4ZZOA

Human erk2 in complex with an irreversible inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
345
structure length
339
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKDDLPKEKLKELIFEETARFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 1
publication title Structure-Guided Design of Highly Selective and Potent Covalent Inhibitors of Erk1/2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 339
sequence length 345
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zzoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zzoA01
4N70A 3DBQA 3QRJA 3R7IA 3NW6A 4MK0A 2HAKA 1ZMUA 4RVMA 3AC1A 4FG9A 5E91A 5GJFA 3BBWA 3EKKA 4QTCA 5CI7A 2IZTA 4FMQA 4V0GB 3UIBA 4DFYA 4HYHA 1M2PA 3O8TA 2RSVA 4GK3A 4JBOA 4HVGA 4OTRA 5FEQA 2B54A 3RNIA 2FUMA 5E92A 4RJ6A 2OJGA 2YLEA 1B6CB 3OW4A 2JBOA 3NUNA 2Y8OA 2WQMA 3KMWA 3LVPA 4XUFA 4XV1A 2XIKA 3F5GA 1WCCA 1JSVA 4JT3A 4JG7A 4IE9A 2XYNA 3GVUA 4J8MA 4RQKA 3VQUA 3R83A 4BBMA 4ZZNA 5IA0A 3QXPA 4UXQA 1U5RA 5BUEA 3PTGA 3FPQA 4BIEA 5C03A 4H3QA 1G8SA 3FE3A 4CMUA 5HG5A 5CAQA 5L8LA 4FNZA 5JMSA 4O6LA 2W1IA 4IAKA 3TUCA 1CMKE 1GIIA 3NLBA 3BHUA 4U42A 4IAFA 3L9PA 4X3FA 2XRWA 5DMZA 5IISA 4U6RA 2FGIA 1V0PA 4AGUA 4GU6A 3BU6A 3ANRA 2C0TA 3GQLA 1ZXEA 3FKOA 3FMNA 3LZBA 3KCKA 4NW5A 4R7HA 4TPTA 5HE2A 4AS0A 4FV0A 4L53A 4TKSA 4AN2A 4M68A 4RA4A 2W1EA 4DGGA 5KUPA 3PPJA 2LAVA 1YRPA 2CLQA 4PMSA 2OBJA 2W1ZA 4M0YA 1OIQA 1Z57A 3E88A 3OG7A 4GG5A 5LVOA 4JBVA 1BI8A 2YIWA 3NGAA 2XK7A 5I9XA 4P90A 4FICA 2BFYA 1OGUA 5D7AA 3VW8A 2EB2A 4JLCA 3FWQA 2PYWA 4JX7A 4QYHA 1I44A 4K0YA 4JS8A 4MNEA 2E9UA 4O7ZA 3RM7A 2C6DA 4ASEA 2JAVA 2OICA 2P33A 3GCUA 3CGOA 2B52A 4GIHA 4QTBA 1F3MC 3E3PA 5HESA 4P4CA 2G1TA 3QTXA 1L8TA 3BU3A 3C4EA 4BZDA 3BLHA 4F6SA 3KK9A 3VRZA 5HD7A 5H3QA 4U40A 1GZKA 2BALA 4EUUA 3DKFA 3F7WA 2B55A 4BCOA 1KSWA 2YFXA 3BIZA 1MRYA 3I5NA 5L8JA 4LG4A 1LUFA 5K4JA 3QUEA 3ZM9A 2PZIA 4AZEA 3C0IA 4M15A 5LVNA 5IMXA 3FUPA 3UP2A 1T45A 1JWHA 3ZDUA 2C6OA 2WTIA 3B8RA 3R71A 4O96A 5ICPA 2OLCA 3WF5A 3ZUVA 1CKJA 4A4XA 4AE6A 5HIDA 4EUTA 4KBCA 3ZUTA 3R2YA 3VIDA 5IQAA 4RX9A 5C8MA 5I4NA 5B2KA 3GC8A 5EH0A 2ONLC 2XEYA 3QL8A 2XNGA 3NNVA 4RLLA 5C1QB 4WBOA 3BE2A 4KRDA 4S30A 3OROA 3P7AA 3MPTA 1Q24A 3BYVA 4FIFA 4NKAA 4I6BA 5EDQA 5IDNA 4DHFA 3HL7A 3R28A 3KXGA 4U80A 5HQ0A 3KRXA 4CQEA 4FTQA 2YLFA 3H9FA 3R8VA 4G17A 3VS2A 4ACMA 3CJGA 3MVLA 4QTDA 1UU9A 4XCUA 3LFFA 1FINA 5DT0A 2ZB0A 2WO6A 3UNZA 1M2QA 4NYEA 1CKIA 5GIOE 4ITIA 1PYEA 2YM5A 3EFWA 2PZ5A 3QLGA 4ANSA 4ZOGA 1MRUA 4EC8A 3MPAA 2RFSA 3NVMB 4M69A 3TTIA 4AQCA 4RC3A 4ENXA 4FYNA 2QC6A 4X2NA 3BYSA 4W9WA 4JQEA 4LQMA 5HU3A 3UJGA 3DK3A 2GNLA 4BZOA 3VS0A 4TZRA 5EHYA 4A9RA 1A06A 4ITHA 5JQ5A 4JVGA 5M53A 4NH1A 5DA3A 4C35A 3R7VA 3ERKA 5CVHA 3R30A 5HCXA 4E73A 2C6TA 4MQ1A 4YR8A 2IW8A 3SLSA 2HCKA 2VWYA 2WQEA 4ZTQA 3IDBA 5CY3A 2ITPA 3AOXA 4RX5A 3UNKA 4EH9A 5HBEA 3IGGA 4TXCA 1UWJA 2J0IA 2WXVA 4FTOA 3RWPA 2V55A 4CYJA 4EEVA 3FSKA 2P0CA 1NW1A 1Q3DA 4AF3A 2R3RA 4MNFA 5JFSA 2C69A 2X6DA 2E9PA 3LXLA 5HO6A 3I5ZA 4KSPA 4EBVA 1M7QA 4YJOA 2RFDA 3HMMA 3OBJA 3FZTA 3NUAA 4OAVB 5EG3A 4D4VA 4MBJA 3F3ZA 2C47A 3R02A 5J95A 3RM6A 3FC2A 4CFNA 4DC2A 2F7XE 2VZ6A 3DQWA 1YDTE 4V01A 1Y8YA 3JY0A 1F0QA 4FR4A 4O0XA 3TNQB 2F2UA 4E4XA 2ITOA 1Z5MA 2WQOA 3BWFA 4U5JA 4AZFA 3F5PA 4BTFA 1QMZA 4ZZOA 2OSCA 4NU1A 3E8DA 4RVKA 2XA4A 3KXHA 2JEDA 4Y72A 2EWAA 4D2PA 4D4SA 3PRIA 5DEYA 2CN8A 1AGWA 4J99A 2XNMA 2W1HA 3K2LA 4ZLYA 4CVAA 3ZO3A 2W9FB 3QCXA 2XM8A 3BQRA 5F94A 4RT7A 4USFA 4XJ0A 3K3JA 4FV5A 5IA1A 2R4BA 5E8ZA 4EHZA 5BUIA 3NYXA 2V22A 2FA2A 4ARKA 4U3YA 2QO2A 2FSOX 3A8XA 1H1WA 3D7TA 2A19B 3FZ1A 3RK7A 3SG8A 1IASA 1RE8A 3D4QA 4NW6A 4XX9A 4P5ZA 3D14A 3CQUA 2QQ7A 3MI9A 4JR7A 4KSQA 3PP0A 4RWLA 2UW7A 4H36A 4PY1A 4FE2A 3ZFYA 4FVRA 3MPMA 4JIKA 4L6QA 4QRCA 3U55A 3GCSA 3CD3A 4L42A 2QHNA 3QC4A 4WG5A 3GT8A 4ZS0A 3WYXA 3V5QA 2WMVA 3KMUA 4JL9A 4LUEA 4AOTA 2B9HA 4RZVA 5GJGA 3W2QA 5CNOA 3R04A 4XG8A 2Q83A 4Y5HA 4ZMEA 5FEEA 4C4JA 3R01A 1R0PA 4CQGA 3CS9A 3P08A 3UOJA 2OF4A 5FP6A 4RLKA 4DITA 4ZY6A 4YUQA 4OLIA 4CLJA 3LLAA 3ZFMA 4LYNA 2VGOA 1IRKA 3IKAA 5M56A 4FEWA 3ZZEA 3NMUF 4FV9A 4MBIA 3LFQA 4IX6A 1J7IA 4QYYA 3VF9A 2BZIB 2YZAA 3EQPA 3MVHA 3DK7A 4FSYA 4MF0A 5E8YA 4IZ5A 5FRIA 5TKDA 4BIDA 3QHRA 3IGOA 2I0EA 2WPAA 2W9ZB 3GOPA 5TF9A 3KMMA 3RZBA 4KAOA 2XKDA 2ZAZA 3WF9A 2J5FA 3HLLA 3R22A 3AC2A 4DEAA 2HZIA 3L9MA 2CPKE 3LQ5A 4W4VA 3UZPA 3W8QA 3CKWA 4ZTHA 1TQMA 4IZYA 4HW7A 5FD2A 4AGWA 5FDPA 2CSNA 3ORIA 4F99A 4DH5A 4Y73A 3S3IA 2FYSA 3LHJA 3E7VA 4FV7A 1H1QA 4LL5A 3LCSA 3MVMA 5FTQA 4DA5A 1RDQE 2ITQA 2NRYA 3V5TA 3UP7A 5AUUA 2YJSA 4A4OA 3TTJA 2G01A 4ANMA 2Y9QA 2EU9A 3BELA 2OG8A 3VS7A 3S00A 3JY9A 5IA2A 2XBAA 4ANOA 4OT6A 2IVSA 5KE0A 3D0EA 3Q53A 4FVQA 4RFZA 2WQBA 3EQRA 4NL0A 4F0IA 2OWBA 4C37A 2JC6A 2WZJA 2YIRA 4X3JA 3MFSA 3ZO4A 4L9IA 1WBTA 4H05A 3HRBA 3DLSA 3Q5ZA 4FG8A 4WT6A 4W4XA 5JT2A 2PUUA 1W98A 3FL4A 5AP1A 4G16A 4F1MA 3OWJA 4ZTMA 1DAWA 2OIBA 1CSNA 1JKKA 2OJJA 1CKPA 2ZM1A 4J8NA 2YM4A 4FGBA 2BFXA 1OPKA 1FGKA 1QPDA 1V1KA 3Q9XA 4AA5A 4BDGA 4FTJA 4U9AA 4BBEA 4O7TA 4O0WA 3RAWA 5IQHA 3K5VA 1E9HA 4QOXA 4EWHA 4ZK5A 5LVPA 3OW3A 3TI1A 4AUAA 5J7BA 3LJ0A 5KBRA 2WGJA 5CNNA 2GQGA 5CU6A 3OVVA 4EJ7A 2P2IA 3V5LA 5JEBA 4CT2A 2QO9A 3MJ2A 4YJNA 5M44A 4IMYA 2WTJA 2REIA 5AAFA 5JN2A 1BI7A 4R3CA 1W0XC 3QA8A 2ZJWA 3TJDA 4BCKA 4FSTA 5CSHA 4A9YA 5M4UA 4O81A 5LMKC 3LMGA 3LM0A 1DI9A 1GZNA 4FOBA 5T3QA 4ZTRA 4BKZA 5CANA 3FHRA 4KBKA 3KXMA 3ORPA 4FUYA 3A7JA 1KV2A 2E9VA 2UZOA 4HPTE 3RCDA 5HTIA 3WE4A 1Q41A 1STCE 3H3CA 4XRJA 4G34A 4DEHA 1PJKA 1W8CA 4O7VA 2F2CB 4ASXA 5IUIA 4JJRA 3HV4A 3UO5A 4J52A 3AD5A 4NCTC 3LCKA 5GZ9A 3FY0A 3R73A 2F49A 3QRTA 4FKUA 2C5VA 4MQ2A 2ONLA 3OCTA 4BDIA 5LCJA 2YDIA 4EJNA 4DH8A 3QALE 4ZSJA 2PVKA 3AC3A 3H9RA 4I3ZA 4DEGA 3UMXA 4QP9A 2ETMA 4WNKA 1O9UA 1UNLA 3U6HA 2VNWA 4ALVA 4EWQA 4HZRA 3BHVA 3NUYA 2R3KA 4QQJA 5ANKA 2YZLA 2UUEA 5HNBA 3BHYA 1OKZA 2C6KA 2E9NA 4I0TA 1Q62A 5EI8A 4CFWA 3FXWA 5H8GA 4C38A 5JFWA 3EN5A 4EOQA 2OXYA 4WHZA 4FL2A 2HIWA 5LVMA 3D2IA 4B0GA 4F65A 4HPUE 4U79A 1REKA 1H26A 3JPVA 3RALA 4ZJVA 3SC1A 3F5UA 4FT7A 3E93A 1JKLA 4CFXA 3RK9A 5D1JA 3HVCA 3LFAA 2GHLA 4GYGA 4NM0A 3V8WA 4W9XA 2O63A 3ZZWA 2YISA 4I5PA 4RX7A 3OP5A 2OF2A 3NWWA 4QMOA 2Y7JA 4X3FC 2A0CX 4HVSA 3D5XA 3AMYA 1J1BA 4M0ZA 4FL1A 4UEUA 1DM2A 1KE8A 3K5UA 3SRVA 1YHWA 5BYYA 5LOHA 4ITJA 4E7WA 4HJOA 4P2KA 3DKCA 3PSBA 3MDYA 3KVXA 4YSMA 5CAOA 2DQ7X 2WMTA 2BZHB 3P5KA 4OW8A 2BKKA 1XQZA 4D4YA 4F09A 1J1CA 2JKOA 2IW9A 3TIYA 1YWVA 4RQVA 3C4ZA 2ITNA 3GBZA 3CTJA 4YZBA 4O1PA 5DGZA 4ANBA 2WELA 3DBDA 4CSVA 3G51A 3GU6A 1XBAA 3NUSA 4W8EA 2XK4A 3DK6A 4IAAA 2Y6MA 2H9VA 1PMNA 2VWXA 4QP3A 4XOYA 5IEYA 3AC4A 2GQSA 3ORXA 5L2WA 3HRCA 5EM8A 3EQDA 4DFZE 1DS5A 1JVPP 2QU6A 2ITTA 3G9NA 4EOJA 2BMCA 3K54A 4U0IA 5EKOA 3G5DA 3BPRA 1JAMA 4K2RA 4BCHA 3BCEA 2BAKA 2QNJA 3UIMA 3F3UA 4UBAA 4OAUC 1Q99A 5M09A 3QD0A 5H2UA 3TNIA 3GEQA 2ETKA 4NTSA 4QMTA 4AWIA 4BDJA 3EQGA 3OWPA 5GINE 4FNXA 1PW2A 5IF1A 1U46A 3C51A 3QHWA 4MHAA 4XP3A 1TKIA 5BVFA 3L8PA 4K18A 2W0JA 2YCSA 4EOLA 4EYJA 3EZVA 4FUXA 4G6LA 4FZFB 3DJ7A 1FOTA 2UW4A 3GENA 3QQKA 3QZFA 2J90A 1NVRA 4AW0A 3PYYA 1OKYA 3F6XA 3MTFA 4XMOA 4JI9A 4O38A 1XHAA 2VTLA 4U8ZA 4I20A 2RG6A 2QOCA 5IH5A 2ZMCA 1XWSA 2ITYA 2QOKA 5FDXA 4IVCA 5T68A 5HG7A 4R77A 3JR1A 5KKRB 2VWBA 4WRGA 1OMWA 4EBWA 3Q4TA 4E6DA 3U4WA 5DFPA 3EWHA 2O0UA 2X8DA 1IEPA 3FJQE 3QYWA 4V0GA 3RBWA 5BUJA 3COHA 3ZSHA 5EYMA 4MXAA 4GG7A 5M55A 2R9SA 4RBLA 4DGLC 4TYGA 1XH8A 1HCLA 4D2RA 4DEDA 3DKOA 1XJDA 2ZM3A 1ATPE 3HMIA 4X2JA 3AXWA 3DDPA 3ZU7A 4F7JA 4QP8A 4O6EA 3DXQA 2PWLA 2CHLA 5J5TA 2PMIA 3MJ1A 4YTFA 5K5NA 3MA6A 4FIHA 2ZM4A 2OFUA 2CN5A 3TKUA 2OIQA 4D28A 2XNOA 3VC4A 3QTQA 4NWMA 4NTTA 3ELJA 4D55A 4RJ5A 5K4IA 2V0DA 3R9HA 2BRHA 3R1SA 4C3FA 4G3FA 2JKMA 4F9BA 4DCEA 3LFDA 2PVJA 3ORTA 3NRMA 3U9CA 4D58A 3FI4A 3D5VA 5CEKA 4IB0A 5CSVA 3UOLA 2B9FA 2XB7A 2RF9A 1R39A 4I6HA 4MBLA 5ACBC 5H9BA 5DT4A 3PJ2A 3QTSA 2YABA 3F88A 2BRGA 4TTHB 3R9NA 1OUYA 1SVHA 3FSFA 3KULB 4K1BA 3L9LA 4TYEA 3RKBA 2WIPA 4PTEA 4WOVA 4PMPA 5I9ZA 3IS5A 3NSZA 2PVHA 4GT4A 5DR9A 1Q4LA 2QLUA 1LEWA 3LLTA 4LRKA 5LJJA 5BVKA 2H6DA 3FZOA 4UYNA 3FQHA 4BB4A 4C58A 4GK2A 3R00A 3TNPC 1RW8A 2QURA 3OXZA 2YCQA 4TYHB 2Y6OA 4OBQA 4FTNA 3ZLYA 1YKRA 2XIRA 4IWPA 4ZSLA 2QOHA 3E7OA 3AMAA 3Q9ZA 3BX5A 3KU2A 1Q8UA 5F1ZA 4FKSA 4DLJA 2R5TA 2VRXA 2ERKA 1IAHA 4GV1A 3PXZA 2PU8A 3LFBA 3RPSA 4BTKA 4L3JA 4GUBA 5CX9A 2GPHA 1PXOA 3D83A 4FSNA 4LGGA 4XBRA 2OU7A 3AQVA 1PMUA 2IO6A 1GNGA 2BIKB 5HVJA 2IG7A 4XG6A 3BGQA 4F6UA 4AW2A 2BILB 4F0FA 2R7IA 4BF2A 2J0MB 4FSUA 4ASDA 5E4HA 2JDTA 4BGHA 4A9UA 1U4DA 5EI2A 1OL1A 4DTAA 4DLIA 4W4YA 3C4CA 3W10A 4FTKA 4XBUA 5A4TA 2PSQA 2B7AA 4LMNA 3IG7A 4FTCA 3RTPA 4EK3A 5CF4A 4R5SA 2H96A 2IJMA 4AZSA 2JBPA 3COMA 3Q5IA 3ROCA 4CYIA 5CEOA 3OMVA 5EDPA 3MFRA 3O8UA 3FI3A 4BBFA 4YLLA 3QQGA 3R2BA 4P5QA 3UGCA 5I5ZA 3EKNA 3PJ1A 4O0RA 4CTBA 2EXEA 1OM1A 5CEQA 3TL8A 4EQUA 4Z7HA 3AC5A 5EYKA 4G6OA 3I6WA 3VS3A 4FSZA 4OTQA 1R0EA 3WYYA 4NCTA 5CF5A 3CKXA 5K9IA 3MFUA 1B39A 2YAAA 1SZMA 4FZ6A 2XIXA 3QTRA 1VYWA 4AE9A 3BEAA 5FTGA 4UMUA 3RAKA 2WEIA 3TKHA 3VBXA 3RPYA 4Z7GA 2CNUA 1YWRA 2X8IA 4IIRA 4E5AX 4QMSA 2WMSA 4NT4A 4O21A 4RIWB 3HAVA 5CI6A 4AGCA 4LRMA 3DDQA 4FBXA 2XUUA 3QRIA 3DJ5A 3DV3A 2PVRA 1WBSA 3PUPA 1PXIA 5HI2A 2J6MA 3ZRKA 1VYZA 3CPBA 5A14A 2GHMA 4MWHA 5HX8A 4BI0A 2C3LA 5AUYA 2VTOA 5BX0A 5DOSA 3MESA 1GOLA 4MXCA 1J91A 2OZAB 5A46A 4ID7A 3EFLA 2HXQA 4O7YA 2CMWA 1OZ1A 2W7XA 4L7FA 3JVSA 3BYOA 4M12A 3UYSA 3P23A 3GB2A 5AP5A 4B6LA 4KS8A 4IJ9A 4BDKA 2X39A 3OCBA 1P4OA 4U44A 4IDTA 5J5SA 5BMSA 1NVQA 3PWYA 1O6LA 2V7AA 4ACHA 1GJOA 2EXMA 5EFQA 4G5PA 3UNJA 2W5HA 5B2MA 3RAHA 4FC0A 4IANA 4EK8A 2WHBA 2G2IA 4JIAA 3KB7A 5L2IA 1YDRE 2UW9A 4OR5A 5DVRA 3OZ6A 1ZOEA 3PIXA 5HCYA 1NY3A 3BYMA 4BYIA 5IU2A 4MXYA 5HEZA 5HORA 4N6ZA 5EW8A 4RSSA 5LARA 3R8PA 2XVDA 3MH2A 3QA0A 4X2KA 5FBOA 2C6LA 3KXNA 2YIYA 4IQ6A 4EH2A 3DBEA 5CEIA 3V01A 3A7GA 4U43A 3R21A 4C4IA 3VO3A 4XG7A 5AP7A 3RAIA 2VTRA 2W1DA 2O65A 2YM6A 3F3WA 3JXWA 3MH3A 3DGKA 1SVEA 3OY1A 4H3BA 3W32A 3ET7A 4DN5A 3KRJA 3I0QA 4FK3A 4L44A 4HGEA 3QD3A 4PDOA 5AIRA 1ZAOA 2UZTA 2XIZA 3GXLA 4FV1A 3TCPA 5KMMA 3V04A 5IQFA 4E93A 4FKIA 4WG4A 4O2PA 3O71A 4YZDA 5HKMA 4H3PA 1JSTA 4OTHA 4FIJA 3DA6A 3PPZA 5EM5A 2QOBA 1ZMVA 2B9IA 2UW8A 3UG2A 3RVGA 4BCIA 2QG7A 4E4NA 4OTPA 3KXXA 1H0WA 3V6SA 5CAVA 4HNIA 3E5AA 5HNIX 4E5WA 1J7LA 1CDKA 5KKRC 3LFCA 5AV4A 3A4PA 4O7WA 2BTSA 3PJCA 1H24A 3DNDA 5CZHA 2JD5A 2VTNA 3MVJA 2IVUA 4HYIA 3P86A 4Q5EA 2UZBA 3BKBA 1UWHA 5AR2A 3UTOA 4DTKA 2YIQA 1XBCA 4BCGA 3OFMA 4O91A 3AGMA 4M7IA 4DG3E 4QP2A 5LXMA 2ITVA 3NYOA 5KMNA 4L45A 3ATTA 4QP4A 1ZZ2A 2C4GA 2I0YA 3NEWA 1PF8A 3VJOA 4EK6A 3I60A 5A6NA 2PK9A 2XBJA 5BVWA 5AADA 1PXPA 3Q96A 2P3GX 3D9VA 2ERZE 1YQJA 5L2QA 3FLQA 2VO6A 4ZIMA 4MXZA 2R3JA 5EOBA 4UB7A 4AA0A 3D94A 4GIIA 5IKWA 4EC9A 1WBNA 3QRUA 1P5EA 3ZLXA 2W5BA 4CZYB 4G9CA 4L8MA 4C4EA 1ZRZA 2X2LA 4KKGA 4BN1A 4QYGA 2IVTA 3LOKA 4IHPA 5IQBA 1X8BA 2QVSE 4D1XA 2WMXA 3EFKA 1MP8A 3QZIA 4GJ3A 5K0KA 3Q60A 3ZMMA 3UQGA 4RFYA 2W4OA 4KKHA 4PV0A 4KUJA 4N0SA 2UVXA 4QT1A 4GMYA 2GNFA 4FG7A 3E8NA 4UV0A 5I3OA 2BDWA 4MKCA 3HYHA 4WSYA 4XP0A 4YZNA 4HGLA 1IA8A 3QWJA 2XH5A 3UPZA 1XH5A 1LEZA 3FZSA 3ORZA 5BVEA 5DBXA 3CQWA 1PHKA 4AGDA 4DFBA 3O2MA 1HCKA 1RJBA 1U59A 4IZ7A 1QCFA 3E92A 2Q0BA 4QO9A 4BDCA 4CEGA 4KABA 4FKWA 4EH4A 3WZEA 4K77A 1YOLA 3ZM4A 2XRUA 3ZOSA 3I0OA 5IDPA 5AUTA 4UX9A 3DB6A 4OUCA 4UWYA 2R64A 2R3MA 2XJ1A 3VS5A 4DBNA 3MY0A 4U97A 5A9UA 3RK5A 2UW3A 3QBNA 2YACA 1VR2A 2H8HA 2PHKA 4C61A 3R6XA 5LCKA 4CFMA 3DBCA 5IQEA 2OKRA 4LGDA 3R8ZA 3UOHA 3LM5A 3O51A 3IDPA 4Q9ZA 4G9RA 4WNPA 3R1QA 4AOIA 4YNEA 1SNUA 3O96A 3DJ6A 5C27A 3TV6A 1FGIA 1PXMA 2WNTA 2C0OA 3ALOA 3CCNA 2XJ2A 2B9JA 3EZRA 2VX0A 3JYAA 5HZNA 2X7OA 3P9JA 1FMKA 3EFJA 3TZMA 3VULA 3VUIA 3HZTA 5FXQA 4DFNA 5J1VA 2WTKB 4EHGA 4YTHA 4I6QA 4PP7A 2NO3A 5DH3A 3E63A 1KOBA 3EN7A 3S4QA 4BDAA 4YC6A 4F1TA 3L8SA 4EHEA 2XEZA 3A7FA 3R7GA 5AV0A 3OUKA 4ANNA 3ZYAA 3COIA 4DH1A 2GCDA 5EM6A 3BWJA 4CXAA 4XH6A 4JRNA 1Q5KA 2V62A 3FMDA 3DLZA 3HNGA 4FKPA 3CLYA 1TQPA 5AJQA 3LJ2A 4UXLA 4XP2A 4EZ3A 2Y4IB 4MAOA 3NNXA 2R3GA 2Y4PA 3DU8A 4ZTLA 1WFCA 3KREA 5CENA 2CCHA 1OUKA 3RCJA 2ESMA 3POOA 4L00A 2YM3A 4GRBA 2YA9A 2AUHA 4Z3VA 5AM7A 3L9NA 5CT0A 2B53A 4JDKA 2O2UA 2UZUE 2QKWB 4CRLA 5C8NA 4RJ8A 2WKMA 4G31A 4R5YA 4FKLA 4CMOA 5CS6A 3LMIA 4GVAA 3QWKA 5IQIA 3DCVA 4I4EA 4DG2E 5KMJA 4IB3A 2CKOA 4OTDA 1VEBA 3QQJA 4IACA 4WRSA 4E4LA 1JKSA 2OJFE 3HDNA 5AUVA 3A61A 4ZP5A 1V0BA 5FM2A 3QQFA 5KNJA 3KY2A 1SMHA 5JZNA 5CSXA 4GH2A 2CKQA 3OCSA 2Z7SA 2VO3A 1PY5A 2NPQA 4UZHA 4XV3A 3C9WA 5KBQA 5CXHA 3QKLA 2UZWE 3AGLA 3FMHA 5IA3A 1YOMA 4F6WA 4M66A 1EH4A 3S0OA 5IUGA 4N6YA 2W06A 4LRJA 4L46A 2VX3A 1M52A 3TG1A 2KULA 1YI4A 3QQHA 3CR0A 1GY3A 1OKWA 3HP5A 4QP1A 1PXKA 2HW6A 4KIPA 1SNXA 4QP7A 2JGZA 1H00A 4E20A 4O2ZA 3NNWA 3WIGA 3QTZA 4CNHA 4BDBA 5I9VA 3D15A 4D0WA 3OOGA 2GNJA 3ODYX 2UZNA 4CV8A 4IAIA 4LOOA 4D5HA 4L01A 3A8WA 3E8CA 3WBLA 4BI2A 3FLYA 4IC7A 1R3CA 4FV3A 1OBGA 4DT9A 3BQCA 4O0SA 4TYIA 3M1SA 4FV4A 5HBHA 4FODA 5AP0A 3R0TA 3VRYA 3DTWA 4NKSA 4EKKA 3OS3A 4D2WA 2C30A 4A9SA 5M57A 3OOMA 2BCJA 4BHZA 1UNGA 4IJPA 2YHVA 3F69A 3PXYA 5BYLA 3TDVA 4R1VA 4UALA 4YJVA 4QMQA 2UZLA 3QQLA 3NIEA 3QYZA 4MD8E 4A07A 4RG0A 3RI1A 5AMNA 4AZTA 1KV1A 1UU7A 3OEFX 5AP3A 4BYJA 4IWDA 4UWBA 3OTVA 4Y95A 4Z55A 2WMAA 3GP0A 3NCZA 3QQUA 4JNWA 4C3RA 2QR8A 4WUAA 4AACA 4D2SA 3FZPA 2W1FA 2WTWA 3POZA 3F66A 4K6ZA 3BI6A 4ZSEA 3COKA 4MEDA 3UO4A 4GCJA 4MVFA 3ZDIA 2YDKA 1XH9A 4YO4A 4E1ZA 4G6NA 5TT7A 2YJRA 2XZSA 2HOGA 3MGYA 4NZWB 3ORMA 1WBVA 3UG1A 3ULIA 3A99A 5EW9A 5FP5A 1U54B 5JFXA 2GFSA 2XYUA 4IZAA 2PTKA 2BAJA 1J7UA 4EH3A 5JZJA 4PL5A 4JG6A 4Y85A 2CDZA 3SX9A 1BL7A 2PE2A 2WMRA 5HO7A 4HYSA 2NNWB 3CP9A 3CXWA 4QPAA 3ZXZA 3MIYA 4QMZA 3DZOA 4DEIA 3ZBXA 2XP2A 1IR3A 4QD6A 3SVVA 5CTPA 4Q9SA 3TT0A 4IC8A 4CKJA 1Q61A 3PY3A 5ACKA 3OF0A 5J79A 1QPCA 4UYAA 2ZB1A 4WA9A 4IVBA 4IW0A 2OH0E 3W16A 3QX2A 3HDMA 4M3QA 4C3PA 2I0HA 4DTBA 2I6LA 3DAEA 2V5QA 3MWUA 4BI1A 1YXUA 2YERA 4QYFA 5CU2A 5J7HA 3D7TB 5FTOA 3EQCA 5B7VA 3VBVA 4DEBA 4NJDA 3P7BA 4B9DA 2VV9A 3TV7A 3RPVA 4ZAUA 1XH4A 3OTUA 3Q3BA 4FSWA 4FV8A 2WTCA 3IOKA 4J96A 4KS7A 4FIEA 3V8SA 4QMLA 1ERKA 3ZXTA 3U9NA 5KMKA 4X6RA 2X81A 2GDOA 3VUTA 3DS6A 1TQIA 1OL2A 4AAAA 4RZWA 3FKLA 3GFEA 3D7ZA 2QI8A 3WIKA 4N57A 1A48A 5C8KA 4TWCA 1QPEA 3NUPA 4ACDA 1WVYA 4FGRA 3R8LA 4CLIA 2QOOA 3WOWA 3RINA 2WIHA 3M11A 3EMGA 4FVPA 4J98A 1Y57A 2Z60A 1NXKA 2X4FA 3ENHA 3FHIA 3TDWA 2RL5A 1UA2A 4HZSA 4TWNA 3FMJA 3OBGA 3OXIA 2C6IA 4DAWA 2C5YA 2UW0A 2QLQA 4XOZA 3SGCA 2V7OA 4FSQA 4KRCA 4ZSGA 3S2PA 2XKFA 4K11A 2F7EE 2G2FA 5J9YA 3FLZA 3GNIB 3HA6A 2I40A 3H0ZA 3A2CA 3GU5A 3HMPA 3SKCA 5I9WA 5CU4A 1JOWB 2BUJA 5TO8A 4NK9A 5HX6A 2R3FA 1AQ1A 3Q32A 4ASZA 3IOPA 4TT7A 2P4IA 2R3LA 3HX4A 2F57A 2PZYA 4NIFB 1QPJA 3KULA 4CFFA 3HAMA 5HD4A 2SRCA 2CKEA 3DQXA 3FQEA 1Q8YA 4UWCA 4ZEGA 2VWUA 3OWKA 4YC8A 4EOKA 4C4HA 4L52A 2CLXA 2HXLA 1OKVA 2C3IB 3V3VA 1MQ4A 2NRUA 2QOQA 1NVSA 4QPMA 3MV5A 3LXPA 3QD4A 1UKHA 4TYHA 5AR4A 1G8AA 3O7LB 2RIOA 4EH7A 2AYPA 3VQHA 4A4LA 4U3ZA 4IB1A 3EYGA 1PRYA 2E2BA 2IWIA 2JFLA 1SM2A 1WVXA 3GC9A 5DIAA 3WARA 4EOIA 2CCIA 4I23A 4H58A 1OIYA 4JDJA 4RPVA 4C59A 1YHVA 2HENA 2IZUA 4I1ZA 5E1EA 3W2OA 5A4QA 2R3HA 2XMYA 3QTIA 4C4GA 2VWVA 4EQMA 1UVRA 2ZDUA 3NDMA 4FEUA 3PXFA 4XHKB 2VTMA 4F63A 4PNIA 2WTDA 4DBXA 5C26A 3BE9A 4C2VA 4ALUA 3V5WA 2UV2A 1O6YA 3O8PA 3MBLA 3C50A 4PL3A 5EHLA 3E87A 3R8MA 5CAPA 1OL7A 4O7LA 1Y6BA 1UKIA 2Y4IC 4DH7A 1LPUA 3GU4A 5GJDA 4IBMA 4S33A 2IVVA 3IQ7A 4XLVA 4R7BA 4CG9A 4RGJA 4AZWA 4GS6A 3DBFA 2VTHA 2PULA 4CG8A 1KE7A 2JDOA 4BCPA 5E8SA 3QF9A 3ZH8A 3CJFA 3EYHA 5G6VA 1SVGA 2X1NA 2J0KA 3SW4A 2X7GA 3FLWA 4PL4A 4F1OA 5ETIA 3NIZA 2HK5A 3ZSGA 3A4OX 4YU2A 3RNYA 5DWRA 3LCTA 4FZAB 2Z8CA 4PPCA 4QMWA 3PG1A 4DINA 5J9ZA 5GHVA 5A4LA 4IX3A 2BTRA 5C01A 4DGNA 1P14A 2FSMX 5AAGA 5CLPA 2HY81 3Q6UA 3PIZA 4JXFA 4LGHA 3QC9A 1JKTA 3QRKA 3UDBA 4WIHA 3UOKA 4QMVA 5BVDA 4WG3A 3V51A 4NJ3A 2VD5A 3AG9A 3I7CA 5CXZA 3V5JA 3FEGA 3FQSA 4AZVA 1AD5A 2R7BA 3UVPA 1CM8A 5C4KA 3QKKA 4QP6A 1P2AA 5D9HA 4XV9A 5CVGA 4E6QA 3HA8A 5HIBA 4DGMA 3ACKA 1ZARA 3HKOA 4GKHA 2XJ0A 4P7EA 5EKNA 5IA5A 4TRLA 4DF3A 3KN5A 1YVJA 4KNBA 3HV7A 2OZAA 1BX6A 3P78A 3ENMA 3JUHA 2GTNA 4HGSA 1PKDA 4ANQA 4IM2A 3FAAA 3TXOA 3WI6A 4EL9A 2JIVA 4U45A 3U8WA 2HWPA 3VS4A 3UQFA 5M08A 4QTAA 3LCOA 4OGRA 5FXRA 4OTGA 4D5KA 4FNYA 2WB8A 2OZOA 3P79A 4EHVA 4ZY5A 4G3GA 1WMKA 3C5IA 2RGPA 1OPJA 1BKXA 4YJRA 2FVDA 5EQEA 4FT0A 4XLIA 4K33A 4MYGA 4CZTA 5JGDA 4NM5A 3CD8A 3C1XA 4UZDA 4AX8A 3NYVA 3PA5A 1GZOA 4I0RA 3EL8A 1JBPE 2ZV7A 4V05A 3CTQA 2EVAA 3LPBA 3PP1A 4YTIA 4BL1A 4F4PA 4MCVA 4IM3A 4RVTA 5DRDA 5FBNC 5AUZA 5HLPA 5C9CA 4C62A 5ANJA 4IVDA 5LVLA 2XK8A 4D9UA 3EHAA 4AN3A 5M4FA 5L4QA 4NEUA 3ZBFA 3Q2MA 2VN9A 2GS2A 3GCPA 3LXNA 4FSMA 3FPMA 4Q5HA 3SA0A 4J95A 2J0LA 2YIXA 4FOCA 4K8AA 3TZ8A 4FI1A 2PL0A 2XNBA 2C3KA 1XBBA 3BV3A 4YBKA 5IH4A 5HICA 3AMBA 1OPLA 4AG8A 4UMPA 3UE4A 4HVDA 1T46A 1ZYJA 2H34A 4TL0A 2PUNA 4FZ7A 1URWA 5L8KA 3G2FA 2XM9A 1Z9XA 4R78A 4K9YA 3C4FA 2W99B 4FT5A 5K0XA 4DFUA 1FVTA 2ITUA 2ACXA 3PA3A 4O27B 4RIXB 3Q2JA 2WTVA 3CTHA 2PVMA 3DAJA 3PXKA 1PXJA 3CBLA 2DYLA 4FIIA 4QMYA 1IAJA 4GK4A 1KOAA 4YLJA 3UZRA 4UY9A 5JGAA 5HU9A 5IG1A 2X0GA 4E4MA 4MXXA 3BV2A 1YOJA 4C02A 4XV2A 3TZ7A 4HVHA 2JIIA 3QGWA 3TNWA 4BCQA 2E9OA 3BGPA 1OIUA 3CY2A 3O17A 1VJYA 4NM7A 3O50A 4RC4A 4Y83A 5LWMA 3FI2A 3DY7A 2ZMDA 3KRLA 4IVAA 4RX8A 3SAYA 3VNTA 5L3AA 3DNEA 4DCAA 3ZRMA 5HTCA 1UU3A 2VU3A 4H1MA 4YO6A 2GMXA 1FVVA 3SOAA 1OIRA 2IN6A 4BWXA 2ITXA 3IO7A 2OIDA 4NM3A 3QZGA 1OECA 4S31A 4TY1A 3VBWA 4AT3A 2J4ZA 3CSVA 1BUHA 3NPCA 4IAZA 2FH9A 3I1AA 3T3UA 4G3EA 4EI4A 3BEGA 5D11A 3R1YA 3TWJA 2BRBA 4B4LA 4Y46A 4JR3A 2F9GA 1K9AA 3H10A 2VTJA 3MIAA 4ZLZA 3QCQA 4O86A 2BDFA 4CD0A 5A4EA 3VS1A 3MB6A 3R9DA 5ANGA 4HVIA 3GCVA 3R7UA 4JAIA 5IQCA 2QOIA 4FKVA 3ZRLA 3VBQA 5KMIA 3RWQA 1FBNA 2WQNA 3FY2A 5M4CA 1ZYCA 3IW6A 2JAMA 5AR8A 4BC6A 3KRWA 2X6EA 2R3QA 2W17A 4YTCA 2XK3A 3PG3A 4PX6A 4GT3A 3Q4UA 3R8UA 3N4UA 5M07A 4YLKA 2WFYA 3PVBA 3IW5A 5HCZA 4ZS4A 3FC1X 2HZNA 3C7QA 2VTPA 4I41A 2Z7RA 3D2KA 3HV3A 4D2TA 3EN9A 4MD7E 3KF7A 3U87A 2YCFA 2QONA 3FI8A 3PVWA 3A60A 3FL5A 3EB0A 4IWQA 2ZYBA 3HUBA 4J97A 2FSTX 3F61A 4GFMA 4U7ZA 5GNKA 3MSSA 4JG8A 5E8WA 1Y6AA 4ZY4A 3MY1A 1CTPE 2Z02A 3ZSIA 3B2TA 4NFMA 4KA3A 4KWPA 3EN6A 3IPHA 4FEXA 3FMKA 1W83A 4PF4A 5CZIA 5AV3A 1MRVA 3JS2A 3FXZA 1KWPA 3U51A 4QMNA 2HZ0A 1ND4A 5JK3A 3ORLA 1HOWA 2YM7A 3GI3A 3MN3A 4YBJA 4BDEA 4C2WA 4FV6A 2X9FA 4MH7A 2PZRA 4M84A 2IW6A 4FTMA 3VWAA 4CFVA 5AV1A 3SXFA 3TKIA 2EB3A 3D5UA 2OW3A 4Q2AA 3UQCA 3WZKA 3NUXA 5E8TA 1JNKA 2Z7LA 4RIYB 1KE9A 3RZFA 3OC1A 2XNPA 3G6HA 3ITZA 4FYOA 1GZ8A 3ATSA 2PUIA 5HGIA 5HBJA 5HIEA 3RJCA 5HG8A 1ZYDA 3KQ7A 2G9XA 5DYJA 5EI6A 4C7TA 3FMLA 4O22A 2HZ4A 5K3YA 4EOSA 4DG0E 3G90X 4YSJA 5ETAA 5JRSA 2FSLX 3QZHA 4HGTA 1Q8TA 5A3XA 4USDA 5DRBA 2GQRA 1YXVA 3E8EA 5E8VA 2OH4A 3VVHA 5CWZA 2A1AB 1ZMWA 3UBDA 3PE2A 5ITAA 3VHKA 5IZFA 1NT2A 1H08A 5JH6A 4CGAA 3ZLWA 2G15A 1WBOA 4J7BA 4R3RA 4CTCA 5M4IA 5EQYA 2WMQA 4AW1A 3C4WA 5GIPE 4IX4A 3G0FA 4JQ7A 3HGKA 3M2WA 3W8LA 4C0TA 4ENYA 1GIHA 5HLNA 3FBVA 2BR1A 4S2ZA 4RIOA 3NAYA 3I79A 3H30A 3NAXA 3HMNA 4IM0A 4QNYA 2F7ZE 4C4FA 3UVQA 5KCVA 3BRBA 3DFAA 4CV9A 1H8FA 3PA4A 3BU5A 2B0QA 3ID6C 1RQQA 2UVZA 2PVLA 3LCDA 4L7SA 5AEPA 4RWKA 4C33A 5AR7A 3VHEA 4JOAA 1KE5A 2C1AA 2OK1A 3TUBA 2UZVA 4CRSA 2A27A 5CF8A 1H4LA 4YNOA 4G2FA 4BCJA 3EH9A 4HCUA 1KUTA 2I7QA 4USEA 3B8QA 4HCVA 5AX3A 4YP8A 2VO0A 3SD0A 3VBYA 3MA3A 4QMPA 3ALNA 3NX8A 1WVWA 1OB3A 2BAQA 1W84A 2KTYA 2O3PA 5DLSA 4FTAA 4X0MA 3ZUUA 4APCA 2XNNA 4XG2A 3ACJA 4X2GA 3VN9A 4KIKB 2PUPA 4F9CA 3MS9A 5KHWA 5D41A 2Z7QA 5A4CA 1NA7A 3F9NA 4FKOA 5FQDC 4FTUA 3DTCA 3OXTA 3C0HA 3WF7A 4DFLA 1H27A 2Y0AA 4IEBA 2OJIA 2C6MA 4JBQA 4BGQA 4YJTA 3IW8A 3ZHPC 4XNEA 3QLFA 2WMUA 3UC4A 3RHXA 5H8EA 1UNHA 4ZJIA 4ZXTA 4EH8A 1ZZLA 4XS2A 3TN8A 1JPAA 2P2HA 1M14A 4EH5A 4GJ2A 2QCSA 1R1WA 4GT5A 5HLWA 4CKRA 4TNBA 4GL9A 2CNQA 2BROA 4D1SA 3HEGA 1OVEA 3PPKA 4F64A 5GZ8A 3C5UA 5I3RA 3T9IA 4RA5A 3QTUA 1Q8WA 1ZY5A 2VAGA 4GEOA 4FKQA 3T8OA 2XS0A 5E1SA 5ETFA 4QTEA 4BKYA 5JGBA 5EYCA 1XR1A 4J71A 5D10A 4OT5A 1XO2B 3ZO2A 5AA8A 5IEVA 5B0XA 2GNIA 3BZ3A 2R0UA 2W05A 2J9MA 3VF8A 3Q4CA 1W7HA 5AP4A 4KB8A 2NP8A 3KFAA 1FQ1B 5EHOA 5KZIA 5E7RA 4BCNA 1A9UA 1YXXA 2CJMA 3CPCA 3KRRA 5AWMA 4G3CA 3V5PA 4FT9A 4L3PA 4TWOA 5ANOA 4AFJA 2OI4X 3LE6A 1E1XA 3N9XA 4M13A 4F7LA 1M7NA 3QCSA 3CC6A 5TOZA 3KGAA 5HHWA 4YJPA 3TEIA 2O8YA 3LIJA 3HP2A 4QYEA 5E9EA 3MH1A 4YZCA 4BWPA 5M51A 5EOLA 3U54A 4I0SA 2I0VA 4DYMA 5L6PA 4S32A 3KA0A 4O0TA 3W18A 3G6GA 5L2TA 4PRJA 4C36A 4J1RA 4X3FB 4MF1A 4ZLOA 3F7ZA 2BHEA 1Y8GA 1ZYLA 3C0GA 4LL0A 1J3HA 4R7IA 4BTMA 3Q6WA 3CE3A 3SHEA 3GOKA 2ZOQA 5F20A 3UODA 3RPOA 3FLNC 3E3BX 4DT8A 3PE1A 4QPSA 3IONA 2GU8A 5IQDA 1U54A 1Q8ZA 3ZONA 3II5A 1YXSA 2X2MA 2X9EA 3EOCA 3Q4ZA 4JRVA 3ZLSA 2X8EA 4LOQA 4PTCA 3BHHA 3EN4A 4R6VA 4B7TA 4TW9A 5AAEA 1BLXA 2JITA 2YWVA 5K5XA 4YJUA 3UVRA 3IW4A 5LWNA 3F2AA 4HCTA 5HE3A 4E5BA 1L3RE 3PFQA 4OTIA 1YW2A 2DS1A 1TVOA 5LMAA 3LQ3A 5CSWA 4MNEB 4JDIA 2AC3A 5AR3A 3DT1A 1URCA 5DT3A 4CMTA 4WSQA 5A54A 3OT8A 4X2FA 5HVYA 4RVLA 4RFMA 5HVKA 5L2SA 4QQTA 1BYGA 4BGGA 5AFVA 4WNMA 3GQIA 3H9OA 1S9IA 3UC3A 4ACGA 3PWDA 1XH6A 3MB7A 4KKEA 4M14A 3ORNA 5HE1A 3GC7A 1OL5A 2BKZA 4OTWA 4BDFA 4EOPA 3NNUA 3IW7A 4GYIA 1B38A 4B99A 2XIYA 1JSUA 1FVRA 2DUVA 2P55A 1PYXA 3ZEPA 2X2KA 2ITZA 1XKKA 2VWWA 4N4SA 4AW5A 4YC3A 3SXSA 1F5QA 3L1SA 4ZMFA 2W1GA 2XK9A 3LJ1A 4KINA 3R7EA 3VUMA 5IUHA 3LFEA 4O83A 4I21A 5EYDA 4F08A 4FA2A 3NCGA 3A62A 2GTMA 2J5EA 5I0BA 1V0OA 3OWLA 3MFTA 3V6RA 4JBPA 4AA4A 2CGVA 3KEXA 3NR9A 3ZC6A 4WUNA 4DEEA 5HE0A 2F4JA 4EH6A 5CEMA 4NFNA 3ZO1A 3SXRA 2HELA 3EQHA 4BRXA 4KIQA 3QCYA 5ANEA 3BGZA 2WU7A 3BYUA 4F0GA 4DE4A 4A9TA 2ITWA 4FEQA 4CCUA 1XH7A 4IB5A 2A2AA 4M97A 3TV4A 2YITA 4M69B 2PMNX 4HNFA 4NIFA 4PNKA 4YMJA 5F9EA 2VTAA 4UN0C 4RC2A 3WF6A 2XCHA 5CEPA 4WNOA 3CQEA 5J1WA 5M06A 4AFEA 4MTAA 5GZAA 3IDCA 4IH8A 5AX9A 4B8MA 4ERWA 4UMRA 1R78A 2R3PA 2QOLA 5LMBA 5C4LA 5ANIA 4ONAA 5I9YA 4LMUA 3RHKA 3FZRA 5JRQA 3AT2A 4PDPA 4QMMA 1UU8A 5IEXA 4YHTA 2HYYA 5L6WL 4FKGA 1YXTA 1GIJA 4O7NA 3OHTA 4AT4A 4HOKA 2PMOX 4XG9A 4WBBB 3UMWA 1DI8A 2ZV8A 4ACCA 4D4RA 5KHXA 4LV8A 1OBDA 4GFOA 3NVKI 2C0IA 2BDJA 4AP7A 3ZCLA 1OL6A 5E8XA 3L8XA 4IWOA 3W55A 4OBOA 3R7YA 4PDYA 5I9UA 5B2LA 2EXCX 5JQ8A 3U6IA 4E26A 3PZEA 3R1NA 5HTBA 4O0UA 1ZOGA 3I4BA 3ZFXA 4BZNA 5CASA 3U6JA 4FTTA 3EQFA 5CT7A 1BL6A 3DB8A 5AV2A 1PMVA 5FM3A 2QG5A 4CKIA 4U81A 2HWOA 4IADA 2GS6A 1BMKA 3BBTB 2C1BA 2HY0A 1WAKA 4KIOA 4LOPA 3KVWA 4R3PA 5HO8A 3VW6A 3NZ0A 4O0YA 4D0XA 4YJSA 5IA4A 2QR7A 3DPKA 2VTTA 5F4NA 5BVOA 2I1MA 4LV5A 3RP9A 2C5NA 3EL7A 4XEYA 2JDSA 3NYNA 3PIYA 5HOAA 3CGFA 3ZEWA 4C57A 3Q9WA 4NSTA 2YCRA 3AD6A 3FXXA 4IFCA 2ETRA 3R7OA 1H1SA 2IZRA 3MW1A 1PMEA 4Y5QA 4WD5A 5AR5A 2WD1A 3LW0A 4RJ7A 4FKJA 4MWIA 1ZY4A 3HRFA 4C34A 3F3TA 3EQIA 4CT1A 5CU0A 2VTIA 5F95A 3PJ3A 3SV0A 1QL6A 5IQGA 4EONA 3VS6A 4QQCA 2BIYA 5T6KA 4I4FA 3VBTA 4DH3A 1JLUE 3P7CA 4O0VA 5J8IA 3F2NA 4BCFA 4AOJA 5DNRA 3S95A 2WOTA 3F5XA 4UMTA 4FNWA 3FLSA 5KMLA 3D5WA 4YPDA 1KE6A 2CGWA 1G5SA 4WO5A 4BICA 3LMHA 3DXNA 1IA9A 5DI1A 3C13A 3T3VA 4F9YA 5IPJA 3FDNA 3DFCB 1YHSA 4FF8A 4EK5A 4L3LA 1H1PA 4Y8DA 5LQFA 3O23A 3O0GA 4NUSA 4EQCA 4QQ5A 5AP6A 5KZ0A 4Z9LA 3PLSA 4X6QC 3Q9YA 2IZSA 4D9TA 1O6KA 3MY5A 4E6CA 4PMMA 3H0YA 5EM7A 4YHFA 4CZUA 4EZ5A 3PXRA 3VJNA 5CF6A 2CGXA 4YURA 3JVRA 4TN6A 5AM6A 3DKGA 2WMWA 2WOUA 3G15A 4QMUA 3O7LD 4LM5A 4BFMA 2QO7A 3UO6A 2O5KA 2ZV9A 4EZ7A 4PWNA 3OCGA 4PQNA 5BQ0A 5ETCA 3C4XA 3A7HA 4PPAA 4XG4A 5G1XA 5KX8A 3NS9A 5CQWA 5BNJA 3M42A 2YM8A 4GFGA 5D12A 2C3JA 4LI5A 3W2CA 3U4UA 2JKQA 3K3IA 1ZWSA 4BDHA 5FGKA 3REPA 4XYFA 4HYUA 3PVUA 4L43A 2CKPA 4PTGA 3OD6X 1OITA 3ANQA 4FIGA 4MD9E 4PUZA 1U5QA 2VWIA 3F3VA 3LKMA 5EQPA 4ZSAA 5J87A 2BPMA 1M17A 2JKKA 4BTJA 3PVGA 5J9LA 4M8TA 3HV6A 5FWKK 5AA9A 3W1FA 2X7FA 2ZV2A 2QOFA 3PRFA 2OJ9A 3OEZA 5H8BA 5IH6A 4FTRA 2WAJA 5DR6A 2VX1A 1LR4A 3E62A 3RGFA 3UIUA 4R8QA 4ALWA 4YZMA 3ZC5A 4TWPA 4FZDB 3G33A 4I24A 4S34A 3KCFA 3MYGA 1P4FA 3WF8A 5TR6A 4EKLA 3HUCA 3ETAA 2OXDA 3QD2B 2PVFA 3WZJA 3OY3A 5IMEA 4ZZMA 2EUFB 3KN6A 4RIXA 2WTKC 1GAGA 2DWBA 2J7TA 3BLQA 3LFNA 5ANDA 2VTSA 3LXKA 3QU0A 4BCMA 1H1RA 5BMMA 3WILA 3SG9A 5CALA 2QU5A 1FPUA 3N4VA 4ZTNA 2LGCA 3EIDA 3P4KA 2VUWA 4IX5A 4TNDA 4ZTSA 3R9RA 2YAKA 1YDSE 2CNVA 1W82A 4YHJA 5CU3A 2C6EA 3W2RA 4A7CA 3UZTA 3TNHA 3BHTA 3QFVA 3V8TA 2BRMA 3WZDA 4FK6A 4QMXA 4CCBA 5TE0A 2UZDA 1Y91A 5FEDA 4GKIA 3NW5A 2W96B 1YI6A 1UV5A 4GU9A 2BVAA 4YPSA 4O84A 3R63A 3GGFA 4I6FA 1PKGA 2OXXA 2C68A 2JIUA 3OT3A 3UYTA 4G5JA 2UW6A 3P1AA 4JQ8A 4Z16A 5FLFA 3QGYA 3ORKA 4D2VA 2QHMA 2O64A 2R3IA 3I7BA 2PVYA 3PJ8A 2VO7A 4IAYA 3F82A 2JLDA 4O1OA 4OTFA 4AU8A 2BHHA 3QAME 3Q52A 4V04A 3OUNB 2BZKB 2PE1A 3B2WA 3L8VA 3RPRA 2J0JA 4G1WA 4B8LA 4W8DA 1G3NA 2UVYA 2W4KA 2YEXA 2VGPA 5DPVA 3CEKA 1ZOHA 2J50A 4JX3A 5AIKA 4C8BA 5BPYA 3ULZA 1YI3A 5JKGA 2IPXA 5E90A 3SQQA 2W1CA 2Q0NA 4I22A 3KF4A 3I81A 5CQUA 1ZYSA 5DHJA 3ZS5A 3LAUA 4XG3A 3F2RA 3GUBA 3DOGA 2PVNA 3HECA 4BIBA 5DG5A 3GFWA 4APPA 3Q04A 4FKRA 4RIWA 4A06A 3FV8A 3KKVA 2VWZA 5D7VA 2YWPA 4F9WA 2GS7A 4PMTA 2GNGA 2W5AA 4XRLA 2XK6A 3QX4A 1H28A 2XKEA 4RRVA 2OGVA 3W33A 3AT4A 2PE0A 3GU8A 3AD4A 2A4LA 3GC0A 2Z2WA 3HV5A 4FTLA 3TUDA 1H0VA 3DAKA 1JQHA 4JDHA 4IFGA 3P0MA 3THBA 3QUDA 2PY3A 4UMQA 5DEWA 4EOMA 2XNEA 1WZYA 5E8UA 4II5A 2XCKA 3TACA 5AUXA 3GCQA 1SYKA 3R9OA 3FYJX 4IDVA 2FO0A 1IG1A 5EK7A 5JSMA 5FXSA 2B1PA 2GFCA 3W2PA 3T9TA 4ORKA 3EJ1A 4F7SA 1LP4A 2RFNA 3ZTXA 5DN3A 3UIXA 4LUDA 3HMOA 4DFXE 4H39A 2WU6A 4BHNA 4IXPA 1OI9A 2GHGA 2RFEA 1E1VA 1VZOA 4FV2A 3FYKX 4FEVA 2C5OA 3UPXA 3QXOA 1REJA 5AP2A 3VUDA 3SW7A 2XF0A 4AT5A 3RMFA 3PXQA 5A6OA 1Q3WA 4FL3A 4BDDA 3ODZX 5L6OA 1I09A 3NW7A 3WE8A 3BLRA 3IK3A 3PY0A 4RIYA 4F9AA 4I5CA 5DR2A 3SOCA 2WEVA 4FKTA 4OBPA 5CSPA 4QNAA 4RJ3A 2R2PA 1K3AA 4YJQA 3W2SA 5JFVA 4G3DA 2QD9A 4DGOA 3E64A 4JAJA 5CVFA 3S1HA 3QUPA 3SRVB 3G9LX 4L68A 2R3NA 4AXAA 2PZPA 3LQ8A 5BYZA 2OFVA 3N4TA 1YWNA 2X4ZA 4GW8A 1M2RA 2RKUA 4X21A 1S9JA 3A7IA 4FT3A 4AN9A 4O7SA 3QTWA 4RMZA 4D1ZA 3FKNA 3AC8A 3EQBA 2B4SB 4I92A 4W4WA 1H25A 4O82A 3PZHA 3KL8A 4J53A 2BZJA 2R0IA 2XKCA 3H4JA 4R1YA 3SDJA 3DZQA 4RJ4A 4EYMA 2UW5A 3FMEA 4TYJA 4RWJA 4BY9E 4CFUA 5FUTA 4YZ9A 4M67A 3TM0A 2G2HA 2YN8A 3TZ9A 4LFIA 4H1JA 2J2IB 4U41A 1PXNA 1PXLA 5CAUA 4O7RA 2BRNA 2R3OA 2C5XA 3TJCA 5KMOA 2ZDTA 3VUHA 3G0EA 4BVUA 3KK8A 4I5HA 3FMMA 3KC3A 1MUOA 4FX3A 4PDSA 4EORA 3NUUA 4MX9A 3AT3A 5KO1A 2PMLX 4L67A 1H07A 3KXZA 4KD1A 2W4JA 1H01A 4BR3A 1Q97A 3DXPA 3PDTA 2VNYA 3CIKA 5HNGA 1K2PA 4EOOA 1ZLTA 3IECA 1WBWA 5EDRA 4KBAA 2JFMA 2ZVAA 4KIKA 3LFSA 4PP9A 2J51A 4WKQA 4YGAA 4FTIA 2WMBA 3PY1A 4ZJJA 4F7NA 5LMKA 2JDVA 4BWKA 4BKJA 5BVNA 3CY3A 4MXOA 1DAYA 3PLAE 4E3CA 2VTQA 3MTLA 4GVJA 4ANLA 2OO8X 5AUWA 4I93A 1MQBA 3QKMA 4I5MA 4E8AA 3ROYA 4ERKA 3WZUA 4I94A 1FMOE 3N51A 3VAPA 3GU7A 4RWIA 4E6AA 2GSFA 1WBPA 3PSCA 5FG8A 2PPQA 2JDRA 3TIZA 3VUGA 3MH0A 2QKRA 2YDJA 2HW7A 2GNHA 5DE2A 2FB8A 3VUKA 4F70A 1APME 4FSRA 4EK4A 2AC5A 3PSDA 2QODA 2RG5A 4PPBA 4GUEA 5CYIA 4GSBA 5EW3A 2UZEA 2CGUA 3I6UA 4X7QA 5HG9A
chains in the Genus database with same CATH superfamily
4N70A 3DBQA 3QRJA 3R7IA 3NW6A 4MK0A 2HAKA 1ZMUA 4RVMA 3AC1A 4FG9A 5E91A 5GJFA 3BBWA 3EKKA 4QTCA 5CI7A 2IZTA 4FMQA 4V0GB 3UIBA 4DFYA 4HYHA 1M2PA 3O8TA 2RSVA 4GK3A 4JBOA 4HVGA 4OTRA 5FEQA 2B54A 3RNIA 2FUMA 5E92A 4RJ6A 2OJGA 2YLEA 1B6CB 3OW4A 2JBOA 1VLRA 3NUNA 2Y8OA 2WQMA 3KMWA 3LVPA 4XUFA 4XV1A 2XIKA 3F5GA 1WCCA 4I6LA 1JSVA 4JT3A 4JG7A 4IE9A 2XYNA 3GVUA 4J8MA 4RQKA 3VQUA 3R83A 4BBMA 4ZZNA 5IA0A 3QXPA 4UXQA 1U5RA 5BUEA 3PTGA 3FPQA 4BIEA 5C03A 4H3QA 1G8SA 3FE3A 4CMUA 5HG5A 5CAQA 5L8LA 4FNZA 5JMSA 4O6LA 2W1IA 4IAKA 3TUCA 1CMKE 1GIIA 3NLBA 3BHUA 4U42A 4IAFA 3L9PA 4X3FA 2XRWA 5DMZA 5IISA 4U6RA 2FGIA 1V0PA 4AGUA 4GU6A 3BU6A 3ANRA 2C0TA 3GQLA 1ZXEA 3FKOA 3FMNA 3LZBA 3KCKA 4NW5A 4R7HA 4TPTA 5HE2A 4AS0A 4FV0A 4L53A 4TKSA 4AN2A 4M68A 4RA4A 2W1EA 4DGGA 5KUPA 3PPJA 2LAVA 1YRPA 2CLQA 4PMSA 2OBJA 2W1ZA 4M0YA 1OIQA 1Z57A 3E88A 3OG7A 4GG5A 5LVOA 4JBVA 1BI8A 2YIWA 3NGAA 2XK7A 5I9XA 4P90A 4FICA 2BFYA 1OGUA 5D7AA 3VW8A 2EB2A 4JLCA 3FWQA 2PYWA 4JX7A 4QYHA 1I44A 4K0YA 4JS8A 4MNEA 2E9UA 4O7ZA 3RM7A 2C6DA 4ASEA 2JAVA 2OICA 2P33A 3GCUA 3CGOA 2B52A 4GIHA 4QTBA 1F3MC 3E3PA 5HESA 4P4CA 2G1TA 3QTXA 1L8TA 3BU3A 3C4EA 4BZDA 3BLHA 4F6SA 3KK9A 3VRZA 5HD7A 5H3QA 4U40A 1GZKA 2BALA 4EUUA 3DKFA 3F7WA 2B55A 4BCOA 1KSWA 2YFXA 3BIZA 1MRYA 3I5NA 5L8JA 4LG4A 1LUFA 5K4JA 3QUEA 3ZM9A 2PZIA 4AZEA 3C0IA 4M15A 5LVNA 5IMXA 3FUPA 3UP2A 1T45A 1JWHA 3ZDUA 2C6OA 2WTIA 3B8RA 3R71A 4O96A 5ICPA 2OLCA 3WF5A 3ZUVA 1CKJA 4A4XA 4AE6A 5HIDA 4EUTA 4KBCA 3ZUTA 3R2YA 3VIDA 5IQAA 4RX9A 5C8MA 5I4NA 5B2KA 3GC8A 5EH0A 2ONLC 2XEYA 3QL8A 2XNGA 3NNVA 4RLLA 5C1QB 4WBOA 3BE2A 4KRDA 4S30A 3OROA 3P7AA 3MPTA 1Q24A 3BYVA 4FIFA 4NKAA 4I6BA 5EDQA 5IDNA 4DHFA 3HL7A 3R28A 3KXGA 4U80A 5HQ0A 3KRXA 4CQEA 4FTQA 2YLFA 3H9FA 3R8VA 4G17A 3VS2A 4ACMA 3CJGA 3MVLA 4QTDA 1UU9A 4XCUA 3LFFA 1FINA 5DT0A 2ZB0A 2WO6A 3UNZA 1M2QA 4NYEA 1CKIA 5GIOE 4ITIA 1PYEA 2YM5A 3EFWA 2PZ5A 3QLGA 4ANSA 4ZOGA 1MRUA 4EC8A 3MPAA 2RFSA 3NVMB 4M69A 3TTIA 4AQCA 4RC3A 4ENXA 4FYNA 2QC6A 4X2NA 3BYSA 4W9WA 4JQEA 4LQMA 5HU3A 3UJGA 3DK3A 2GNLA 4BZOA 3VS0A 4TZRA 5EHYA 4A9RA 1A06A 4ITHA 5JQ5A 4JVGA 5M53A 4NH1A 5DA3A 4C35A 3R7VA 3ERKA 5CVHA 3R30A 5HCXA 4E73A 2C6TA 4MQ1A 4YR8A 2IW8A 3SLSA 2HCKA 2VWYA 2WQEA 4ZTQA 3IDBA 5CY3A 2ITPA 3AOXA 4RX5A 3UNKA 4EH9A 5HBEA 3IGGA 4TXCA 1UWJA 2J0IA 2WXVA 4FTOA 3RWPA 2V55A 4CYJA 4EEVA 3FSKA 2P0CA 1NW1A 1Q3DA 4AF3A 2R3RA 4MNFA 5JFSA 2C69A 2X6DA 2E9PA 3LXLA 5HO6A 3I5ZA 4KSPA 4EBVA 1M7QA 4YJOA 2RFDA 3HMMA 3OBJA 3FZTA 3NUAA 4OAVB 5EG3A 1W2CA 4D4VA 4MBJA 3F3ZA 2C47A 3R02A 5J95A 3RM6A 3FC2A 4CFNA 4DC2A 2F7XE 2VZ6A 3DQWA 1YDTE 4V01A 1Y8YA 3JY0A 1F0QA 4FR4A 4O0XA 3TNQB 2F2UA 4E4XA 2ITOA 1Z5MA 2WQOA 3BWFA 4U5JA 4AZFA 3F5PA 4BTFA 1QMZA 4ZZOA 2OSCA 4NU1A 3E8DA 4RVKA 2XA4A 3KXHA 2JEDA 4Y72A 2EWAA 4D2PA 4D4SA 3PRIA 5DEYA 2CN8A 1AGWA 4J99A 2XNMA 2W1HA 3K2LA 4ZLYA 4CVAA 3ZO3A 3R8PA 2W9FB 3QCXA 2XM8A 3BQRA 5F94A 4RT7A 4USFA 4XJ0A 3K3JA 4FV5A 5IA1A 2R4BA 5E8ZA 4EHZA 5BUIA 3NYXA 2V22A 2FA2A 4ARKA 4U3YA 2QO2A 2FSOX 3A8XA 1H1WA 3D7TA 2A19B 3FZ1A 3RK7A 3SG8A 1IASA 1RE8A 3D4QA 4NW6A 4XX9A 4P5ZA 3D14A 3CQUA 2QQ7A 3MI9A 4JR7A 4KSQA 3PP0A 4RWLA 2UW7A 4H36A 4PY1A 4FE2A 3ZFYA 4FVRA 3MPMA 4JIKA 4L6QA 4QRCA 3U55A 3GCSA 3CD3A 4L42A 2QHNA 3QC4A 4WG5A 3GT8A 4ZS0A 3WYXA 3V5QA 2WMVA 3KMUA 3W0MA 4JL9A 4LUEA 4AOTA 2B9HA 4RZVA 5GJGA 3W2QA 5CNOA 3R04A 4XG8A 2Q83A 4Y5HA 4ZMEA 5FEEA 4C4JA 3R01A 1R0PA 4CQGA 3CS9A 3P08A 3UOJA 2OF4A 5FP6A 4RLKA 4DITA 4ZY6A 4YUQA 4OLIA 4CLJA 3LLAA 3ZFMA 4LYNA 2VGOA 1IRKA 3IKAA 5M56A 4FEWA 3ZZEA 3NMUF 4FV9A 4MBIA 3LFQA 4IX6A 1J7IA 4QYYA 3VF9A 2BZIB 2YZAA 3EQPA 3MVHA 3DK7A 4FSYA 4MF0A 5E8YA 4IZ5A 5FRIA 5TKDA 4BIDA 3QHRA 3IGOA 2I0EA 2WPAA 2W9ZB 3GOPA 5TF9A 3KMMA 3RZBA 4KAOA 2XKDA 2ZAZA 3WF9A 2J5FA 3HLLA 3R22A 3AC2A 4DEAA 4AXEA 2HZIA 3L9MA 2CPKE 3LQ5A 4W4VA 3UZPA 3W8QA 3CKWA 4ZTHA 1TQMA 4IZYA 4HW7A 5FD2A 4AGWA 5FDPA 2CSNA 3ORIA 4F99A 4DH5A 4Y73A 3S3IA 2FYSA 3LHJA 3E7VA 4FV7A 1H1QA 4LL5A 3LCSA 3MVMA 5FTQA 4DA5A 1RDQE 2ITQA 2NRYA 3V5TA 3UP7A 5AUUA 2YJSA 4A4OA 4AXDA 3TTJA 2G01A 4ANMA 2Y9QA 2EU9A 3BELA 2OG8A 3VS7A 3S00A 3JY9A 5IA2A 2XBAA 4ANOA 4OT6A 2IVSA 5KE0A 3D0EA 3Q53A 4FVQA 4RFZA 2WQBA 3EQRA 4NL0A 4F0IA 2OWBA 4C37A 2JC6A 2WZJA 4O4DA 2YIRA 4X3JA 3MFSA 3ZO4A 4L9IA 1WBTA 4H05A 3HRBA 3DLSA 3Q5ZA 4FG8A 4WT6A 4W4XA 5JT2A 2PUUA 1W98A 3FL4A 5AP1A 4G16A 4F1MA 3OWJA 4ZTMA 3W0QA 1DAWA 2OIBA 1CSNA 1JKKA 2OJJA 1CKPA 2ZM1A 4J8NA 2YM4A 4FGBA 2BFXA 1OPKA 1FGKA 1QPDA 1V1KA 3Q9XA 4AA5A 4BDGA 4FTJA 4U9AA 4BBEA 4O7TA 4O0WA 3RAWA 5IQHA 3K5VA 1E9HA 4QOXA 4EWHA 4LDTA 4ZK5A 5LVPA 3OW3A 3TI1A 4AUAA 5J7BA 3LJ0A 5KBRA 2WGJA 5CNNA 2GQGA 5CU6A 3OVVA 4EJ7A 2P2IA 3V5LA 5JEBA 4CT2A 2QO9A 3MJ2A 4YJNA 5M44A 4IMYA 2WTJA 2REIA 5AAFA 5JN2A 1BI7A 4R3CA 1W0XC 3QA8A 2ZJWA 3TJDA 4BCKA 4FSTA 5CSHA 4A9YA 5M4UA 4O81A 5LMKC 3LMGA 3LM0A 1DI9A 1GZNA 4FOBA 5T3QA 4ZTRA 4BKZA 5CANA 3FHRA 4KBKA 3KXMA 3ORPA 4FUYA 3A7JA 1KV2A 2E9VA 2UZOA 4HPTE 3RCDA 5HTIA 3WE4A 1Q41A 1STCE 3H3CA 4XRJA 5BV3A 4G34A 4DEHA 1PJKA 1W8CA 4O7VA 2F2CB 4ASXA 2YWVA 5IUIA 4JJRA 3HV4A 3UO5A 4J52A 3W0OA 3AD5A 2X0QA 4NCTC 3LCKA 5GZ9A 3FY0A 3R73A 2F49A 3QRTA 4FKUA 2C5VA 4MQ2A 2ONLA 3OCTA 4BDIA 5LCJA 2YDIA 4EJNA 4DH8A 3QALE 4ZSJA 2PVKA 3AC3A 3H9RA 4I3ZA 4DEGA 3UMXA 4QP9A 2ETMA 4WNKA 1O9UA 1UNLA 3U6HA 2VNWA 4ALVA 4EWQA 4HZRA 3BHVA 3NUYA 2R3KA 4QQJA 5ANKA 2YZLA 2UUEA 5HNBA 3BHYA 1OKZA 2C6KA 2E9NA 4I0TA 1Q62A 5EI8A 4CFWA 3FXWA 5H8GA 4C38A 5JFWA 3EN5A 4EOQA 2OXYA 4WHZA 4FL2A 2HIWA 5LVMA 3D2IA 4B0GA 4F65A 4HPUE 4U79A 1REKA 1H26A 3JPVA 4BJJB 3RALA 4ZJVA 3SC1A 3F5UA 4FT7A 3E93A 1JKLA 4CFXA 3RK9A 5D1JA 3HVCA 3LFAA 2GHLA 4GYGA 4NM0A 3V8WA 4W9XA 2A98A 2O63A 3ZZWA 2YISA 4I5PA 4RX7A 3OP5A 2OF2A 3NWWA 4QMOA 2Y7JA 4X3FC 2A0CX 4HVSA 3D5XA 3AMYA 1J1BA 4M0ZA 4FL1A 4UEUA 1DM2A 1KE8A 3K5UA 3SRVA 1YHWA 5BYYA 5LOHA 4ITJA 4E7WA 4HJOA 4P2KA 3DKCA 3PSBA 3MDYA 3KVXA 4YSMA 5CAOA 2DQ7X 2WMTA 2BZHB 3P5KA 4OW8A 2BKKA 1XQZA 4D4YA 4F09A 3VONA 1XMLA 1J1CA 2JKOA 2IW9A 3TIYA 1YWVA 4RQVA 2XAOA 3C4ZA 2ITNA 3GBZA 3CTJA 4YZBA 4O1PA 5DGZA 4ANBA 2WELA 3DBDA 4CSVA 3G51A 3GU6A 1XBAA 3NUSA 4W8EA 2XK4A 3DK6A 4IAAA 2Y6MA 2H9VA 1PMNA 2VWXA 4QP3A 4XOYA 5IEYA 3AC4A 2GQSA 3ORXA 5L2WA 3HRCA 5EM8A 3EQDA 4DFZE 1DS5A 1JVPP 2QU6A 2ITTA 3G9NA 4EOJA 2BMCA 3K54A 4U0IA 5EKOA 3G5DA 3BPRA 1JAMA 4K2RA 4BCHA 3BCEA 2BAKA 2QNJA 3UIMA 3F3UA 4UBAA 4OAUC 1Q99A 5M09A 3QD0A 5H2UA 3TNIA 3GEQA 2ETKA 4NTSA 4QMTA 4AWIA 4BDJA 3EQGA 3OWPA 5GINE 4FNXA 1PW2A 5IF1A 1U46A 3C51A 3QHWA 4MHAA 4XP3A 1TKIA 5BVFA 3L8PA 4K18A 2W0JA 2YCSA 4EOLA 4EYJA 3EZVA 4FUXA 4G6LA 4FZFB 3DJ7A 1FOTA 2UW4A 3GENA 3QQKA 3QZFA 3O5AA 2J90A 1NVRA 4AW0A 3PYYA 1OKYA 3F6XA 3MTFA 4XMOA 4JI9A 4O38A 1XHAA 2VTLA 4U8ZA 4I20A 2RG6A 2QOCA 5IH5A 2ZMCA 1XWSA 2ITYA 2QOKA 5FDXA 4IVCA 5T68A 5HG7A 4R77A 3JR1A 5KKRB 2VWBA 4WRGA 1OMWA 4EBWA 3Q4TA 4E6DA 3U4WA 5DFPA 3EWHA 2O0UA 2X8DA 1IEPA 3FJQE 3QYWA 4V0GA 3RBWA 5BUJA 3COHA 3ZSHA 5EYMA 4MXAA 4GG7A 5M55A 2R9SA 4RBLA 4DGLC 4TYGA 1XH8A 1HCLA 4D2RA 4DEDA 3DKOA 1XJDA 2ZM3A 1ATPE 3AKJA 3HMIA 4X2JA 3AXWA 3DDPA 3ZU7A 4F7JA 4QP8A 4O6EA 3DXQA 2PWLA 2CHLA 5J5TA 2PMIA 3MJ1A 4YTFA 5K5NA 3MA6A 4FIHA 2ZM4A 2OFUA 2CN5A 3TKUA 2OIQA 4D28A 2XNOA 3VC4A 3QTQA 4NWMA 4NTTA 3ELJA 4D55A 4RJ5A 5K4IA 2V0DA 4QDEA 3R9HA 1G8JA 2BRHA 3R1SA 4C3FA 4G3FA 2JKMA 4F9BA 4DCEA 3LFDA 2PVJA 3ORTA 3NRMA 3U9CA 4D58A 3FI4A 3D5VA 5CEKA 4IB0A 5CSVA 3UOLA 2B9FA 2XB7A 2RF9A 1R39A 4I6HA 4MBLA 5ACBC 5H9BA 5DT4A 3PJ2A 3QTSA 2YABA 3F88A 2BRGA 4TTHB 2IEWA 3R9NA 1OUYA 1SVHA 3FSFA 3KULB 4K1BA 3L9LA 4TYEA 3RKBA 2WIPA 4PTEA 4WOVA 4PMPA 5I9ZA 3IS5A 3NSZA 2PVHA 4GT4A 5DR9A 1Q4LA 2QLUA 1LEWA 3LLTA 4LRKA 5LJJA 5BVKA 2H6DA 3FZOA 4UYNA 3FQHA 4BB4A 4C58A 4GK2A 3R00A 3TNPC 1RW8A 2QURA 3OXZA 2YCQA 4TYHB 2Y6OA 4OBQA 4FTNA 3ZLYA 1YKRA 2XIRA 4IWPA 4ZSLA 2QOHA 3E7OA 3AMAA 3Q9ZA 3BX5A 3KU2A 1Q8UA 5F1ZA 4FKSA 1ST0A 4DLJA 2R5TA 2VRXA 2ERKA 1IAHA 4GV1A 3PXZA 2PU8A 3LFBA 3RPSA 4BTKA 4L3JA 4GUBA 5CX9A 2GPHA 1PXOA 3D83A 4FSNA 4O4BB 4LGGA 4XBRA 2OU7A 3AQVA 1PMUA 2IO6A 1GNGA 2BIKB 5HVJA 2IG7A 4XG6A 3BGQA 4F6UA 4AW2A 2BILB 4F0FA 2R7IA 4BF2A 2J0MB 3BL9A 4FSUA 4ASDA 5E4HA 2JDTA 4BGHA 4A9UA 1U4DA 5EI2A 1OL1A 4DTAA 4DLIA 4W4YA 3C4CA 3W10A 4FTKA 4XBUA 5A4TA 2PSQA 2B7AA 4LMNA 3IG7A 4FTCA 3RTPA 4EK3A 5CF4A 4R5SA 2H96A 2IJMA 4AZSA 2JBPA 3COMA 3Q5IA 3ROCA 4CYIA 5CEOA 3OMVA 5EDPA 3MFRA 3O8UA 3FI3A 4BBFA 4YLLA 3QQGA 3R2BA 4P5QA 3UGCA 5I5ZA 3EKNA 3PJ1A 4O0RA 4CTBA 2EXEA 1OM1A 5CEQA 3TL8A 4EQUA 4Z7HA 3AC5A 5EYKA 4G6OA 3I6WA 3VS3A 4FSZA 4OTQA 1R0EA 3WYYA 4NCTA 5CF5A 3CKXA 5K9IA 3MFUA 1B39A 2YAAA 1SZMA 4FZ6A 2XIXA 3QTRA 1VYWA 4AE9A 3BEAA 5FTGA 4UMUA 3RAKA 2WEIA 3TKHA 3VBXA 3RPYA 4Z7GA 2CNUA 1YWRA 2X8IA 4IIRA 4E5AX 4QMSA 2WMSA 4NT4A 4O21A 4RIWB 1W2DA 3HAVA 5CI6A 4AGCA 4LRMA 3DDQA 1G8KA 4FBXA 2XUUA 3QRIA 3DJ5A 3DV3A 2PVRA 1WBSA 3PUPA 1PXIA 5HI2A 2J6MA 3ZRKA 1VYZA 3CPBA 5A14A 2GHMA 4LV7A 4MWHA 5HX8A 4BI0A 2C3LA 5AUYA 2VTOA 5BX0A 5DOSA 3MESA 1GOLA 4MXCA 1J91A 2OZAB 5A46A 4ID7A 3EFLA 2HXQA 4O7YA 2CMWA 1OZ1A 2W7XA 4L7FA 3JVSA 3BYOA 4M12A 3UYSA 3P23A 3GB2A 5AP5A 4B6LA 4KS8A 4IJ9A 4BDKA 2X39A 3OCBA 1P4OA 4U44A 4IDTA 5J5SA 5BMSA 1NVQA 3PWYA 1O6LA 2V7AA 4ACHA 1GJOA 2EXMA 5EFQA 4G5PA 3UNJA 2W5HA 5B2MA 3RAHA 4QEBA 4FC0A 4IANA 4EK8A 1TZDA 2NYAA 2WHBA 2G2IA 4JIAA 3KB7A 5L2IA 3PFYA 1YDRE 2UW9A 4OR5A 5DVRA 3OZ6A 1ZOEA 3PIXA 5HCYA 1NY3A 3BYMA 4BYIA 5IU2A 4MXYA 5HEZA 5HORA 4N6ZA 4O4CA 4RSSA 5EW8A 5LARA 2XVDA 3MH2A 3QA0A 4X2KA 5FBOA 2C6LA 1ST4A 3KXNA 2YIYA 4IQ6A 4EH2A 3DBEA 5CEIA 3V01A 3A7GA 4U43A 3R21A 4C4IA 3VO3A 4XG7A 5AP7A 3RAIA 2VTRA 2W1DA 2O65A 2YM6A 3F3WA 3JXWA 3MH3A 3DGKA 1SVEA 3OY1A 4H3BA 3W32A 3ET7A 4DN5A 3KRJA 3I0QA 4FK3A 4L44A 4HGEA 3QD3A 4PDOA 5AIRA 1ZAOA 2UZTA 2XIZA 3GXLA 4FV1A 3TCPA 5KMMA 3V04A 5IQFA 4E93A 4FKIA 4WG4A 4O2PA 3O71A 4YZDA 5HKMA 4H3PA 1JSTA 4OTHA 4FIJA 3DA6A 3PPZA 5EM5A 2QOBA 1OGYA 1ZMVA 2B9IA 2UW8A 3UG2A 3RVGA 4BCIA 2QG7A 4E4NA 4OTPA 3KXXA 1H0WA 3V6SA 5CAVA 4HNIA 3E5AA 5HNIX 4E5WA 1J7LA 1CDKA 5KKRC 3LFCA 5AV4A 3A4PA 4O7WA 2BTSA 3PJCA 1H24A 3DNDA 5CZHA 2JD5A 2VTNA 3MVJA 2IVUA 4HYIA 3P86A 4Q5EA 2UZBA 3BKBA 1UWHA 5AR2A 3UTOA 4DTKA 2YIQA 1XBCA 4BCGA 3OFMA 4O91A 3AGMA 4M7IA 4DG3E 4QP2A 5LXMA 2ITVA 3NYOA 5KMNA 4L45A 3ATTA 4QP4A 1ZZ2A 2C4GA 2I0YA 3NEWA 1PF8A 3VJOA 4EK6A 2IF8A 3I60A 5A6NA 3UDTA 2PK9A 2XBJA 5BVWA 5AADA 1PXPA 3Q96A 2P3GX 3D9VA 2ERZE 1YQJA 5L2QA 3FLQA 2VO6A 4ZIMA 4MXZA 2R3JA 5EOBA 4UB7A 4AA0A 3D94A 4GIIA 5IKWA 4EC9A 1WBNA 3QRUA 1P5EA 3ZLXA 2W5BA 4CZYB 4G9CA 4L8MA 4C4EA 1ZRZA 2X2LA 4KKGA 4BN1A 4QYGA 2IVTA 3LOKA 4IHPA 5IQBA 1X8BA 2QVSE 4D1XA 2WMXA 3EFKA 1MP8A 3QZIA 4GJ3A 5K0KA 3Q60A 3ZMMA 3UQGA 4RFYA 2W4OA 4KKHA 4PV0A 4KUJA 4N0SA 2UVXA 4QT1A 4GMYA 2GNFA 4FG7A 3E8NA 4UV0A 5I3OA 2BDWA 4MKCA 3HYHA 4WSYA 4XP0A 4YZNA 4HGLA 1IA8A 3QWJA 2XH5A 3UPZA 1XH5A 1LEZA 3FZSA 3ORZA 5BVEA 5DBXA 3CQWA 1PHKA 4AGDA 4DFBA 3O2MA 1HCKA 1RJBA 1U59A 4IZ7A 1QCFA 3E92A 2Q0BA 4QO9A 4BDCA 4CEGA 4KABA 4FKWA 4EH4A 3WZEA 4K77A 1YOLA 3ZM4A 2XRUA 3ZOSA 3I0OA 5IDPA 5AUTA 4UX9A 3DB6A 4OUCA 4UWYA 2R64A 2R3MA 2XJ1A 3VS5A 4DBNA 3BLAA 3MY0A 4U97A 5A9UA 3RK5A 2UW3A 3QBNA 2YACA 1VR2A 4AXFA 2H8HA 2PHKA 4C61A 3R6XA 5LCKA 4CFMA 3DBCA 5IQEA 2OKRA 4LGDA 3R8ZA 3UOHA 3LM5A 3O51A 3IDPA 4Q9ZA 4G9RA 4WNPA 3R1QA 4AOIA 4YNEA 1SNUA 3O96A 3DJ6A 5C27A 3TV6A 1FGIA 1PXMA 2WNTA 2C0OA 3ALOA 3CCNA 2XJ2A 2B9JA 3EZRA 2VX0A 3JYAA 5HZNA 2X7OA 3P9JA 1FMKA 3EFJA 3TZMA 3VULA 3VUIA 3HZTA 5FXQA 4DFNA 5J1VA 2WTKB 4EHGA 4YTHA 4I6QA 4PP7A 2NO3A 5DH3A 3E63A 1KOBA 3EN7A 3S4QA 4BDAA 4YC6A 4F1TA 3L8SA 4EHEA 2XEZA 3A7FA 3R7GA 5AV0A 3OUKA 4ANNA 3ZYAA 3COIA 4DH1A 2GCDA 5EM6A 3BWJA 4CXAA 4XH6A 4JRNA 1Q5KA 2V62A 3FMDA 3DLZA 3HNGA 4FKPA 3CLYA 1TQPA 5AJQA 3LJ2A 4UXLA 4XP2A 4EZ3A 2Y4IB 4MAOA 3NNXA 2R3GA 2Y4PA 3DU8A 4ZTLA 1WFCA 3KREA 5CENA 2CCHA 1OUKA 3RCJA 2ESMA 3POOA 4L00A 2YM3A 4GRBA 2YA9A 2AUHA 4Z3VA 5AM7A 3L9NA 5CT0A 2B53A 4JDKA 2O2UA 2UZUE 2QKWB 4CRLA 5C8NA 4RJ8A 2WKMA 4G31A 4R5YA 4FKLA 4CMOA 5CS6A 3LMIA 4GVAA 3QWKA 5IQIA 3DCVA 4I4EA 4DG2E 5KMJA 4IB3A 2CKOA 4OTDA 1VEBA 3QQJA 4IACA 4WRSA 4E4LA 1JKSA 2OJFE 3HDNA 5AUVA 3A61A 4ZP5A 4BJJA 1V0BA 5FM2A 3QQFA 5KNJA 3KY2A 1SMHA 5JZNA 5CSXA 4GH2A 2CKQA 3OCSA 2Z7SA 2VO3A 1PY5A 2NPQA 4UZHA 4XV3A 3C9WA 5KBQA 5CXHA 3QKLA 2UZWE 3AGLA 3FMHA 5IA3A 1YOMA 4F6WA 4DDGA 4M66A 1EH4A 3S0OA 5IUGA 4N6YA 2W06A 4LRJA 4L46A 2VX3A 1M52A 3TG1A 2KULA 1YI4A 3QQHA 3CR0A 1GY3A 1OKWA 3HP5A 4QP1A 1PXKA 2HW6A 4KIPA 1SNXA 4QP7A 2JGZA 1H00A 4E20A 4O2ZA 3NNWA 3WIGA 3QTZA 4CNHA 4BDBA 5I9VA 3D15A 4D0WA 3OOGA 2GNJA 3ODYX 2UZNA 4CV8A 4IAIA 4LOOA 4D5HA 4L01A 3A8WA 3E8CA 3WBLA 4BI2A 3FLYA 4IC7A 1R3CA 4FV3A 1OBGA 4DT9A 3BQCA 4O0SA 4TYIA 3M1SA 4FV4A 5HBHA 4FODA 5AP0A 3R0TA 3VRYA 3DTWA 4NKSA 4EKKA 3OS3A 4D2WA 2C30A 4A9SA 5M57A 3OOMA 2BCJA 4BHZA 1UNGA 4IJPA 2YHVA 3F69A 3PXYA 5BYLA 3TDVA 4R1VA 4UALA 4YJVA 4QMQA 2UZLA 3QQLA 3NIEA 3QYZA 4MD8E 4A07A 4RG0A 3RI1A 5AMNA 4AZTA 1KV1A 1UU7A 3OEFX 5AP3A 4BYJA 4IWDA 4UWBA 3OTVA 4Y95A 4Z55A 2WMAA 3GP0A 3NCZA 3QQUA 4JNWA 4C3RA 2QR8A 4WUAA 4AACA 4D2SA 3FZPA 2W1FA 2WTWA 3POZA 3F66A 4K6ZA 3BI6A 4ZSEA 3COKA 4MEDA 3UO4A 4GCJA 4MVFA 3ZDIA 2YDKA 1XH9A 4YO4A 4E1ZA 4G6NA 5TT7A 2YJRA 2XZSA 2HOGA 3MGYA 4NZWB 3ORMA 1WBVA 3UG1A 3ULIA 3A99A 5EW9A 5FP5A 1U54B 5JFXA 2GFSA 2XYUA 4IZAA 2PTKA 2BAJA 1J7UA 4EH3A 5JZJA 4PL5A 4JG6A 4Y85A 2CDZA 3SX9A 1BL7A 2PE2A 2WMRA 3NFFB 5HO7A 4HYSA 2NNWB 3CP9A 3CXWA 4QPAA 3ZXZA 3MIYA 4QMZA 3DZOA 4DEIA 3ZBXA 2XP2A 1IR3A 4QD6A 3SVVA 5CTPA 4Q9SA 3TT0A 4IC8A 4CKJA 1Q61A 3PY3A 5ACKA 3OF0A 5J79A 1QPCA 4UYAA 2ZB1A 4WA9A 4IVBA 4IW0A 2OH0E 3W16A 3QX2A 3HDMA 4M3QA 4C3PA 2I0HA 4DTBA 2I6LA 3DAEA 2V5QA 3MWUA 4BI1A 1YXUA 2YERA 4QYFA 5CU2A 5J7HA 3D7TB 5FTOA 3EQCA 5B7VA 3VBVA 4DEBA 4NJDA 3P7BA