 2VWVA 4J71A 3D5WA 1PKGA 2XKEA 3BQCA 3HV7A 3U87A 3I7CA 3KA0A 3I5NA 1Y8YA 4FL3A 4RIXB 3L8XA 4IDTA 2PVFA 3QD3A 5AR8A 4OBPA 3R71A 4BGGA 4XCUA 4DG0E 3E3BX 3SDJA 3NYNA 1IAHA 4FEVA 1G8SA 4NM3A 3ZDIA 4RVKA 4ANLA 2OH4A 1QPDA 2ZV2A 5GINE 5LVOA 2FUMA 2EUFB 4IFCA 4XG3A 1RJBA 4YP8A 3R7UA 5CQWA 3TTIA 1PF8A 4DITA 4ASEA 3UQFA 4GEOA 2J4ZA 3GBZA 4NJ3A 2Y4IC 2F2CB 3CPCA 2W1ZA 5CAUA 3RPSA 1UU8A 2KTYA 3OS3A 4G5JA 4XYFA 5E8TA 1UU7A 3R7IA 4RQVA 4RZWA 4YHFA 1VR2A 2IVTA 2YLFA 1ZYDA 3R1QA 4QTCA 4BWPA 3FY2A 3AQVA 3PXKA 3FL4A 2Z7QA 4LV5A 2VO6A 4NZWB 4YC8A 2I0VA 2GNLA 2PZ5A 1XH5A 5A4TA 3ZXZA 2RG6A 3JY9A 3W2CA 1KUTA 1G5SA 1Q97A 1YXTA 5DR2A 4X2NA 4MVFA 4OTQA 3RJCA 3GT8A 1Y8GA 2ESMA 3KL8A 5KMNA 1J1BA 5BYLA 2ZB1A 3KVWA 3ZC5A 2CMWA 2UZVA 4FV7A 2BR1A 4WSQA 5DR9A 1V0PA 2YDKA 3NZ0A 2XK6A 4AUAA 4F7LA 4C2WA 4UZDA 5AV2A 3NAYA 2UZLA 4BICA 4HCTA 3HMOA 3HEGA 2O63A 3H9RA 4FL2A 4FV8A 4GU9A 4D1ZA 4CLJA 3BBWA 5M57A 4UALA 2VGPA 4Y5QA 3UYSA 3R1YA 4I6QA 2UW5A 4IZ7A 1YI3A 5E8ZA 4FKLA 4CFNA 1U59A 4RIWA 5LMKC 3OT3A 4F0FA 4O0WA 4KKEA 3NUYA 3GC7A 2R64A 4KSQA 3OD6X 4ARKA 4BCJA 5HVJA 5L2QA 3QTUA 5KNJA 3TDVA 2RF9A 2W4JA 3RHKA 4HCVA 2EB3A 2WNTA 5BVOA 5K0KA 3OG7A 4RJ8A 5CU0A 4MWIA 4FUYA 4O2PA 2P2HA 5C01A 2GSFA 2WEIA 3R8MA 3LXKA 1IASA 5HBJA 5EG3A 4FEQA 4Q9ZA 2A2AA 5BUJA 3UZPA 4AN3A 2HWOA 2VX0A 4JDIA 4IHPA 5M4IA 3A8WA 4ZTNA 3FZSA 1KSWA 5LJJA 4PV0A 4FSYA 2W4OA 5FP5A 2LGCA 2C3JA 4U81A 2IVUA 2JDVA 5GNKA 3BV2A 2HOGA 3FL5A 2R0UA 3S4QA 3NVKI 4I4FA 4H3QA 4MD8E 1GZ8A 2GNHA 2ZM3A 3OW3A 5DT4A 4BCPA 4E26A 2ITXA 5EYMA 4DHFA 4DGMA 1YRPA 4FIIA 4UYAA 1XQZA 2PVKA 4E6DA 2WQBA 2JKOA 4BFMA 3TT0A 1QCFA 4BKYA 5I9VA 3DDPA 3OCGA 2CLQA 4EORA 4FOBA 3LCDA 1ZLTA 4K18A 3W10A 5KUPA 3H3CA 3OEFX 4XOZA 4NM7A 2XCKA 3QXOA 3FC1X 1LUFA 5E8YA 3D5XA 2XK9A 2XM9A 4WNOA 3E7OA 3HP2A 5BQ0A 4UMRA 3FV8A 3HV4A 3WZJA 3A7FA 4FI1A 4EH7A 3ZU7A 3DS6A 2GS2A 1ZXEA 3COKA 4RVMA 5FM2A 5J7BA 4ZJIA 2XIXA 2YCSA 3CTJA 4FK6A 4TL0A 3EN7A 4IM0A 2B9IA 1JWHA 1OMWA 2OF2A 2OWBA 3OP5A 4ASDA 4XUFA 2PE1A 3DZOA 3FKNA 4FNXA 4HOKA 4ZTLA 2XIYA 3C0HA 2Y6OA 4RT7A 4DTBA 4WOVA 3LHJA 1DI9A 3NIEA 4AN2A 4L45A 4A06A 4BL1A 4DEEA 4EYJA 4C33A 4FSMA 5D11A 3A8XA 2JDOA 5AUXA 3QALE 4IEBA 4DFUA 2W1GA 2C6LA 1DM2A 1Y57A 3MJ2A 4G1WA 5CSVA 3NVMB 4ZTSA 3COMA 3JPVA 4FV4A 2YM8A 4NJDA 4GRBA 4EH2A 4QP1A 3F7WA 4LYNA 2BPMA 2OJIA 1REJA 3ULZA 4ZSJA 2G1TA 5HX6A 3RNIA 3HUCA 4FEWA 2XK3A 3Q2JA 1JOWB 4B6LA 4LUDA 4FVQA 3MSSA 4EZ3A 3BU3A 4K9YA 5AUWA 5LMAA 4AZFA 3ZFMA 2EVAA 3AGMA 3MVHA 5L6WL 4DINA 3ACJA 5H8GA 4RJ4A 4Y8DA 4GIIA 4EK4A 5HCXA 2AUHA 4LGHA 1QL6A 3QTZA 3DNEA 5TOZA 2J0IA 4FT0A 1U5RA 4GFGA 4OTHA 5KE0A 4C34A 4F9WA 2QOHA 3F3UA 5TE0A 4AS0A 4YJPA 4XBRA 1NT2A 4USEA 4PNKA 5EOLA 4S34A 3RK5A 2GDOA 2PVLA 1FGIA 3IGGA 4FL1A 1R0EA 4G6NA 4OW8A 4AT3A 5AR2A 4ASZA 2WTJA 4I21A 3DKCA 1JLUE 4Z9LA 3FKOA 5HVKA 1VJYA 2PZIA 2F4JA 1FVVA 5E8VA 4O91A 4QPAA 3O7LD 3IONA 4RC2A 4UEUA 2ZV9A 5CSXA 5GZ9A 4LMUA 5HNGA 4L44A 4EONA 5IUIA 3V5WA 3ZO4A 3QD2B 1FOTA 1AD5A 3LKMA 2IJMA 4Y73A 3F5UA 3F69A 4MBIA 5HBHA 3RWQA 3W2RA 5AUTA 1CKPA 5BUEA 3PYYA 3ZBXA 4IJ9A 2QOLA 5DHJA 2C6MA 3V3VA 3CTQA 3ZTXA 5AX9A 4GT3A 3L8PA 5EQPA 4L42A 4Z16A 2XS0A 4U0IA 5CALA 1ZMUA 2VTHA 4V0GB 5DFPA 3ORPA 2C0TA 4PMSA 4GT5A 2P33A 2QU5A 3FE3A 2CLXA 3E7VA 3UMWA 3DA6A 4QD6A 3VF9A 4HVDA 3R9NA 3CD8A 3SKCA 2FSLX 2W05A 4AE9A 2R3MA 2PUIA 4HYIA 5F4NA 3PG1A 3D5UA 4HGSA 4RIYA 4WRGA 2BZIB 2B9HA 3F5GA 4G31A 4XV3A 3LXNA 4F0GA 4BHNA 3ROCA 1KE6A 2JBPA 2W96B 3G6HA 4P5ZA 4S31A 4WNPA 4FKWA 3G0EA 3K5VA 4RJ7A 4X6QC 4Z7GA 1RQQA 3F2AA 4MX9A 4S32A 5KMIA 5IQCA 1CSNA 4Z55A 4NK9A 3H10A 4O7SA 4WHZA 1YHSA 5JZNA 3NR9A 4D4YA 2W0JA 3N4UA 2YAKA 4F9CA 5CAQA 1LEWA 4ZS0A 3VULA 3U4WA 4E4XA 3VWAA 3BWFA 2FYSA 3W18A 3R7YA 3KF4A 1WFCA 1MUOA 3D0EA 3A7HA 3ORTA 3OBJA 4M68A 5M07A 3MPAA 4FV6A 1L8TA 3KMUA 3VJOA 1JKTA 2ITVA 3Q5ZA 5CT7A 3ZM9A 1FMOE 2GU8A 3MA6A 2EXMA 5ANIA 4J8MA 3GVUA 3ZFYA 4TYHB 4EHZA 3TIYA 4QNAA 5EI6A 4R78A 3G33A 4O0VA 4WBOA 4AW1A 2BZKB 5I9WA 1H0VA 1FPUA 2OICA 3LVPA 5DNRA 2W1HA 4GVAA 5CSPA 2PE0A 4HNFA 3L8SA 4BDBA 1OGUA 2WTWA 4JDHA 2C6TA 4MH7A 4UMPA 3ENMA 5LVNA 4R5YA 5A4CA 1TKIA 2VZ6A 4B8LA 3VUIA 2I6LA 3QA0A 4YJNA 3EFKA 3VUGA 3THBA 4EQCA 4I93A 5C4LA 4MNEB 2GHMA 3PA3A 2GNJA 4PUZA 2R3OA 4QTBA 5EYKA 4W9XA 4YR8A 3MA3A 4DGLC 4O83A 5EKOA 4AQCA 4F6UA 1WBPA 5DR6A 3O23A 5IEYA 4MEDA 5AV1A 1ZMVA 4CZUA 2VO7A 4CZTA 3H9FA 4PX6A 4YJUA 2PY3A 4BIBA 3PPZA 4F1MA 3P86A 3EB0A 2VTSA 3QZHA 4ZMFA 2YM5A 2I0EA 3GB2A 4AN9A 4R77A 2AYPA 3CGOA 1Q3WA 3EQFA 2XRUA 3C4WA 2GFSA 1B6CB 4N6YA 2C3KA 4QTDA 1OVEA 3QYZA 4FT5A 4YZBA 4DBXA 3R8PA 2WMRA 1P4OA 3E92A 5EK7A 3SW4A 2UZUE 5FBOA 2CJMA 3O8UA 4MQ1A 2OZAA 3ODYX 1MP8A 3QUEA 4XLIA 4U40A 4LGDA 3VC4A 2C6EA 3OXIA 2WHBA 3BHTA 2C5NA 3EQBA 3I6WA 3EQGA 3ELJA 4Q9SA 4QMXA 5FRIA 2RFDA 2YAAA 5HO7A 4C35A 2BAKA 3VBTA 2BRGA 4E93A 4X3FC 5LXMA 4B99A 1MRUA 5EH0A 2EWAA 3MTFA 1MQ4A 5JQ5A 1CDKA 4AOJA 3LE6A 4CRLA 3ZLYA 1IR3A 1YOMA 2HELA 5IA3A 4MF1A 4EUTA 4X0MA 1TVOA 3HV3A 3VS2A 2VTAA 3CR0A 5E8UA 4PP7A 3G2FA 2IZSA 4L7FA 5KO1A 1K9AA 4QP8A 4E73A 3E8CA 4XMOA 4K2RA 1U5QA 4FV5A 4GK3A 4PPBA 5I3RA 5M06A 2BVAA 4MQ2A 3OMVA 4YZCA 2QI8A 3RGFA 3UC3A 5CEKA 5LMKA 4M3QA 5CVFA 4NIFB 2EXCX 4U9AA 3Q9YA 3PXQA 2QHMA 2A4LA 4UWBA 3FMDA 4EZ7A 4LRKA 1W83A 3UO4A 2QKWB 2QLQA 3PXRA 4K33A 3DQWA 4J99A 5HLNA 4ERWA 3I0QA 2ITTA 1QPJA 1H0WA 3KQ7A 4W4YA 4F4PA 3KREA 3U9CA 2B0QA 3DBEA 3CE3A 4QP3A 5AP4A 2R3LA 2GQSA 5DEWA 3TXOA 3PPJA 2WMBA 4RX8A 3VVHA 2YHVA 4E6CA 2O65A 1XH8A 3RHXA 4YTCA 4DFBA 3DFAA 3POOA 2ZM1A 4UV0A 3KMMA 4L3JA 4DLJA 2PZYA 1UKHA 3FLZA 4IC8A 5CEOA 5TT7A 4MF0A 4USDA 3MH0A 4JBQA 5HZNA 1U4DA 3C4CA 2PL0A 3E3PA 4NT4A 4U7ZA 4M84A 2GS6A 4ZSGA 3ZC6A 4C38A 4EUUA 4E4MA 5M4FA 4JQ8A 2J5FA 2GHLA 3RPYA 1WBTA 2OJJA 4YZ9A 4EKKA 4QNYA 3W2QA 5IQGA 1RW8A 2X7OA 3WF5A 4O7NA 1Q3DA 2GS7A 3F3VA 3OCTA 4D2TA 2P2IA 3HUBA 4WRSA 5HIDA 2HZNA 5CF6A 1YDSE 1UNHA 3BHYA 5I9UA 3S0OA 5FUTA 5HHWA 2ERKA 2ZYBA 3BHHA 3R7VA 3AMBA 3QCXA 3QLFA 3E63A 4L67A 3PVBA 5I9YA 1ZAOA 4BI2A 2B52A 3M2WA 4FTLA 1OKZA 3C50A 3DY7A 3VBXA 3DK3A 3MV5A 1PXMA 3LMHA 5FGKA 2Y4PA 3H9OA 3UG2A 1KE9A 4AA0A 1H27A 4FG8A 2XIKA 3L8VA 4GV1A 2C5XA 2R7BA 4O22A 5KBRA 2C5YA 3QU0A 1W98A 5LWMA 1XH6A 2HZ0A 3OCBA 2WMVA 2JAVA 4U44A 5ANKA 3RKBA 3BEGA 5JFSA
chains in the Genus database with same CATH superfamily
2DS1A 2XK7A 1ZOHA 4AXDA 2CNUA 4ACCA 1FMKA 2NP8A 4CZYB 3COIA 3HRFA 2J5EA 2WIPA 2YABA 3ZUTA 4F70A 5LCJA 4XV9A 2CGUA 1GIIA 4V05A 1B38A 1SM2A 4DF3A 4FKUA 5ETCA 3ZH8A 4NEUA 3VUMA 3KCKA 3SV0A 5E92A 3KXMA 2QLUA 5BYZA 4CTBA 4GS6A 1K2PA 3OBGA 4DGNA 1Q8WA 4FTKA 3G51A 4GG5A 5GHVA 4EK8A 2YEXA 1OIUA 2BTSA 1R1WA 3G9LX 3UTOA 4BDDA 3OOMA 4G3FA 3VNTA 3R04A 1PJKA 4ALWA 4O7ZA 1BKXA 3M11A 4FSZA 3RWPA 2UW0A 2HZIA 5J5SA 5KMMA 5IMXA 1TZDA 5HVYA 1WZYA 5KZIA 4RJ5A 4FZ6A 4YC6A 4BIEA 3KXGA 3PLSA 3UPZA 4R8QA 4F7JA 5DG5A 4FNYA 5IUGA 3U4UA 4BYIA 2GQRA 4FV0A 3B2TA 3IW7A 4OTWA 3NUAA 4FTIA 3QX2A 3VRYA 3FI2A 4QQJA 1XKKA 3PVGA 4H39A 3ULIA 3AG9A 4R1VA 3CD3A 5EW8A 1GZNA 4LOQA 1F5QA 2C6OA 4H36A 1JSVA 4O0RA 4ASXA 5C03A 3NUPA 3PDTA 2X7FA 4QQ5A 2W4KA 3BX5A 3GCQA 3LCKA 4WUNA 4JLCA 3NSZA 5C9CA 4JDJA 3RPRA 4DTKA 1LPUA 3CCNA 5AUUA 3V5TA 3C13A 3HKOA 3IW5A 4DEIA 1TQIA 5KHXA 2RG5A 2VO0A 2FVDA 2UW6A 1J91A 2VTJA 3G5DA 4Y95A 3I6UA 3N51A 4G3GA 3MB7A 4IWOA 2AC3A 3ZSGA 4C62A 5CAVA 2VWWA 4KIPA 4OTDA 2X2KA 3LQ8A 4A9SA 4H3PA 4BDEA 1OIRA 3I60A 3QTSA 5EDRA 3WF8A 3PIZA 4F65A 3P23A 3DXNA 3DFCB 5CNNA 3ZOSA 5M44A 3C0IA 2VV9A 4FKQA 1XBAA 4MBJA 4A4XA 4UN0C 3Q53A 4EC8A 5JRQA 4KUJA 4GK2A 3RAWA 4CFMA 4YJSA 4YSMA 5E8WA 4IB1A 2UVXA 3P7BA 4U43A 2J7TA 3QGWA 2SRCA 2VGOA 4LL0A 4E5BA 4ZAUA 4MK0A 5BX0A 5D7VA 5KMLA 3HMPA 2F7EE 3KCFA 4ID7A 3FI8A 5FTGA 4IDVA 4R7IA 4CV9A 5E9EA 3NNVA 1YXVA 3DCVA 4G6OA 2C69A 2XNGA 3SRVB 4NKSA 3SQQA 3QYWA 3T3VA 4ANSA 1ERKA 4FGBA 5DYJA 3GCPA 3PWYA 4PQNA 1H24A 1M14A 4J53A 4I0RA 3UNZA 4XBUA 4FX3A 3W0MA 2Y9QA 2VAGA 3AXWA 4I5PA 4DN5A 4MUQA 4I20A 3TUCA 4I41A 5T3QA 3MFTA 4TRLA 3CQWA 4YTIA 2R3GA 3GU8A 4HYSA 2ITWA 3DBDA 3AOXA 4FKOA 4AW2A 3T3UA 4PDYA 4NFNA 4YO6A 3ZRKA 3G9NA 4AZEA 4ZTRA 4IQ6A 1OM1A 5JSMA 1E9HA 3H30A 2Z8CA 3VHKA 3QX4A 3RI1A 2YDIA 3H4JA 3LM0A 2QONA 3PY3A 4PF4A 3MS9A 3QQUA 1YI4A 4BZDA 2G2FA 3VN9A 4OTPA 5DRDA 3C0GA 3UGCA 3LMIA 3ORXA 4QOXA 5DGZA 3WILA 4YC3A 1Q41A 2YISA 1YDRE 2J0LA 3I7BA 3QF9A 4WNKA 2ITOA 5HD7A 3PJ2A 4FT7A 3R9OA 4E5AX 1JKKA 5JGAA 1XMLA 3RZFA 5H8EA 2E9OA 2XNPA 4WO5A 2ZB0A 3T9TA 3LFSA 2ITZA 4M69A 2XIRA 3PXFA 4QMMA 1R3CA 2WEVA 3IGOA 2R5TA 4QYEA 3D2IA 1QPEA 4TNDA 4MKCA 3TZ9A 2Y0AA 2OBJA 3W2OA 5AUZA 4BCKA 2R3IA 3W2SA 2X4FA 2XALA 4JQEA 3AD4A 2WXVA 4AAAA 2YIRA 4IWDA 2IW8A 5B2KA 3VBWA 5GJFA 1Q61A 2B7AA 4BCIA 4L53A 1OPKA 4H1MA 4IXPA 3D83A 4X6RA 3UOHA 5TKDA 4LQMA 3NUSA 3FMEA 3UIMA 3OWLA 4BDKA 3LJ2A 2YZLA 4E6QA 2XH5A 2IVSA 5HTBA 4YPDA 4O7VA 3BRBA 3CY2A 4DCEA 4A9UA 3HMIA 3HL7A 3Q5IA 2UUEA 5DBXA 4ANQA 3JVRA 2PPQA 1LP4A 2RKUA 4JR3A 3OWPA 4FSRA 4IE9A 5BMMA 4W4WA 1WAKA 4ZOGA 3QHRA 2XJ1A 3CLYA 3QQLA 3TI1A 3ZSHA 3UMXA 3FZTA 5KKRB 2ZVAA 4DLIA 1ZZ2A 4I6BA 4RX7A 4TYEA 3MFRA 3POZA 4IX5A 4BCHA 4QPSA 2C47A 2PVHA 2YITA 4QYYA 3CSVA 1DAYA 3LMGA 4FOCA 5A6NA 3W8QA 5E7RA 4X3FA 2UW9A 4F7SA 4F9AA 1MRVA 2UZEA 3FQSA 2PK9A 3QKKA 4L7SA 4P2KA 4YBJA 2QOFA 2X0PA 4XG2A 3N9XA 4RMZA 5J5TA 5JFWA 3FEGA 2IPXA 4IAZA 2XAOA 3ZEWA 3K2LA 3PG3A 4BDJA 3OFMA 4M7IA 4EOLA 3FI3A 5EM6A 3PWDA 4IM3A 4OT5A 4W8EA 4ENYA 4BWKA 2UV2A 3A99A 4JS8A 4BDAA 2VUWA 4IX6A 4UXQA 4CYJA 3HNGA 3UPXA 3QHWA 1O6LA 2R3NA 4X2JA 5AV4A 4YZDA 4RJ3A 2I7QA 4AGUA 3KN5A 3SX9A 4XG8A 1CTPE 2F7XE 2Z7SA 4W4VA 5CY3A 2DUVA 3OUKA 1WVYA 4J98A 5BVNA 3NCZA 4BI1A 2BIKB 2XNMA 2Q83A 4FZ7A 3CKWA 3GI3A 4OTGA 4HJOA 4MCVA 3LPBA 2O64A 3V5PA 2R3FA 2YIWA 3AT4A 1YKRA 5CX9A 3UVPA 3ZLSA 2YJSA 3LAUA 3DT1A 4AU8A 3PSBA 4FIJA 4QP9A 4RA5A 5FBNC 4RIOA 3NFGB 4DDIA 4OTRA 2JFLA 4N70A 3PJCA 5HICA 3ZYAA 2FSMX 4J96A 4RFMA 3SLSA 4BTFA 3FMNA 3PLAE 5M08A 4QDEA 2XF0A 3LQ5A 4TN6A 4YHJA 5H9BA 3FBVA 4FK3A 4MBLA 3Q52A 5EDPA 4L52A 4LOPA 3R63A 1HCLA 3D7ZA 3Q9ZA 4TY1A 5LQFA 3VBQA 2NO3A 3D7TA 3WZKA 1YWRA 3PFQA 3QLGA 3W8LA 2YERA 1M2RA 5BVKA 2W1FA 4FMQA 4PPCA 2ZMDA 3IW8A 1HCKA 2BRNA 1OITA 2BUJA 3AD6A 3HECA 3IO7A 4FKRA 4FTMA 4ANMA 4EZ5A 4AA5A 2UZNA 3OZ6A 3FY0A 4RVLA 5CU6A 1NW1A 2V55A 3CP9A 4K11A 4D5KA 2ITYA 3MH1A 3NWWA 4TWOA 3BV3A 3CC6A 3QTXA 2X39A 3TMOA 4LG4A 3KY2A 4KS7A 2OLCA 3DXQA 4I5CA 4I6LA 3FI4A 2Q0BA 2XVDA 2BDJA 3DLZA 3FMJA 3QAME 2FSTX 4IVBA 4Q5HA 5A3XA 2YFXA 1WMKA 2YM7A 5HU3A 4MNFA 3QRKA 5E1EA 2VU3A 3IKAA 1IRKA 3NPCA 2XEYA 4L6QA 3KRRA 5LMBA 3E8EA 5TO8A 2GNIA 3A7GA 3ORKA 2J0KA 2PSQA 4KKHA 3AKLA 3U55A 3OOGA 2BKZA 2ZOQA 1BLXA 2WMQA 2WQEA 3FLYA 1ZOGA 4GK4A 4RLKA 4YUQA 2PMLX 3LXPA 4BTKA 3E64A 2JLDA 3ATTA 5AP3A 3ML1A 1LR4A 3RAIA 4ANOA 4C37A 4EH3A 4O7YA 1OBDA 2VWIA 1AGWA 2A1AB 2E9VA 3OTUA 3PSCA 4OGRA 4B4LA 3PZEA 5CAOA 2Y7JA 5LARA 3FLSA 3REPA 5IQAA 2C30A 5LCKA 3BYVA 2W5AA 5ETIA 4W8DA 3SD0A 4C57A 4YGAA 3DB6A 3FAAA 4U5JA 3RVGA 4YBKA 4A9TA 4EOOA 5AM6A 4DA5A 2O3PA 4BGQA 1XHAA 3F61A 2EU9A 4M15A 4ZZNA 3KRXA 3SAYA 1NA7A 2IN6A 1AQ1A 3PPKA 4CFFA 3QKLA 1YW2A 3A7JA 2CN8A 4APPA 3RCDA 2ZMCA 2QR8A 5LVPA 3I1AA 3P0MA 2VRXA 4NTTA 3F66A 2RFSA 3ZDUA 4AA4A 3K54A 4CG9A 4OBQA 3MGYA 4FNWA 5DRBA 2B53A 3UZTA 5JFXA 2H96A 5AIRA 2NRYA 5DPVA 3TEIA 3SW7A 5JFVA 3BLQA 4XP2A 3BELA 3DB8A 3KB7A 5G6VA 3RK9A 3MFSA 5HOAA 4F7NA 4F0IA 4RIXA 1ATPE 1TFFA 4RC3A 3F2RA 2J90A 4KRCA 4AFEA 5E8SA 3V5QA 3IDCA 1CM8A 2X9EA 3HGKA 5FD2A 2YLEA 5A46A 4MXZA 5FTOA 4JL9A 5IEXA 4GT4A 2WTVA 4Y83A 2Y4IB 3MH2A 3GFWA 4P7EA 2QOQA 5DI1A 3R2BA 4IFGA 3WZUA 2VNYA 3F3ZA 5J9LA 2WU7A 3EMGA 3C5IA 4CVAA 2XA4A 4I23A 4RWJA 4E6AA 3MFUA 3WF6A 4I0SA 3BL7A 3RP9A 4RVTA 4PMPA 3PXYA 2CGVA 4DFYA 5J7HA 2PYWA 4K77A 3ZSIA 4CRSA 1WVXA 4USFA 5EFQA 3KIOC 3RPVA 3WF9A 1OIYA 4D4RA 5E8XA 1JKLA 5I4NA 3UC4A 2C4GA 3QUDA 4XV1A 1FQ1B 2PVNA 4DYMA 3F5XA 4FC0A 2B9JA 3F3TA 4HGLA 2OJGA 3P7CA 5AP1A 5HE2A 4E4LA 4ZMEA 3D14A 4I0TA 3W32A 5C8NA 5FLFA 3UJGA 4P4CA 3PA4A 4FYNA 3UODA 1ZOEA 3OEZA 3BE2A 3QGYA 2R3PA 3EKKA 4GVJA 4FV2A 4GYGA 3BHVA 3ZEPA 3GC9A 2R7IA 4EI4A 3N4VA 3I0OA 5AIKA 4N0SA 5KX8A 4BDHA 3OWJA 3F2NA 4BTMA 4NFMA 5DEYA 2RSVA 4C61A 4AXFA 4FIHA 2R3KA 2XUUA 3DOGA 4WSYA 2GFCA 2OJ9A 4ZXTA 4AE6A 2XK4A 2YWPA 3GUBA 3ZM4A 3VUTA 4O4EA 2RGPA 2ETMA 5D41A 3DNDA 4RA4A 3VHEA 3FYKX 2E9NA 4QMUA 4HW7A 2XARA 3TDWA 4IIRA 2BRHA 4H1JA 1S9JA 3OXTA 4ANBA 3PY1A 4PDSA 4TTHB 4WG3A 5CEIA 4C4EA 3LFAA 1H01A 2ITQA 4PTCA 4IMYA 3TTJA 3MY5A 3OROA 3JYAA 5IA5A 4D4VA 3R0TA 1YHWA 2RFEA 3LW0A 3FUPA 3LOKA 1ZWSA 5CS6A 3KGAA 4BDFA 4N4SA 2ITUA 2WAJA 4YJRA 3COHA 2YWVA 4XEYA 3VS0A 3UBDA 3QQKA 1NVQA 4JAIA 3EQDA 3ZHPC 3LLAA 4O86A 2PVRA 4O81A 1RDQE 2BDWA 2X1NA 3QZIA 1Y6BA 4NW5A 3LXLA 5HTCA 4NSTA 2UZWE 5IDPA 5HORA 1X8BA 3V8TA 3BE9A 4OLIA 1PXIA 2REIA 5EW3A 1M17A 3R21A 2QC6A 4RC4A 4W4XA 5CYIA 5AR5A 5BVWA 4D2SA 4F99A 1BL6A 1OGYA 3O8TA 3GNIB 4QTEA 1J7UA 3C51A 4UY9A 1K3AA 4V01A 3GCUA 2X0QA 3LZBA 5IUHA 3BGZA 3U54A 4JXFA 4EOMA 3HMMA 3AT2A 2C6DA 3PJ3A 1VZOA 4KIOA 3QCYA 3TN8A 4YTFA 4TWNA 2YN8A 2BKKA 3B8RA 3PTGA 2BDFA 1SNUA 4LRMA 4U8ZA 5DE2A 5KCVA 5C4KA 1V1KA 1UWHA 1F0QA 3EFWA 3FLNC 4FODA 3Q6UA 3MVMA 5HG8A 4IAAA 3WZEA 5IQEA 5K5XA 2V0DA 3GU5A 3TWJA 3TZ7A 1H1PA 3FMLA 1XWSA 4UYNA 4OTIA 4BJJA 2EXEA 3QZGA 3SXSA 2WMUA 4FKJA 4HPUE 1IA8A 1YI6A 4Q2AA 3C5UA 3CIKA 2ZJWA 4CGAA 1GZOA 3OTVA 5EW9A 3WE8A 1Z57A 4TWPA 1PXJA 3TZ8A 4Y72A 4RSSA 4ZSEA 4DE4A 3P5KA 4X7QA 3MY0A 4PRJA 3CGFA 3LCOA 4FTUA 4GH2A 4L43A 4II5A 2IF8A 1OKYA 4BR3A 3VONA 4DH5A 4XRLA 4C4JA 4O7LA 3RNYA 4FIGA 3KRJA 3F3WA 4S30A 3RBWA 4C3RA 3PVUA 4A4LA 3U6HA 1V0BA 4TNBA 5GJGA 4G9CA 5L8KA 3SOAA 2A98A 4ORKA 3UIXA 3ALOA 5K0XA 4TYJA 5ANOA 4ALUA 1ZRZA 3E87A 3TUDA 3KULB 3QC4A 4CYIA 2Z7RA 5JGBA 1UU3A 2GNGA 3KKVA 5AP5A 4A9YA 3W0QA 4TYGA 4AZVA 3NNUA 3R7OA 4FVPA 1UKIA 3U8WA 1XMMA 2PULA 4ACHA 3DPKA 4NCTC 4UMUA 3UG1A 5IA1A 4O4FA 2ITNA 2VWBA 5IA0A 4DT8A 4HVGA 3F6XA 4MAOA 4JI9A 3R9HA 3DU8A 4EH9A 3L9PA 2RFNA 4FSTA 4M12A 4XS2A 4K8AA 1DAWA 4H3BA 4IZYA 4U42A 3QQFA 3NYOA 3PZHA 4PTGA 3GU7A 4AGCA 3UP2A 5EQEA 3MDYA 3OWKA 5CANA 2WIHA 4KKGA 3KFAA 1OL5A 4MXOA 5AP7A 4M66A 1M52A 4O7RA 1ZY4A 3AC2A 4MXXA 3HRCA 3R1NA 4EOPA 4NUSA 1OL7A 3JR1A 4EEVA 3AC1A 4FTQA 4R3RA 4Z7HA 4FSNA 5HLWA 2XNNA 4EH4A 2XRWA 3UZRA 3QRJA 4BCFA 5HU9A 4F6WA 2QD9A 2ETRA 4C4IA 3GOPA 4U6RA 2BFXA 5AUVA 5DVRA 3ZMMA 4R5SA 3NUUA 2QODA 4YNOA 3A62A 4EHEA 2C5VA 4EOQA 2XKCA 4QTAA 3M42A 4BDGA 4C4GA 3KN6A 3FMHA 4DBNA 1VLRA 3EWHA 4BBFA 5ETAA 2C1BA 5AUYA 4CQGA 1T46A 2FGIA 4BDCA 5BMSA 2WTCA 1S9IA 3WYYA 3FXWA 3V04A 3OW4A 5D1JA 4LMNA 4P5QA 5CTPA 3H0YA 3W1FA 2O2UA 4G2FA 3O71A 3NFFB 4MTAA 4AAYA 5IH5A 3P78A 3R7EA 4V0GA 4YURA 3V8WA 5IU2A 3RALA 4FKVA 1OPJA 3ORZA 4DTAA 2YJRA 2OIQA 5JRSA 3AC5A 3Q4TA 1U54B 3ZO3A 4O2ZA 3ODZX 5FDXA 3W2PA 3QQJA 1ST0A 2O8YA 2IW6A 1V0OA 3PRIA 5HX8A 1KE7A 2GQGA 4ONAA 3ORIA 3PXZA 4MYGA 3ZFXA 1KE5A 3L9LA 4BVUA 5JQ8A 3FHRA 4OR5A 2OU7A 5LVLA 4JBOA 4DAWA 5IH6A 2WMWA 1P4FA 3PP1A 3VO3A 4BDIA 3UO6A 4C7TA 2JDRA 1ZYCA 3WF7A 2X8IA 2BHEA 2Z2WA 3BGQA 3MESA 3ZBFA 3VW6A 4ZP5A 4MXCA 5G1XA 2JKKA 1OECA 3G90X 4ZZMA 1YXUA 4DFNA 4IB3A 2XAMA 3OHTA 5FXRA 4DG2E 4FSQA 3FXZA 4ZK5A 1OUKA 3U6IA 3BHUA 3EQIA 3KVXA 3KXNA 3LFEA 5CEMA 2R2PA 5ITAA 1PRYA 3WIGA 2JC6A 1SZMA 1UWJA 4F09A 2W1EA 3QFVA 2B54A 4MXAA 3NAXA 1E1VA 4PPAA 2VD5A 4R3CA 4AZTA 3R2YA 3BCEA 4P90A 2Z7LA 5E1SA 3T9IA 5LVMA 4O82A 5K9IA 1EH4A 2PUNA 1XO2B 4Y85A 5FEEA 5CF5A 2XB7A 3PRFA 4XG6A 5GZAA 3SXFA 5IF1A 4WT6A 2WQMA 3LCSA 4DG3E 4HVIA 4R6VA 4UMTA 3Q9XA 4FV3A 4JR7A 2IO6A 4TYHA 3O5AA 5FDPA 2R3JA 2XP2A 4QMWA 2P3GX 5AR7A 4ITHA 2WTKB 2JDTA 2UZOA 4I5MA 2HXQA 4M69B 5FG8A 5I9ZA 4EK3A 4PL3A 4IJPA 4A9RA 4LL5A 5BVFA 3I4BA 3QC9A 4UX9A 1A48A 4EK5A 3TM0A 2OXXA 4QMZA 4ZJJA 3QTQA 3RPOA 4ZLZA 4M97A 2CN5A 3O2MA 1XH9A 4WIHA 5EYDA 1GZKA 3GU6A 5H2UA 4AGWA 2ZV7A 4W9WA 4I3ZA 1VEBA 4FTTA 4GUBA 3KF7A 5IQHA 3TNQB 3A2CA 2VWXA 2HCKA 4IAYA 3QTWA 2H6DA 3OXZA 4FZFB 5IA2A 2GMXA 4MNEA 4JVGA 5L6OA 1SYKA 2CSNA 5J9ZA 3HYHA 2H34A 1G3NA 1W7HA 1FGKA 2X2MA 1B39A 2V5QA 2PVMA 3CBLA 4GUEA 4YO4A 1WBSA 2VTPA 3A4OX 5HG5A 5M4UA 2PE2A 2ZDTA 4IC7A 4YU2A 4X2KA 4ZLOA 1YHVA 4KBCA 2G2HA 3I81A 4M0YA 2OIDA 2G15A 3OCSA 3UYTA 5IQIA 3QCQA 4EH8A 3LFNA 2BAQA 3R8LA 4AX8A 3TUBA 3TNWA 2P0CA 4L68A 2HENA 3JUHA 4GYIA 4TWCA 3EHAA 3A61A 4MD9E 5H3QA 3VJNA 2RIOA 4QMQA 5IQFA 5I5ZA 1SMHA 5EHOA 3QL8A 4J97A 1PMUA 1P2AA 2RL5A 2VTOA 3F9NA 4RGJA 5J9YA 4YLLA 4QEBA 4RG0A 1ZMWA 2X2LA 5KKRC 4JNWA 3PP0A 4X3FB 2YCQA 2BILB 2VX1A 3QBNA 4KBKA 3JS2A 3AMAA 4FKTA 5TR6A 2X8DA 3AC4A 2WO6A 2VTNA 2J2IB 2VTLA 3FSKA 1PW2A 2WZJA 1JSUA 3E8DA 2BRBA 4FR4A 4M67A 4R3PA 2Y8OA 2YA9A 3UQGA 1CKJA 2QOCA 5J95A 5ACKA 1H1RA 4H05A 4IX4A 1SVHA 3ZRMA 4GFMA 1UNGA 4CT1A 4CV8A 5JK3A 3QRUA 1YOJA 5AWMA 4QO9A 3UOKA 3SG8A 5CXZA 4TW9A 1H1QA 3QWJA 3UNKA 1P5EA 1RE8A 1JBPE 5CNOA 3V6RA 3HDMA 5DA3A 4ZTMA 4CKJA 1KOBA 3NW5A 3RMFA 3MH3A 5F1ZA 5FP6A 5CASA 3DXPA 3KC3A 4RFYA 2W9ZB 4O1OA 4BZNA 3MIAA 4RIWB 4A07A 5K5NA 2XJ2A 1GAGA 3IS5A 4IZAA 3GENA 2DQ7X 1UV5A 3QCSA 1WBOA 4FICA 1KWPA 4HVHA 2G9XA 2YIYA 3GC8A 4J95A 4C0TA 4QT1A 4FKSA 4DCAA 4FTAA 3EH9A 5EKNA 2OXDA 1PXOA 3IG7A 4C3PA 3PIXA 3BLRA 4CSVA 3V6SA 2YM6A 2WGJA 3MB6A 2QOKA 5ANJA 4XG7A 3U6JA 5DMZA 4BKJA 3L9NA 3MWUA 4G6LA 4BTJA 3ETAA 5CENA 3FLWA 3MJ1A 3EQCA 2QU6A 4KIQA 5ACBC 4QMTA 3VQUA 4L3PA 5BNJA 2WB8A 4FIEA 1Q8TA 3MN3A 5ICPA 3KEXA 4LUEA 3D4QA 5AM7A 4J1RA 3K5UA 4DHZA 3FMMA 4LFIA 4EQUA 3VF8A 1JNKA 1IEPA 3F5PA 4DEAA 4CLIA 2CKPA 5AAGA 4GW8A 2A0CX 2OF4A 4EH5A 4F9YA 2CGXA 3DBFA 2UZBA 2J0JA 4GJ3A 4JG7A 4FZAB 2X8EA 3MPMA 2ACXA 2WMSA 4JG8A 4PY1A 3SC1A 3D5VA 1OUYA 5T68A 5KBQA 4DEBA 5L2TA 4CD0A 4I5HA 1Q24A 2CGWA 1VYWA 5HCYA 3EKNA 4AFJA 3P1AA 4DEHA 2BROA 5C26A 3Q6WA 3QRIA 3PA5A 5FEDA 4C36A 5B7VA 5HG9A 5DT0A 2BZJA 4WD5A 4QPMA 3DJ6A 2QO9A 5HE1A 3TNHA 3HRBA 4ZY6A 3MY1A 3JXWA 2OZOA 4ACGA 4MD7E 5KMJA 3C4EA 5CQUA 4OAVB 2ONLA 2P55A 3EZRA 3ID6C 3BLAA 4E1ZA 5BV3A 3W0RA 2C5OA 5T6KA 5HKMA 5AV3A 3HA6A 1H4LA 3ZRLA 4QYGA 1IA9A 3QA8A 4IVCA 5CVGA 4CTCA 4U3ZA 5HO6A 4FSUA 3UIUA 4DFLA 2CNVA 3PUPA 2JD5A 3NGAA 2UW3A 3NYVA 4J8NA 5E90A 5AAEA 4X21A 1KOAA 4ZTHA 5EM7A 4KNBA 2JKQA 4X2FA 4BBMA 4IM2A 3L9MA 5C8MA 5AEPA 4I4EA 3ITZA 1YOLA 5D9HA 4AT5A 1L3RE 2KULA 3I79A 3VIDA 1FVRA 3U51A 4NL0A 2G01A 4FTCA 3GCSA 4O6EA 4NCTA 3BKBA 4ALVA 3O51A 1NVRA 3RAKA 4YZNA 3ANRA 4FYOA 4FZDB 3SOCA 5AA8A 2C6IA 4GFOA 4AZSA 5A4LA 4NM5A 4BN1A 4CKIA 5EI2A 5BVEA 1J7LA 2BALA 1H08A 4HYHA 4PNIA 5I9XA 5AFVA 3NEWA 3RINA 4DH3A 5AAFA 4IVAA 4U97A 3FC2A 3OT8A 5DN3A 3UDBA 4FTOA 5CSHA 2X7GA 4D2PA 2F57A 3F7ZA 3OVVA 2JIUA 1I09A 3Q3BA 1OL2A 4L00A 2FH9A 3E8NA 4ZIMA 5HCZA 1W84A 2JAMA 3BYMA 3TV7A 1WBNA 3VS1A 5M09A 4JX7A 2WQOA 2VWUA 5TF9A 3WE4A 4BHZA 3ORNA 4CXAA 3KMWA 4E3CA 4DT9A 1M2PA 4G9RA 4YJVA 4OBOA 4C4HA 1GOLA 4KD1A 2HZ4A 3EN5A 1UNLA 1W8CA 1BMKA 1URWA 4WG4A 3RM7A 3OC1A 2P4IA 5C27A 5J1WA 1J7IA 4AOTA 4AW5A 4FEXA 3CTHA 3TV6A 2UZDA 3IOKA 4O0TA 5L8JA 2OJFE 3MPTA 4L46A 5CU4A 5CF8A 4UWYA 4JBPA 1PHKA 4KA3A 1P14A 2OSCA 4CMOA 3HAVA 2IWIA 3R00A 4NYEA 3VRZA 2XIZA 5D7AA 5C8KA 3GU4A 5EDQA 4CT2A 3TZMA 4DFXE 4O7WA 3GGFA 1Y6AA 2GTNA 4U79A 4U80A 3D15A 3S95A 3TKIA 3LLTA 5CEQA 1IG1A 3EL7A 3A4PA 4C3FA 2C1AA 3LCTA 3QD0A 3AC8A 4U41A 4YLKA 5J87A 3MYGA 4DEDA 5GIPE 1A06A 1H8FA 4O1PA 2XANA 1M7NA 2VTTA 5JZJA 3NW6A 1Q62A 1OPLA 3MVJA 2CKEA 5A9UA 4IAIA 4F1OA 3R73A 1H26A 4RWKA 3NS9A 4D5HA 5L3AA 4IAFA 5BPYA 4DH8A 4BYJA 3EIDA 3RTPA 1YDTE 5IG1A 3E88A 3DQXA 3JVSA 3NMUF 3G6GA 5HE0A 1STCE 4CQEA 4G17A 4X3JA 3ZS5A 1PMEA 5M56A 3SRVA 3HAMA 4JIAA 3OY1A 4KIKA 2OXYA 2UW8A 5EI8A 4FE2A 3UDSA 3FMKA 4RIYB 3EL8A 3EZVA 5HG7A 1QMZA 2WOUA 4FF8A 1YWVA 3BL9A 2IZUA 4YSJA 3EN9A 2FSOX 3HLLA 3LFDA 4KB8A 2WTDA 3II5A 2QO2A 3ANQA 1FINA 2F9GA 2WMTA 4IWQA 4OTFA 2R9SA 2X6EA 4YPSA 5D12A 3ENHA 1YQJA 3HDNA 2WMXA 3FHIA 4B0GA 3NNXA 2X9FA 3DAJA 5IEVA 2J50A 4IWPA 2HXLA 4XG9A 4F1TA 5AV0A 5IA4A 3GP0A 3VAPA 4RX9A 3MW1A 2YACA 2BHHA 1NY3A 3PY0A 5K4IA 4I92A 5FQDC 5HTIA 2WU6A 3GC0A 4FNZA 4GL9A 5CF4A 4APCA 4FTNA 4NU1A 3O50A 1H00A 3FWQA 4PL4A 3M1SA 5JKGA 3SG9A 2GNFA 2VWZA 4JT3A 2R3RA 4KAOA 4A7CA 4JRVA 4KABA 3IQ7A 2G2IA 2J0MB 5GJDA 5C1QB 1W2FA 3QQGA 4JQ7A 4BIDA 4F6SA 2UW7A 1YWNA 3FJQE 2W1CA 1GY3A 3FZOA 4FKGA 3R8UA 5IQBA 5IISA 2HYYA