4ZZOA

Human erk2 in complex with an irreversible inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
345
structure length
339
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKDDLPKEKLKELIFEETARFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 1
publication title Structure-Guided Design of Highly Selective and Potent Covalent Inhibitors of Erk1/2.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 339
sequence length 345
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zzoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zzoA01
4M8TA 2HOGA 4QTEA 4BKZA 4EK8A 3L9NA 3BHTA 1AQ1A 2H34A 4RIYA 3S3IA 3KQ7A 3DZOA 2ITVA 2YHVA 1J7LA 1H8FA 4YJPA 3ZEPA 4DF3A 3FKLA 3QTRA 2J0IA 3WYYA 3DK3A 2XIKA 1ZYJA 5HE3A 3V5JA 3E88A 3BLRA 2GSFA 3WZDA 4BGHA 4OUCA 3O50A 2CNUA 1JOWB 1LEWA 5AV1A 3VBXA 3ZU7A 5HKMA 4QMOA 3UQCA 2WMWA 5JRQA 3CD3A 4EOPA 4CFNA 3O8UA 4K33A 2BDFA 3R7YA 2J0KA 1JPAA 2O64A 3PWDA 4JG8A 1JSVA 3TG1A 1OPLA 5J7HA 3K5VA 5GIPE 3F2NA 3RK7A 3TI1A 2ITUA 2KULA 3D83A 4CV8A 4S33A 3DQWA 5CLPA 2V7OA 5IMEA 4KBAA 4CLIA 4AX8A 4EOQA 5BVWA 1DAYA 1YXUA 3GP0A 3TKUA 1PMUA 4AZTA 3KU2A 4FV4A 3V5WA 1Q99A 5EOLA 5D9HA 3FXXA 4AWIA 4BL1A 4O81A 4DEIA 4ZTLA 5I3OA 2CKPA 3OF0A 2QCSA 5E8UA 4ZJVA 3GC9A 4EOJA 5AR2A 4MD8E 3QFVA 4O0UA 3BU5A 5KMMA 3HMOA 1YWRA 4NJDA 1KOBA 4E5AX 3L9LA 2VWIA 2W7XA 3EIDA 5F20A 3QTZA 4OT6A 3ZLXA 4HNIA 1EH4A 3SAYA 3ORNA 3V51A 5EKNA 3B8QA 4U79A 5LVPA 4MF0A 4KUJA 4I23A 3LMHA 3R1YA 4H39A 4DCAA 4FZAB 2YJRA 4S31A 3NNVA 5CSWA 4CG8A 1SZMA 4AF3A 3CTQA 3QTWA 4ANMA 1XBCA 3VBTA 3O51A 5E8YA 3ZSIA 2CKOA 2NRUA 3IDCA 4D1ZA 2UUEA 3IECA 4M12A 5IEVA 2R3FA 3GU4A 4EOIA 1REJA 3FI3A 4FTIA 3WF7A 3EN4A 4CTCA 1XBBA 4N6ZA 5AP1A 2CNQA 5HNGA 1H0VA 5L6OA 3PPJA 2YIRA 4J71A 4WIHA 3EZVA 5FRIA 4JDJA 3LFSA 3DCVA 2YM3A 3NNUA 1U59A 5TKDA 1ZYLA 5DR6A 5I9UA 5BMMA 2UZLA 4BCJA 2QOQA 4CMTA 3G6GA 4Y8DA 1MQBA 2HZNA 3SQQA 4YJNA 3GC7A 5JGBA 1OPKA 4QP9A 3HKOA 3ULZA 2QOLA 5IH4A 4U3ZA 4I41A 3VUIA 4CEGA 3POOA 4RJ8A 3EFLA 1OBDA 1J1BA 3ODYX 2OWBA 3LQ8A 3PA5A 5ETCA 2E2BA 3SXRA 4DEEA 3E93A 2W05A 3BYOA 3RGFA 3THBA 4QP6A 5J5TA 1YHVA 2WU7A 1OL1A 4UWBA 3PJ2A 3PYYA 4EZ3A 5LVNA 4S30A 5A4TA 3E8CA 3D4QA 4LQMA 2Z8CA 2Q0BA 3GCSA 3MN3A 4RQVA 1RW8A 5DPVA 4D0WA 4ANQA 2DUVA 3LFBA 4Y83A 4R5SA 2EU9A 3CC6A 3Q4UA 1RDQE 5HCZA 3NW7A 3SD0A 4ERKA 3JXWA 4XLIA 3ZH8A 3RHKA 2WFYA 4NZWB 3VS2A 3OY3A 2GS7A 4TZRA 2F7EE 2QODA 1OL5A 1KV1A 4IB3A 5FDXA 3OT8A 2WMXA 4MD7E 5M4FA 2BKZA 5H8BA 3ELJA 4TYHB 1IA9A 3ZBFA 1WBNA 2YN8A 3KXHA 4AT4A 2XIYA 3PJ8A 4GVJA 5A4QA 2ITTA 2R2PA 3E87A 3G51A 4PTCA 4I5HA 4OTDA 1M7QA 3UO5A 3F5UA 3PA3A 2WTDA 3A7HA 4O1OA 3RMFA 3QALE 3DNEA 3BGZA 4EOLA 2QHMA 4D55A 1R0PA 2PVLA 1U54A 3TJDA 3FKNA 4P5QA 2P2HA 2OW3A 5HEZA 4AZVA 2RF9A 5EHLA 4EZ7A 4PPAA 4GS6A 4ACMA 4CQEA 3E62A 4XBUA 1YXSA 4IHPA 1XH8A 4O7TA 4D4SA 2X6EA 2ACXA 4H3PA 3PXQA 2QU5A 4RJ4A 4E4XA 1LR4A 4GUBA 2BAJA 4YJRA 5HVKA 4ITIA 2H8HA 3R2YA 3S95A 3GQIA 4L46A 2ZV9A 3ZRLA 2VN9A 4QNAA 1GNGA 4FOCA 4KINA 3LVPA 3R83A 4NYEA 2YWPA 2QOIA 4GKHA 5KKRC 5KUPA 3VUKA 2VTRA 5LOHA 3PVWA 3ORTA 1UU8A 1ZWSA 3H3CA 4S2ZA 3ACKA 3W16A 2W1FA 4DINA 2CGXA 3O7LB 2BZKB 1GAGA 2F2UA 4GJ2A 5AUYA 2HXQA 3PY1A 4G34A 3P4KA 4FNYA 4D2RA 3ZC6A 1YDTE 3V8TA 4FSUA 4HW7A 2XNPA 3U4UA 2WTWA 2ITZA 3AC4A 4NKAA 5HHWA 3A60A 2PVMA 4BDEA 1UV5A 1V0PA 2Z7QA 5E90A 5I9YA 2GNGA 3L8VA 4QP8A 2F9GA 2W5HA 5C03A 4ENYA 5T6KA 4B8LA 3FYJX 5H2UA 2C0TA 4H05A 2QOOA 5JN2A 5CAPA 4M3QA 3CKXA 5CQWA 1GIJA 3TDWA 4MAOA 3GEQA 3SXFA 2OU7A 3DXNA 4CTBA 2V55A 4EONA 4NFMA 4YLLA 2XBJA 1ZYCA 4Q2AA 3C4CA 1U46A 2F2CB 3H4JA 2W99B 3II5A 3IPHA 5CAUA 2GCDA 4O0YA 4FG9A 4FIIA 3KXMA 4YMJA 3DB8A 4FE2A 4B6LA 1P4FA 2W06A 4I4EA 4QYYA 2OF4A 1OIUA 4ANBA 5GJFA 5IQEA 2I0EA 5DEWA 4BI2A 4PNKA 2G1TA 3BV3A 5BVNA 2B9FA 2VUWA 3O2MA 3BWJA 5EK7A 3HUBA 3AMBA 3R1NA 2XK4A 1VR2A 3BGPA 3PPKA 4JRNA 4TY1A 3NMUF 5HZNA 2YACA 3R8ZA 1O6KA 4U81A 3DXPA 4DA5A 2H6DA 2NNWB 5JH6A 3VS3A 3A7JA 3MVJA 5L6WL 1G8AA 2E9UA 3C13A 3I81A 4HYIA 4MCVA 5LWMA 2JIUA 2VWVA 2JIIA 2OZAA 5M06A 3F3TA 4CLJA 4CXAA 4B8MA 2WEIA 5FLFA 2VTOA 4XG8A 4BIEA 3QUPA 2BROA 1ND4A 4G2FA 3P23A 3DFAA 4EH7A 2O8YA 3EN7A 4QMMA 1ZZLA 2XK8A 4J95A 3FI4A 1X8BA 4FZDB 3ITZA 3EZRA 3UVPA 4E1ZA 3LFAA 1PF8A 3QA0A 2WXVA 4G6OA 3UQGA 2X81A 4I94A 3MFSA 4TRLA 3PIXA 3UNZA 3UIXA 5BUEA 5J9YA 3DAEA 4R3RA 3MFRA 3DA6A 4TYEA 4A9UA 3NPCA 3NZ0A 5EW8A 1OBGA 4YP8A 3NR9A 2CGWA 4U7ZA 3V5LA 4F0GA 3UZTA 1A9UA 1NXKA 3FHIA 3Q2MA 5EDQA 1DI9A 5KMJA 3F5XA 1FVTA 2WTKB 3N4VA 2BPMA 2G9XA 3O71A 4O27B 4CNHA 4ZS4A 3GOKA 5JFSA 1H08A 4FF8A 3RJCA 4GL9A 3FSKA 4K0YA 5BVEA 2YM5A 3D94A 2IVUA 3OCBA 3SKCA 3TT0A 4G5PA 4R3CA 4MBIA 3QRJA 3U6JA 3MPMA 4ENXA 5LMBA 2ZB0A 4L01A 2OXXA 3MDYA 3QKKA 4GK2A 4N0SA 4QTBA 4DEDA 1YW2A 1TQIA 4NIFB 4RIXB 5CT7A 3UVRA 4QYGA 3RM6A 4IAIA 5ETFA 3N4TA 2PE2A 3VQUA 3ANQA 3D15A 4ITJA 2JDOA 3N51A 4OTHA 2J50A 5A54A 4BZOA 4FG8A 5E7RA 3PZHA 3FQHA 3LLTA 3ATTA 1WMKA 2CDZA 2W1ZA 2ZV2A 3LXNA 4LGHA 4QP2A 5EYMA 5HESA 4D58A 3UBDA 4X2FA 3LJ2A 3GB2A 4HPTE 1CKJA 3OS3A 4FV1A 3H9FA 4O0XA 1YXVA 3QYZA 4C33A 1WBSA 1DS5A 3AOXA 3EFKA 4FT3A 4PL5A 3D9VA 3M11A 3LFDA 4CRLA 2F7ZE 4WG4A 5L2WA 5M08A 3SRVB 4F4PA 4XH6A 3GOPA 1WBPA 3L8PA 3PPZA 4G6NA 5EQYA 1IA8A 4U97A 2WD1A 3LM0A 2C0IA 5CSPA 4EYJA 2PZ5A 1XH5A 3UOLA 5IQDA 4YTHA 2E9PA 3EQDA 3MA6A 2XJ1A 5EKOA 2CGUA 3U87A 3EN5A 4IM2A 4NW5A 1H26A 4R6VA 3UG1A 1PMNA 3Q5ZA 3LLAA 4O6LA 3QKLA 3CXWA 4I5CA 1GY3A 3VS0A 2OIQA 3MV5A 4O0RA 2DWBA 4DGGA 1LEZA 2BZIB 2YM6A 3AC1A 5JZJA 2RGPA 3PXZA 2VTMA 5L6PA 5E8TA 3V3VA 3R7UA 3E92A 5GIOE 2YM7A 4CKJA 4C2VA 3MS9A 4C4GA 2WQNA 5CAVA 3FWQA 4CCBA 3QX2A 5AUXA 3QZGA 2WMSA 2X9EA 4BZDA 4G6LA 5IA5A 5HBEA 2ITYA 4N70A 3FC1X 2CN8A 4X21A 2QOFA 4RX7A 2IZUA 4Z55A 2JKOA 2Y6OA 3KN6A 4KBCA 4ALVA 4ZP5A 3ORZA 4K6ZA 4FSWA 5H9BA 4A9TA 1W84A 3ZM4A 4QMUA 1NVRA 3MW1A 4NU1A 1UU3A 3K5UA 4HVGA 3R8LA 2X8IA 5IUHA 4IVCA 3KMUA 3N9XA 2UZWE 1SNXA 5DOSA 2WMUA 4PTEA 4X3FB 4CFWA 2OH0E 3CTJA 4D1SA 5HLNA 4PX6A 3NUSA 5HG5A 3PJ3A 3ZEWA 1JSTA 5FBOA 2XEYA 2JKMA 3L9MA 4XCUA 4OAUC 3DLZA 4BRXA 4Y73A 4FEUA 5C8NA 4FR4A 4ZSLA 5D10A 1PYEA 4RVLA 3Q3BA 3ZUTA 1H28A 3HDNA 2WTIA 2ZMCA 2WMTA 3PE1A 2YCRA 4GJ3A 4TWOA 5FEQA 4DFYA 4XG6A 4HVIA 3E8DA 4UBAA 5IA3A 1G8SA 2CJMA 2YAAA 1NT2A 3QLFA 1PMEA 3P9JA 4U40A 3K3IA 4W4WA 4D4YA 5ANKA 1HCLA 3FZ1A 2EVAA 3DBDA 5TT7A 2ZDUA 2YERA 3G15A 3HZTA 2X7FA 3ZM9A 1YXXA 2WMBA 2OJ9A 2P33A 5CEMA 2OJIA 2R3IA 3D14A 5TR6A 4E6QA 4DH3A 2Z7RA 4YPDA 1LP4A 2YA9A 3VIDA 3KRRA 4XV9A 2ITWA 4AT3A 3BEGA 5KO1A 4ZK5A 1Q8YA 2X6DA 4GT5A 1AGWA 1ERKA 4LV8A 4OTPA 4F9WA 3QD4A 5K5XA 3HRFA 3RWPA 5AADA 5JQ5A 2GQRA 1UA2A 5J1WA 2PUNA 2XJ0A 3FMNA 1CDKA 1GJOA 2XIZA 2GQSA 3CS9A 4J96A 4QP7A 3ZDUA 1MUOA 4C34A 1ZMVA 3C0HA 4CT2A 3TCPA 4YUQA 4FODA 5IQHA 1KE8A 2YITA 4FSYA 4ZTNA 3ALOA 4ZJJA 3L1SA 4ANSA 5H8EA 4XBRA 3COMA 3EL8A 2XK3A 3CD8A 4XRLA 4ANNA 4BI0A 5HIDA 4BYIA 5IG1A 3C0GA 3FZPA 3T8OA 2R3RA 4C8BA 3PRIA 3U4WA 1YDRE 4FZ7A 4EQUA 5M4UA 1FVVA 2HW6A 3KXNA 4KNBA 4GT3A 4EL9A 3KB7A 3VWAA 4ACGA 3ETAA 3F3ZA 4H1MA 3HRCA 2OIDA 3FLZA 4UXLA 4ZXTA 3TUCA 2JD5A 4FTJA 5DNRA 4XV1A 2C6OA 3BIZA 3KEXA 3IQ7A 4AAAA 4JNWA 2YWVA 3CKWA 5J5SA 2I1MA 4LMNA 4FNXA 3PP1A 3QCXA 4PMSA 4WSQA 2R7BA 4DBNA 3VNTA 3COHA 2J90A 4YC3A 3UP2A 4LOOA 3BYMA 2PMLX 3UOHA 3V8SA 2I7QA 2YDIA 4D2PA 4JVGA 1VEBA 2PYWA 4WUNA 3F66A 4CRSA 3QTIA 4DFLA 2W5BA 3FPMA 5FXSA 3M2WA 5J8IA 3DOGA 1W0XC 4HJOA 4RC3A 4OR5A 4RG0A 5DE2A 3M1SA 3C7QA 5DA3A 5DT4A 2HWOA 3RINA 4L3PA 3R00A 5ANIA 4I6FA 2BRMA 4X7QA 3FKOA 4FTAA 3OWPA 4ZEGA 5TF9A 3VJNA 3OCGA 4YLJA 1XWSA 2W9FB 2R3JA 1MRYA 3DS6A 2ITQA 4DTKA 1WFCA 2VTHA 2YLFA 3WZKA 4BDBA 1JKSA 2IVVA 4FL1A 5IA2A 3NUPA 2PZYA 3FE3A 3P1AA 3ORKA 4K8AA 3SOAA 3VW6A 4F1TA 2QD9A 1Z5MA 4IH8A 5HTCA 3U55A 4BCKA 4CYJA 2OFUA 3UZRA 4H1JA 3TTIA 5TE0A 5GINE 4AG8A 4J1RA 2FSTX 2FYSA 4FKJA 4ZMEA 3NCGA 4IM3A 3HV6A 4RX9A 4FI1A 2QO9A 4PY1A 3KL8A 3RALA 4I4FA 5JFXA 3QD0A 3FMLA 3T9TA 3NS9A 2PMNX 3I7BA 2Z02A 5KBRA 1OECA 1V0BA 2I0HA 3W32A 4M84A 4D0XA 1UNGA 1H27A 1OPJA 3MIAA 2IJMA 3F5PA 2FUMA 2VGOA 4XX9A 3ZFXA 5CAOA 3HP2A 2NO3A 4O7LA 3HEGA 3UVQA 3OOGA 2A19B 4JI9A 2HCKA 2PVFA 1G3NA 4ASEA 4BWXA 4ZLOA 4IM0A 2VD5A 4JIAA 4QP4A 2R5TA 4FTCA 5CEOA 1WAKA 5HG7A 1ZARA 3R0TA 4X2KA 2J5FA 3U9NA 4NFNA 4MXAA 1YDSE 2ITOA 1M2QA 2WMVA 3FMEA 4ASDA 3FXZA 4ARKA 4XNEA 3AD4A 4R7BA 4PV0A 4UZHA 4GYGA 3F7WA 4DBXA 4ALWA 1M14A 3EQPA 4WT6A 2XKEA 2NRYA 4A06A 1OIYA 4O84A 4AGUA 4DEGA 3EQCA 4AFJA 4IB5A 4O1PA 4X3JA 5KMIA 3NW5A 2QOBA 3OHTA 4C62A 3KMWA 2ZMDA 2YIWA 4G5JA 2KTYA 4FKRA 2YIQA 3BLQA 3ZLWA 4M97A 4QRCA 1BMKA 3FMKA 3DPKA 5BMSA 4IAKA 3R7OA 1JSUA 1AD5A 4PDSA 4EYMA 2WQBA 3HV4A 4QYFA 4BCFA 1ZLTA 2EXMA 5CT0A 4YU2A 2BZHB 2GHLA 3BI6A 4RJ7A 4C3FA 3OROA 5KMKA 3NAYA 1Q8ZA 4KS7A 4L00A 4JX7A 4LRMA 5CEQA 1PKGA 3TNHA 3VAPA 3MY1A 3VHKA 3DK7A 3EQBA 4X2JA 1Q97A 1Y8GA 2IVSA 3MPAA 4FKQA 5AV0A 3TNPC 4IJ9A 4ASXA 4YZDA 5AA8A 3FDNA 4BDFA 5AX3A 4FGRA 5E8WA 3D5WA 2UW5A 4WHZA 5GNKA 5IEYA 3ZTXA 4LMUA 5A4LA 2UZVA 4IVBA 1OVEA 3E8EA 4NK9A 4JR3A 3VN9A 2GPHA 4GVAA 4JOAA 1TQMA 2PL0A 4RSSA 2EXCX 2WQOA 5IQBA 1CKIA 1TKIA 4BCNA 5M4IA 5CWZA 4CG9A 3GU5A 4BFMA 3S1HA 2CKEA 1M7NA 3RP9A 2ETRA 3MESA 4EH2A 4F70A 1G5SA 4U45A 4DHFA 2PTKA 4AN9A 2R0UA 2ZM3A 3QGWA 4LL0A 4PRJA 1V0OA 2ZDTA 4JBOA 2OJJA 4CGAA 2YM8A 5D11A 3HAVA 3TDVA 3LHJA 2IO6A 3NVMB 4IADA 2R64A 2QO7A 2UW8A 2XM8A 1SMHA 2B53A 4TYIA 2Y8OA 4WUAA 5DHJA 5EM8A 3VF9A 2C5NA 4IE9A 5CF5A 3VBVA 1KV2A 4EBVA 2XZSA 4F0FA 3DJ6A 3D7TB 2VO3A 4HYHA 4IFGA 1NW1A 2E9NA 3BHVA 1FVRA 2VO7A 5HICA 5BYZA 4O86A 3TACA 2XCHA 4FA2A 4QP1A 5JGDA 4I0RA 3OVVA 3VBWA 3IW8A 5IDNA 3Q9YA 3P08A 4PF4A 5A4EA 2XP2A 4JRVA 4RWIA 5M53A 3ZUVA 4YTIA 4IB1A 3PY3A 4OGRA 1OUYA 4F9AA 3ORMA 4F63A 2BKKA 5F1ZA 3NUYA 2F4JA 2CHLA 2ZV7A 4Y46A 4CT1A 4XOZA 5D1JA 3C4ZA 2UZUE 1H24A 4XEYA 4APPA 4EH5A 2EB2A 2WB8A 5AIKA 4G3CA 4AZWA 3SA0A 1PW2A 2FSMX 3E5AA 3P7BA 3RPVA 4HYUA 1ZYDA 2EB3A 3PIYA 4N6YA 2X0GA 2QURA 2YEXA 4RGJA 5EFQA 4G3DA 3O17A 4UZDA 5CF4A 3E3BX 4IMYA 3GNIB 4J8NA 5C8MA 4DH5A 4FV0A 3OY1A 5IUGA 2JGZA 2VTTA 4JQ7A 4F9BA 3BYSA 4BKYA 4BICA 1K9AA 3D5VA 3LOKA 4M66A 3UO6A 3H9OA 4DFZE 3C5IA 4GKIA 3SX9A 3ZRMA 3JS2A 4BTJA 3GVUA 4XP0A 3ORIA 5FEEA 3FC2A 4TNBA 1SM2A 2BRHA 2OI4X 3DY7A 5ANOA 4CFXA 3SG8A 3IW7A 3T3UA 3VQHA 5EQPA 4QTCA 4JAJA 4R3PA 5BVFA 2P2IA 4DGNA 2XNGA 4IBMA 4BBEA 2GNLA 2F7XE 5ANEA 2QONA 5CU4A 5KBQA 5HD4A 3BHHA 1Q3DA 1JNKA 3DU8A 3NYVA 5LQFA 5A6OA 2E9OA 2CPKE 4I6QA 4RWLA 4FTLA 5FWKK 4BDJA 4FEWA 2WMRA 3HP5A 3OD6X 3VULA 3W8LA 4YJUA 3BRBA 3E8NA 3IW6A 4QPAA 3QWJA 1PMVA 3QHWA 2RSVA 3EQIA 5IPJA 2JDTA 2VTNA 4UWYA 2IG7A 3C5UA 1OI9A 3MJ2A 4D2TA 4EKLA 5DT3A 5ANJA 4WBOA 4L44A 4QPSA 4FUXA 3PVGA 3ID6C 5C4KA 5I0BA 3GQLA 3VS4A 4BC6A 1B6CB 4BY9E 5FEDA 4F6UA 2JDRA 3KFAA 4YZBA 4D2SA 3FLNC 4B4LA 3AXWA 3FL4A 5HO6A 4BKJA 5IQIA 2OK1A 4RA4A 5G1XA 4A9SA 1IRKA 2Z2WA 3Q4CA 4EK4A 3TL8A 5LMKC 5AFVA 4ORKA 2ZYBA 2C5OA 3DKGA 3TXOA 3ZHPC 4AGDA 5DYJA 3PXRA 2J0LA 3P5KA 2HXLA 4FSRA 2VTJA 2VO0A 2REIA 3FZTA 3EJ1A 4DLIA 4EHGA 4QMPA 4IB0A 3PSCA 4QT1A 4UMUA 4XV2A 4GT4A 2BDJA 3GFEA 3TZMA 1UKIA 2XNBA 4EQMA 4OTWA 2BVAA 2WZJA 4UEUA 2VX3A 4DEBA 1BX6A 4UMPA 3R22A 5CI6A 4WRSA 4J97A 2Y4IB 3A2CA 4KWPA 5DI1A 5EDPA 5EHYA 3WF9A 4M15A 5FBNC 4EH9A 3DGKA 1QL6A 4I3ZA 3EQHA 5CEIA 4KKGA 4R78A 3IW5A 3HMMA 4GIIA 3QRKA 3JR1A 2Z7LA 5E9EA 4BCGA 2XIXA 3CY2A 4M69A 4I24A 1R0EA 3SHEA 4C4IA 1PXMA 4NH1A 3QUDA 5DMZA 4BVUA 1JKKA 2X9FA 4X3FC 2IZSA 3KVWA 4MNEB 4QYHA 4UYAA 4GFMA 3KKVA 3DXQA 4NT4A 3R9DA 1OIRA 4A9RA 3CIKA 4WNPA 4KIPA 4EOMA 4LV5A 3DK6A 3TUDA 2W4KA 2B52A 1PKDA 1BI7A 2RL5A 3JVRA 3UG2A 2YAKA 3VS1A 4AGWA 4AN3A 4CZYB 2JC6A 2W9ZB 4F9CA 3SRVA 4FV8A 2P0CA 2PSQA 3OWJA 5LJJA 5CZIA 4WO5A 3PSBA 4FT9A 4XG7A 5HGIA 3ET7A 3HGKA 4F1MA 2W96B 3EB0A 4XG2A 4FKLA 5M09A 5AM6A 3IOKA 3U51A 2CLQA 3Q2JA 5J9LA 4F99A 2JFLA 2R3QA 3VUDA 4ZZMA 3ZFMA 4CD0A 3QQFA 5AX9A 1OL6A 2ITPA 3DKFA 2J5EA 3OXTA 3RVGA 5K4JA 3IOPA 4BDDA 3CP9A 5LMKA 2CLXA 4IWDA 1JBPE 4W8DA 4UMTA 4QTAA 4O0TA 3DLSA 1SYKA 4K1BA 4L8MA 4PUZA 4RIYB 4BDCA 5A14A 3O23A 2DQ7X 3VW8A 5HX6A 5AR7A 3FZRA 1PHKA 4Y95A 3CE3A 3EL7A 5IDPA 2XUUA 4DYMA 1Q24A 1GZNA 3MA3A 2C6EA 4FTQA 1F3MC 4S32A 2XKDA 3GU6A 3GCQA 4V04A 1DAWA 4PL4A 3ROYA 4KKEA 3I6UA 3WARA 4BBFA 1ZXEA 4FNZA 3UQFA 4FEVA 3A4PA 5M4CA 2AYPA 2Q83A 4B99A 4G3EA 4QP3A 2VGPA 5CSHA 1DI8A 2PHKA 4ZY6A 4EH6A 2W0JA 5AM7A 4UN0C 4F65A 5GZAA 3I0OA 3DT1A 3EHAA 4GH2A 4IZ5A 4BIDA 2X2LA 2GFSA 1BLXA 4GFGA 1MRUA 5EG3A 2BHEA 1YVJA 1R78A 3G9LX 4ANLA 1BL6A 4X3FA 3VF8A 2Y6MA 4C4JA 3ZZEA 4GG7A 4BGGA 5IH5A 1P5EA 4RIWA 2X2MA 4M68A 1WVWA 4QPMA 5HX8A 4P90A 5LVOA 3LFFA 4HGTA 4L7SA 3I5ZA 1M2RA 2XRWA 3HVCA 1F5QA 2UW9A 4U42A 2C69A 2RKUA 5H3QA 4LM5A 3W2CA 2OKRA 3E3PA 1OL2A 2OZOA 3RTPA 2BDWA 3CR0A 3ZSGA 4O7SA 3BCEA 4HZRA 3UIBA 4DEHA 4AUAA 2BRNA 4TW9A 1H1SA 3MPTA 4O22A 5DR2A 3ULIA 3UNJA 2CCIA 3CEKA 1VJYA 2BIYA 4JLCA 2O63A 4E4NA 2IN6A 2F49A 3AMYA 3WF8A 4NWMA 5DR9A 1OUKA 2V0DA 3KVXA 4EBWA 5I3RA 3NUAA 5CEPA 4LUEA 4EEVA 3F2AA 2R0IA 3KC3A 2W4OA 2RFDA 3IGGA 3LJ1A 5DWRA 3GUBA 4NM5A 3TN8A 3PP0A 4F09A 2W1DA 5K9IA 3SLSA 2VV9A 3KRJA 2WAJA 4BDAA 4EQCA 1E1XA 3R1QA 5M57A 3WE4A 4DFXE 2QKWB 3CQUA 4FYOA 4Q9SA 4MNFA 3EH9A 4WNOA 1CM8A 3VS5A 3PZEA 4B0GA 4GG5A 4D5HA 2YZLA 1ZZ2A 3K3JA 3F5GA 4FZFB 4D2VA 4DFUA 3UZPA 2ZJWA 1IASA 3A7GA 2JDSA 4LG4A 4GV1A 1ATPE 4U3YA 5C8KA 4X2NA 4BDHA 1J1CA 3K54A 4C61A 3LQ3A 1SNUA 1Q61A 2VTSA 2BCJA 3FHRA 4YJQA 3ODZX 5JQ8A 3OWLA 5JSMA 5LCJA 5LVMA 2VRXA 4JQEA 1WBWA 2XNEA 3CGFA 3HLLA 2J6MA 5CVFA 3TWJA 5GZ8A 4O82A 2FO0A 4OAVB 1ZY5A 4FTMA 3SGCA 3KULB 3M42A 2GU8A 2R9SA 4W4XA 4JR7A 5BVDA 3NNWA 5HTIA 4F6WA 2BFXA 5FTOA 3OEFX 1JQHA 4W9XA 4CKRA 3PTGA 1UKHA 4AS0A 4BDKA 1T45A 2CSNA 2EUFB 5CYIA 5JFVA 3QGYA 4O7NA 4JBVA 5D7VA 1REKA 2UZTA 3DBCA 3I7CA 4FTKA 4GW8A 4RFZA 4JDHA 3W18A 3NW6A 4NKSA 4D28A 4EHVA 1KUTA 2PVHA 4DTAA 1WVXA 1H1RA 1YRPA 2GNHA 2BRBA 4N4SA 4QMQA 4QMZA 4BBMA 4PPBA 3ZUUA 1WBTA 3PSDA 3TZ9A 4RVKA 1IAHA 3ERKA 3CBLA 4KIQA 4E5WA 5CEKA 4BCOA 4FTNA 3P86A 4DEAA 4RC4A 3NCZA 1YHWA 5CANA 2R3LA 3RNIA 5CXZA 5CZHA 3V04A 1ZYSA 2XB7A 3MH3A 3IKAA 3PG3A 4O0SA 4X6QC 4EK6A 1U4DA 2C4GA 4NL0A 4ZIMA 1H1QA 4MVFA 4P2KA 2J2IB 3Q04A 5EYKA 2PVRA 3EQRA 4BR3A 1BKXA 3W2PA 3IG7A 2OXYA 3W2QA 4EC9A 4U0IA 1M2PA 4QMYA 4DH7A 4FGBA 4DH8A 4P7EA 3VS7A 4X2GA 2A0CX 4B7TA 4DITA 4EH3A 4C59A 2RFEA 5B2KA 3ZO3A 3NIEA 4QD6A 4I0SA 4FT7A 5A6NA 3P7AA 4OBQA 5EYCA 4O7WA 3FEGA 3GC8A 4YSMA 1JWHA 2GNFA 3MVHA 4RQKA 4YNOA 3ZMMA 2LGCA 4V0GA 3OW4A 5CU3A 5BNJA 1J7IA 4H3QA 3DJ7A 2R3GA 3I0QA 1U54B 5FM3A 4PDPA 5CU0A 3FMJA 2Z60A 4E6DA 3FYKX 3R04A 5JGAA 2R3KA 1URCA 5CAQA 3EKKA 2W17A 1JAMA 1M17A 5AP6A 3OMVA 5DIAA 4CMUA 1E9HA 5HVJA 1K2PA 2WKMA 3DFCB 3R9HA 5AP0A 4EK5A 1KE7A 3NYNA 4DTBA 3GU7A 2J0JA 3GGFA 4QO9A 5E8ZA 3HX4A 5K0XA 4WOVA 4A07A 5FG8A 2GMXA 4RVTA 4XUFA 3QTSA 5GJGA 5AV3A 4KRDA 4DC2A 3UTOA 3UGCA 4C36A 4ZSEA 4YZCA 1Y6AA 1H4LA 5CU6A 4HVHA 4ZSGA 3LFNA 4DFNA 2XCKA 3ZLYA 2UZOA 1Q62A 5JT2A 5KMOA 3G90X 2CGVA 4MTAA 2OG8A 4FIFA 4KBKA 5IKWA 3UNKA 2BAKA 5AP5A 3QYWA 4FC0A 1Y91A 2HZ0A 2X1NA 4LL5A 4RPVA 4TPTA 4UXQA 4BCMA 4KAOA 2WPAA 3ZLSA 5EH0A 3R8MA 2C6TA 4DLJA 1Z9XA 5FTGA 2WTVA 3QRTA 3PXYA 4C4EA 4W4YA 3FJQE 3LAUA 4FNWA 1I09A 4L68A 3VS6A 2C1BA 1KOAA 3OTVA 3SG9A 2G15A 3GT8A 3OP5A 2Y9QA 3RBWA 4YZ9A 2G2HA 2H9VA 3BBWA 4U8ZA 3UC4A 4GU6A 3W1FA 4B9DA 4OLIA 4TT7A 4W4VA 5FDPA 2B7AA 4QMVA 4HYSA 5HD7A 4MWHA 2XNOA 4R7HA 4YJSA 1BI8A 5AMNA 5E4HA 1OMWA 1URWA 2YFXA 3VBQA 5DGZA 3WIGA 4BB4A 4Z9LA 4FSMA 3SXSA 4M14A 4XRJA 3VUGA 1XQZA 5HORA 5HU3A 5CNOA 3EN9A 2BALA 4G3FA 5IA0A 3DTWA 2C68A 1B39A 1FOTA 4KKHA 4O96A 4Y5QA 2UZNA 4MQ2A 4DT9A 2WIHA 3BYUA 3CY3A 3D2KA 5KHXA 3FQEA 4FIJA 3W33A 3QCQA 1JKTA 3G0EA 2PVYA 3BHUA 4F7NA 1H25A 2C6LA 3UYTA 3G5DA 3VHEA 4BZNA 4O2PA 4XYFA 3OBJA 2YCFA 2B54A 2YDJA 4FV7A 4IW0A 5D12A 4YTCA 4UMQA 3WZEA 4ZLZA 4C3PA 1QPCA 4FMQA 4K2RA 4KIKA 4Y85A 4BCQA 1Y8YA 1RE8A 4YO4A 4CKIA 4USDA 4YURA 4O7YA 3N4UA 2G2IA 4ZTRA 3OG7A 2VWXA 3UYSA 1SVEA 2YLEA 4BF2A 4EHZA 5KKRB 4NM0A 4RJ6A 3QWKA 3VO3A 4YHJA 2V62A 2PY3A 3G0FA 5FD2A 4ZZOA 3U6IA 2PU8A 3ZO2A 1SVHA 4U43A 4V05A 4E4LA 5HNIX 3LMIA 5CF8A 3SW7A 3BKBA 4ZZNA 3ACJA 2HENA 4NEUA 5JEBA 3V5TA 1QPEA 5M56A 3HV3A 4NSTA 4I0TA 3I4BA 3PVUA 4AZFA 4D4VA 2XYUA 4G9CA 5EOBA 4UX9A 3FMHA 3OC1A 2IWIA 1NA7A 2JKQA 1O9UA 2X4ZA 3MVMA 4L9IA 5BVOA 3PXFA 4C2WA 1OKWA 4XV3A 2RFNA 2PUUA 2ERKA 3QQKA 5AR5A 4W9WA 4RJ5A 4DG2E 3MYGA 4MBJA 5L2QA 4XHKB 3MY5A 4GRBA 1GIIA 2ZAZA 3A8XA 3FQSA 4L6QA 4IX5A 3Q9ZA 4OT5A 1QPJA 3C9WA 3I1AA 4C02A 3FL5A 4BTMA 4PNIA 4IFCA 3WZJA 4UY9A 2JBOA 5AR4A 1KE9A 4IX6A 3WE8A 3DKCA 1Z57A 3JPVA 4ZY5A 3F3UA 5J1VA 3QZHA 4WNMA 4YPSA 4FICA 1UWJA 4TWCA 3RCJA 4AW2A 4AZEA 3WF6A 2PE1A 5C4LA 3KRWA 1PXLA 3OWKA 3DZQA 5CQUA 5EI6A 2QR7A 1NVSA 4IANA 2W1HA 2WHBA 2XA4A 3VVHA 3H9RA 4GUEA 3R28A 3CPCA 2PMOX 3R8UA 4BI1A 2QI8A 3ZO4A 4DAWA 4LUDA 4F64A 5IEXA 4WSYA 5CI7A 5HI2A 3ZCLA 1FGIA 1HCKA 3I6WA 4WBBB 4AE6A 2YDKA 3C50A 5HIBA 3W8QA 3R73A 5GHVA 3MTFA 3A7FA 4PP9A 3FLYA 3RPYA 4X6RA 4NTSA 4BIBA 2BIKB 2UZEA 3D5XA 3QBNA 3DV3A 4RWKA 3NEWA 4IAFA 4ACDA 3BU3A 1Q4LA 5HG9A 3LFCA 3FLWA 3SDJA 1QPDA 4KIOA 5F9EA 2C3IB 3MGYA 4OTRA 3ZRKA 4UYNA 1YWVA 4PTGA 2QG7A 3L9PA 5HE1A 4YTFA 3BGQA 5HLPA 4I20A 5C9CA 2ZM1A 3VRYA 5BQ0A 2X7OA 3HYHA 3QA8A 2W1EA 4P5ZA 2YCSA 2O65A 2GNIA 3ALNA 3JVSA 3R9RA 3D2IA 2JEDA 2C6IA 2X39A 3OOMA 1H1PA 5I9WA 4IAYA 3LXPA 1ZAOA 2QLQA 5I9XA 1YOJA 2ONLC 2GNJA 1MRVA 2GTMA 4QQTA 3LCKA 2XVDA 3LE6A 4IIRA 3TKHA 3MY0A 4FV6A 5ETAA 2R3HA 2OJFE 3LQ5A 3TNQB 2VAGA 5AP3A 4AT5A 2P4IA 2PWLA 4GIHA 1R39A 5JZNA 2YCQA 4E20A 1UWHA 5JK3A 4QQ5A 4RLLA 4K11A 2XJ2A 4XP3A 4MK0A 2RFSA 2GDOA 4IEBA 4A4LA 4J53A 3PJCA 2BAQA 2X7GA 2OICA 3HA6A 5EQEA 2PZPA 3WOWA 3TV4A 3R63A 2XKCA 3R7EA 3RAHA 5L8JA 1LPUA 4I92A 5GZ9A 2GS2A 3OUKA 4U9AA 4FKOA 3UMWA 5KCVA 4FK6A 1R3CA 3RPRA 4L67A 1HOWA 2FB8A 3AT3A 2ZM4A 5I9ZA 2I0VA 3S00A 4LRJA 4FKSA 4QMTA 2X2KA 1FBNA 4FTRA 2OFVA 2ETMA 4GK3A 2UVXA 4P4CA 3RAKA 4BCHA 1U5RA 3WI6A 3QQUA 1YKRA 4G1WA 3F88A 3LW0A 5J87A 3AD5A 4GMYA 4YC8A 5EHOA 4A7CA 4AOIA 5FTQA 1BUHA 5TOZA 3RK9A 4TYHA 2VWWA 3PXKA 1S9IA 5KZIA 2V22A 2XNNA 1R1WA 3QUEA 4EORA 2CKQA 2QOHA 4E26A 1FGKA 1KWPA 3TEIA 4CZUA 1YXTA 2UW6A 5F4NA 4BDIA 4C57A 2BRGA 5DN3A 3AGMA 5BVKA 4CSVA 5AAGA 3AT4A 2LAVA 1W98A 5CVGA 4AOJA 4RWJA 5A46A 5BUJA 1H07A 3R7IA 5EM7A 1ZY4A 4U44A 4TYJA 4APCA 4D1XA 4L52A 4DE4A 4DN5A 3PLAE 4EH4A 3C4EA 1JKLA 3CJFA 2PE0A 2ONLA 5HO7A 4C38A 1YI6A 5AWMA 4N57A 1CSNA 3OZ6A 3TTJA 4F6SA 4WG5A 5DVRA 1XKKA 3O8PA 3HNGA 2BHHA 2GQGA 2HW7A 3QHRA 4OTGA 4C4HA 2ZVAA 3UIUA 4AW0A 3QCSA 4BWKA 5I4NA 4O83A 4I93A 3A8WA 5E8SA 3PY0A 3EYGA 2B9IA 1IR3A 1H01A 3HAMA 1FINA 3ZO1A 3AC8A 3MJ1A 3PE2A 4HGEA 1YI3A 3REPA 5L2IA 2XK9A 3R7GA 2UW7A 3HMIA 3NSZA 5E1EA 3LFQA 4TWPA 1XH6A 4L7FA 4EUUA 2W1IA 3F3WA 4IC8A 2IPXA 2VX1A 4TTHB 1OGUA 4O7RA 3OT3A 4K9YA 1TQPA 2QVSE 5AUVA 3B8RA 5D7AA 3FUPA 2WTCA 1B38A 3FZSA 5BPYA 2Z7SA 3R8VA 3R7VA 2JBPA 3ANRA 1PXIA 3EYHA 3U6HA 4EHEA 5HE0A 4YNEA 3ZONA 4HNFA 2HAKA 3QC9A 4JL9A 5T68A 3RKBA 1H1WA 4J99A 3HV7A 3P7CA 5IZFA 2W5AA 2R4BA 3RPOA 4ASZA 3QKMA 2XS0A 5AUZA 3TUBA 5LVLA 1OZ1A 3S4QA 4E73A 5HU9A 2OH4A 3COIA 3IS5A 4BCPA 4NCTC 2XRUA 3QX4A 3QRUA 4FBXA 1WCCA 4EK3A 1RJBA 3I79A 1MP8A 4TN6A 5C01A 4FK3A 4MXYA 4QOXA 4TXCA 3A4OX 4JG6A 3UDBA 3WILA 1KE6A 2C3KA 1LUFA 2OIBA 4R1YA 4RX5A 3MWUA 4FIGA 2ZV8A 3GCUA 2WMAA 4LGGA 3C1XA 2WTKC 3OFMA 1QMZA 2XM9A 4D9TA 4AQCA 4DG3E 3KCKA 2C1AA 3LCTA 5FGKA 2XYNA 2UZDA 3BYVA 4JBPA 4UB7A 5CENA 3QZFA 3FY0A 4JDIA 3Q52A 5LXMA 4O6EA 4BTFA 4EI4A 3EMGA 5IF1A 3QAME 3JY0A 5J79A 3P0MA 4L3LA 3UIMA 2WMQA 2NP8A 2O2UA 1FMKA 3JY9A 3EWHA 3OBGA 4M7IA 5IISA 4KABA 2W1CA 3FBVA 5IA1A 3G2FA 2RG5A 3MB6A 4IVAA 4PPCA 5CX9A 1YQJA 4AXAA 4AZSA 4EJ7A 1YWNA 4EWHA 2C30A 1CKPA 4ERWA 3NX8A 2VWYA 2WELA 2OF2A 3H30A 4OTFA 2R3PA 5HNBA 3QQHA 4ZMFA 3SV0A 1WBOA 2VTAA 2XK6A 3L8SA 1UVRA 4Q9ZA 4E3CA 3D7ZA 3EFJA 2GHGA 3RNYA 2VWZA 5EYDA 4M13A 3SOCA 4BWPA 4MEDA 5K4IA 3UC3A 2PPQA 4A4XA 1WVYA 1UU7A 3TJCA 3HA8A 1A48A 3O8TA 3OCTA 2UV2A 1PYXA 1WZYA 4HCUA 4GYIA 4NCTA 4D2WA 4ZTHA 2H96A 2R3NA 5DRDA 2X8DA 3F69A 1DM2A 4F7JA 2YZAA 2OSCA 3NWWA 4HCVA 1PRYA 5KNJA 2IZTA 1CTPE 3KULA 5HLWA 5LMAA 4YJTA 5AA9A 5CTPA 5IQCA 3G9NA 2BTSA 4Z7HA 4L43A 1JVPP 1ZMUA 4ZLYA 3SW4A 3F2RA 4ZSAA 3ZC5A 3C4FA 3Q9WA 2R7IA 3G33A 3ORXA 4Q5HA 4YBKA 4FTTA 5J95A 4FKUA 5C27A 5AP4A 4QQCA 2CCHA 2SRCA 3NLBA 2XKFA 5JMSA 3P79A 3FXWA 5EM6A 1Q8TA 4RJ3A 5BUIA 3WZUA 3P78A 3QLGA 4NTTA 3KXZA 3MFUA 3W55A 4O38A 4CV9A 1V1KA 3Q32A 4RZWA 4YC6A 2QU6A 5EW3A 3WIKA 4ACCA 4C0TA 5HCYA 3KN5A 1F0QA 3KA0A 3LIJA 3LXKA 4NIFA 4O21A 4RIXA 4EOOA 4C58A 3IW4A 3NYOA 2YIYA 4LRKA 3UE4A 1SVGA 3QL8A 3ATSA 3FZOA 4KSPA 4M0YA 4OBOA 5DFPA 4MF1A 4FKIA 4CQGA 4MQ1A 2EWAA 1FMOE 4BHNA 4FVQA 2UW3A 1P4OA 5I9VA 3SC1A 4C4FA 3KGAA 3FMDA 4DH1A 4ZTQA 3CTHA 4YSJA 5HE2A 3H0YA 4X0MA 5GJDA 2RIOA 4ZOGA 3TZ7A 4AFEA 5HO8A 4RMZA 3GI3A 2CMWA 4MXOA 4RC2A 3BX5A 2YJSA 1PXKA 3GENA 4FZ6A 4U80A 3UP7A 3MTLA 4XG9A 3E64A 2UVZA 2VTLA 3BWFA 4NW6A 5L8LA 4OTIA 1BYGA 5EDRA 4I22A 3CCNA 3BBTB 4TWNA 2IVTA 4XP2A 2HYYA 1OL7A 4WRGA 4XG3A 2OGVA 3AC3A 5DLSA 3ZZWA 3KK8A 4XLVA 3K2LA 3KRXA 2BFYA 4FT0A 4J8MA 4IZ7A 1GZOA 4AOTA 3CGOA 4QMNA 4FL3A 5HQ0A 3B2TA 3LZBA 2C3LA 4E6CA 2ESMA 4EH8A 1CMKE 2C5YA 2BZJA 1XHAA 3NDMA 4UWCA 1XO2B 3TKIA 3UO4A 2QNJA 3UJGA 3IDPA 3HDMA 3QTXA 5L2SA 2PZIA 4AN2A 5J7BA 3UOKA 2XBAA 5B7VA 2EXEA 4HVDA 5A9UA 4KD1A 5CSXA 4CFVA 3SVVA 1GOLA 1ZOEA 3DDPA 1XR1A 2GS6A 2WU6A 3QQGA 4TKSA 3HUCA 4FVPA 3V8WA 4ZTMA 4JDKA 5K0KA 3DKOA 4YZMA 3RI1A 4AE9A 3KCFA 4RX8A 4II5A 2WNTA 2YM4A 3W2RA 5IU2A 1XJDA 2W1GA 3MB7A 4NM7A 5JRSA 1S9JA 3R01A 4UALA 5AUTA 2JKKA 3BU6A 5CS6A 4ZJIA 3F7ZA 2HZIA 4I6BA 1Q41A 2HWPA 4TL0A 4O0VA 3VUMA 5DEYA 2XF0A 2XH5A 5AAFA 2E9VA 3R21A 3KXGA 5C1QB 3UPZA 4YHTA 5DH3A 3NAXA 4IQ6A 4PMMA 4IWOA 2DYLA 3QU0A 4HPUE 3OXZA 4J52A 4QMXA 4HGLA 2VWUA 2JIVA 2JDVA 3F61A 4H3BA 3BPRA 4LOPA 1O6LA 3MI9A 1UNLA 1OKYA 3PWYA 2RG6A 3QRIA 4ALUA 3KY2A 2B1PA 3CLYA 3Q6WA 3R6XA 4QMSA 4D5KA 2Q0NA 3TNIA 3LXLA 3Q53A 4RT7A 3ORLA 2BUJA 3AD6A 4TYGA 3FPQA 2BMCA 1U5QA 1I44A 2PULA 3C4XA 2ERZE 3PVBA 4JXFA 3AMAA 4H58A 5E8XA 4FV2A 1XBAA 4ID7A 1RQQA 2BR1A 3MH1A 3EKNA 4A4OA 3I60A 4YJVA 4ANOA 4RLKA 3IGOA 3V5QA 3FMMA 4WD5A 4QMWA 4FUYA 2C5XA 2ZOQA 5HTBA 1H0WA 4BGQA 2B4SB 3CSVA 5JKGA 2VZ6A 4ZSJA 4KS8A 3IONA 2I40A 1K3AA 1W7HA 3ZXZA 4FSTA 3HRBA 4IWQA 5ITAA 2HY81 4IJPA 4W8EA 3UPXA 5L4QA 2WTJA 3O96A 1FPUA 2OLCA 4I6HA 2VU3A 1KSWA 5AJQA 3QXOA 3A7IA 1Q8WA 3R02A 4Y5HA 4AP7A 1VYZA 2YIXA 2UW0A 4JX3A 1IEPA 4DGMA 5ACKA 4TNDA 4R8QA 3IDBA 3DQXA 5CF6A 4WG3A 4Z16A 3EQGA 4OW8A 3COKA 2AUHA 3TNWA 4IXPA 4XS2A 4YBJA 1Y57A 5M44A 1O6YA 3TV7A 1MQ4A 3H0ZA 3POZA 4IX4A 4KSQA 3ENMA 5HBHA 1PXOA 5EI2A 3FI8A 4KB8A 3V01A 4F9YA 5CSVA 5K3YA 1NY3A 4JBQA 4AACA 3Q96A 2PVNA 5FUTA 4CZTA 4F0IA 4F7LA 5FXRA 2GFCA 2J7TA 5CY3A 1J7UA 3C4WA 2QLUA 2C6KA 4PDYA 4FIHA 4UV0A 5FQDC 4CVAA 4FEXA 2IW6A 5CASA 2V5QA 2VWBA 4E4MA 1YOLA 3BHYA 5FP6A 4OBPA 3BV2A 5AP2A 1VYWA 3OEZA 4ITHA 3NGAA 5B2LA 3LJ0A 3QTUA 3MH0A 5HIEA 3UOJA 2J51A 1A06A 3E7OA 2B9JA 5BX0A 2QOCA 4GK4A 4PDOA 5AUWA 3ZS5A 5IQGA 1PXPA 3GCPA 3NYXA 4M69B 5HCXA 1GZKA 3NUNA 3OXIA 3TV6A 2OXDA 5HOAA 4G17A 3HECA 4O91A 4ZTSA 3VBYA 3VJOA 4C3RA 4I5PA 3HL7A 4J98A 3Q6UA 3FY2A 4IX3A 4FTUA 2UZBA 1XH9A 1TVOA 3NUUA 5AP7A 2HZ4A 5EM5A 4DG0E 3LCOA 2G2FA 3KF4A 4FL2A 5T3QA 4HZSA 4JQ8A 2I6LA 2OBJA 4RFYA 3VUTA 3LPBA 4QNYA 4C7TA 4YR8A 4EZ5A 5IQAA 3TM0A 1IG1A 3VUHA 2C47A 2FH9A 3RPSA 2QR8A 3NNXA 3WF5A 5M07A 3AC2A 4CYIA 4AA4A 1OM1A 5DRBA 3QXPA 3F6XA 1OITA 2W4JA 3QC4A 4MHAA 5ETIA 3RWQA 4CCUA 3C51A 4YGAA 1APME 4USFA 5KE0A 4HVSA 3OUNB 1IAJA 3DBEA 2O0UA 2C6DA 3CPBA 3BE9A 5CNNA 5CXHA 4IZYA 1QCFA 2FSLX 4EC8A 4FKWA 2J0MB 4L45A 4HOKA 5AV2A 2FA2A 2NPQA 3OW3A 4CFMA 2CNVA 1T46A 2BILB 3A61A 4FV3A 4G31A 1Y6BA 3F82A 2PUIA 2R3OA 4RIOA 5E1SA 1OKVA 2VTIA 3GBZA 3UODA 3AQVA 1GZ8A 2A1AB 2IW9A 4OTQA 3UMXA 2VO6A 4MYGA 3BLHA 5L8KA 4HCTA 2C6MA 3PIZA 4IZAA 4QQJA 3RZFA 4ZS0A 3PDTA 2VX0A 2C5VA 3S2PA 3E63A 5AAEA 4J7BA 2AC3A 4Y72A 4U5JA 3MVLA 4DCEA 4E7WA 1WBVA 5KMNA 3NVKI 1J91A 3QZIA 3JYAA 2V7AA 4CMOA 5J9ZA 1M52A 5FM2A 3V6SA 2B0QA 5KX8A 3HMNA 4HGSA 4RIWB 1OKZA 3BZ3A 3V6RA 4E6AA 3KXXA 4FT5A 2QOKA 2AC5A 4I1ZA 5L3AA 1YOMA 1PJKA 4GCJA 3HMPA 2HY0A 4FSNA 4XJ0A 2I0YA 4LYNA 2WGJA 4GEOA 1ZMWA 3Q5IA 4FOBA 3QQLA 4I21A 5G6VA 5IUIA 1E1VA 1PXJA 3BELA 3DDQA 2WOUA 3QCYA 5D41A 3H10A 4GFOA 5CALA 1Q3WA 5IMXA 2WIPA 2B9HA 4FEQA 3FLQA 2QKRA 3KMMA 3PG1A 4L42A 4R5YA 2O3PA 1ZOHA 3IO7A 3TIYA 4MBLA 4BDGA 3NIZA 3R30A 3KF7A 4FG7A 2ITXA 1ZRZA 2UW4A 2VTPA 4JIKA 3RAIA 4BYJA 3NUXA 2OZAB 3R8PA 2PK9A 3CQWA 3GFWA 4L53A 3WBLA 4R77A 2HELA 4G3GA 2C3JA 3U8WA 3VC4A 3R71A 5ICPA 2WOTA 4IDTA 4RA5A 4C37A 3DJ5A 5E92A 2BTRA 3MIYA 4RRVA 2A27A 2Y0AA 4FSZA 4IC7A 4MX9A 5M55A 3ROCA 4AW5A 4E93A 3DB6A 4WA9A 4E5BA 3ENHA 3D7TA 1OIQA 2UVYA 4LI5A 4MH7A 2VNWA 2WEVA 2YISA 4IAAA 1FQ1B 2QG5A 5LCKA 4JJRA 2OO8X 4RZVA 3W2SA 1PXNA 4NJ3A 3BQRA 3D5UA 2F57A 2ITNA 4DFBA 4PL3A 4EOKA 3E7VA 4FX3A 3W2OA 4GU9A 4PWNA 2HK5A 4MXCA 4FYNA 4RVMA 4O7ZA 3NRMA 4YLKA 3ZOSA 3C0IA 3O0GA 4DGOA 5K5NA 4PMTA 5KZ0A 3MH2A 3MFTA 3LCDA 1P2AA 3GCVA 3PFQA 3DAKA 3R9OA 3W10A 1L8TA 3G6HA 3R2BA 3ZBXA 5IH6A 4G16A 2JAMA 4JS8A 1L3RE 1Q5KA 5E91A 2PVJA 5FP5A 1P14A 4BHZA 4LGDA 4BCIA 2YABA 5F94A 4O7VA 2HIWA 3DBFA 4BTKA 3BEAA 5DT0A 5TO8A 3DAJA 4ZY4A 3DNDA 3V5PA 2IW8A 1XH7A 3KREA 3F3VA 3RM7A 3WYXA 5AEPA 5H8GA 4MKCA 3RCDA 3ZXTA 2Y4PA 4U6RA 2QQ7A 4AA5A 5IA4A 1J3HA 5IQFA 2QHNA 4AU8A 4I5MA 3BQCA 2JFMA 4RFMA 2Y4IC 2GTNA 4UMRA 2B55A 4ACHA 5FXQA 3HV5A 3B2WA 5JFWA 1BL7A 4IVDA 3U9CA 3ZYAA 5M51A 2PMIA 5F95A 4ONAA 3LMGA 2CN5A 2XK7A 5B0XA 2Y7JA 4FKVA 4WNKA 2QC6A 2WQMA 3DBQA 3MSSA 4V0GB 4YZNA 3FSFA 5AIRA 5LARA 4EKKA 2WQEA 1YI4A 4U41A 4AA0A 3U54A 4S34A 4FV5A 3PLSA 2FGIA 3OCSA 4G9RA 4DGLC 4F08A 4ZAUA 4CFUA 4FKPA 1OB3A 3RHXA 2IZRA 3R1SA 5EI8A 1JLUE 3PA4A 4JT3A 3EN6A 4KRCA 5C26A 4FVRA 1UNHA 3QQJA 4JAIA 2A2AA 4L3JA 4FKGA 5DG5A 5HBJA 4E8AA 3Q9XA 1ZOGA 5BYLA 4QMLA 4O0WA 2DS1A 2P3GX 3AT2A 3LCSA 2ETKA 3CQEA 4O2ZA 4MXXA 5A4CA 3EFWA 5HG8A 3QD3A 4MD9E 3CJGA 1W8CA 3O7LD 4Z7GA 4M67A 2ZB1A 4QYEA 4AW1A 5KMLA 4MXZA 3Q4ZA 2A4LA 4H36A 5ANGA 4KA3A 3F9NA 3BE2A 5CU2A 3A99A 5EW9A 3MBLA 5AR8A 3FV8A 2XNMA 4AGCA 3IK3A 4FKTA 4EUTA 3AC5A 3Q60A 4LOQA 1KE5A 2X8EA 2P55A 5LWNA 4USEA 4GSBA 3I5NA 4Z3VA 2JAVA 3TZ8A 3AG9A 4F1OA 2G01A 3PUPA 3GXLA 4K77A 4XOYA 3R9NA 1STCE 2J9MA 4PQNA 1UU9A 2J4ZA 2XEZA 3JUHA 3T9IA 4PMPA 5AV4A 4FV9A 5AR3A 3EQFA 1PY5A 4LFIA 4IACA 4RBLA 4YHFA 1H00A 2PZRA 2C0OA 3FAAA 3Q4TA 5HVYA 3TIZA 5E8VA 3L8XA 4IDVA 4MWIA 4FTOA 2R3MA 2VNYA 4C35A 3QF9A 4R1VA 1GIHA 1VZOA 3LFEA 4D4RA 2VTQA 4Q5EA 3ZFYA 4V01A 5ACBC 4D9UA 2FSOX 3QD2B 3RK5A 3A62A 4MNEA 5ANDA 5BYYA 3EOCA 1YHSA 2JLDA 3KK9A 3QTQA 2PVKA 3FI2A 2WO6A 4QTDA 3RAWA 5B2MA 3OTUA 4IAZA 2XMYA 5A3XA 4A9YA 3T3VA 3GC0A 3ORPA 4YJOA 3ZDIA 3LKMA 4XG4A 2XIRA 4FSQA 1Q8UA 2O5KA 4IWPA 4M0ZA 3DTCA 4NM3A 4BN1A 5KHWA 5DBXA 4PP7A 3D0EA 4NUSA 3RZBA 4CFFA 1XH4A 4DT8A 4EOSA 2OJGA 5CVHA 4K18A 4EJNA 4FIEA 3GU8A 3PJ1A 1W82A 5L2TA 4R7IA 3AGLA 3LM5A 3PRFA 4KIKB 2QO2A 3FLSA 4YO6A 4WKQA 3ZSHA 2GHMA 2PUPA 4EWQA 5I5ZA 4XMOA 3S0OA 2JITA 5AUUA 1W83A 2FVDA 2X4FA 3KRLA 3VRZA 1NVQA 4JG7A 4F7SA
chains in the Genus database with same CATH superfamily
4M8TA 2HOGA 4QTEA 4BKZA 4EK8A 3L9NA 3BHTA 1AQ1A 2H34A 4RIYA 3S3IA 3KQ7A 3DZOA 2ITVA 2YHVA 1J7LA 1H8FA 4YJPA 3ZEPA 4DF3A 3FKLA 3QTRA 2J0IA 3WYYA 3DK3A 2XIKA 1ZYJA 5HE3A 3V5JA 3E88A 3BLRA 2GSFA 3WZDA 4BGHA 4OUCA 3O50A 2CNUA 1JOWB 1LEWA 4DHJA 5AV1A 3VBXA 3ZU7A 5HKMA 4QMOA 3UQCA 2WMWA 5JRQA 3CD3A 4EOPA 4CFNA 3O8UA 4K33A 2BDFA 3R7YA 2J0KA 1JPAA 2O64A 3PWDA 4JG8A 1JSVA 3TG1A 1OPLA 5J7HA 3K5VA 5GIPE 3F2NA 3RK7A 3TI1A 2ITUA 2KULA 3D83A 4CV8A 4DDGA 4S33A 3DQWA 5CLPA 2V7OA 5IMEA 4KBAA 4CLIA 4AX8A 4EOQA 5BVWA 1DAYA 1YXUA 3GP0A 3TKUA 1PMUA 4AZTA 3KU2A 4FV4A 3V5WA 1Q99A 5EOLA 5D9HA 3FXXA 4AWIA 4BL1A 4O81A 4DEIA 4ZTLA 5I3OA 2CKPA 3OF0A 2QCSA 5E8UA 4ZJVA 3GC9A 4EOJA 5AR2A 4MD8E 3QFVA 4O0UA 3BU5A 5KMMA 3HMOA 1YWRA 4NJDA 1KOBA 4E5AX 3L9LA 2VWIA 2W7XA 3EIDA 5F20A 3QTZA 4OT6A 3ZLXA 4HNIA 1EH4A 3SAYA 3ORNA 3V51A 5EKNA 3B8QA 4U79A 5LVPA 4MF0A 4KUJA 4I23A 3LMHA 3R1YA 4H39A 4DCAA 4FZAB 2YJRA 4S31A 3NNVA 5CSWA 4CG8A 1SZMA 4AF3A 3CTQA 3QTWA 4ANMA 1XBCA 3VBTA 3O51A 5E8YA 3ZSIA 2CKOA 2NRUA 3IDCA 4D1ZA 2UUEA 3IECA 3W0PA 4M12A 5IEVA 2R3FA 3GU4A 4EOIA 1REJA 3FI3A 4FTIA 3WF7A 3EN4A 4CTCA 1XBBA 4N6ZA 5AP1A 2CNQA 5HNGA 1H0VA 5L6OA 3PPJA 2YIRA 4J71A 4WIHA 3EZVA 5FRIA 4JDJA 3LFSA 3DCVA 2YM3A 3NNUA 1U59A 5TKDA 1ZYLA 5DR6A 5I9UA 5BMMA 2UZLA 4BCJA 2QOQA 4CMTA 3G6GA 4Y8DA 1MQBA 2HZNA 3SQQA 1VLRA 4YJNA 3GC7A 5JGBA 1OPKA 4QP9A 3HKOA 3ULZA 2QOLA 5IH4A 4U3ZA 4I41A 3VUIA 4CEGA 3POOA 4RJ8A 3EFLA 1OBDA 1J1BA 3ODYX 2OWBA 3LQ8A 3PA5A 5ETCA 2E2BA 3SXRA 4DEEA 3E93A 2W05A 3BYOA 3RGFA 3THBA 4QP6A 5J5TA 1YHVA 2WU7A 1OL1A 4UWBA 3PJ2A 3PYYA 4EZ3A 5LVNA 4S30A 5A4TA 3E8CA 3D4QA 4LQMA 2Z8CA 2Q0BA 3GCSA 3MN3A 4RQVA 3UDTA 1RW8A 5DPVA 4D0WA 4ANQA 2DUVA 3LFBA 4Y83A 4R5SA 2EU9A 3CC6A 3Q4UA 1RDQE 5HCZA 3NW7A 3SD0A 4ERKA 3JXWA 4XLIA 3ZH8A 3RHKA 2WFYA 4NZWB 3VS2A 3OY3A 2GS7A 4TZRA 2F7EE 2QODA 1OL5A 1KV1A 4IB3A 5FDXA 3OT8A 2WMXA 4MD7E 5M4FA 2BKZA 5H8BA 3ELJA 4TYHB 1IA9A 3ZBFA 1WBNA 2YN8A 3KXHA 4AT4A 2XIYA 3PJ8A 4GVJA 5A4QA 2ITTA 2R2PA 3E87A 3G51A 4PTCA 4I5HA 4OTDA 1M7QA 3UO5A 3F5UA 3PA3A 2WTDA 3A7HA 4O1OA 3RMFA 3QALE 3DNEA 3BGZA 4EOLA 2QHMA 4D55A 1R0PA 2PVLA 1U54A 3TJDA 3FKNA 4P5QA 2P2HA 2OW3A 5HEZA 4AZVA 2RF9A 5EHLA 4EZ7A 4PPAA 4GS6A 4ACMA 4CQEA 3E62A 4XBUA 1YXSA 4IHPA 1XH8A 4O7TA 4D4SA 2X6EA 2ACXA 4H3PA 3PXQA 2QU5A 4RJ4A 4E4XA 1LR4A 4GUBA 4BJJB 2BAJA 4YJRA 5HVKA 4ITIA 2H8HA 3R2YA 3S95A 3GQIA 4L46A 2ZV9A 3ZRLA 2VN9A 4QNAA 1GNGA 4FOCA 4KINA 3LVPA 3R83A 4NYEA 2YWPA 2QOIA 4GKHA 5KKRC 5KUPA 3VUKA 2VTRA 5LOHA 3PVWA 3ORTA 1UU8A 1ZWSA 3H3CA 4S2ZA 3ACKA 3W16A 2W1FA 4DINA 2CGXA 3O7LB 1G8KA 2BZKB 1GAGA 2F2UA 4GJ2A 5AUYA 2HXQA 3PY1A 4G34A 3P4KA 4FNYA 4D2RA 3ZC6A 1YDTE 3V8TA 4FSUA 4HW7A 2XNPA 3U4UA 2WTWA 2ITZA 2X0PA 3AC4A 4NKAA 5HHWA 3A60A 2PVMA 4BDEA 1UV5A 1V0PA 2Z7QA 5E90A 5I9YA 2GNGA 3L8VA 4QP8A 2F9GA 2W5HA 5C03A 4ENYA 5T6KA 4B8LA 3FYJX 5H2UA 2C0TA 4H05A 2QOOA 5JN2A 5CAPA 4M3QA 3CKXA 5CQWA 1GIJA 3TDWA 4MAOA 3GEQA 3SXFA 2OU7A 2NYAA 3DXNA 4CTBA 2V55A 4EONA 4NFMA 4YLLA 2XBJA 1ZYCA 4Q2AA 3C4CA 4QEBA 1U46A 2F2CB 3H4JA 2W99B 3II5A 3IPHA 5CAUA 2GCDA 4O0YA 4FG9A 4FIIA 3KXMA 4YMJA 3DB8A 4FE2A 4B6LA 1P4FA 2W06A 4I4EA 4QYYA 2OF4A 1OIUA 4ANBA 5GJFA 5IQEA 2I0EA 5DEWA 4BI2A 4PNKA 2G1TA 3BV3A 5BVNA 2B9FA 2VUWA 3O2MA 3BWJA 5EK7A 3HUBA 3AMBA 3R1NA 2XK4A 1VR2A 3BGPA 3PPKA 4JRNA 4TY1A 3NMUF 5HZNA 2YACA 3R8ZA 1O6KA 4U81A 3DXPA 4DA5A 2H6DA 2NNWB 5JH6A 3VS3A 3A7JA 3MVJA 5L6WL 1G8AA 2E9UA 3C13A 3I81A 4HYIA 4MCVA 5LWMA 2JIUA 2VWVA 2JIIA 2OZAA 5M06A 3F3TA 4CLJA 4CXAA 4B8MA 2WEIA 5FLFA 2VTOA 4XG8A 4BIEA 3QUPA 2BROA 1ND4A 4G2FA 3P23A 3DFAA 4EH7A 2O8YA 3EN7A 4QMMA 1ZZLA 2XK8A 4J95A 3FI4A 1X8BA 4FZDB 3ITZA 3EZRA 3UVPA 4E1ZA 3LFAA 1PF8A 3QA0A 1G8JA 2WXVA 4G6OA 3UQGA 2X81A 4I94A 3MFSA 4TRLA 3PIXA 3UNZA 3UIXA 5BUEA 5J9YA 3DAEA 4R3RA 3MFRA 3DA6A 4TYEA 4A9UA 3NPCA 3NZ0A 5EW8A 1OBGA 4YP8A 3NR9A 2CGWA 4U7ZA 3V5LA 4F0GA 3UZTA 1A9UA 1NXKA 3FHIA 3Q2MA 5EDQA 1DI9A 5KMJA 3F5XA 1FVTA 2WTKB 3N4VA 2BPMA 2G9XA 3O71A 4O27B 4CNHA 4ZS4A 3GOKA 5JFSA 1H08A 4FF8A 3RJCA 4GL9A 3FSKA 4K0YA 5BVEA 2YM5A 3D94A 2IVUA 3OCBA 3SKCA 3TT0A 4G5PA 4R3CA 4MBIA 3QRJA 3U6JA 3MPMA 4ENXA 5LMBA 2ZB0A 4L01A 2OXXA 3MDYA 3QKKA 4GK2A 4N0SA 4QTBA 4DEDA 1YW2A 1TQIA 4NIFB 4RIXB 5CT7A 3UVRA 4QYGA 3RM6A 4IAIA 5ETFA 3N4TA 2PE2A 3VQUA 3ANQA 3D15A 4ITJA 2JDOA 3N51A 4OTHA 2J50A 5A54A 4BZOA 4FG8A 5E7RA 3PZHA 3FQHA 3LLTA 3ATTA 1WMKA 2CDZA 2W1ZA 2ZV2A 3LXNA 4LGHA 4QP2A 5EYMA 5HESA 4D58A 3UBDA 4X2FA 3LJ2A 3GB2A 4HPTE 1CKJA 3OS3A 4FV1A 3H9FA 4O0XA 1YXVA 3QYZA 4C33A 1WBSA 1DS5A 3AOXA 3EFKA 4FT3A 4PL5A 3D9VA 3M11A 3LFDA 4CRLA 2F7ZE 4WG4A 5L2WA 5M08A 3SRVB 4F4PA 4XH6A 3GOPA 1WBPA 3L8PA 3PPZA 4G6NA 5EQYA 1IA8A 4U97A 2WD1A 3LM0A 2C0IA 5CSPA 4EYJA 2PZ5A 1XH5A 3UOLA 5IQDA 4YTHA 2E9PA 3EQDA 3MA6A 2XJ1A 5EKOA 2CGUA 3U87A 3EN5A 4IM2A 4NW5A 1H26A 4R6VA 3UG1A 2ZFYA 1PMNA 3Q5ZA 3LLAA 4O6LA 3QKLA 3CXWA 4I5CA 1GY3A 3VS0A 2OIQA 3MV5A 4O0RA 2DWBA 4DGGA 1LEZA 2BZIB 2YM6A 3AC1A 5JZJA 2RGPA 3PXZA 2VTMA 5L6PA 5E8TA 3V3VA 3R7UA 3E92A 5GIOE 2YM7A 4CKJA 4C2VA 3MS9A 4C4GA 2WQNA 5CAVA 3FWQA 4CCBA 3QX2A 5AUXA 3QZGA 2WMSA 2X9EA 4BZDA 4G6LA 5IA5A 5HBEA 2ITYA 4N70A 3FC1X 2CN8A 4X21A 2QOFA 4RX7A 2IZUA 4Z55A 2JKOA 2Y6OA 3KN6A 4KBCA 4ALVA 4ZP5A 3ORZA 4K6ZA 4FSWA 5H9BA 4A9TA 1W84A 3ZM4A 4QMUA 1NVRA 3MW1A 4NU1A 1UU3A 3K5UA 4HVGA 3R8LA 2X8IA 5IUHA 4IVCA 3KMUA 3N9XA 2UZWE 1SNXA 5DOSA 2WMUA 4PTEA 4X3FB 4CFWA 2OH0E 3CTJA 4D1SA 5HLNA 4PX6A 3NUSA 5HG5A 4LV7A 3PJ3A 3ZEWA 1JSTA 5FBOA 2XEYA 2JKMA 3L9MA 4XCUA 4OAUC 3DLZA 4BRXA 4Y73A 4FEUA 5C8NA 4FR4A 4ZSLA 5D10A 1PYEA 4RVLA 3Q3BA 3ZUTA 1H28A 3HDNA 2WTIA 2ZMCA 2WMTA 3PE1A 2YCRA 4GJ3A 4TWOA 5FEQA 4DFYA 4XG6A 4HVIA 3E8DA 4UBAA 5IA3A 1G8SA 2CJMA 2YAAA 1NT2A 4O4FA 3QLFA 1PMEA 3P9JA 4U40A 3K3IA 4W4WA 4D4YA 5ANKA 1HCLA 3FZ1A 2EVAA 3DBDA 5TT7A 2ZDUA 2YERA 3G15A 3HZTA 2X7FA 3ZM9A 4DHIB 1YXXA 2WMBA 2OJ9A 2P33A 5CEMA 2OJIA 2R3IA 3D14A 5TR6A 4E6QA 4DH3A 2Z7RA 4YPDA 1LP4A 2YA9A 3VIDA 3KRRA 4XV9A 2ITWA 4AT3A 3BEGA 5KO1A 3W0QA 4ZK5A 1OGYA 1Q8YA 2X6DA 4GT5A 1AGWA 1ERKA 4LV8A 4OTPA 4F9WA 3QD4A 5K5XA 3HRFA 3RWPA 5AADA 5JQ5A 2GQRA 1UA2A 1TZDA 5J1WA 2XJ0A 3FMNA 2PUNA 1CDKA 1GJOA 2XIZA 2GQSA 3CS9A 4J96A 4QP7A 3ZDUA 1MUOA 4C34A 1ZMVA 3C0HA 4CT2A 3TCPA 4YUQA 4FODA 5IQHA 1KE8A 2YITA 4FSYA 4ZTNA 3ALOA 4ZJJA 3L1SA 4ANSA 5H8EA 4XBRA 3COMA 3EL8A 2XK3A 3CD8A 4XRLA 4ANNA 4BI0A 5HIDA 4BYIA 5IG1A 3C0GA 3FZPA 3T8OA 2R3RA 4C8BA 3PRIA 3U4WA 1YDRE 4FZ7A 4EQUA 5M4UA 1FVVA 2HW6A 3KXNA 4KNBA 4GT3A 4EL9A 3KB7A 3VWAA 4ACGA 3ETAA 3F3ZA 4H1MA 3HRCA 2OIDA 3FLZA 4UXLA 4ZXTA 3TUCA 2JD5A 4FTJA 5DNRA 4XV1A 2C6OA 3BIZA 3KEXA 3IQ7A 4AAAA 4JNWA 2YWVA 3CKWA 5J5SA 2I1MA 4LMNA 4FNXA 3PP1A 3QCXA 4PMSA 4WSQA 2R7BA 4DBNA 3VNTA 3COHA 2J90A 4YC3A 3UP2A 4LOOA 3BYMA 2PMLX 3UOHA 3V8SA 2I7QA 2YDIA 4D2PA 4JVGA 1VEBA 3UDZA 2PYWA 4WUNA 3F66A 4CRSA 3QTIA 4DFLA 2W5BA 3FPMA 5FXSA 3M2WA 5J8IA 3DOGA 1W0XC 4HJOA 4RC3A 4OR5A 4RG0A 5DE2A 3M1SA 3C7QA 5DA3A 5DT4A 2HWOA 3RINA 4L3PA 3R00A 5ANIA 2XAMA 4I6FA 2BRMA 4X7QA 3FKOA 4FTAA 3OWPA 4ZEGA 5TF9A 3VJNA 3OCGA 4YLJA 1XWSA 2W9FB 2R3JA 1MRYA 3DS6A 2ITQA 4DTKA 1WFCA 2VTHA 2YLFA 3WZKA 4BDBA 1JKSA 2IVVA 4FL1A 5IA2A 3NUPA 2PZYA 3FE3A 3P1AA 3ORKA 4K8AA 3SOAA 3VW6A 4F1TA 2QD9A 1Z5MA 4IH8A 5HTCA 3U55A 4BCKA 4CYJA 2OFUA 3UZRA 4H1JA 3TTIA 5TE0A 5GINE 4AG8A 4J1RA 2FSTX 2FYSA 4FKJA 4ZMEA 3NCGA 4IM3A 3HV6A 4RX9A 4FI1A 2QO9A 4PY1A 3KL8A 3RALA 4I4FA 5JFXA 3QD0A 3FMLA 3T9TA 3NS9A 2PMNX 3I7BA 2Z02A 5KBRA 1OECA 1V0BA 2I0HA 3W32A 4M84A 4D0XA 1UNGA 1H27A 1OPJA 3MIAA 2IJMA 3F5PA 2FUMA 2VGOA 4XX9A 3ZFXA 5CAOA 3HP2A 1W2DA 2NO3A 4O7LA 3HEGA 3UVQA 3OOGA 2A19B 4JI9A 2HCKA 2PVFA 1G3NA 4ASEA 4BWXA 4ZLOA 4IM0A 2VD5A 4JIAA 4QP4A 2R5TA 4FTCA 5CEOA 1WAKA 5HG7A 1ZARA 3R0TA 4X2KA 2J5FA 3U9NA 4NFNA 4MXAA 1YDSE 2ITOA 1M2QA 2WMVA 3FMEA 4ASDA 3FXZA 4ARKA 4XNEA 3AD4A 4R7BA 4PV0A 4UZHA 4GYGA 3F7WA 4DBXA 4ALWA 1M14A 3EQPA 4WT6A 2XKEA 2NRYA 4A06A 1OIYA 4O84A 4AGUA 4DEGA 3EQCA 4O4CA 4AFJA 4IB5A 4O1PA 4X3JA 5KMIA 3NW5A 2QOBA 3OHTA 4C62A 3KMWA 2ZMDA 2YIWA 4G5JA 2KTYA 4FKRA 2YIQA 3BLQA 3ZLWA 4M97A 4QRCA 2AEGA 1BMKA 3FMKA 3DPKA 5BMSA 4IAKA 3R7OA 1JSUA 1AD5A 4PDSA 4EYMA 2WQBA 3HV4A 4QYFA 4BCFA 1ZLTA 2EXMA 5CT0A 4YU2A 2BZHB 2GHLA 3BI6A 4RJ7A 4C3FA 3OROA 5KMKA 3NAYA 1Q8ZA 4KS7A 4L00A 4JX7A 4LRMA 5CEQA 1PKGA 3TNHA 3VAPA 3MY1A 3VHKA 3DK7A 3EQBA 4X2JA 1Q97A 1Y8GA 2IVSA 3MPAA 4FKQA 5AV0A 3TNPC 4IJ9A 4ASXA 4YZDA 5AA8A 3FDNA 4BDFA 5AX3A 4FGRA 5E8WA 3D5WA 2UW5A 4WHZA 5GNKA 2X0OA 5IEYA 3ZTXA 4LMUA 5A4LA 2UZVA 4IVBA 1OVEA 3E8EA 4NK9A 4JR3A 3VN9A 2GPHA 4GVAA 4JOAA 1TQMA 2PL0A 4RSSA 2EXCX 2WQOA 5IQBA 1CKIA 1TKIA 4BCNA 5M4IA 5CWZA 3ML1A 4CG9A 3GU5A 4BFMA 3S1HA 2CKEA 1M7NA 3RP9A 2ETRA 3MESA 4EH2A 4F70A 1G5SA 4U45A 4DHFA 2PTKA 4AN9A 2R0UA 2ZM3A 3QGWA 4LL0A 4PRJA 1V0OA 2ZDTA 4JBOA 2OJJA 4CGAA 2YM8A 5D11A 3HAVA 3TDVA 3LHJA 2IO6A 4QDVA 3NVMB 4IADA 2R64A 2QO7A 2UW8A 2XM8A 1SMHA 2B53A 4TYIA 2Y8OA 4WUAA 5DHJA 5EM8A 3VF9A 2C5NA 4IE9A 5CF5A 3VBVA 1KV2A 4EBVA 2XZSA 4F0FA 3DJ6A 3D7TB 2VO3A 4HYHA 4IFGA 1NW1A 2E9NA 3BHVA 1FVRA 2VO7A 5HICA 5BYZA 4O86A 3TACA 2XCHA 4FA2A 4QP1A 5JGDA 4I0RA 3OVVA 3VBWA 3IW8A 5IDNA 3Q9YA 3P08A 4PF4A 5A4EA 2XP2A 4JRVA 4RWIA 5M53A 3ZUVA 4YTIA 4IB1A 3PY3A 4OGRA 1OUYA 4F9AA 3ORMA 4F63A 2BKKA 5F1ZA 3NUYA 2F4JA 2CHLA 2ZV7A 4Y46A 4CT1A 4XOZA 5D1JA 3C4ZA 2UZUE 1H24A 4XEYA 4APPA 4EH5A 2EB2A 2WB8A 5AIKA 4G3CA 4AZWA 3SA0A 1PW2A 2FSMX 3E5AA 3P7BA 3RPVA 4HYUA 1ZYDA 2EB3A 3PIYA 1ST4A 4N6YA 2X0GA 2QURA 2YEXA 4RGJA 5EFQA 4G3DA 3O17A 4UZDA 5CF4A 3E3BX 4IMYA 3GNIB 4J8NA 5C8MA 4DH5A 4FV0A 3OY1A 5IUGA 3BL7A 2JGZA 2VTTA 4JQ7A 4F9BA 3BYSA 4BKYA 4BICA 1K9AA 3D5VA 3LOKA 4M66A 3UO6A 3H9OA 4DFZE 3C5IA 4GKIA 3SX9A 3ZRMA 3JS2A 4BTJA 3GVUA 4XP0A 3ORIA 5FEEA 3FC2A 4TNBA 1SM2A 2BRHA 2OI4X 3DY7A 5ANOA 4CFXA 3SG8A 3IW7A 3T3UA 3VQHA 5EQPA 4QTCA 4JAJA 4R3PA 5BVFA 2P2IA 4DGNA 2XNGA 4IBMA 4BBEA 2GNLA 2F7XE 5ANEA 2QONA 5CU4A 5KBQA 5HD4A 3BHHA 1Q3DA 1JNKA 3DU8A 3NYVA 5LQFA 4I6LA 5A6OA 2E9OA 2CPKE 4I6QA 4RWLA 4FTLA 5FWKK 4BDJA 4FEWA 2WMRA 3HP5A 3OD6X 3VULA 3W8LA 4YJUA 3BRBA 3E8NA 3IW6A 4QPAA 3QWJA 1PMVA 3QHWA 2RSVA 3EQIA 5IPJA 2JDTA 2VTNA 4UWYA 2IG7A 3C5UA 1OI9A 3MJ2A 4D2TA 4EKLA 5DT3A 5ANJA 4WBOA 4L44A 4QPSA 4FUXA 3PVGA 3ID6C 5C4KA 5I0BA 3GQLA 3VS4A 4BC6A 1B6CB 4BY9E 5FEDA 4F6UA 2JDRA 3KFAA 4YZBA 4D2SA 3FLNC 4B4LA 3AXWA 3FL4A 5HO6A 4BKJA 5IQIA 3W0OA 2OK1A 4RA4A 5G1XA 4A9SA 1IRKA 2Z2WA 3Q4CA 4EK4A 3TL8A 5LMKC 5AFVA 4ORKA 2ZYBA 2C5OA 3DKGA 3TXOA 3ZHPC 4AGDA 5DYJA 3PXRA 2J0LA 3P5KA 2HXLA 4FSRA 2VTJA 2VO0A 2REIA 3FZTA 3EJ1A 4DLIA 4EHGA 4QMPA 4IB0A 3PSCA 4QT1A 4UMUA 4XV2A 4GT4A 2BDJA 3GFEA 3TZMA 2XANA 1UKIA 2XNBA 4EQMA 4OTWA 2BVAA 2WZJA 4UEUA 2VX3A 4DEBA 1BX6A 4UMPA 3R22A 5CI6A 4WRSA 4J97A 2Y4IB 3A2CA 4KWPA 5DI1A 5EDPA 5EHYA 3WF9A 3NFFB 4AXFA 4M15A 5FBNC 4EH9A 3DGKA 1QL6A 4I3ZA 3EQHA 5CEIA 4KKGA 4R78A 3IW5A 3HMMA 4GIIA 3QRKA 3JR1A 2Z7LA 5E9EA 4BCGA 2XIXA 3CY2A 4M69A 4I24A 1R0EA 3SHEA 4C4IA 1PXMA 4NH1A 3QUDA 5DMZA 4BVUA 1JKKA 2X9FA 4X3FC 2IZSA 3KVWA 4MNEB 4QYHA 4UYAA 4GFMA 3KKVA 3DXQA 4NT4A 3R9DA 1OIRA 4A9RA 3CIKA 4WNPA 4KIPA 4EOMA 4LV5A 3DK6A 3TUDA 2W4KA 2B52A 1PKDA 1BI7A 2RL5A 3JVRA 3UG2A 2YAKA 3VS1A 4AGWA 4AN3A 4CZYB 2JC6A 2W9ZB 4F9CA 3SRVA 4FV8A 2P0CA 2PSQA 3OWJA 5LJJA 5CZIA 4WO5A 3PSBA 4FT9A 4XG7A 5HGIA 3ET7A 3HGKA 4F1MA 2W96B 3EB0A 4XG2A 4FKLA 5M09A 5AM6A 3IOKA 3U51A 2CLQA 3Q2JA 5J9LA 4F99A 2JFLA 2R3QA 3VUDA 4ZZMA 3ZFMA 4CD0A 3QQFA 5AX9A 1OL6A 2ITPA 3DKFA 2J5EA 3OXTA 3RVGA 5K4JA 3IOPA 4BDDA 3CP9A 5LMKA 3PFYA 2CLXA 4IWDA 1JBPE 4W8DA 4UMTA 4QTAA 4O0TA 3DLSA 1SYKA 4K1BA 4L8MA 4PUZA 4RIYB 4BDCA 5A14A 3O23A 2DQ7X 3VW8A 5HX6A 5AR7A 3FZRA 1XMMA 1PHKA 4Y95A 3CE3A 3EL7A 5IDPA 2XUUA 4DYMA 1Q24A 1GZNA 3MA3A 2C6EA 4FTQA 1F3MC 4S32A 2XKDA 3GU6A 3GCQA 4V04A 1DAWA 4PL4A 3ROYA 4KKEA 3I6UA 3WARA 4BBFA 1ZXEA 4FNZA 3UQFA 4FEVA 3A4PA 5M4CA 2AYPA 2Q83A 4B99A 4G3EA 4QP3A 2VGPA 5CSHA 1DI8A 2PHKA 4ZY6A 4EH6A 2W0JA 5AM7A 4UN0C 4F65A 5GZAA 3I0OA 3DT1A 3EHAA 4GH2A 4IZ5A 4BIDA 2X2LA 2GFSA 1BLXA 4GFGA 1MRUA 5EG3A 2BHEA 1YVJA 1R78A 3G9LX 4ANLA 1BL6A 4X3FA 3VF8A 2Y6MA 4C4JA 3ZZEA 4GG7A 4BGGA 5IH5A 1P5EA 4RIWA 2X2MA 4M68A 1WVWA 4QPMA 5HX8A 4P90A 5LVOA 3LFFA 4HGTA 4L7SA 3I5ZA 1M2RA 2XRWA 3HVCA 1F5QA 2UW9A 4U42A 2C69A 2RKUA 5H3QA 4LM5A 3W2CA 2OKRA 3E3PA 1OL2A 2OZOA 3RTPA 2BDWA 3CR0A 4FRFA 3ZSGA 4O7SA 3BCEA 4HZRA 3UIBA 4DEHA 4AUAA 2BRNA 4TW9A 1H1SA 3MPTA 4O22A 5DR2A 3ULIA 3UNJA 2CCIA 3CEKA 1VJYA 2BIYA 4JLCA 2O63A 4E4NA 2IN6A 2F49A 3AMYA 3WF8A 4NWMA 5DR9A 1OUKA 2V0DA 3KVXA 4EBWA 5I3RA 3NUAA 5CEPA 4LUEA 4EEVA 3F2AA 2R0IA 3KC3A 2W4OA 2RFDA 3IGGA 3LJ1A 5DWRA 3GUBA 4NM5A 3TN8A 3PP0A 4F09A 2W1DA 5K9IA 3SLSA 2VV9A 3KRJA 2WAJA 4BDAA 4EQCA 1E1XA 3R1QA 5M57A 3WE4A 4DFXE 2QKWB 3CQUA 4FYOA 4Q9SA 4MNFA 3EH9A 4WNOA 1CM8A 3VS5A 3PZEA 4B0GA 4GG5A 4D5HA 2YZLA 1ZZ2A 3K3JA 3F5GA 4FZFB 4D2VA 4DFUA 3UZPA 2ZJWA 1IASA 3A7GA 2JDSA 4LG4A 4GV1A 1ATPE 4U3YA 5C8KA 4X2NA 4BDHA 1J1CA 3K54A 4C61A 3LQ3A 1SNUA 1Q61A 2VTSA 2BCJA 3FHRA 4YJQA 3ODZX 5JQ8A 3OWLA 5JSMA 5LCJA 5LVMA 2VRXA 4JQEA 3CGFA 1WBWA 2XNEA 3HLLA 2J6MA 5CVFA 3TWJA 5GZ8A 4O82A 2FO0A 4OAVB 1ZY5A 4FTMA 3SGCA 3KULB 3M42A 2GU8A 2R9SA 4W4XA 4JR7A 5BVDA 3NNWA 5HTIA 4F6WA 2BFXA 5FTOA 3OEFX 1JQHA 4W9XA 4CKRA 3PTGA 1UKHA 4AS0A 4BDKA 1T45A 2CSNA 2EUFB 5CYIA 5JFVA 3QGYA 4O7NA 4JBVA 5D7VA 1REKA 2UZTA 3DBCA 3I7CA 4FTKA 4GW8A 4RFZA 4JDHA 3W18A 3NW6A 4NKSA 4D28A 4EHVA 1KUTA 2PVHA 4DTAA 1WVXA 1H1RA 1YRPA 2GNHA 2BRBA 4N4SA 4QMQA 4QMZA 4BBMA 4PPBA 3ZUUA 1WBTA 3PSDA 3TZ9A 4RVKA 1IAHA 3ERKA 3CBLA 4KIQA 4E5WA 5CEKA 4BCOA 4FTNA 3P86A 4DEAA 4RC4A 3NCZA 1YHWA 5CANA 2R3LA 3RNIA 5CXZA 5CZHA 3V04A 1ZYSA 2XB7A 3MH3A 3IKAA 3PG3A 4O0SA 4X6QC 4EK6A 1U4DA 2C4GA 4NL0A 4ZIMA 1H1QA 4MVFA 4P2KA 2J2IB 3Q04A 5EYKA