4GIIA

Tyk2 (jh1) in complex with 2,6-dichloro-4-cyano-n-{2-[(cyclopropylcarbonyl)amino]pyridin-4-yl}benzamide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
b'TVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRNLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Lead Optimization of a 4-Aminopyridine Benzamide Scaffold To Identify Potent, Selective, and Orally Bioavailable TYK2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 289
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4giiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4giiA01
3Q6UA 5AP2A 2VTOA 4DCEA 4DGLC 3KXZA 2IO6A 4GKIA 3QGYA 4KINA 4ZY5A 3DK6A 4KA3A 4D5HA 2WMTA 1ZYLA 3ZHPC 4NH1A 4O2ZA 4UMQA 3UC3A 2C5XA 5JSMA 2HELA 4IAZA 4ZTNA 3OBGA 3OG7A 4BDKA 3E7OA 3BU6A 4UB7A 4LOPA 4FOBA 4HGLA 1SVGA 5TT7A 4EJNA 4C2VA 4UBAA 4EK3A 2C6MA 3HL7A 4FV5A 3ZCLA 3D2IA 2OF4A 4BDIA 5GJGA 5L3AA 4C8BA 4QP7A 4E7WA 4C7TA 3G0EA 4IFGA 4FK6A 4BCOA 2OO8X 2XF0A 2I0VA 3UTOA 3AGLA 4A7CA 4L67A 2QI8A 4ANQA 4ZJIA 4BGQA 1QPJA 3O0GA 5CASA 1PKDA 3PRIA 2UW3A 3Q4UA 4ASZA 5DYJA 5LWNA 3CE3A 4EH8A 2I0YA 4HVHA 2B4SB 3CSVA 1XO2B 4TYIA 4FTUA 4E6QA 4OGRA 2PUIA 4YTHA 2J0LA 5IH6A 2E2BA 4UXQA 3MSSA 5DIAA 2XJ0A 4RJ5A 4GT4A 4RIWA 4NWMA 4BCJA 3WF9A 4FKOA 3K5UA 5AP0A 3R7IA 4IBMA 3L9MA 3ZLXA 2JDVA 4L7FA 2I7QA 1PRYA 3LXNA 4UN0C 3NAXA 3QZHA 2DYLA 3FC2A 2QOFA 2VO6A 4NU1A 3TV6A 3W2RA 4R77A 3E8DA 5AP1A 2IWIA 2P4IA 2XVDA 3O23A 3WI6A 4DC2A 1FGIA 3A2CA 3TL8A 3SLSA 3VJNA 3V5PA 2VWVA 4XG2A 3TNHA 1URWA 3PZHA 5ANDA 5L2SA 4EOQA 2HW7A 3I0OA 2BAJA 3PG1A 5HG8A 3FMDA 4KSPA 5CEQA 3S1HA 4OTDA 3ACKA 1H1PA 3KULB 3ORPA 1ZY4A 4FV6A 4RX7A 4BI2A 5K0XA 2UW9A 5HO8A 3MPTA 4FZAB 1QL6A 2GS2A 4NKSA 3VW6A 3BYSA 2VTRA 2CGVA 5KKRB 2WELA 4FTIA 4IDTA 5HCZA 2XEZA 4GRBA 3W2OA 3NUPA 4E8AA 3A8WA 4D1XA 1GIHA 3WYYA 4BWPA 3MPAA 2PMOX 3OY3A 5IMEA 5A4EA 3ZO4A 4YLKA 5ICPA 2GNLA 4ZLZA 4F08A 3FMKA 2E9NA 3QRIA 5HU9A 4S31A 2OZAB 1YOMA 2ITOA 3S3IA 3MH2A 3OTUA 3QKMA 3ZDIA 4ERWA 3G6GA 3AD5A 4IB5A 2X7FA 3OROA 4BKZA 3IPHA 2A0CX 2QOOA 4EEVA 2C5YA 1ND4A 4CNHA 4FIFA 1OIRA 2JFLA 3NUSA 5J9ZA 2BKZA 3QL8A 1JSTA 1BX6A 5HIEA 3WIGA 4K18A 4EZ3A 1NVRA 3QQJA 3U51A 3V3VA 5GHVA 4I41A 3WILA 4RFYA 5EYCA 3L9NA 2PTKA 4DH1A 1YOJA 3P4KA 2VU3A 4NFNA 5J5SA 2C5NA 3I1AA 1YKRA 1GNGA 1Y6BA 4L8MA 1STCE 2QU6A 1MUOA 2W5AA 4QMUA 4QMTA 2VTIA 3SA0A 3HMNA 4GS6A 1S9JA 2PWLA 3EQBA 3UJGA 4YPDA 4XG4A 4DAWA 2UZUE 4AN2A 3BV2A 3LQ3A 4G16A 4D58A 3EYHA 3O8UA 4XCUA 2V5QA 4I4EA 1XH5A 2XUUA 2ZM1A 2RFNA 2QOCA 5M4FA 5FLFA 1AGWA 4EH4A 2UW5A 4FV4A 3TKIA 5HTIA 3QBNA 2W9FB 2VTSA 5CVGA 2C1AA 5LJJA 1SNUA 4EQCA 3I6WA 3PYYA 3LAUA 4KBCA 3IW7A 2W96B 3RAHA 2R3OA 2B1PA 3DTCA 4IVDA 4V0GB 3AC4A 4YJSA 3WF5A 5DVRA 3MESA 4A9SA 3L1SA 3TWJA 3FLYA 3BX5A 4AF3A 1MRVA 4JNWA 3TNIA 5F95A 3ZTXA 4QTAA 2YLEA 4G17A 1M14A 3CTJA 2VRXA 4WUAA 3V6SA 1FQ1B 5JT2A 4YHJA 4O7YA 4D4RA 2WMVA 4IX4A 3HGKA 5DFPA 4GIHA 4RBLA 3F69A 4LOQA 1Q5KA 5HTBA 1PXMA 1JPAA 2JDSA 2PVNA 3LCSA 4BTJA 3EN5A 5IMXA 3E5AA 3JVSA 2GHLA 3IONA 3ORNA 4FNYA 4TWNA 4CZYB 2RFEA 2XH5A 4TTHB 3SKCA 4ZS4A 1XH8A 2Y8OA 4BL1A 4CZUA 3LE6A 3EQPA 3OC1A 1WAKA 3U9CA 1H00A 3FUPA 2JDRA 4I1ZA 4N6YA 2EUFB 3A60A 4G5JA 5J87A 2QOQA 5CENA 4DG3E 3UBDA 2RSVA 5GJFA 4NZWB 4QTEA 2R3MA 4CMUA 5L2QA 2ETKA 3UOLA 3A62A 4KKHA 4PDSA 5E8YA 5I9XA 4MWIA 1PXOA 4FT7A 4U97A 2FO0A 3IW4A 3ETAA 4L3JA 4CKRA 1K2PA 3CPBA 3DAEA 4RC2A 3MJ2A 4FUYA 3ZOSA 4FZ7A 4AU8A 3UYTA 2YN8A 4C38A 1ZOGA 3L8SA 4GK2A 4IJPA 5CNOA 3O50A 1VYZA 4FT0A 4FEUA 3W8QA 5BNJA 3QC4A 3E8CA 4F65A 2O3PA 3II5A 2XKFA 2ZMCA 2JLDA 4QYFA 3ZUVA 3AC5A 3DDPA 5KHWA 2OGVA 2YCRA 3QGWA 4QQJA 4DH3A 2WFYA 4IB0A 4OTHA 3BYUA 4GFGA 5HU3A 4MH7A 3HLLA 3S0OA 2ZV8A 3LFQA 4YC8A 5JGAA 3PXRA 3B2TA 3MN3A 3FMNA 4J1RA 2KTYA 3SQQA 5EM7A 1U54A 4WOVA 3PWYA 4MF1A 1LEWA 1NA7A 3A8XA 4EC9A 4FKUA 3PRFA 5AR4A 2R5TA 3MV5A 4QMPA 3I0QA 2X7GA 2OBJA 4JQ8A 2YHVA 4E6AA 5KMNA 1PKGA 2ITPA 3EQHA 4FTOA 4D4YA 2ITTA 1VJYA 3R7OA 1K9AA 1KE8A 3CTHA 1YXVA 5FWKK 3GNIB 1OIYA 4HGEA 2VWXA 4JBQA 3UGCA 3CCNA 2NP8A 4FI1A 4AN3A 3ZXTA 4ANBA 3SXSA 1V0BA 2QD9A 4WA9A 2YM5A 4X3FB 3WF6A 4BYIA 4C02A 3MY1A 3G5DA 1QCFA 4TN6A 4IDVA 3WZJA 3S00A 4EC8A 1TQMA 2G2FA 4L9IA 4I0SA 2ZDTA 4IHPA 3QLFA 2VV9A 1E1XA 3F6XA 4ALUA 4DN5A 3ZONA 5CVFA 4EOOA 4QMNA 2YWVA 4EH3A 3FQEA 3V5WA 5JFWA 4BCQA 3DBFA 3KB7A 1Q8YA 2BFXA 3GB2A 3ZEPA 3CY2A 4FYOA 1IAJA 2UZVA 3F9NA 2WTVA 5E7RA 4FV8A 2AYPA 1OM1A 2O64A 2XP2A 2WEVA 4FTCA 4O0SA 4DBXA 2HOGA 1SVEA 3A4OX 3D15A 4AT4A 4U42A 2RFDA 2BZIB 3O7LB 2X2MA 3QCYA 4Y83A 3LFCA 3PA4A 3QRTA 3Q2JA 2EU9A 4IWQA 4FKTA 3VUMA 3FZ1A 2QO7A 5D41A 3TV4A 2ONLA 2ACXA 3HMPA 3PA5A 2QNJA 4XP0A 3PDTA 4EH9A 3KVXA 3LXPA 4BCIA 2YEXA 4QMOA 5JZNA 4AZFA 4BN1A 4MAOA 3K54A 2XKCA 4JX3A 5DR6A 2HAKA 5CZIA 2CMWA 5A4CA 3SXFA 3FC1X 5AA8A 5CLPA 2IVSA 5JRQA 3HV7A 4YLLA 1ZYDA 1XKKA 4DFUA 4D2RA 3FI2A 4AUAA 3KXGA 3UVRA 3R21A 2PU8A 2XIRA 3QXOA 2ITWA 3AQVA 3BU3A 5IUGA 5A4QA 4DFBA 1SYKA 1HCKA 5E8SA 4AACA 3IW8A 4MX9A 4YGAA 1KE7A 1JKSA 2R3LA 2V7OA 2WIHA 3BE9A 4GK3A 3WZDA 3C4EA 3IGOA 3CR0A 2PMIA 1XBCA 3ZO1A 3UZRA 4O7WA 2VWZA 3THBA 4AW1A 4UMUA 1G8AA 4FODA 1R39A 4PMSA 1CTPE 4C2WA 2W17A 5AP4A 4FEWA 4QT1A 2BRBA 3DBEA 3PG3A 3TNPC 5LVNA 1OB3A 1YXXA 1QPDA 3UOHA 4APPA 4EHZA 3DJ6A 3HRBA 4ANNA 2CN5A 5AR5A 2ZB0A 3F5GA 1OIQA 4UMPA 4RVLA 1U5QA 4DEIA 3UQGA 2YDKA 3NCGA 3FQSA 4G9RA 4FTAA 4LI5A 3G2FA 3RGFA 4Z55A 2GS7A 2ZMDA 4U3YA 3AMYA 4XUFA 3OCBA 4IVBA 4X6QC 4F99A 2JDTA 3HAVA 1GJOA 1U5RA 3KMWA 3O7LD 4JT3A 3ID6C 2W1ZA 3NPCA 4OAUC 4OTIA 3NS9A 4O0WA 2BILB 4QPSA 4E4NA 4U3ZA 3W16A 4F09A 3ITZA 5F4NA 5A54A 4QYYA 2H9VA 3MFUA 4RLLA 3RCDA 4C3PA 3DFAA 4XYFA 1GIIA 2WOTA 3TTIA 4C3FA 5EI2A 2IZUA 3BBTB 2O65A 4YTCA 4RWIA 3PJ3A 3FYJX 2R3GA 4M15A 4U45A 4KAOA 4L46A 3CD3A 4CFUA 4YJTA 2X81A 4A4LA 2ITVA 4LYNA 3FMMA 3R01A 3ZBXA 4MEDA 2JEDA 3LQ8A 3UG1A 4C34A 3FI4A 2C6LA 4G3GA 4K11A 4X6RA 5DA3A 5C27A 3HAMA 3SG8A 3KRWA 1LPUA 4OTRA 3QKKA 3IW5A 4A06A 3H3CA 2WMRA 2XEYA 4M97A 3QU0A 3N9XA 4C59A 4G9CA 5CY3A 4EORA 3CKWA 4B0GA 2E9OA 3OS3A 1W83A 4H58A 5CYIA 3PJ2A 1VEBA 2X2LA 3ZYAA 3VF9A 4AZEA 4CFFA 4PP7A 4IZYA 3DJ7A 5JFXA 4QP4A 3H0YA 5AUVA 3ZU7A 2A1AB 4IM2A 5J95A 3R8ZA 4I3ZA 2VGPA 1B38A 1FMKA 4FICA 1PXNA 3FZPA 3GCQA 4KIKB 3RALA 4EBWA 5C8KA 4U44A 2GPHA 5C8MA 3CP9A 2XBJA 4MBLA 4DGGA 5IQBA 1ERKA 1KUTA 3UIMA 2VX0A 4FUXA 5HE1A 3SV0A 4D2PA 3GCPA 2J90A 1F3MC 4RA5A 4BBMA 2B9JA 2NPQA 2PK9A 4GG7A 3PP0A 3HA6A 4XNEA 3ZRLA 4NJDA 4F1MA 4AGDA 1U4DA 3QF9A 4QYEA 1WBTA 3DBCA 2XRUA 2BVAA 4UYAA 4ZOGA 4XV3A 1Y8YA 1IRKA 5E8UA 1H27A 1YW2A 4WIHA 2CNUA 3A7IA 3PY3A 4WKQA 4ZK5A 4LMUA 1R0PA 3FMHA 4Y73A 4YNOA 2W06A 2GS6A 5I4NA 3UC4A 1IR3A 4XP2A 3GC8A 1OUYA 3QHWA 1REJA 5LVMA 4DCAA 3NNUA 5J7BA 4FKRA 4U80A 3LVPA 2WAJA 1EH4A 4BCGA 4BIBA 2PUPA 2PVKA 3G51A 4FKWA 2FA2A 3D7ZA 4NW6A 4D1SA 4O38A 3V5TA 4IB1A 5EM6A 4NSTA 3RPOA 3SW7A 1NVQA 2UZNA 4RJ4A 4RGJA 4PMMA 2IW8A 4DH8A 5CALA 3KULA 3QAME 2OJJA 4F6UA 4UMRA 2IW9A 4BR3A 3OW3A 4FKIA 5DT3A 4ID7A 2ZV2A 4C4GA 5A4TA 4Q9ZA 4FSRA 2FYSA 2P0CA 1Z5MA 3MBLA 2VNWA 2WXVA 3BWFA 4XBRA 3TUDA 5HBJA 3F5UA 4TW9A 2GFSA 3QTRA 4UZDA 5DH3A 3S2PA 3V5LA 1CKIA 3KQ7A 1ZZLA 3KRXA 1J1CA 4O96A 5KBRA 3DZOA 2J0IA 5E91A 5A6OA 5CANA 5J1VA 5EQEA 2OZAA 3QTQA 1U54B 3BIZA 3F88A 3F3WA 2F7ZE 1ZARA 5AADA 5TKDA 3FSKA 5CU0A 3HRFA 2CGWA 2IJMA 2WTKB 3D5VA 3Q04A 4XRLA 3OHTA 2VTNA 5AR8A 2J4ZA 4DLJA 1AD5A 3FJQE 3LZBA 5EQYA 5GJDA 2W1IA 2WTDA 3N51A 4MQ1A 4WG5A 3KXNA 3QZFA 5LARA 4BI1A 4O7NA 2QO2A 2GMXA 2A4LA 4EUTA 3R7GA 3IW6A 3FZTA 4KRDA 4M13A 3ATTA 2PE1A 3QQGA 3P7BA 3FLQA 4X0MA 5IQEA 2WMBA 2WU7A 3AT2A 4ZAUA 2QQ7A 2RKUA 3RK5A 4RC3A 4QYGA 3EB0A 1ZMUA 1YQJA 5AV2A 4YZMA 4KSQA 4GK4A 4U8ZA 4TNBA 4I5MA 2WTIA 1V0PA 3FLNC 3DPKA 2R3JA 3FPMA 5AMNA 3TN8A 2EWAA 1P4FA 3PE2A 3W33A 3TM0A 2XK8A 5AX3A 3BLHA 1DAYA 4IQ6A 3CXWA 5CQWA 5GZ9A 5M06A 2BRHA 2Y4PA 4Q9SA 1ZOHA 3VBXA 1OIUA 4XRJA 2DUVA 1PW2A 3TI1A 4CT1A 4Y5QA 2ZAZA 3O96A 4Q5HA 3V8TA 3OFMA 4RT7A 5M4IA 4DA5A 2G2HA 2WEIA 3VRYA 4BHNA 3ET7A 3VQHA 3I4BA 3TCPA 4IEBA 4A9RA 4LGHA 2QONA 1KE9A 2B9IA 1L3RE 2FB8A 2JIVA 4CCBA 4ZEGA 3K3JA 2JAVA 3QXPA 5EM8A 5HNGA 1Q8TA 2WO6A 3UO4A 4A4XA 3KGAA 5HLWA 2C6EA 4QNYA 5AR3A 1QPCA 2OKRA 3VJOA 2H34A 4Z7HA 4AGCA 1CKPA 2AC5A 4FTTA 5C9CA 3Q53A 4F70A 4H3PA 2W1DA 5D7AA 2C47A 5CEIA 2QKRA 5FEQA 4BBEA 2BTRA 1MRUA 4GMYA 4IAYA 4BDEA 4BTKA 3DBDA 3D4QA 3VW8A 3F5XA 2PVHA 1A06A 2W4JA 4FYNA 4V01A 4EZ7A 3OXZA 4UWYA 5L2IA 5LMKC 5FQDC 2Y0AA 2QG7A 5TO8A 2JITA 4IZAA 3R8LA 3EN7A 3ELJA 3VHEA 3ALOA 3I81A 2XJ1A 4ZZMA 5CQUA 2R3RA 2NO3A 1I09A 3VQUA 4JJRA 3MPMA 1M52A 2BUJA 5AUWA 4LRKA 4R6VA 4X21A 4YZCA 3W55A 4E5WA 4USFA 1IAHA 4QP3A 1DI9A 4FKPA 5C01A 3KFAA 4JX7A 4HYSA 4A9YA 4ZTQA 3RZFA 4BDJA 4ZLOA 4HVGA 4AGUA 4PNIA 4S34A 5EHYA 2ZJWA 4DEGA 2HWPA 4IACA 2ETMA 4CYIA 4EONA 4PNKA 4OTWA 4PMTA 2B0QA 1JSUA 4B8LA 2UW0A 1GIJA 4AE6A 3DZQA 4I23A 4IB3A 5DRBA 3GVUA 3SHEA 5LMBA 3DBQA 4DINA 4JS8A 5JK3A 5L8LA 2SRCA 1OGUA 2QOBA 1S9IA 4H3QA 4L52A 5K4JA 2BRGA 4QP8A 4PX6A 2ITYA 1WBOA 4J7BA 5BVNA 1PXJA 3CIKA 3I7BA 2G01A 3O2MA 2R3IA 4CQEA 2XJ2A 2R2PA 2QHMA 3GCSA 4L44A 4UZHA 4EOKA 3DKCA 3LLTA 3UVQA 2CSNA 1BI8A 3Q4ZA 4L53A 3NX8A 4LFIA 2Z02A 2CKEA 1UU3A 3DK3A 2X6EA 1H0WA 5IEYA 1QPEA 5FDXA 3H4JA 2BKKA 5CAQA 4LGDA 3GU8A 5KKRC 4RZVA 3PSDA 5GZ8A 2O5KA 3KVWA 5AIRA 3ZXZA 1RDQE 2F9GA 2JD5A 4EJ7A 4HVDA 4OTPA 2J9MA 4C58A 3ZUTA 4IADA 4E93A 3SRVB 2R7IA 4FT3A 3CGOA 3ULZA 4A4OA 2OJGA 3EJ1A 4ZSGA 3VAPA 4Y72A 4HPUE 3C5UA 3MVLA 5C8NA 1YDRE 2JIIA 3TJCA 4XS2A 1BKXA 2VTHA 4BFMA 3UZTA 1YHSA 3EIDA 3OP5A 4MXAA 4NIFB 1R78A 2G1TA 3ULIA 3EKNA 4GW8A 3RCJA 2ZOQA 4X3FA 4KS8A 2C6DA 4QMZA 1WCCA 5ETIA 3R22A 4HNIA 4D2SA 2VZ6A 1O9UA 4G6OA 3KN5A 3BLRA 2X4FA 2PVMA 1PYXA 4PL4A 2OF2A 4C4IA 3DY7A 4CV9A 2GHMA 3EQCA 2OZOA 3U55A 4GJ3A 4PPBA 1B39A 2RIOA 2Z7QA 3Q9XA 4D2VA 4BB4A 4M67A 3QYWA 4ZTRA 4KB8A 2VTTA 4PL3A 3DXNA 3DOGA 3BGZA 3E93A 3R8MA 3OUKA 4RJ8A 2OFVA 3C0IA 4L43A 4ITIA 3UMXA 4AZSA 4FL3A 5IQCA 1WBNA 4ALWA 3AXWA 3BBWA 2JC6A 3FHRA 1ZWSA 2H96A 4X2JA 1H1WA 4LGGA 3NYXA 3TJDA 3KRLA 5IA3A 5HG5A 3UG2A 3P86A 5HI2A 2KULA 3UMWA 4O2PA 3R1QA 3FDNA 3GU7A 5JRSA 5A9UA 4I94A 5EDRA 4C4JA 4M3QA 5I9ZA 2W1FA 2Z8CA 2OXXA 3WBLA 5B2LA 2BPMA 5LQFA 3DCVA 4NW5A 5AWMA 2CJMA 5ITAA 4RLKA 5EI6A 2PZIA 5IQDA 3VNTA 4Y5HA 4IAIA 4YZ9A 3E64A 4C57A 4O21A 1T46A 3NRMA 2UW6A 3BYVA 5M55A 4DH5A 2WQMA 4O91A 2QC6A 4J98A 3GI3A 2XM8A 3F61A 4PWNA 5KUPA 4P4CA 4KWPA 5LVOA 3HMOA 4MBIA 2WPAA 2YACA 4LM5A 2UUEA 5FM3A 4YSMA 3V04A 3EFJA 4QTBA 4S32A 3ODYX 3W1FA 4DH7A 3PFQA 5BUIA 4Z7GA 5E1EA 3GU6A 2ZM3A 4WNPA 3P79A 4I6BA 5HE0A 5K9IA 2IN6A 3AOXA 2VD5A 4ANMA 3MGYA 4JQEA 4G6NA 5HKMA 4GV1A 2B55A 3TIZA 3RNYA 2Y9QA 2Q0BA 4RZWA 2OU7A 4J8MA 5CEMA 5D10A 1Y6AA 3QQFA 5BQ0A 2UZLA 4FV7A 4PL5A 5HTCA 3BHUA 5KNJA 3CEKA 4JRNA 4RX9A 4DFXE 4FF8A 4EK4A 4L45A 5E4HA 4QMLA 3D94A 3OCTA 3FKOA 4V04A 4LV8A 5KBQA 4N57A 5HIBA 1MP8A 4TWCA 5IG1A 4JDJA 4B9DA 2J5EA 1WBWA 4PY1A 4FIHA 4TT7A 2LGCA 2F49A 3T9TA 3MH0A 3VC4A 2WMUA 5TR6A 3G15A 2C6TA 3FL5A 5HGIA 1BMKA 1PYEA 5DWRA 3AMBA 5K3YA 3UQFA 2WMSA 5CF8A 2WMWA 4AT5A 3HV4A 4PMPA 4PPCA 4TYEA 5HORA 3RM7A 3GOKA 1TKIA 5CAOA 4BC6A 3QTSA 4AFEA 1PMVA 2X9FA 4M12A 5AIKA 5DOSA 4C61A 3NW7A 4GUBA 4O7LA 5L8JA 4DYMA 3LFAA 5CVHA 2FGIA 4FTNA 4L01A 3N4TA 4E3CA 2XNMA 1MQ4A 4DEEA 3QTWA 4CMOA 5T68A 3VS6A 3OWPA 4LUDA 5E90A 3R9OA 2ETRA 3F2RA 5IQFA 5CZHA 4M7IA 5BVKA 1H4LA 4WRSA 3QQLA 2YITA 1ZRZA 3DLZA 4BRXA 1WVYA 3IGGA 4V05A 4CYJA 3OCGA 3DT1A 3SDJA 3ZM4A 3QTIA 4IFCA 2W1GA 4XLIA 3K3IA 3PIXA 4EOPA 4EZ5A 3R83A 3PY1A 4F7SA 4BF2A 5GZAA 3R8PA 4JOAA 3KF7A 4ZY6A 1JKKA 3RHXA 3QD2B 3CJFA 3LCDA 1PXKA 2R3PA 4NCTA 3KREA 1R3CA 3PLAE 5EYKA 2OK1A 3ZMMA 4J8NA 4DG2E 4O6EA 4KIKA 3C0GA 3DDQA 3PXFA 4LL5A 2BRMA 3R2BA 3FXXA 1WBVA 4D0WA 3MJ1A 2XCHA 4N0SA 2PMNX 3ORLA 4E5AX 3UVPA 3GENA 3MYGA 4E1ZA 4ZSAA 2VWWA 4WNKA 5FTGA 2GNFA 3OZ6A 1TQIA 4IX5A 5KMOA 3F5PA 3EFKA 1GZOA 5JKGA 2YZLA 2WQNA 5A46A 4J52A 5CAUA 3EH9A 4RIYB 3EQFA 4NL0A 3BQRA 3QRUA 3DQXA 4FG7A 4O0RA 4X3JA 3IOKA 4WD5A 4OW8A 3MY5A 5HIDA 3BWJA 5IA5A 3U4WA 4IW0A 4FKGA 5I9YA 4E20A 5CF4A 4F1TA 4FKJA 3DNEA 1YI4A 3MH1A 3B2WA 3Q5ZA 3KEXA 4KBAA 4GSBA 2YJSA 4D5KA 1WVWA 3CJGA 3VUIA 1PMUA 3GU5A 5HEZA 2XNEA 4RC4A 3OF0A 4K1BA 1YDSE 4X7QA 3GFEA 3PSBA 4USDA 4MXZA 5EOLA 3BKBA 4N6ZA 4QQCA 4XHKB 4IH8A 4J96A 4OR5A 3KK9A 3D9VA 3Q96A 3VUGA 2IW6A 4U40A 1OMWA 4X2KA 5KZIA 4QTCA 2BROA 4JIKA 3UNZA 4EK8A 5CEKA 3WIKA 1ZYCA 2PSQA 1PF8A 3BELA 3I5ZA 4KD1A 2R3FA 4XG6A 4AWIA 1SNXA 2P2IA 2XIZA 3L9PA 4BDGA 3FWQA 4HCUA 4E6CA 3GEQA 4YHFA 3ZEWA 4XOZA 3ZRKA 3JR1A 4JBPA 5CI6A 4CKJA 3UPXA 2CDZA 2WQBA 5HE2A 3R8VA 4AW5A 2CKPA 5M08A 4PDYA 4NK9A 3T3VA 5AV1A 4H1JA 3ZFYA 3VO3A 4CG8A 4RVKA 3FQHA 3OD6X 2HWOA 3TUBA 3RPVA 1OITA 4AX8A 5JFSA 3MIYA 3QX2A 2XK6A 3REPA 1OKVA 4RJ7A 1FVTA 4F0FA 4H3BA 1Q61A 1OL2A 4FT9A 4KUJA 5HO6A 3IDBA 4TYHA 4J95A 1TQPA 1F5QA 1LR4A 2X8IA 2OSCA 3QHRA 2VNYA 5AUYA 4ZTHA 2NRYA 5BMMA 3ZSGA 4I24A 4UX9A 3TEIA 4PV0A 4RSSA 3FEGA 1WVXA 3F2AA 3LIJA 3UE4A 3EL8A 3QRJA 3R9DA 4GIIA 4BDBA 4CTCA 3BPRA 4M8TA 3VBWA 3MH3A 4CT2A 3UNKA 1M2QA 4RX8A 3RAIA 3DNDA 4HGTA 3DFCB 3BYMA 3U87A 4YNEA 3BHTA 3QYZA 5CXHA 3CGFA 3UQCA 2F2CB 2HW6A 4MCVA 1QMZA 3D7TA 3C4FA 3DKFA 3FBVA 4FR4A 2QU5A 5AR7A 4QPAA 3ZDUA 2WZJA 5M07A 1YI3A 3Q6WA 1G8SA 2OIQA 2CN8A 4WHZA 5F20A 5IDPA 4P5QA 5IDNA 4RJ3A 2A2AA 3FI8A 4IZ7A 4FV0A 4I22A 4G31A 3VRZA 1NXKA 4ZJVA 3OXTA 3LJ0A 5EW3A 1JSVA 4JR3A 1XHAA 4MNFA 4E26A 2E9UA 3F7ZA 3JPVA 3NEWA 1JWHA 2E9PA 4IAFA 4KS7A 4APCA 3OCSA 3NNVA 5I5ZA 2WGJA 1F0QA 4RVMA 2Y4IC 5ACBC 2QR7A 3COMA 4WG3A 4MBJA 2XCKA 2J0JA 4IC7A 3BU5A 3PIZA 4NM0A 4BWXA 2IG7A 4ZY4A 3I60A 5IA4A 5E8XA 1CKJA 4YO4A 2G9XA 2LAVA 4YO6A 2WMXA 3CQUA 1OBGA 1SVHA 3ORXA 5T3QA 2UZDA 4RWLA 3W18A 1P2AA 3QA0A 4FTJA 5FXQA 4ARKA 4DLIA 4DEDA 5I0BA 5L8KA 1KE6A 3HKOA 4RX5A 3AT3A 3C13A 3FE3A 4CKIA 4KIPA 3DGKA 1XR1A 3TT0A 2ERKA 4L42A 4M68A 5CSVA 3TZ8A 3PUPA 2FSOX 3ZSIA 3NUYA 4JG8A 4KABA 3FZSA 4TYJA 5FXSA 2QHNA 1JVPP 2OFUA 3KN6A 1XBAA 4R1YA 4FSTA 5AAFA 4PF4A 3RPSA 3QCSA 3COKA 3OT3A 3LFEA 2R4BA 4FKSA 4D28A 3JVRA 3V5JA 5A6NA 3HX4A 4BDHA 3NVKI 3HMIA 4QMVA 3NYOA 5A3XA 2BDJA 3MA3A 4WT6A 5CAPA 3F7WA 2PZRA 4IWDA 4FIJA 3BHHA 4GKHA 4AOIA 2GU8A 3JYAA 2RFSA 3N4VA 4ANLA 4FMQA 2XRWA 1IEPA 1YDTE 4AZVA 4YMJA 5C1QB 3PTGA 4B8MA 5AM6A 2VWBA 4ENXA 2JKOA 4NEUA 4B4LA 3HECA 1GOLA 3OVVA 4F0IA 1H1QA 3GU4A 3RWPA 3P78A 3OXIA 4IM0A 2HZNA 4NTTA 2GDOA 3EOCA 4A9UA 2JBOA 4OBPA 4FKQA 4FX3A 3KF4A 4HVIA 4AZTA 2OJFE 4F7JA 3PVBA 2ESMA 5JGDA 1OI9A 3DB8A 4MD9E 2QR8A 2VTAA 2ITQA 2W0JA 4GFMA 2C0OA 3LXKA 4FZDB 4WSQA 2XIKA 4ZSLA 5C4KA 1KV1A 2WHBA 4MXYA 5IU2A 2EXEA 4BWKA 4RQKA 4YJRA 4FSYA 4RQVA 5ACKA 2NNWB 5BVOA 4FEQA 3UOJA 3DXQA 3GC0A 5JZJA 4I93A 2JAMA 2AUHA 2R0UA 3KMUA 3SRVA 3DKGA 4GT5A 3R9HA 1FGKA 3BLQA 4Y8DA 5LCJA 3VBVA 4O82A 2IZRA 3R9RA 5I9UA 2DWBA 4AGWA 4BDCA 1H1RA 2HIWA 4NIFA 2X2KA 2WTKC 1OECA 2HCKA 4CV8A 3RK7A 2YIWA 5AX9A 5HD7A 5IA0A 3P5KA 2J50A 3CBLA 4G3FA 3FI3A 3KXHA 1YXSA 2OIDA 4S30A 3ZRMA 4F64A 2FSMX 2QKWB 2YIQA 5HLPA 3RVGA 3ANQA 5E8ZA 2NRUA 2WOUA 4FIEA 5DG5A 4CRSA 1J3HA 4XG9A 2GCDA 2UV2A 5ETFA 2R0IA 4JDKA 3OWJA 3QUEA 1OL7A 1H26A 4KKGA 3A7HA 3NUXA 2P55A 3Q3BA 4O86A 4GYIA 4YJOA 2JDOA 1W8CA 3PP1A 4F9WA 5BVFA 2C5VA 5EK7A 4E5BA 2RG5A 3LCKA 5EOBA 4AP7A 4DFYA 5J7HA 2XMYA 4YJUA 4FE2A 3KC3A 3PPZA 5J8IA 3ORTA 4OAVB 3LOKA 4QOXA 5CT0A 4ITJA 2ITXA 4QRCA 3QA8A 4W9WA 4D2TA 3HP2A 3NIEA 5ANJA 4IVAA 3KMMA 4I6QA 3QCQA 5F1ZA 5EW9A 5AEPA 1OL1A 2OICA 4G3DA 2W5HA 4PTGA 2ONLC 1VYWA 3R8UA 1XH7A 4C3RA 4CXAA 5H8GA 4AOJA 2V7AA 3P08A 2WTCA 4H36A 4FT5A 1BL6A 4KRCA 1OL5A 2BIKB 2X39A 3O71A 4KIOA 5CU6A 5B2MA 3TUCA 5HZNA 1YI6A 2EVAA 4EK5A 4LMNA 2O63A 3PJ8A 2X6DA 3D83A 3TG1A 4DGOA 4F9AA 2X4ZA 3FZRA 5AUZA 5I3OA 2BTSA 2HENA 4FNXA 5GNKA 4HYUA 1OKWA 3VS0A 4B99A 1BLXA 5IZFA 3S4QA 2UZEA 4O6LA 3AC2A 2GNJA 3VBYA 4P2KA 2FH9A 4DE4A 2C3KA 3LFNA 4WSYA 4QO9A 4YR8A 5E9EA 5EHLA 3M1SA 4DITA 1WBPA 5M09A 2V62A 1E1VA 5CT7A 4TZRA 4BZNA 5I3RA 2R3KA 3EHAA 3QRKA 5IKWA 4FV3A 4ZJJA 3DU8A 5E1SA 4AAAA 5BVWA 2GQSA 4EKKA 2UZBA 1H01A 1LUFA 2VX3A 3D5WA 3L8VA 3E7VA 1HCLA 2QLUA 3LFBA 4FVQA 1JBPE 3Q32A 4TYHB 3ZLYA 3MVMA 3LKMA 4BVUA 2HY0A 2YABA 3QD0A 1KV2A 2C6OA 2BDFA 4LUEA 3COIA 2BZHB 1FOTA 3DV3A 3K5VA 5HOAA 4AOTA 3O8TA 4E4MA 1GZKA 3ACJA 1W0XC 2IZTA 1ZAOA 5AA9A 5GINE 1OVEA 4O0XA 4D9TA 5CTPA 5IF1A 4ALVA 4U41A 4WNOA 2F2UA 5G6VA 5FUTA 3VIDA 4UWBA 3DAKA 3O51A 3NWWA 3TZ7A 1JOWB 1OBDA 3DK7A 1PY5A 2RGPA 3UIBA 4HYHA 3MW1A 5DNRA 1OPLA 3D7TB 3L9LA 2CPKE 3MTFA 2GQGA 4YBJA 4DEHA 4TWOA 5GIOE 3KK8A 4TRLA 4CFVA 1ZMVA 1PXPA 1WFCA 5HG7A 1BI7A 2QG5A 3BI6A 2WTWA 4FL2A 5M53A 2GNIA 4ZIMA 4QP2A 3VULA 4D55A 3U6HA 3SG9A 2JFMA 4F9BA 4M69B 1OZ1A 4OLIA 2XKEA 4YP8A 2J5FA 5M4UA 3C0HA 2F4JA 2XNNA 2C3LA 5JQ5A 4XV1A 3P7CA 3A7FA 2W1EA 3OOGA 1NT2A 4YZNA 3WF7A 5HQ0A 2H8HA 3PVGA 3LJ2A 4HVSA 5AUTA 3RBWA 4NYEA 3PWDA 3ZC6A 5IA1A 1UU7A 3VVHA 4HYIA 4CZTA 3O17A 4IANA 1IG1A 3R1SA 3UNJA 2C3IB 5KMIA 1P4OA 5CWZA 5I9WA 3GXLA 4HCTA 1YOLA 5E8WA 1GZNA 2FSLX 4D0XA 4FVRA 4EOSA 1Q62A 2UZTA 3IDCA 4O84A 5C4LA 2XM9A 2UZWE 4FV1A 3R7EA 4YPSA 2HY81 2C3JA 4JAIA 4DGNA 4EBVA 3OWLA 4D9UA 3V51A 4FSNA 3OUNB 5DRDA 4A9TA 3BQCA 4IAKA 4DHFA 5HNIX 4ASDA 3FL4A 4L68A 2GFCA 4I21A 4QNAA 4K33A 2P3GX 2V22A 4HGSA 4RIYA 4F4PA 3EFLA 3RNIA 5EYMA 1AQ1A 4R7IA 3QCXA 2BAQA 3EMGA 4TPTA 4D4SA 3ZM9A 1UWJA 2Y7JA 3OT8A 3R2YA 3R6XA 3R1YA 3MY0A 3T9IA 4KKEA 2PUNA 3NW6A 5A14A 3BGPA 3UO5A 3T8OA 2BHEA 3M42A 2YZAA 3TNQB 4Y95A 2BCJA 5CXZA 5DPVA 3BGQA 2BIYA 3ENHA 5EYDA 4NT4A 5DT4A 4FZFB 5J9YA 3IECA 4FV2A 5DGZA 2BMCA 4GEOA 4AE9A 1UU9A 2CGXA 2GNHA 3PXQA 3TZ9A 4I20A 5AAGA 3FZOA 2I1MA 4PQNA 4EOMA 5HD4A 2ZM4A 2QODA 4LRJA 5DR9A 3HV5A 3QALE 4YHTA 4IE9A 2J6MA 3R7VA 3BEAA 4FOCA 4QD6A 3VUTA 3ZZEA 4BCHA 3WYXA 1CM8A 4LRMA 4AT3A 5JGBA 2YDJA 4C35A 3D0EA 4K6ZA 4NFMA 4BZOA 4DF3A 4YLJA 3DKOA 3FMLA 3QFVA 4ONAA 4RPVA 3BHVA 3H9FA 3HP5A 4IAAA 3U4UA 3OEFX 3PPJA 3W32A 2BALA 5TF9A 2W5BA 4C62A 2WD1A 4DTAA 3OWKA 4MNEA 4R78A 4UWCA 4DTBA 3EQGA 4F0GA 4O7SA 3NVMB 2UVYA 2ZV7A 3QZIA 4W4YA 4O83A 1URCA 3ENMA 2C30A 2W4OA 3QKLA 4OBOA 3F3ZA 4FBXA 3R02A 4BKJA 2PZPA 3CD8A 4G1WA 1NW1A 3LCOA 1KSWA 1GZ8A 4MK0A 4Z9LA 4F6WA 4GVJA 1Z57A 4MF0A 4QMSA 3GCVA 1UNHA 2W4KA 4BDAA 2IVUA 3C4CA 5JFVA 3H9OA 3P1AA 4EH7A 4JI9A 2YM4A 4BCFA 4CSVA 4DBNA 3FLZA 4N4SA 3RZBA 3FPQA 2REIA 4RFMA 4D1ZA 3BV3A 4MVFA 1KWPA 4FG8A 3ZLWA 2EXCX 1P14A 1SMHA 3A61A 2QOKA 4RFZA 3RI1A 4YSJA 3A7JA 2IZSA 2WQOA 5D11A 3U9NA 4EL9A 3Q5IA 4AA5A 5KMJA 4JG7A 5TOZA 3U6IA 3KXXA 5CAVA 5K4IA 2BFYA 3F82A 5HE3A 3HV3A 1M7NA 5B0XA 3ZBFA 2OH4A 1IA8A 4IXPA 3P23A 1FBNA 3NMUF 3PJ1A 3GQLA 3PE1A 4U0IA 3MFSA 4FL1A 4UEUA 4BGGA 3G9NA 4FEVA 4X2NA 3HVCA 5M51A 1LEZA 5IISA 4YJQA 5T6KA 1Q4LA 3EFWA 4CG9A 4QYHA 4ITHA 5AR2A 1V0OA 5FBOA 1DI8A 2EB3A 3ZSHA 3P7AA 4WG4A 3VS1A 2AC3A 2GTMA 3R30A 4AFJA 3QC9A 1OL6A 1MQBA 1WMKA 2UW7A 2YIXA 5DI1A 5EH0A 5D1JA 1UA2A 4I4FA 3VS5A 1JKLA 3GFWA 4A07A 3P0MA 4NM5A 2PMLX 5LCKA 4LG4A 4TYGA 4BICA 5JH6A 2RF9A 3TKHA 4GCJA 5D9HA 3IDPA 4E4LA 3GC7A 3HYHA 3NDMA 2PY3A 3B8QA 4I5HA 5EG3A 5H9BA 1H1SA 2XNPA 5KZ0A 1ZYSA 3GUBA 1J7LA 4IJ9A 2VWYA 4BHZA 5DHJA 1Y91A 4XP3A 3LMHA 1PMNA 1FPUA 3KU2A 2JKQA 2VUWA 3KY2A 4XOYA 5LVLA 1PHKA 3TTJA 2UVZA 1G5SA 4U5JA 5ETCA 2W7XA 3VF8A 5IUIA 4G34A 1Q99A 4IM3A 4RA4A 5L6PA 4Q5EA 1YWNA 4JQ7A 3RINA 2WMQA 4OT5A 5B2KA 2ZVAA 5HVKA 2R3QA 4XX9A 3DTWA 3FMEA 3HMMA 4H05A 3Q4CA 4DFZE 4ZSJA 3KCKA 3UIUA 5AUUA 4J99A 3GP0A 5BUJA 2PZ5A 4O0YA 4AQCA 5CSWA 4HPTE 4DTKA 3NW5A 4QP1A 1LP4A 4RG0A 2PE2A 1UNLA 4ZP5A 4BCKA 4DFLA 4U79A 3DS6A 4OTQA 3VS2A 3C9WA 4W4WA 5BVEA 4Q2AA 3RK9A 3VS7A 4XEYA 2C4GA 2WB8A 3GGFA 3SXRA 5J1WA 4W8DA 2J2IB 2C0TA 2XYNA 2ZB1A 3OY1A 4U9AA 4EHGA 3LFFA 5IQAA 1GAGA 3ZO3A 5AFVA 1PXIA 2IVTA 4C4FA 5AV4A 3TKUA 2XA4A 4IWPA 4AG8A 2XK4A 5TE0A 5HBHA 2VTMA 4YTFA 3JY0A 2IPXA 1M2PA 2HZ4A 3H9RA 4I6HA 3LFSA 4P7EA 3ZC5A 1K3AA 2O2UA 2YWPA 3OTVA 3PVUA 3R73A 3UZPA 1E9HA 4RIXB 2C5OA 1UVRA 3QTUA 3ERKA 5CEPA 4X2FA 5D7VA 5AM7A 5AV0A 4S33A 3FY2A 3AG9A 3EYGA 3SX9A 4C37A 4JL9A 2PZYA 1Q97A 3D5XA 4GG5A 5BPYA 5HLNA 1VZOA 3F3TA 1H8FA 3E92A 2W1HA 3EKKA 4JBVA 4K8AA 5FEDA 3F3UA 4N70A 1XH9A 4CFNA 2VO3A 3WOWA 4ASXA 2XKDA 5E8TA 4ACCA 1PJKA 4G3EA 3FLWA 4QP6A 4CLJA 2G15A 1CSNA 4ACDA 2OJIA 1UKHA 3KL8A 4BCMA 5IQHA 4C4EA 2CKQA 2G2IA 4TXCA 3TXOA 4YURA 3IOPA 4CLIA 2WTJA 3ZUUA 2VO0A 4W4VA 3Q4TA 3CQWA 4O0TA 2XIXA 3C4WA 3WE8A 4Z3VA 2W9ZB 3OEZA 3R7YA 4I0RA 4AS0A 4X2GA 2BHHA 5A4LA 1CDKA 3Q60A 5IH4A 2QOIA 4IX6A 3KCFA 3SVVA 2BR1A 5H2UA 3PXKA 2B9FA 4WBOA 3L8XA 4BTMA 3VHKA 4M66A 4LOOA 2X9EA 1T45A 1A9UA 1X8BA 3LJ1A 1Z9XA 4YZBA 1G3NA 4X3FC 3CKXA 4QMQA 1UWHA 2IVVA 3QQKA 3G6HA 4YJPA 3ORKA 4R3PA 4JBOA 3R9NA 2F7EE 3RM6A 3UP7A 3ATSA 1Y8GA 1Y57A 2CCIA 2ZYBA 4FIGA 5D12A 5BYZA 3IG7A 2RL5A 4AW0A 2UW8A 4CGAA 4O22A 4II5A 4BZDA 4HNFA 2XNGA 4I6FA 4CFMA 4BYJA 2YLFA 3G90X 3KRJA 3MWUA 2VTJA 2W99B 4G6LA 4EOIA 4F9CA 3COHA 1VR2A 1ATPE 3BHYA 4KBKA 4NUSA 4JG6A 3PSCA 2A27A 5HHWA 4ACGA 1J91A 5IPJA 5EKNA 3Q9ZA 4ZXTA 1SM2A 4USEA 3QQUA 4YC3A 4ERKA 5CF6A 2WMAA 2CLXA 4Y46A 4S2ZA 1OUKA 4OBQA 3HUCA 3JS2A 2BRNA 2I0HA 2PVLA 2QLQA 3Q52A 4M0ZA 3MDYA 4C4HA 2C1BA 3UDBA 3HV6A 1XJDA 4TWPA 5CU4A 3VUKA 3NUNA 1DM2A 2I6LA 3QTZA 5L2TA 1REKA 2OI4X 2VWUA 3R71A 4XLVA 3DJ5A 5GIPE 1YXTA 4PPAA 1M17A 5HG9A 2JGZA 4BGHA 5DMZA 4UMTA 3QUDA 3EZRA 2H6DA 2R64A 3KA0A 3V01A 5K0KA 4C0TA 3A4PA 5FXRA 4R5YA 3WF8A 2CNVA 3NGAA 4R7HA 4ZMEA 3WZEA 5EKOA 3NIZA 2RG6A 4DT8A 4QQ5A 2XBAA 5FTQA 3W10A 4AW2A 4IX3A 1Q24A 5M4CA 2XK3A 3R28A 4MNEB 3LW0A 3EQIA 3LM0A 3CLYA 3E87A 3LXLA 3MB6A 1HOWA 1APME 3CC6A 5IQGA 1O6LA 5F94A 5J9LA 2WU6A 3FAAA 4U6RA 5HBEA 4JRVA 3IQ7A 3ORZA 3UIXA 2R9SA 4O27B 2B53A 2R3HA 3LCTA 4YTIA 5CSPA 4MYGA 4D2WA 5L2WA 1JNKA 2BDWA 3F2NA 4R8QA 1B6CB 2YCFA 5FBNC 1JQHA 3VUHA 5AUXA 3W2PA 3G9LX 3T3UA 1CMKE 2YDIA 4EKLA 2XK7A 3SGCA 1MRYA 2C68A 5FP6A 5LWMA 1RW8A 4BCPA 5CX9A 2OWBA 3TV7A 2WKMA 2Z7RA 3E88A 3QWJA 4BY9E 4U43A 2GTNA 5IUHA 2R3NA 2Y6MA 4L7SA 3UP2A 3RAKA 2PVRA 3FHIA 4ZMFA 4ZLYA 1R0EA 5KMMA 3C4ZA 4Y85A 3N4UA 3BE2A 4M69A 4O81A 1ZLTA 2UZOA 3U54A 3R7UA 1UU8A 2HXQA 2W05A 3RP9A 4O0VA 5EI8A 5FRIA 4MWHA 4GYGA 3TDWA 1UNGA 1DS5A 2HYYA 3QLGA 1RQQA 4D4VA 3NUAA 4YJVA 2B7AA 3NNWA 4I5PA 4CMTA 3L8PA 4OTGA 4IVCA 5B7VA 4EK6A 4EWQA 2QOLA 3E3PA 2O0UA 4W4XA 5DN3A 4EHEA 1OPJA 1Q3DA 2YCQA 2I0EA 4MXXA 4UXLA 4CVAA 4FSQA 5CF5A 4OT6A 3D5UA 1V1KA 3EQRA 5HICA 3FXWA 5CNNA 3IK3A 3R1NA 5DR2A 1YWVA 3GC9A 4R3CA 3MFTA 2JKMA 3TACA 2VAGA 2ZDUA 3MS9A 2QVSE 3BYOA 4L3LA 3W2QA 3R63A 1KOBA 5KE0A 2Z7SA 4AXAA 4O1PA 4RIWB 3E62A 4NCTC 2I40A 2WQEA 3DB6A 5BYLA 5DE2A 3PA3A 5HVJA 4O0UA 3LFDA 5J79A 4F1OA 3FXZA 2PE0A 3MIAA 5HX6A 4PRJA 5FM2A 3FKNA 5BVDA 2ERZE 5DEYA 2W1CA 1IA9A 3PPKA 3H0ZA 5F9EA 1BUHA 1YHWA 2OJ9A 3GCUA 3AC8A 3O8PA 3OMVA 3UO6A 4TKSA 4EYMA 3VUDA 4TNDA 5KCVA 5M57A 4B6LA 4YBKA 4BIEA 5HX8A 5LMAA 4AA4A 4GU9A 3NNXA 4MXCA 4FIIA 3ROYA 5DBXA 2OG8A 2CLQA 2YERA 5LXMA 3TIYA 5HO7A 5FTOA 4ASEA 2PPQA 4ZTLA 2QURA 4PDOA 3SC1A 3VS3A 3E8EA 2PHKA 4RWJA 4U7ZA 2XNBA 4DFNA 1ZMWA 3I7CA 3Q9YA 2WIPA 3LM5A 3WE4A 2HXLA 4JDHA 1OPKA 1RE8A 4JR7A 2DQ7X 2VWIA 2VO7A 5H3QA 2XZSA 5KMKA 2HZIA 4ZTMA 1BYGA 5HESA 3W8LA 4R1VA 3R0TA 2WNTA 1J7UA 5ANEA 3ANRA 5FP5A 3GOPA 4O7VA 3C4XA 4QMYA 4RMZA 5EDPA 4EYJA 5C26A 2CNQA 3CPCA 3Q9WA 2XIYA 3POOA 3ZO2A 1KOAA 3PXZA 4RJ6A 4BTFA 1A48A 5FGKA 5EHOA 5H8BA 3PJCA 3UOKA 4PTEA 3MA6A 4JLCA 4LQMA 4MD7E 1KE5A 3HZTA 4OTFA 3RPYA 2Z60A 2YFXA 5AJQA 2Q0NA 4GVAA 3MTLA 2GHGA 2QCSA 4TY1A 3LMGA 5CSHA 2EXMA 2YM6A 3EZVA 4XH6A 2CKOA 4EI4A 5DLSA 4TL0A 5AV3A 3RTPA 4ZZOA 3PXYA 2FSTX 3NAYA 4WO5A 3MVJA 3RWQA 3QD4A 3I5NA 3RAWA 2F57A 4FSUA 4L00A 2Z2WA 3DA6A 3KKVA 4YZDA 4F6SA 5KHXA 3C5IA 1UV5A 4WUNA 1W82A 4EOJA 2X1NA 4ACMA 1XH4A 4FSMA 1H28A 4R3RA 5IQIA 5ETAA 3QX4A 4FTQA 3ZFXA 1Q8UA 3LQ5A 2E9VA 2Y4IB 3TZMA 4DEBA 4MKCA 3LLAA 1PMEA 3GBZA 4LV5A 1H07A 3RHKA 5CEOA 1I44A 3UYSA 4F63A 4FKVA 3U6JA 2J7TA 4GL9A 3LHJA 4P90A 3EN6A 4O7TA 4HOKA 5FG8A 2VGOA 3HEGA 4XG8A 5LVPA 2VTQA 4FTMA 1TVOA 3GQIA 5H8EA 3M2WA 2BAKA 3QD3A 4G2FA 4JDIA 4NTSA 2Q83A 4AZWA 4H39A 2YM7A 1WBSA 4UALA 5E8VA 3IO7A 4UY9A 4FTLA 5L6OA 3POZA 4FG9A 5AP7A 4C33A 2B52A 5ANIA 2OLCA 1Q41A 1H25A 4QTDA 2PULA 5HNBA 4EHVA 1J1BA 1JKTA 3FMJA 5LMKA 4K2RA 4FEXA 3AD4A 3CY3A 2HK5A 3PY0A 3RPRA 4F9YA 4O1OA 3M11A 1WZYA 3OBJA 1JAMA 1H0VA 3C7QA 4R7BA 4YC6A 3JY9A 4FKLA 4EH2A 3E3BX 2JIUA 3AMAA 3VBQA 3RKBA 3H10A 3GT8A 2F7XE 4L3PA 4QMMA 4ORKA 2J51A 4UYNA 4ZTSA 4RIOA 3V8WA 4WRGA 4Z16A 1O6YA 1XWSA 4YUQA 1H08A 4ACHA 2J0MB 4U81A 2VTPA 3MB7A 4PUZA 3I79A 1PXLA 2EB2A 3OW4A 4QPMA 4MQ2A 3HA8A 3EL7A 4HJOA 1XQZA 5FEEA 1H24A 2X7OA 3OOMA 2V55A 3NYVA 4ZZNA 4QMWA 5K5NA 2VX1A 3FKLA 5EW8A 4W9XA 2YJRA 1Q8WA 3CQEA 4HZRA 3QQHA 4I5CA 3TNWA 2PVYA 4XMOA 5CU3A 4EH5A 4EWHA 4O7ZA 4DGMA 1YVJA 2PUUA 4QMXA 4IWOA 3AT4A 3SW4A 3FLSA 5M56A 4CQGA 2OIBA 2B54A 3QTXA 3ZFMA 1RJBA 1NY3A 1W7HA 2ZV9A 2VTLA 3IS5A 4FC0A 2JKKA 4K77A 5BUEA 3ZLSA 5CU2A 1ZYJA 3ALNA 2X0GA 1W84A 4KIQA 2P2HA 4FZ6A 5EQPA 1M7QA 3HRCA 4RRVA 1J7IA 3D2KA 5AP6A 5HCXA 3KXMA 3BEGA 3ZS5A 5I9VA 3C1XA 1YRPA 1U46A 4ZS0A 5G1XA 4BI0A 3P9JA 4GFOA 4P5ZA 4PDPA 3ORMA 1ZY5A 4FNZA 5KMLA 1YXUA 3QZGA 4EUUA 4EQUA 2XB7A 2V0DA 1XH6A 5L6WL 4E4XA 2DS1A 4JAJA 3VWAA 3CTQA 5L4QA 3DXPA 4FTRA 3E8NA 3LMIA 4GH2A 2YIRA 3U8WA 3ORIA 4M0YA 4WNMA 4RIXA 4CFXA 4ZSEA 4CTBA 3G33A 5JQ8A 5IEXA 2XK9A 1Q8ZA 4FTKA 2VN9A 4XJ0A 5ANGA 4YU2A 2YM8A 2OXDA 5HCYA 4F7LA 2C69A 4KNBA 4CRLA 4I92A 4BCNA 4FA2A 4L6QA 4I0TA 3SOCA 1FMOE 4J53A 4FGBA 3I6UA 2J0KA 1ZZ2A 4ANSA 1U59A 3B8RA 4IIRA 1P5EA 5BYYA 2C0IA 3DLSA 2HZ0A 2ITZA 3NSZA 4G5PA 4GT3A 4FK3A 4OUCA 4FV9A 3G0FA 4RVTA 4AN9A 3QUPA 4BKYA 4NM3A 1R1WA 4E73A 5M44A 4FGRA 3BCEA 3H30A 2BZJA 4PTCA 3QWKA 5KO1A 4M84A 4HCVA 5ANKA 2OH0E 3EN9A 4FSWA 5K5XA 3IKAA 3C51A 4WBBB 4JVGA 5AP3A 5C03A 2PYWA 3R00A 2C6KA 3E63A 4JIAA 3NZ0A 2XS0A 4FVPA 4IZ5A 4DEAA 3C50A 2CHLA 3SAYA 1FVVA 2YCSA 3HUBA 5AAEA 4NKAA 1NVSA 4ENYA 3TDVA 4EH6A 2PL0A 2O8YA 3DAJA 2YIYA 3MFRA 5EFQA 2PVFA 2Y6OA 2JBPA 2X8DA 3EWHA 4R5SA 5EDQA 3ZZWA 5BMSA 4JXFA 5J5TA 3JXWA 3PLSA 1UKIA 1OKZA 2ITUA 3AD6A 3D14A 4UV0A 4GU6A 3V8SA 3W2CA 5FD2A 2OW3A 2CCHA 4RWKA 4QQTA 2GNGA 3DQWA 1YWRA 5ANOA 5KX8A 3WZKA 3KRRA 3SD0A 3ODZX 4AA0A 1GY3A 5EM5A 4K9YA 3PVWA 5DT0A 4G3CA 5CS6A 2YISA 4V0GA 3VS4A 3F3VA 3V6RA 5JMSA 3A7GA 4B7TA 4C36A 1L8TA 4YJNA 2YA9A 5HVYA 4NJ3A 3NR9A 4MTAA 2UW4A 1Q3WA 2CGUA 3VBTA 4DT9A 2PVJA 2UVXA 5IH5A 2QO9A 4BDFA 4FNWA 4F7NA 4IC8A 5CSXA 2P33A 1FINA 3EN4A 3W2SA 5IA2A 4HZSA 3FYKX 4QP9A 5JN2A 4LL0A 3A99A 4J71A 3FY0A 4MXOA 2GSFA 4NM7A 5AP5A 4XG7A 1O6KA 3NLBA 4J97A 3RMFA 4XG3A 4ANOA 4W8EA 1YHVA 1M2RA 2BZKB 2C6IA 1JLUE 5BX0A 3F66A 2XNOA 3NCZA 5LOHA 3LPBA 3AGMA 5CI7A 4DG0E 4EQMA 3EQDA 1BL7A 4CCUA 3SOAA 2FUMA 2XYUA 4FSZA 3WZUA 5JEBA 4HW7A 5E92A 3JUHA 3S95A 3NYNA 4BIDA 3MVHA 1OKYA 1SZMA 4XBUA 2A19B 5IEVA 4XV9A 3VN9A 3HNGA 4K0YA 1FVRA 3NUUA 1IASA 3R04A 4O7RA 3BZ3A 4BBFA 2ITNA 1XBBA 5DEWA 4E6DA 3FV8A 2GQRA 3AC1A 3UPZA 3HDNA 2FVDA 1ZOEA 4MD8E 4CEGA 3PZEA 1ZXEA 3BRBA 3Q2MA 4PP9A 3FSFA 4XV2A 2OXYA 3V5QA 2YM3A 3HDMA 4H1MA 3ZH8A 4GUEA 1DAWA 2YAKA 3RJCA 2B9HA 5FDPA 4BDDA 4IMYA 4CD0A 3CS9A 3K2LA 2QOHA 4M14A 3MI9A 1W98A 4MHAA 3UODA 3WARA 2R7BA 3ROCA 4GJ2A 4EOLA 2X8EA 4CFWA 2Z7LA 2YAAA 3AC3A 3PIYA
chains in the Genus database with same CATH superfamily
3Q6UA 5AP2A 2VTOA 4DCEA 4DGLC 3KXZA 2IO6A 4GKIA 3QGYA 4KINA 4ZY5A 3DK6A 4KA3A 4D5HA 2WMTA 1ZYLA 3ZHPC 4NH1A 4O2ZA 4UMQA 3UC3A 2C5XA 5JSMA 2HELA 4IAZA 4ZTNA 3OBGA 3OG7A 4BDKA 3E7OA 3BU6A 4UB7A 4LOPA 4FOBA 4HGLA 1SVGA 5TT7A 4EJNA 4C2VA 4UBAA 4EK3A 2C6MA 3HL7A 4FV5A 3ZCLA 3D2IA 2OF4A 4BDIA 5GJGA 5L3AA 4C8BA 4QP7A 4E7WA 4C7TA 3G0EA 4IFGA 4FK6A 4BCOA 2OO8X 2XF0A 2I0VA 3UTOA 3AGLA 4A7CA 4L67A 2QI8A 4ANQA 4ZJIA 4BGQA 1QPJA 3O0GA 5CASA 1PKDA 3PRIA 2UW3A 3Q4UA 4ASZA 5DYJA 5LWNA 3CE3A 4EH8A 2I0YA 4HVHA 2B4SB 3CSVA 1XO2B 4TYIA 4FTUA 4E6QA 4OGRA 2PUIA 4YTHA 2J0LA 5IH6A 2E2BA 4UXQA 3MSSA 5DIAA 2XJ0A 4RJ5A 4GT4A 4RIWA 4NWMA 4BCJA 3WF9A 4FKOA 3K5UA 5AP0A 3R7IA 4IBMA 3L9MA 3ZLXA 2JDVA 4L7FA 2I7QA 1PRYA 3LXNA 4UN0C 3NAXA 3QZHA 2DYLA 3FC2A 2QOFA 2VO6A 4NU1A 3TV6A 3W2RA 4R77A 3E8DA 5AP1A 2IWIA 2P4IA 2XVDA 3O23A 3WI6A 4DC2A 1FGIA 3A2CA 3TL8A 3SLSA 3VJNA 3V5PA 2VWVA 4XG2A 3TNHA 1URWA 3PZHA 5ANDA 5L2SA 4EOQA 2HW7A 3I0OA 2BAJA 3PG1A 5HG8A 3FMDA 4KSPA 5CEQA 3S1HA 4OTDA 3ACKA 1H1PA 3KULB 3ORPA 1ZY4A 4FV6A 4RX7A 4BI2A 5K0XA 2UW9A 5HO8A 3MPTA 4FZAB 1QL6A 2GS2A 4NKSA 3VW6A 3BYSA 2VTRA 2CGVA 5KKRB 2WELA 4FTIA 4IDTA 5HCZA 2XEZA 4GRBA 3W2OA 3NUPA 4E8AA 3A8WA 4D1XA 1GIHA 3WYYA 4BWPA 3MPAA 2PMOX 3OY3A 5IMEA 5A4EA 3ZO4A 4YLKA 5ICPA 2GNLA 4ZLZA 4F08A 3FMKA 2E9NA 3QRIA 5HU9A 4S31A 2OZAB 1YOMA 2ITOA 3S3IA 3MH2A 3OTUA 3QKMA 4AXFA 3ZDIA 3O5AA 4ERWA 3G6GA 3AD5A 4IB5A 2X7FA 3OROA 4BKZA 3IPHA 2A0CX 2QOOA 4EEVA 2C5YA 1ND4A 4CNHA 4FIFA 4AQKA 1OIRA 2JFLA 3NUSA 5J9ZA 2BKZA 3QL8A 1JSTA 1BX6A 5HIEA 3WIGA 4K18A 4EZ3A 1NVRA 3QQJA 3U51A 3V3VA 5GHVA 4I41A 3WILA 4RFYA 5EYCA 3L9NA 2PTKA 4DH1A 1YOJA 3P4KA 2VU3A 4NFNA 5J5SA 2C5NA 3I1AA 1YKRA 1GNGA 1Y6BA 4L8MA 1STCE 2QU6A 1MUOA 2W5AA 4QMUA 4QMTA 2VTIA 3SA0A 3HMNA 4GS6A 1S9JA 2PWLA 3EQBA 3UJGA 4YPDA 4XG4A 4DAWA 2UZUE 4AN2A 3BV2A 3LQ3A 4G16A 4D58A 3EYHA 3O8UA 4XCUA 2V5QA 4I4EA 1XH5A 2XUUA 2ZM1A 2RFNA 2QOCA 5M4FA 5FLFA 1AGWA 4EH4A 2UW5A 4FV4A 3TKIA 5HTIA 3QBNA 2W9FB 2VTSA 5CVGA 2C1AA 5LJJA 1SNUA 4EQCA 3I6WA 3PYYA 3LAUA 4KBCA 3IW7A 2W96B 3RAHA 2R3OA 2B1PA 3DTCA 4IVDA 3UDTA 4V0GB 3AC4A 4YJSA 3WF5A 5DVRA 3MESA 4A9SA 3L1SA 3TWJA 3FLYA 3BX5A 4AF3A 1MRVA 4JNWA 3TNIA 5F95A 3ZTXA 4QTAA 2YLEA 4G17A 1M14A 3CTJA 2VRXA 4WUAA 3V6SA 1FQ1B 5JT2A 4YHJA 4O7YA 4D4RA 2WMVA 4IX4A 3HGKA 5DFPA 4GIHA 4RBLA 3F69A 4LOQA 1Q5KA 5HTBA 1PXMA 1JPAA 2JDSA 2PVNA 3LCSA 4BTJA 3EN5A 5IMXA 3E5AA 3JVSA 2GHLA 3IONA 3ORNA 4FNYA 4TWNA 4CZYB 2RFEA 2XH5A 4TTHB 3SKCA 4ZS4A 1XH8A 2Y8OA 4BL1A 4CZUA 3LE6A 3EQPA 3OC1A 1WAKA 3U9CA 1H00A 3BL9A 3FUPA 2JDRA 4I1ZA 4N6YA 2EUFB 3A60A 4G5JA 5J87A 2QOQA 5CENA 4DG3E 3UBDA 2RSVA 5GJFA 4NZWB 4QTEA 2R3MA 4CMUA 5L2QA 2ETKA 3UOLA 3A62A 3KIOC 4KKHA 4PDSA 5E8YA 5I9XA 4MWIA 1PXOA 4FT7A 4U97A 2FO0A 3IW4A 3ETAA 4L3JA 4CKRA 1K2PA 3CPBA 3DAEA 4RC2A 3MJ2A 4FUYA 3ZOSA 4FZ7A 4AU8A 3UYTA 2YN8A 4C38A 1ZOGA 3L8SA 4GK2A 4IJPA 5CNOA 3O50A 1VYZA 4FT0A 4FEUA 3W8QA 5BNJA 3QC4A 3E8CA 4F65A 2O3PA 3II5A 2XKFA 2ZFYA 2ZMCA 2JLDA 4QYFA 3ZUVA 3AC5A 3DDPA 5KHWA 2OGVA 2YCRA 3QGWA 4QQJA 4DH3A 2WFYA 4IB0A 4OTHA 3BYUA 4GFGA 5HU3A 4MH7A 3HLLA 3S0OA 2ZV8A 3LFQA 4YC8A 5JGAA 3PXRA 3B2TA 3MN3A 3FMNA 4J1RA 2KTYA 3SQQA 5EM7A 1U54A 4WOVA 3PWYA 4MF1A 1LEWA 1NA7A 3A8XA 4EC9A 4FKUA 3PRFA 5AR4A 2R5TA 3MV5A 4QMPA 3I0QA 2X7GA 2OBJA 4JQ8A 2YHVA 4E6AA 5KMNA 1PKGA 2ITPA 3EQHA 4FTOA 4D4YA 2ITTA 1VJYA 3R7OA 1K9AA 1KE8A 3CTHA 1YXVA 5FWKK 3GNIB 1OIYA 4HGEA 2VWXA 4JBQA 3UGCA 3CCNA 2NP8A 4FI1A 4AN3A 3ZXTA 4ANBA 3SXSA 1V0BA 2QD9A 4WA9A 2YM5A 4X3FB 3WF6A 4BYIA 4C02A 3MY1A 3G5DA 1QCFA 4TN6A 4IDVA 3WZJA 3S00A 4EC8A 1TQMA 2G2FA 3W0OA 4L9IA 4I0SA 4O7VA 2ZDTA 4IHPA 3QLFA 2VV9A 1E1XA 3F6XA 4ALUA 4DN5A 3ZONA 5CVFA 4EOOA 4QMNA 2YWVA 4EH3A 3FQEA 3V5WA 5JFWA 4BCQA 3DBFA 3KB7A 1Q8YA 2BFXA 3GB2A 3ZEPA 3CY2A 4FYOA 1IAJA 2UZVA 3F9NA 2WTVA 5E7RA 4FV8A 2AYPA 1OM1A 2O64A 2XP2A 2WEVA 4FTCA 4O0SA 4DBXA 2HOGA 1SVEA 3A4OX 3D15A 4AT4A 1XMLA 4U42A 2RFDA 2BZIB 3O7LB 2X2MA 3QCYA 4Y83A 3LFCA 3PA4A 3QRTA 3Q2JA 2EU9A 4IWQA 4FKTA 3VUMA 3FZ1A 2QO7A 5D41A 3TV4A 2ONLA 2ACXA 3HMPA 3PA5A 2QNJA 4XP0A 3PDTA 4EH9A 3KVXA 3LXPA 4BCIA 2YEXA 4QMOA 5JZNA 4AZFA 4BN1A 4MAOA 3K54A 2XKCA 4JX3A 5DR6A 2HAKA 5CZIA 2CMWA 5A4CA 3SXFA 3FC1X 5AA8A 5CLPA 2IVSA 5JRQA 3HV7A 4YLLA 1ZYDA 1XKKA 4DFUA 4D2RA 3FI2A 4AUAA 3KXGA 3UVRA 3R21A 2PU8A 2XIRA 3QXOA 2ITWA 3AQVA 3BU3A 5IUGA 5A4QA 4DFBA 1SYKA 1HCKA 5E8SA 4AACA 3IW8A 4MX9A 4YGAA 1KE7A 1JKSA 2R3LA 2V7OA 2WIHA 3BE9A 4GK3A 3WZDA 3C4EA 3IGOA 3CR0A 2PMIA 1XBCA 3ZO1A 3UZRA 4O7WA 4DDGA 2VWZA 3THBA 4AW1A 4UMUA 1G8AA 4FODA 1R39A 4PMSA 1CTPE 4C2WA 2W17A 5AP4A 4FEWA 4QT1A 2BRBA 3DBEA 3PG3A 3TNPC 5LVNA 1OB3A 1YXXA 1QPDA 3UOHA 4APPA 4EHZA 3DJ6A 3HRBA 4ANNA 2CN5A 5AR5A 2ZB0A 3F5GA 1OIQA 4UMPA 4RVLA 1U5QA 4DEIA 3UQGA 2YDKA 3NCGA 3FQSA 4G9RA 4FTAA 4LI5A 3G2FA 3RGFA 4Z55A 2GS7A 2ZMDA 4U3YA 3AMYA 4XUFA 3OCBA 4IVBA 4X6QC 4F99A 2JDTA 3HAVA 1GJOA 1U5RA 3KMWA 3O7LD 4JT3A 3ID6C 2W1ZA 3NPCA 4OAUC 4OTIA 3NS9A 4O0WA 2BILB 4QPSA 4E4NA 4U3ZA 3W16A 4F09A 3ITZA 5F4NA 5A54A 4QYYA 2H9VA 5BV3A 3MFUA 4RLLA 3RCDA 4C3PA 3DFAA 4XYFA 1GIIA 2WOTA 3TTIA 4C3FA 5EI2A 2IZUA 3BBTB 2O65A 4YTCA 4RWIA 3PJ3A 3FYJX 2R3GA 4M15A 4U45A 4KAOA 4L46A 3CD3A 4CFUA 4YJTA 2X81A 4A4LA 2ITVA 4LYNA 3FMMA 3R01A 3ZBXA 4MEDA 2JEDA 3LQ8A 3UG1A 4C34A 3FI4A 2C6LA 4G3GA 4K11A 4X6RA 5DA3A 5C27A 3HAMA 3SG8A 3KRWA 1LPUA 4OTRA 3QKKA 3IW5A 4A06A 3H3CA 2WMRA 2XEYA 4M97A 3QU0A 3N9XA 4C59A 4G9CA 5CY3A 4EORA 3CKWA 4B0GA 2E9OA 3OS3A 1W83A 4H58A 5CYIA 3PJ2A 1VEBA 2X2LA 3ZYAA 3VF9A 4AZEA 4CFFA 4PP7A 4IZYA 3DJ7A 5JFXA 4QP4A 3H0YA 5AUVA 3ZU7A 2A1AB 4IM2A 5J95A 3R8ZA 4I3ZA 2VGPA 1B38A 1FMKA 4FICA 1PXNA 3FZPA 3GCQA 4KIKB 3RALA 4EBWA 5C8KA 4U44A 2GPHA 5C8MA 3CP9A 2XBJA 4MBLA 4DGGA 5IQBA 1ERKA 1KUTA 3UIMA 2VX0A 4FUXA 5HE1A 3SV0A 4D2PA 3GCPA 4O4DA 2J90A 1F3MC 4RA5A 4BBMA 2B9JA 2NPQA 2PK9A 4GG7A 3PP0A 3HA6A 4XNEA 3ZRLA 4NJDA 4F1MA 4AGDA 1U4DA 3QF9A 4QYEA 1WBTA 3DBCA 2XRUA 2BVAA 4UYAA 4ZOGA 4XV3A 1Y8YA 1IRKA 5E8UA 1H27A 1YW2A 4WIHA 2CNUA 3A7IA 3PY3A 4WKQA 4ZK5A 4LMUA 1R0PA 3FMHA 4Y73A 4YNOA 2W06A 2GS6A 5I4NA 3UC4A 1IR3A 4XP2A 3GC8A 1OUYA 3QHWA 1REJA 5LVMA 4DCAA 3NNUA 5J7BA 4FKRA 4U80A 3LVPA 2WAJA 1EH4A 4BCGA 4BIBA 2NYAA 2PVKA 2PUPA 3G51A 4FKWA 2FA2A 3D7ZA 4NW6A 4D1SA 4O38A 3V5TA 4IB1A 5EM6A 4NSTA 3RPOA 3SW7A 1NVQA 2UZNA 4RJ4A 4RGJA 4PMMA 2IW8A 4DH8A 5CALA 3KULA 3QAME 2OJJA 4F6UA 4UMRA 2IW9A 4BR3A 3OW3A 4FKIA 5DT3A 4ID7A 2ZV2A 4C4GA 5A4TA 4Q9ZA 4FSRA 2FYSA 2P0CA 1Z5MA 3MBLA 2VNWA 2WXVA 3BWFA 4XBRA 3TUDA 5HBJA 3F5UA 4TW9A 2GFSA 3QTRA 4UZDA 5DH3A 3S2PA 3V5LA 1CKIA 3TYKA 3KQ7A 1ZZLA 3KRXA 1J1CA 4O96A 5KBRA 3DZOA 2J0IA 5E91A 5A6OA 5CANA 5J1VA 5EQEA 2OZAA 3QTQA 1U54B 3BIZA 3F88A 3F3WA 2F7ZE 1ZARA 5AADA 5TKDA 3FSKA 5CU0A 3HRFA 2CGWA 2IJMA 2WTKB 3D5VA 3Q04A 4XRLA 3OHTA 2VTNA 5AR8A 2J4ZA 4DLJA 1AD5A 3FJQE 3LZBA 5EQYA 5GJDA 2W1IA 2WTDA 3N51A 4MQ1A 4WG5A 3KXNA 3QZFA 5LARA 4BI1A 4O7NA 2QO2A 2GMXA 2A4LA 4EUTA 3R7GA 3IW6A 3FZTA 4KRDA 4M13A 3ATTA 2PE1A 3QQGA 3P7BA 3FLQA 4X0MA 5IQEA 2WMBA 2WU7A 3AT2A 4ZAUA 2QQ7A 2RKUA 3RK5A 4RC3A 4QYGA 3EB0A 1ZMUA 1YQJA 5AV2A 4YZMA 4KSQA 4GK4A 4U8ZA 4TNBA 4I5MA 2WTIA 1V0PA 3FLNC 3DPKA 2R3JA 3FPMA 5AMNA 3TN8A 2EWAA 1P4FA 3PE2A 3W33A 3TM0A 1W2FA 2XK8A 5AX3A 3BLHA 1DAYA 4IQ6A 3CXWA 5CQWA 5GZ9A 5M06A 2IF8A 2BRHA 2Y4PA 4Q9SA 1ZOHA 3VBXA 1OIUA 4XRJA 2DUVA 1PW2A 3TI1A 4CT1A 4Y5QA 2ZAZA 3O96A 4Q5HA 3V8TA 3OFMA 4RT7A 5M4IA 4DA5A 2G2HA 2WEIA 3VRYA 4BHNA 3ET7A 3VQHA 3I4BA 3TCPA 4IEBA 4A9RA 4LGHA 2QONA 3W0MA 1KE9A 2B9IA 1L3RE 2FB8A 2JIVA 4CCBA 4ZEGA 3K3JA 2JAVA 3QXPA 5EM8A 5HNGA 1Q8TA 2WO6A 3UO4A 4A4XA 3KGAA 5HLWA 2C6EA 4QNYA 5AR3A 1QPCA 2OKRA 3VJOA 2H34A 4Z7HA 4AGCA 1CKPA 2AC5A 4FTTA 5C9CA 3Q53A 4F70A 4H3PA 2W1DA 5D7AA 2C47A 5CEIA 2QKRA 5FEQA 4BBEA 2BTRA 1MRUA 4GMYA 4IAYA 4BDEA 4BTKA 3DBDA 3D4QA 3VW8A 3F5XA 2PVHA 1A06A 2W4JA 4FYNA 4V01A 4EZ7A 3OXZA 4UWYA 5L2IA 5LMKC 5FQDC 2Y0AA 2QG7A 5TO8A 2JITA 4IZAA 3R8LA 3EN7A 3ELJA 3VHEA 3ALOA 3I81A 2XJ1A 4ZZMA 5CQUA 2R3RA 2NO3A 1I09A 3VQUA 4JJRA 3MPMA 1M52A 2BUJA 5AUWA 4LRKA 4R6VA 4X21A 4YZCA 3W55A 4E5WA 4USFA 1IAHA 4QP3A 1DI9A 4FKPA 5C01A 3KFAA 4JX7A 4HYSA 4A9YA 4ZTQA 3RZFA 4BDJA 4ZLOA 4HVGA 4AGUA 4PNIA 4S34A 5EHYA 2ZJWA 4DEGA 2HWPA 4IACA 2ETMA 4CYIA 4EONA 4PNKA 4OTWA 4PMTA 2B0QA 1JSUA 4B8LA 2UW0A 1GIJA 4AE6A 3DZQA 4I23A 4IB3A 5DRBA 3GVUA 3SHEA 5LMBA 3DBQA 4DINA 4JS8A 5JK3A 5L8LA 2SRCA 1OGUA 2QOBA 1S9IA 4H3QA 4L52A 5K4JA 2BRGA 4QP8A 4PX6A 2ITYA 1WBOA 4J7BA 5BVNA 1PXJA 3CIKA 3I7BA 2G01A 3O2MA 2R3IA 4CQEA 2XJ2A 2R2PA 2QHMA 3GCSA 4L44A 4UZHA 4EOKA 3DKCA 3LLTA 3UVQA 2CSNA 1BI8A 3Q4ZA 4L53A 3NX8A 4LFIA 2Z02A 2CKEA 1UU3A 3DK3A 2X6EA 1H0WA 5IEYA 1QPEA 5FDXA 3H4JA 2BKKA 5CAQA 4LGDA 3GU8A 5KKRC 4RZVA 3PSDA 5GZ8A 2O5KA 3KVWA 5AIRA 3ZXZA 1RDQE 2F9GA 2JD5A 4EJ7A 4HVDA 4OTPA 2J9MA 4C58A 3ZUTA 4IADA 4E93A 3SRVB 2R7IA 4FT3A 3CGOA 3ULZA 4A4OA 2OJGA 3EJ1A 4ZSGA 3VAPA 4Y72A 4HPUE 3C5UA 3MVLA 5C8NA 3W0PA 1YDRE 2JIIA 3TJCA 4XS2A 1BKXA 2VTHA 4BFMA 3UZTA 1YHSA 3EIDA 2A98A 3OP5A 4MXAA 4NIFB 1R78A 2G1TA 3ULIA 3EKNA 4GW8A 3RCJA 2ZOQA 4X3FA 2XAMA 4KS8A 2C6DA 4QMZA 1WCCA 5ETIA 3R22A 4HNIA 4D2SA 1ST4A 2VZ6A 1O9UA 4G6OA 3KN5A 3BLRA 2X4FA 2PVMA 1PYXA 4PL4A 2OF2A 4C4IA 3DY7A 4CV9A 2GHMA 3EQCA 2OZOA 3U55A 4GJ3A 4PPBA 1B39A 2RIOA 2Z7QA 3Q9XA 4D2VA 4BB4A 4M67A 2XAOA 3QYWA 4ZTRA 4KB8A 2VTTA 4PL3A 3W0SA 3DXNA 3DOGA 3BGZA 3E93A 3R8MA 3OUKA 4RJ8A 2OFVA 3C0IA 4L43A 4ITIA 3UMXA 4AZSA 4FL3A 5IQCA 1WBNA 4ALWA 1XMMA 3AXWA 3BBWA 2JC6A 3FHRA 1ZWSA 2H96A 4X2JA 1H1WA 3P5JC 4LGGA 3NYXA 3TJDA 3KRLA 5IA3A 5HG5A 3W0NA 3UG2A 3P86A 5HI2A 2KULA 3UMWA 4O2PA 3R1QA 3FDNA 3GU7A 5JRSA 5A9UA 4I94A 5EDRA 4C4JA 4M3QA 5I9ZA 2W1FA 2Z8CA 2OXXA 3WBLA 5B2LA 2BPMA 5LQFA 3DCVA 4NW5A 5AWMA 2CJMA 5ITAA 4RLKA 5EI6A 2PZIA 5IQDA 3VNTA 4Y5HA 4IAIA 4YZ9A 3E64A 4C57A 4O21A 1T46A 3NRMA 2UW6A 3BYVA 5M55A 4DH5A 2WQMA 4O91A 2QC6A 4O4FA 4J98A 3GI3A 2XM8A 3F61A 4PWNA 5KUPA 4P4CA 4KWPA 5LVOA 3HMOA 4MBIA 2WPAA 2YACA 4LM5A 2UUEA 5FM3A 4YSMA 3V04A 3EFJA 4QTBA 4S32A 3ODYX 3W1FA 4DH7A 3PFQA 5BUIA 4Z7GA 5E1EA 3GU6A 2ZM3A 4WNPA 3P79A 4I6BA 5HE0A 5K9IA 2IN6A 3AOXA 2VD5A 4ANMA 3MGYA 4JQEA 4G6NA 5HKMA 4GV1A 2B55A 3TIZA 3RNYA 2Y9QA 2Q0BA 4RZWA 2OU7A 4J8MA 5CEMA 5D10A 1Y6AA 3QQFA 5BQ0A 4DHZA 2UZLA 4FV7A 4PL5A 5HTCA 3BHUA 5KNJA 3CEKA 4JRNA 4RX9A 4DFXE 4FF8A 4EK4A 4L45A 5E4HA 4QMLA 3D94A 3OCTA 3FKOA 4V04A 4LV8A 5KBQA 4N57A 5HIBA 1MP8A 4TWCA 5IG1A 4JDJA 4B9DA 2J5EA 1WBWA 4PY1A 4FIHA 4TT7A 4MUQA 2LGCA 2F49A 3T9TA 3MH0A 4JMQA 3VC4A 2WMUA 5TR6A 3G15A 2C6TA 3FL5A 5HGIA 1BMKA 1PYEA 5DWRA 3AMBA 5K3YA 3UQFA 2WMSA 5CF8A 2WMWA 4AT5A 3HV4A 4PMPA 4PPCA 4TYEA 5HORA 3RM7A 3GOKA 1TKIA 5CAOA 4BC6A 3QTSA 4AFEA 1PMVA 2X9FA 4M12A 5AIKA 5DOSA 4C61A 3NW7A 4GUBA 4O7LA 5L8JA 4DYMA 3LFAA 5CVHA 2FGIA 4FTNA 4L01A 3N4TA 4E3CA 3PFYA 2XNMA 1MQ4A 4DEEA 3QTWA 4CMOA 5T68A 3VS6A 3OWPA 4LUDA 5E90A 3R9OA 2ETRA 3F2RA 3PUFC 5IQFA 5CZHA 4M7IA 5BVKA 1H4LA 4WRSA 3QQLA 2YITA 1ZRZA 3DLZA 4BRXA 1WVYA 3IGGA 4V05A 4CYJA 3OCGA 3DT1A 3SDJA 3ZM4A 3QTIA 4IFCA 2W1GA 4XLIA 3K3IA 3PIXA 4EOPA 4EZ5A 3R83A 3PY1A 4F7SA 4BF2A 5GZAA 3R8PA 4JOAA 3KF7A 4ZY6A 1JKKA 3RHXA 4DDIA 3QD2B 3CJFA 3LCDA 1PXKA 2R3PA 4NCTA 3KREA 1R3CA 3PLAE 5EYKA 2OK1A 3ZMMA 4J8NA 4DG2E 4O6EA 4KIKA 3C0GA 3DDQA 3PXFA 4LL5A 2BRMA 3R2BA 3FXXA 1WBVA 4D0WA 3MJ1A 2XCHA 4N0SA 2PMNX 3ORLA 4E5AX 3UVPA 3GENA 3MYGA 4E1ZA 4ZSAA 2VWWA 4WNKA 5FTGA 2GNFA 3OZ6A 1TQIA 4IX5A 5KMOA 3F5PA 3EFKA 1GZOA 5JKGA 2YZLA 2WQNA 5A46A 4J52A 5CAUA 3EH9A 4RIYB 3EQFA 4NL0A 3BQRA 3QRUA 3DQXA 4FG7A 4O0RA 4X3JA 3IOKA 4WD5A 4OW8A 3MY5A 5HIDA 3BWJA 5IA5A 3U4WA 4IW0A 4FKGA 5I9YA 4E20A 5CF4A 4F1TA 4FKJA 3DNEA 1YI4A 3MH1A 3B2WA 3Q5ZA 3KEXA 4KBAA 4GSBA 2YJSA 4D5KA 1WVWA 3CJGA 3VUIA 1PMUA 3GU5A 5HEZA 2XNEA 4RC4A 3OF0A 4K1BA 1YDSE 4X7QA 3GFEA 3PSBA 4USDA 4MXZA 5EOLA 3BKBA 4N6ZA 4QQCA 4XHKB 4IH8A 4J96A 4OR5A 3KK9A 3D9VA 3Q96A 3VUGA 2IW6A 4U40A 1OMWA 4X2KA 5KZIA 4QTCA 2BROA 4JIKA 3UNZA 4EK8A 5CEKA 3WIKA 1ZYCA 2PSQA 1PF8A 3BELA 3I5ZA 4KD1A 2R3FA 4XG6A 4AWIA 1SNXA 2P2IA 2XIZA 3L9PA 4BDGA 3FWQA 4HCUA 4E6CA 3GEQA 4YHFA 3ZEWA 4XOZA 3ZRKA 3JR1A 4JBPA 5CI6A 4CKJA 3UPXA 2CDZA 2WQBA 5HE2A 3R8VA 4AW5A 2CKPA 5M08A 4PDYA 4NK9A 3T3VA 5AV1A 4H1JA 4F78A 3ZFYA 3VO3A 4CG8A 4RVKA 3FQHA 3OD6X 2HWOA 3TUBA 3RPVA 1OITA 4AX8A 5JFSA 3MIYA 3QX2A 2XK6A 3REPA 1OKVA 4RJ7A 1FVTA 4F0FA 4QDEA 4H3BA 1Q61A 1OL2A 4FT9A 4KUJA 5HO6A 3IDBA 4TYHA 4J95A 1TQPA 1F5QA 1LR4A 2X8IA 2OSCA 3QHRA 2VNYA 5AUYA 4ZTHA 2NRYA 5BMMA 3ZSGA 4I24A 4UX9A 3TEIA 4PV0A 4RSSA 3FEGA 1WVXA 3F2AA 3LIJA 3UE4A 3EL8A 3QRJA 3R9DA 4GIIA 4BDBA 4CTCA 3BPRA 4M8TA 3VBWA 3MH3A 4CT2A 3UNKA 1M2QA 4RX8A 3RAIA 3DNDA 4HGTA 3DFCB 3BYMA 3U87A 4YNEA 3BHTA 3QYZA 5CXHA 3CGFA 3UQCA 2F2CB 2HW6A 4MCVA 1QMZA 3D7TA 3C4FA 3DKFA 3FBVA 4FR4A 2QU5A 5AR7A 4QPAA 3ZDUA 2WZJA 5M07A 1YI3A 3NFFB 3Q6WA 1G8SA 2OIQA 2CN8A 4WHZA 5F20A 5IDPA 4P5QA 5IDNA 4RJ3A 2A2AA 3FI8A 4IZ7A 4FV0A 4I22A 4G31A 3VRZA 1NXKA 4ZJVA 3OXTA 3LJ0A 5EW3A 1JSVA 4JR3A 1XHAA 4MNFA 4E26A 2E9UA 3F7ZA 3JPVA 3NEWA 1JWHA 2E9PA 4IAFA 4KS7A 4APCA 3OCSA 3NNVA 5I5ZA 2WGJA 1F0QA 4RVMA 2Y4IC 5ACBC 2QR7A 3COMA 4WG3A 4MBJA 2XCKA 2J0JA 4IC7A 3BU5A 3PIZA 4NM0A 4BWXA 2IG7A 4ZY4A 3I60A 5IA4A 5E8XA 1CKJA 4O4BB 4YO4A 3VONA 2G9XA 2LAVA 4YO6A 2WMXA 3CQUA 1OBGA 1SVHA 3ORXA 5T3QA 2UZDA 4RWLA 3W18A 1P2AA 3QA0A 4FTJA 5FXQA 4ARKA 4DLIA 4DEDA 5I0BA 5L8KA 1KE6A 3HKOA 4RX5A 3AT3A 3C13A 4LDTA 3FE3A 4CKIA 4KIPA 3DGKA 1XR1A 3TT0A 2ERKA 4L42A 4M68A 5CSVA 3TZ8A 3PUPA 2FSOX 3ZSIA 3NUYA 4JG8A 4KABA 3FZSA 4TYJA 5FXSA 2QHNA 1JVPP 2OFUA 3KN6A 1XBAA 4R1YA 4FSTA 5AAFA 4PF4A 3RPSA 3QCSA 3COKA 3OT3A 3LFEA 2R4BA 4FKSA 4D28A 3JVRA 3V5JA 5A6NA 3HX4A 4BDHA 3NVKI 3HMIA 4QMVA 3NYOA 5A3XA 2BDJA 3MA3A 4WT6A 5CAPA 3F7WA 2PZRA 4IWDA 4FIJA 3BHHA 4GKHA 4AOIA 2GU8A 3JYAA 2RFSA 3N4VA 4ANLA 4FMQA 2XRWA 1IEPA 1YDTE 4AZVA