1PYXA

Gsk-3 beta complexed with amp-pnp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
352
structure length
343
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title Structural characterization of the GSK-3beta active site using selective and non-selective ATP-mimetic inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 343
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1pyxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1pyxA01
3VQHA 3LQ3A 4HVDA 1VYWA 4YSJA 5F95A 5IUIA 4D2WA 5IMXA 5EW3A 4FX3A 2H9VA 3DK3A 2VNWA 4J97A 4JT3A 4WNKA 3ZC6A 3NYOA 3BYUA 4Y72A 2RL5A 2C3KA 4MYGA 5KZIA 5HEZA 2FH9A 3ANQA 4ANMA 4OT5A 5I9VA 4XCUA 4O83A 1UVRA 3ZZWA 4BGGA 4EQUA 1WVWA 4K0YA 4MNEB 3HA6A 3EFJA 5LMKA 2VX1A 1OPJA 4YLLA 4BDFA 2PTKA 5B2MA 3IS5A 3BGQA 4QP9A 1UNLA 5LWMA 3EKNA 4JL9A 5D9HA 3DBDA 2H6DA 2C5XA 3G6GA 1G3NA 3M42A 4FGBA 4PDSA 4DGMA 4YHTA 3DS6A 3R8UA 1Q3WA 2CGVA 4IB5A 4PMTA 3UPXA 4EK3A 1NA7A 3CGOA 4NK9A 4P5ZA 4X21A 5EI6A 2RFNA 3IDCA 1FVRA 3P23A 3UO4A 2C3IB 4L52A 4Y85A 5CF6A 3F88A 3W1FA 3OXZA 2UW7A 1IEPA 3CGFA 4ZZMA 5GZ9A 3Q32A 4R1YA 2I6LA 2WTDA 4V01A 4O6LA 4ZOGA 3FY0A 1H1QA 3R2YA 2R3IA 1OKVA 2YM6A 2V7AA 3PJ8A 3DJ6A 2CGXA 4M3QA 5DVRA 4FSWA 5HG9A 4EWHA 4TYIA 3Q2JA 1YQJA 1ZAOA 5FUTA 5G6VA 1H1PA 2OZAB 4U79A 1APME 5IPJA 3CP9A 4KKEA 3R63A 2A2AA 2QOQA 1FMKA 1SNXA 2ZM1A 3NUSA 4N6ZA 4GW8A 5IH5A 3N4UA 1DAYA 2ZM4A 4DFXE 3PSCA 2YFXA 4EOPA 4P5QA 3QTIA 2JDVA 3UQCA 1JVPP 3F7ZA 4ZSJA 5CXZA 3GEQA 4ITJA 5DBXA 3OCTA 4HYUA 2JLDA 2E9VA 2G1TA 4C3RA 2J51A 2C6OA 2R9SA 1J7LA 3OUKA 2EU9A 4RQKA 4DH3A 2HOGA 2VRXA 4O2PA 3W16A 4EZ7A 2PVLA 4USEA 5L3AA 2X8IA 3MFSA 4XYFA 4JR7A 1LR4A 2VTOA 1XKKA 2GFSA 4BIBA 4ANNA 3ORMA 2RF9A 3HP5A 3NDMA 4EH7A 3MFUA 4EZ3A 4M12A 5AAFA 1CSNA 2JDOA 3AT4A 2W17A 3E92A 5J7BA 5JMSA 4JDHA 3R9HA 5IKWA 3IO7A 4MXCA 3PE2A 2W4JA 5B0XA 5HE1A 1OUYA 3H0ZA 5AV1A 5T3QA 4BI0A 4F65A 4I24A 3R8LA 3F2NA 5CEKA 2BKKA 2RFSA 3IDPA 4GKIA 2BHEA 5CF5A 5DRBA 2R7IA 4X3FC 3RALA 3KK9A 4AW5A 4C4FA 4D9UA 4DGLC 3DKCA 4AE9A 2CKPA 3EQCA 3PFQA 4QPSA 4QQCA 3GCSA 4XHKB 4JVGA 4TPTA 4UYAA 4ANOA 3PXYA 2CHLA 4O22A 5DG5A 5T6KA 1H25A 4MBIA 3O8TA 2FA2A 1V0BA 2VD5A 4QYFA 2YCFA 5CSXA 1XR1A 2VN9A 4LQMA 4BBMA 4DITA 4O81A 4FKVA 2HXQA 1YXVA 1G8SA 5ANDA 3O8PA 4DEEA 4B8MA 1SYKA 3AC8A 3QRIA 2X8DA 3D5UA 3Q6UA 2X2KA 2AC5A 4QMNA 4O7LA 2WQNA 3PPZA 2XZSA 3HMNA 4KSQA 3TZ8A 2PUPA 3ATTA 4FNZA 3TV7A 1RE8A 3GBZA 3IW4A 3TL8A 4E3CA 1WBOA 4AGCA 4MQ1A 2GFCA 4M69B 4GS6A 2VTHA 3C4WA 3OEZA 2Y6MA 4K6ZA 2FSLX 4QRCA 3F9NA 5AP2A 3RAHA 3TACA 4O7TA 1O6LA 2RFDA 3UODA 4EHEA 5M55A 4XG7A 1MRUA 2FYSA 2VUWA 5ETAA 2BZIB 2OJIA 2QC6A 3BGZA 2I7QA 4FUXA 2IPXA 2FVDA 4HCVA 4U42A 1GIJA 2I1MA 4FZAB 5A46A 3PY0A 1M2QA 4NKSA 4A9RA 1MUOA 2Q0BA 4J1RA 2UW4A 3A7FA 4FTNA 3QQUA 4RJ6A 4AGWA 3IW5A 2XM8A 3E8NA 5JN2A 2XIZA 5EW8A 3W8QA 3MB7A 1PMEA 1W98A 5HZNA 4FKSA 4FUYA 4BN1A 1M7QA 1YKRA 3G6HA 4I5MA 4RIYB 4IVDA 1OIQA 2UZOA 4EOSA 3K5UA 2XS0A 4CMTA 5C8MA 4NM5A 5BVKA 2PPQA 5BMSA 2QODA 3FEGA 3FQSA 4GK2A 4X2NA 3TNPC 2IG7A 3IK3A 4EQMA 4ZTQA 1CKJA 4IB0A 4PPCA 3QC9A 5HKMA 4XBUA 2XJ1A 3L9NA 1FINA 2W1FA 4I23A 4DH7A 1K9AA 3Q96A 2IW6A 3CY2A 3LHJA 4IAZA 4M14A 3LM0A 4O7NA 4G3DA 4Z16A 2GCDA 4G16A 4XP3A 3ACKA 3TN8A 4O1PA 2A27A 3COKA 4QT1A 4EK4A 4B7TA 2XIYA 4GIHA 1Y8GA 2XYUA 5GJGA 4J7BA 2VTMA 3HV7A 1PJKA 3FWQA 4MXOA 4YC8A 3MY5A 3HAMA 2Z60A 1DI9A 3U87A 5IQGA 4FIJA 4O0SA 2W5AA 4R1VA 1RQQA 1JKSA 1YW2A 3QUEA 2VO3A 3TNHA 4D4YA 4LRJA 5HD7A 4MTAA 5C01A 5A4TA 4KIQA 4ZXTA 5BMMA 5JEBA 2ONLC 5KO1A 4JBOA 2UW6A 1JLUE 5AJQA 1S9IA 3R71A 1WBWA 1XH6A 3UO5A 3W2RA 3NAXA 1QCFA 2ERKA 4CYJA 3E3PA 3BHUA 3MH1A 3EQHA 4C57A 5EDQA 2X6DA 3KVXA 2ETKA 3KRWA 2NRYA 3NUPA 3QGWA 4YZMA 4EH9A 3MWUA 4UB7A 3VRYA 2WAJA 1U5RA 2C5NA 3II5A 2YJSA 4OTIA 5FBNC 5CT0A 3RK5A 4DFBA 2SRCA 3GC0A 3I5NA 1WMKA 3R7OA 3QQJA 3F3WA 3VAPA 3KQ7A 3E62A 4QMQA 5J8IA 3ETAA 3FKNA 2R4BA 4W8DA 5BVNA 2VTRA 4IFGA 4BC6A 3PYYA 3RPSA 5HG7A 2W4OA 4FKJA 4PL3A 4YJOA 4FV8A 5HI2A 3HZTA 3MBLA 3NIEA 3LE6A 2PWLA 3MH3A 3MPMA 4O0YA 4UWCA 5E8ZA 4XV1A 4F6WA 2XJ2A 4BCFA 4U97A 3RNYA 4J98A 4FKQA 3OXTA 4ZMFA 1BYGA 4LM5A 3CEKA 1ZMWA 3AMYA 3QCQA 4FMQA 4QYHA 5HOAA 1IA8A 2Y0AA 4IACA 3LJ2A 5IQIA 4RIXA 3I79A 3U51A 5FEEA 5CEOA 2ITQA 4X6RA 3VUTA 1Q97A 2R3PA 4YJRA 4X2KA 5FTOA 4UYNA 2GHGA 5ANJA 4EOQA 4O1OA 4ANBA 5CNOA 3F82A 3E8CA 4ZSLA 4QP7A 4U6RA 3VS7A 3SOCA 2VO0A 5HO8A 4EBWA 5K5NA 4I0SA 4F7SA 5FLFA 3QCYA 3FZOA 2YIYA 5AUYA 2J0IA 1TQMA 4YURA 4S32A 4XG2A 4CT2A 3FDNA 4NT4A 5C8KA 5CSPA 4A7CA 1ZY5A 3BI6A 4TTHB 3R01A 1U54A 5A4EA 1J7UA 3I6UA 1H0WA 4CQGA 2VWUA 4UMRA 2YM7A 3OCGA 4R77A 3T3VA 2C5YA 3CKWA 2VGOA 4I1ZA 4JBQA 4JLCA 5E8UA 2CJMA 4LMNA 3BYOA 3AT3A 1IG1A 3F3VA 3GU4A 3KKVA 2BIKB 4G3FA 4XMOA 5FG8A 3ZEPA 4YTIA 2XKDA 2ZOQA 3ZBFA 3S2PA 1XH7A 3IOKA 5EG3A 5IDPA 3JR1A 4JX7A 2ETMA 4F4PA 3OD6X 2QD9A 4FC0A 3VHKA 3RNIA 3DDQA 4B4LA 2QU5A 4TYJA 4YNOA 3FI4A 3VS5A 5IQBA 2WEIA 5CU6A 1OI9A 3GCQA 3EMGA 4UMPA 2B53A 4BDBA 4IM0A 1FBNA 3ALOA 2F7XE 2ITXA 1J1BA 2OF4A 3R04A 4FV2A 4QTDA 3CTQA 3L9PA 5AV2A 1YOLA 5D7AA 3Q4CA 3ZUUA 1LEWA 1JSUA 2HZ0A 3DBQA 4IC7A 3ORIA 4AN3A 1H27A 3R8VA 3ZRKA 4A9SA 4FZ7A 5JFVA 1H1SA 4S33A 2XB7A 3D5VA 3E7VA 4BTKA 2W0JA 3G2FA 5E8TA 4GYIA 3NW6A 4A07A 2WTIA 1YWRA 4FG9A 4OTWA 2QO7A 4EORA 4Z9LA 4D55A 2GNIA 3ZOSA 1UKHA 2RSVA 5CT7A 3W33A 2JITA 4FEXA 2RIOA 4H1MA 5E1SA 3G15A 3I7BA 3D4QA 4DEDA 4O0VA 4GFMA 4MD9E 4O82A 4E4NA 3RZFA 5LMKC 3VUKA 3BHHA 4EYMA 2C30A 1QPEA 3IG7A 4MXAA 2QO9A 3BQCA 4F9CA 4RC4A 5KMIA 4TWPA 3GFEA 1U46A 3DKFA 5KNJA 2YCSA 4ORKA 5IQHA 3PIYA 4UXLA 4UZHA 4C58A 1WAKA 4IX4A 3C1XA 4RLKA 1OBGA 5ANGA 5A6OA 1KV1A 2QHNA 4ASDA 5AX9A 4FSZA 4O0WA 4H05A 4E7WA 5LJJA 4AFEA 4C2VA 3OHTA 3ZYAA 4ZTHA 3Q53A 1RDQE 1YVJA 3M2WA 2OH0E 4FT9A 3RWPA 4GT4A 2H34A 1BI7A 3MVMA 4FNWA 1AGWA 1NVSA 1U4DA 4FKOA 4ID7A 5BVDA 5J9ZA 1HCLA 5GHVA 1L3RE 1OZ1A 3E7OA 4RVLA 4NZWB 4UWBA 4UWYA 3TV6A 2BTRA 2R0IA 2VX0A 3A99A 4EH5A 5L8LA 2EVAA 3MTLA 5AV4A 4CLIA 4J53A 3VS2A 4EOJA 5CY3A 1XH4A 3S00A 2ZV8A 2XK6A 4AT4A 5CZIA 2HY0A 1FVVA 3H9OA 3MVHA 3WYXA 1Y91A 1YWVA 4FVRA 4J71A 5AV0A 3NR9A 5LMBA 5J87A 1P5EA 2IVTA 4QYYA 4KINA 4EL9A 2DQ7X 3I0OA 3QYWA 4KBCA 3DU8A 4KSPA 4R3CA 3HV6A 5DT4A 3FMEA 3TZMA 4C4JA 3OXIA 4G17A 4KRDA 3U55A 2G01A 4S34A 5CF4A 4RA4A 2IVVA 3ZC5A 5ANIA 1VYZA 1XBBA 2PVNA 4L7SA 5E9EA 2CCHA 2HWPA 5FXQA 4F7JA 1PHKA 3H10A 4BKJA 4A4LA 4AZSA 5EKNA 2BIYA 4ZSEA 4JS8A 4FODA 5E91A 3TIZA 5CENA 3T9IA 3VHEA 5LVOA 4I0RA 4L45A 2P0CA 2I40A 3EQRA 5HORA 1M17A 1Q41A 4PDYA 3S1HA 3D7TA 4KS7A 3I4BA 4UEUA 2WQEA 3EIDA 3H4JA 4U40A 3FI2A 2XYNA 5HVJA 3TKUA 4LFIA 3QRJA 1LP4A 4BDEA 5H8BA 4BYIA 4E73A 4AGDA 2UZWE 4Q5HA 5DNRA 3PIXA 2WTKB 3C4FA 4BCOA 5IU2A 4QTAA 5KX8A 2Y7JA 4RJ8A 2NP8A 4F7LA 1URWA 1T46A 3DBCA 4OUCA 5KE0A 4IX3A 3V5LA 3QKMA 4CFUA 5FGKA 5AUUA 2GNHA 3A7JA 3HMMA 3DTWA 3MH0A 4GG7A 4Z55A 5CALA 1G8AA 4D2PA 4Q5EA 3TZ7A 3EL8A 3TZ9A 4N57A 3D7ZA 3HMPA 3EKKA 1M2RA 1MRVA 4ONAA 2B9IA 5HNBA 4TT7A 2CKQA 4I41A 2Z02A 3FYKX 3K5VA 4O7SA 4EJ7A 4F0GA 3HRBA 1J1CA 1ZXEA 3P9JA 3NSZA 1A9UA 3GOKA 4E6CA 2PVFA 1K3AA 5JFXA 1PMUA 3CD8A 3QBNA 4ZZOA 3KN6A 4BY9E 3KVWA 4WUAA 3LFAA 5EHYA 3KXMA 3EN4A 3R7YA 3BWFA 2JGZA 4I5PA 3LPBA 1U54B 5CZHA 5DR6A 3F6XA 4RA5A 5ETFA 4YLKA 3A60A 3V6RA 2AYPA 3VO3A 3HRFA 2ITUA 5EYKA 3O2MA 4CCUA 1U59A 4YC3A 4A06A 3FY2A 4GH2A 3R9NA 1UV5A 4LYNA 5FM3A 4FV0A 3ZRLA 4TKSA 5DEYA 4CZTA 1OL5A 5HHWA 2R3LA 3C4XA 2HZ4A 3LZBA 4DEAA 2ZDUA 5J1WA 2OWBA 2E9OA 4JG6A 4GYGA 3UGCA 5J9LA 5AIKA 1DM2A 1SMHA 3KXHA 5J7HA 5LARA 3I6WA 3ANRA 4W9WA 5CLPA 2KTYA 4WG5A 4AW2A 5BUEA 4ZSGA 4PX6A 5J1VA 5H2UA 4B9DA 2WOTA 4FV5A 2YA9A 4ALVA 1Q8TA 2WU6A 3CR0A 4KIKA 3UDBA 3VUHA 2WZJA 5IA4A 5HCXA 2WU7A 2XK9A 2P4IA 4GIIA 2EXMA 4JR3A 4L9IA 3DBEA 3D5WA 2PZPA 2YM3A 2GQRA 2RFEA 4BDHA 3R21A 4AW0A 2WHBA 1JKTA 4N4SA 5TE0A 3DBFA 1ZOGA 4I5CA 3P79A 4MD8E 3NX8A 3PA5A 5CASA 3N4VA 2H8HA 5C9CA 5F4NA 5CEQA 4NM0A 2OKRA 3EWHA 4OTDA 1ATPE 3RKBA 4DEIA 2XUUA 1SZMA 4L01A 4BDKA 1GAGA 3UIBA 3F5PA 4XV2A 1SVHA 5DE2A 3FSKA 2B55A 4IX6A 5AX3A 2J6MA 5DYJA 4ZJJA 4CMOA 3VN9A 2Y6OA 3FI3A 5AUTA 3QU0A 1F5QA 4HYSA 3FHRA 3EN9A 1LUFA 2ZAZA 4JDIA 4FBXA 2W1ZA 5F9EA 4RC2A 4KKGA 3ZUVA 4CZUA 4L43A 4M7IA 4GU9A 1B6CB 2PVJA 4TYGA 5J5SA 5H3QA 3RAKA 3FLNC 3QAME 3H9RA 4QTCA 3OTVA 3FPMA 1ERKA 5AP7A 4CEGA 3O23A 4DTAA 5AP3A 5AWMA 5IQFA 5L2QA 4AN2A 5J95A 4DEGA 2GHMA 2ZMDA 2Y4PA 3BPRA 2WQOA 3P7BA 3KC3A 1OECA 4NW5A 1G5SA 3BLQA 2VU3A 3Q9WA 3ORZA 4TYEA 5GJFA 2C4GA 4FVPA 5HCYA 4HCUA 2JEDA 4YPSA 4AZFA 4XJ0A 4I6FA 2YIXA 2QKRA 2WTKC 3QQHA 4X2GA 1XH9A 2BZHB 2PVHA 1WVXA 4C3FA 3OWPA 4DH8A 4G34A 4F09A 3UG1A 3C5UA 4X3FB 4F9WA 3TNWA 5IA0A 4L68A 3PXQA 3QTZA 3F5XA 3R8PA 2O63A 4R3RA 4CFFA 3Q52A 4YJVA 3FC2A 1KE8A 3ZO2A 2BROA 1BI8A 5LCKA 3BHTA 4FSQA 5FTGA 5HESA 3SHEA 5M4FA 3PRIA 2C0OA 5EOBA 4QO9A 5FXSA 5M44A 3VBWA 2WXVA 1NW1A 4WIHA 4KUJA 1Q8WA 4IWDA 4JAJA 3UIXA 1H01A 2YABA 4ZTNA 2ITYA 3FAAA 5AR2A 3W2QA 5L8KA 1W84A 1KWPA 2QLQA 4HGLA 3KCFA 4YP8A 5KBQA 4XBRA 3DK7A 4HOKA 3RK7A 4FTLA 3EYHA 1IAJA 3D7TB 4O96A 4ZJVA 2G9XA 3FMLA 2B9JA 5HLPA 3ZLWA 4DYMA 5A6NA 4V04A 5KMKA 3ID6C 3DXNA 4FL3A 2LGCA 4HZSA 5IUGA 4TYHA 3ORKA 4R8QA 4HJOA 4YBJA 2W5BA 3HLLA 4O0XA 4XG9A 3ALNA 4RX8A 5M53A 3VULA 4BVUA 3D2KA 3EH9A 1JKLA 4Y8DA 3MFTA 1CTPE 4DFZE 3ZFMA 4NH1A 1QPCA 4BI1A 2E9NA 3NYVA 2VWXA 4LOOA 4N0SA 5KMOA 3OF0A 2ITPA 4J52A 2ZV2A 3BLHA 4KS8A 4BB4A 5JGBA 5EI8A 3F3TA 5JGAA 4DFLA 4DLIA 2GQGA 1X8BA 2PMNX 3BQRA 5BYYA 4H58A 4B0GA 4L6QA 3PA3A 1PXKA 4I93A 3JUHA 4L53A 3ZMMA 4FIHA 4D4RA 1LPUA 2XA4A 3U8WA 2BRHA 1PKGA 3B8RA 3MTFA 4GL9A 3QYZA 4DFNA 2J0KA 2R3QA 2O0UA 5AM6A 4RVTA 5EYCA 5FBOA 4FTQA 3FMDA 3V5JA 3RBWA 3QD2B 4FL2A 3V8WA 1IA9A 3Q3BA 5KMMA 4D28A 4QMLA 3SRVB 5GJDA 5EFQA 2RKUA 4FKWA 2PE1A 4YU2A 2C6DA 2VTJA 4W4XA 1UU8A 2W06A 3PY1A 3ORLA 3EZRA 2X2LA 4QP1A 4WNPA 5AIRA 3ZFXA 2QOBA 4QNYA 4F9AA 1Q24A 2J5FA 5AR7A 4PP7A 4MVFA 3FXXA 2F9GA 3GUBA 3V01A 1Q99A 2ACXA 4F1TA 5IMEA 3UPZA 4AUAA 4U8ZA 2QG5A 2VZ6A 4W9XA 3G9LX 1KSWA 3R9OA 5D11A 1WCCA 3AQVA 3PDTA 1Q8UA 4HNIA 1Q61A 2XK7A 3EFKA 3K54A 4RMZA 5HBHA 3OCBA 3KRXA 5IEVA 3R7VA 2VO6A 3VS3A 2G2HA 1ZYCA 2XH5A 4YZCA 1XJDA 4R5YA 1PF8A 2REIA 4EOLA 2WTWA 3AC4A 4TWCA 5CVFA 1IRKA 3EFWA 3ELJA 5D41A 4KIKB 4ITHA 4JBVA 1BLXA 2OIQA 3NUUA 1YDTE 4K11A 2OJ9A 3EFLA 1J3HA 3OCSA 4CRLA 3CE3A 4NIFA 4EK5A 3QQKA 2OXXA 3WIGA 4FTCA 3CJGA 1ZOHA 1A06A 3HGKA 3FLZA 2PVRA 5TO8A 3RCDA 3GCUA 5AADA 2DYLA 2G2IA 3VS0A 3QZHA 2YDIA 4YJNA 3QRTA 4IZYA 4O84A 4FTIA 4YZBA 2PE0A 2UZLA 2W1CA 4AZTA 4E1ZA 3OEFX 2X39A 4GJ2A 3PXKA 1KE6A 4GJ3A 3A4PA 4H39A 4IE9A 4UZDA 4ZY6A 3UJGA 4E8AA 5M08A 3O51A 1M52A 3UZTA 4Q2AA 3TJCA 1RJBA 2RG5A 2B4SB 1YXUA 3L1SA 3P0MA 4IQ6A 5FQDC 4FGRA 4NSTA 2WTVA 4FNXA 4QYEA 4KNBA 4AAAA 4LUEA 4EOMA 2PUIA 2UW9A 3PSDA 4KABA 5LMAA 3D9VA 5BVEA 3F3ZA 4L00A 3BU3A 2XRUA 3KFAA 3FLYA 3QCSA 4WD5A 4JG8A 4Y83A 4DBXA 3GC7A 3AMAA 3MIAA 4DLJA 3S0OA 4ZLOA 4EH6A 4JIAA 4S2ZA 5CI7A 3T3UA 4ZSAA 4CD0A 3CIKA 3ORPA 3MPTA 2R3RA 3ODYX 4NTSA 4QOXA 5E8VA 4H1JA 4IDVA 4JDKA 5C4LA 3LFNA 5AR8A 2JFMA 3ODZX 3GU5A 4QD6A 5AR3A 3I0QA 2GNJA 5CAVA 2QOKA 4JXFA 2BILB 3OS3A 4JIKA 4RJ5A 4BGQA 4ENXA 2Z7SA 2CKEA 4MF1A 3HUCA 5EM8A 3KF4A 3BBTB 4AU8A 3FBVA 5AUWA 4J8NA 2HENA 3HEGA 5L4QA 3RPOA 5L2SA 4AZVA 3C7QA 3B8QA 3QF9A 4HYHA 4Y5QA 4CYIA 3D94A 3KMMA 5L2WA 5EYMA 1Q62A 2R3FA 4HPUE 5DA3A 2WMXA 3QHWA 4U3ZA 3QD4A 5AP4A 4CSVA 4JQ8A 2UW3A 3WF7A 5A9UA 2BTSA 3BZ3A 4YLJA 2FB8A 2BAQA 3DAKA 3PJ1A 4C02A 3P86A 5JH6A 1PXIA 1OIUA 2GPHA 3TG1A 3U4UA 4BICA 2UVXA 2VX3A 3PRFA 3O8UA 3D15A 2GSFA 5HVKA 2NNWB 2IVSA 2ITZA 4BWXA 3ORXA 4BWPA 2PZYA 3BKBA 3G0FA 1WVYA 4NTTA 3D14A 4UALA 2CGWA 3TEIA 4G3GA 4WNOA 2Q0NA 3EZVA 3H0YA 3NYXA 3OOMA 1QPDA 3P7AA 3NGAA 4OT6A 2UZBA 3Q60A 4OTPA 4RPVA 2QOFA 4XG8A 4NUSA 2B7AA 3DAEA 3JYAA 1O9UA 2XKCA 2VTQA 1Y8YA 1REJA 5K4JA 2NRUA 3O7LB 2WMAA 3A7GA 1AQ1A 4U0IA 4WSYA 4XRLA 3EL7A 4YNEA 1PY5A 3NUXA 5KCVA 1TVOA 4OAVB 4D1ZA 5AMNA 2WMRA 1PYEA 3S3IA 3MI9A 4O7YA 3NS9A 4U7ZA 4XV9A 2GMXA 2YWPA 2QKWB 4DINA 4JI9A 2CCIA 2YAAA 4EKLA 3UYTA 2EB2A 3VS1A 3ZRMA 5HD4A 3NUNA 3LFCA 4Q9ZA 3R9RA 2FGIA 2HWOA 4MH7A 3JVSA 4W8EA 4WRSA 1XHAA 1B38A 3AMBA 4NL0A 1KUTA 4N70A 2OO8X 3L8XA 4BDGA 4RFZA 4NEUA 3EYGA 3F69A 2JAMA 3FKLA 1JAMA 3QTXA 3MJ1A 4RQVA 3BYMA 4ERWA 3U6JA 4BDCA 4WKQA 3LAUA 3QKKA 3QTUA 4R7HA 2IZSA 4EK8A 2WMUA 4FTJA 2R7BA 3D5XA 2ZYBA 1JQHA 3EN7A 3EB0A 5D10A 4KRCA 4BHZA 4AZEA 3MFRA 4NCTC 2XCKA 3SOAA 3R8MA 3V5PA 4AW1A 5HU3A 2JD5A 3BGPA 3C0HA 1Q4LA 3TJDA 2F7ZE 4PPBA 5HG5A 4CCBA 3VUIA 4ARKA 4NYEA 2W05A 1B39A 4BL1A 2ZB1A 4TL0A 1SVGA 4UN0C 5KHWA 4FEUA 2C6MA 2YACA 4BCPA 4YTCA 5CU2A 3UQFA 1NT2A 5H8GA 4AZWA 2QU6A 3CPCA 2W1EA 2JKKA 2YN8A 4UX9A 4DGGA 3V5WA 3HV4A 2QONA 1H07A 3SX9A 5FWKK 2X7FA 5KZ0A 4F1OA 2Z7LA 2YITA 5IA1A 5HLWA 2JKOA 1VR2A 2X6EA 3NW7A 3FLWA 4RVKA 5M51A 3FL4A 5E4HA 2FSOX 3TV4A 3W2CA 4HGSA 4M15A 4JX3A 4IM2A 4AT3A 4F08A 4ZLYA 1PRYA 4II5A 1O6YA 2ETRA 2OI4X 2WFYA 5IF1A 4O7ZA 5IEYA 1BX6A 4IAAA 5B2KA 3ROCA 1PMNA 4NIFB 2BUJA 3NUYA 3I60A 4D0WA 3VBXA 5AR5A 4ZS0A 3RVGA 3LCKA 4C59A 4F99A 3QFVA 2IN6A 2WIHA 4GFOA 5CSVA 3F5GA 2YM8A 5HX6A 4P90A 4ZJIA 2HW7A 5CU4A 3RPYA 3QTWA 1NVRA 2HYYA 2J0JA 3FSFA 3GU8A 4FZFB 5D12A 4BTFA 5IZFA 2OZOA 3OY1A 3QHRA 5E90A 3Q4ZA 4P4CA 3Q2MA 2VWZA 4BZOA 3BE9A 3IQ7A 4F9YA 4LGHA 2PE2A 3GT8A 5A4QA 3IGGA 2BZJA 2OJFE 3ZSGA 1YHVA 2EUFB 2PY3A 3LFBA 3KRLA 3NCZA 3REPA 3UIUA 3MW1A 3QC4A 4YC6A 3ZDUA 2JIIA 3LCDA 3R00A 2IW8A 3BU6A 4DH5A 5HICA 4FA2A 4MXZA 1ZZLA 3OP5A 5HIEA 3DOGA 3FQHA 4FKPA 3ZXZA 4K8AA 1H1RA 4FV3A 3V8TA 1HOWA 5KMLA 1P4OA 4QNAA 4O7WA 2BR1A 3TI1A 5F94A 3WZKA 3PJ2A 4R78A 4GEOA 2F7EE 3O71A 4I20A 2BMCA 5JK3A 1J91A 4RZWA 4UBAA 1ND4A 1SM2A 4TWOA 5EHLA 1R0EA 5JGDA 1YDRE 3UOJA 2J9MA 4MCVA 3AGLA 2R3OA 2P3GX 3NIZA 1ZLTA 2YEXA 4G9CA 1WBPA 3L8VA 4O7VA 5IQCA 3FZTA 2F57A 4ZTMA 2OLCA 1YRPA 2UUEA 3UVRA 2P2HA 4FOCA 3C5IA 3TTIA 1HCKA 4FT7A 4HZRA 2PMOX 2C6TA 3S4QA 1YXTA 3PVUA 4QMXA 3P5KA 4EJNA 2JC6A 3N51A 3OWLA 5ANEA 4V05A 2CNVA 1OL7A 2FO0A 2J90A 2CGUA 3FLSA 4CKIA 3HMOA 4YO6A 3VWAA 4D2VA 4FEVA 3S95A 1L8TA 3R2BA 2XEZA 2X9EA 3KXNA 3V04A 5JT2A 5EQPA 4PL4A 4RBLA 4Z7HA 3GOPA 2VWIA 3WARA 5C27A 3A62A 2ZDTA 3RHXA 5DOSA 4NM7A 1GZKA 4IAIA 4XV3A 3WE4A 1JNKA 2GQSA 3E87A 4LV5A 4PQNA 3HAVA 2G15A 2UZEA 3SG8A 4TNBA 1DAWA 3ZH8A 1R39A 2XF0A 2W99B 4NM3A 4MWHA 3RK9A 3QKLA 4CKJA 1GY3A 3NWWA 4XUFA 3PP1A 4LRMA 1FPUA 5EH0A 4YO4A 3NNUA 5EM6A 4OLIA 4QMVA 4P2KA 1ZOEA 1ZWSA 2WMVA 3FLQA 3AXWA 4XOYA 1Q8YA 4WG4A 3VUMA 3JVRA 1SVEA 2CLXA 2VWWA 5CAQA 4TRLA 3TUDA 4OTQA 2YAKA 4RZVA 3NNWA 3FZRA 4F0IA 4C35A 1UU9A 4K18A 3ORTA 3QTQA 1Y57A 2R3JA 3OROA 2Y4IC 4M0YA 5AUXA 5CNNA 3KRJA 3WZUA 4DC2A 4QMOA 4IIRA 3HRCA 4I92A 4DEHA 3UC3A 3IOPA 4BCHA 4HVSA 1UA2A 1YXSA 5EM5A 2O64A 3P08A 2JAVA 1I44A 3IECA 3F7WA 3Q9XA 5M4IA 5EQYA 4BR3A 4XS2A 3GNIB 3UP7A 4AOJA 3W2PA 5K9IA 3MSSA 4LL0A 1BMKA 4XNEA 4FTOA 2AUHA 5ETCA 5C03A 5D7VA 4EI4A 3OT8A 2XRWA 4K33A 5LOHA 1OIRA 2W7XA 2JDTA 3OUNB 4UMTA 4EH4A 4HVHA 3H9FA 4IDTA 4YJUA 4A9UA 3UIMA 2C68A 2CLQA 3MN3A 3QQFA 2I0HA 2QCSA 5AV3A 2R3MA 4ACMA 5KHXA 3VBYA 4UMUA 4F6SA 1F0QA 5DPVA 4NJ3A 3LCSA 3NPCA 3LW0A 3KXXA 1T45A 2OK1A 1W83A 3DY7A 3WZJA 5IA2A 5IH4A 3LMGA 3WOWA 4L3LA 2Y8OA 3I7CA 3FMNA 5I0BA 2NO3A 3Q5IA 4EONA 5JKGA 2ITOA 4FEWA 5IISA 3L8SA 4AA0A 3MESA 3COHA 3PZEA 4DTBA 3CJFA 3DAJA 3BU5A 4DH1A 3A61A 2ZJWA 2F2CB 3GCVA 3E8DA 3O0GA 4FSTA 4B99A 4MD7E 4DA5A 5KBRA 3LFDA 3P4KA 5DHJA 2OIDA 4G2FA 3WBLA 3MPAA 3DZQA 2ITVA 1NVQA 3CSVA 3VUDA 4BDJA 4RIXB 4YPDA 5LQFA 1STCE 3C51A 5I9XA 5B7VA 5CXHA 4E93A 4EHZA 1OL1A 2C1AA 2PSQA 3NLBA 4EEVA 2OW3A 5GINE 5EKOA 2XNBA 1NXKA 3L8PA 4QQTA 4EK6A 3W55A 4R3PA 1NY3A 2QLUA 4YUQA 3EQGA 4UXQA 3ATSA 3V5QA 3HDMA 4HGTA 2VTPA 3DA6A 3RINA 2V55A 5BVOA 4FEQA 4ASZA 3ZBXA 2WMQA 4BZNA 2Z8CA 4WBOA 4X0MA 4AXAA 5JFSA 5JFWA 4H3QA 4RWKA 3HVCA 3ZO4A 3TNIA 3SAYA 5CF8A 4EHVA 3FZSA 2QOIA 3ENMA 4IZ5A 3CCNA 3D2IA 4BCJA 3UYSA 4ANLA 3NEWA 3PY3A 1XO2B 4O7RA 3UBDA 4AE6A 3C4ZA 3KULA 5CANA 5EK7A 3R22A 4OR5A 4PF4A 2C6EA 3AD4A 5CEIA 3VIDA 4AS0A 4CT1A 5ANOA 2CPKE 3TM0A 4ANQA 2B9HA 4E6AA 4G3EA 2B54A 2WMWA 5CVGA 3FUPA 4TXCA 1GOLA 3WYYA 3OBGA 3HMIA 4ERKA 1CDKA 4RJ4A 2I0EA 3ROYA 4RJ3A 3R1QA 3R73A 3MB6A 2UZVA 4GT3A 2BRGA 1M7NA 4HGEA 4D5KA 5AP5A 3ULZA 3HP2A 5HTIA 5HG8A 3R28A 2OZAA 3PZHA 3SW4A 5I4NA 2PU8A 4LGDA 3UMXA 4QMWA 4DN5A 3EN6A 3C50A 2XBJA 3IDBA 4IWPA 4DEBA 3UG2A 2WEVA 1DI8A 5CAPA 5IQAA 2P33A 3GC8A 3W2SA 4APPA 2JIVA 3UNKA 3ULIA 3D0EA 4AWIA 4HW7A 2FSTX 2EXEA 3OWJA 2YHVA 3KN5A 4FKIA 5E8WA 2QNJA 3MH2A 3SLSA 3Q4UA 3LQ8A 5D1JA 1DS5A 3FJQE 1QMZA 4DCAA 3NMUF 2PYWA 3AGMA 3EN5A 4B8LA 2JIUA 2J0MB 2YCRA 4ZIMA 3NW5A 3WZDA 3U4WA 3BX5A 2PL0A 2XVDA 3P78A 4Y95A 3LXLA 3MDYA 2UZUE 2XNGA 4KIOA 4L8MA 5HIDA 3R8ZA 4AACA 4C4GA 4EKKA 2W1DA 2GS7A 3MY1A 3IW8A 4R5SA 2W1IA 4NWMA 4G31A 3T8OA 3GQLA 3KEXA 4CRSA 2V22A 1H1WA 1H08A 4Q9SA 4J96A 3C13A 3JY0A 2YIRA 5CEPA 5K4IA 5M06A 1UU7A 2WPAA 4M66A 4M84A 2GU8A 1JSVA 2CMWA 5F20A 5BVWA 4C33A 3QRUA 4FF8A 4FKUA 1H0VA 3RMFA 1GIHA 4BZDA 5KUPA 3F2RA 5GNKA 4YJTA 2V62A 4Y46A 5CTPA 2XNOA 4H3PA 3R02A 3W2OA 3F5UA 1YWNA 1PXJA 3MIYA 2OU7A 3LVPA 3FQEA 3OTUA 2ZVAA 3THBA 5JQ5A 1Y6BA 2BFXA 4D5HA 2OICA 2QHMA 4FSMA 3KXGA 4CFVA 4G5PA 5GIOE 3HV5A 2OFUA 1REKA 3TCPA 1UNHA 3W8LA 1E1VA 5LVLA 2WB8A 4GVAA 1UKIA 2JKQA 3FC1X 4C4HA 2IZTA 4OTFA 5CVHA 4EZ5A 3SW7A 3H30A 3B2WA 3LXKA 3TIYA 2BRNA 4FVQA 1GZOA 4FSUA 4C37A 5HE3A 5E1EA 2C5OA 4BTMA 4RC3A 3HL7A 1YXXA 4WNMA 4JOAA 5H9BA 1V0PA 2X9FA 4FTRA 1R0PA 4PL5A 4L46A 4M69A 3DJ7A 4IWOA 3SD0A 3VBVA 1SNUA 2E9PA 3ZLYA 2VTLA 3LOKA 4IHPA 3AOXA 4O38A 4FV1A 4EUTA 1VJYA 3M11A 2IVUA 4PMMA 5AM7A 2UVZA 2X2MA 2R2PA 3A7HA 3I1AA 4OBPA 4PV0A 5BNJA 3TUBA 4FR4A 3T9TA 4MQ2A 3MVJA 4ALUA 3PLAE 4K2RA 3KB7A 4PUZA 3MY0A 5I3OA 4X2JA 5FRIA 2RG6A 4OW8A 2PHKA 4JRVA 3NNVA 4PNKA 4MK0A 2Q83A 3DLSA 3IPHA 4L7FA 4QPMA 4MBJA 5F1ZA 2WOUA 3P7CA 4FKTA 1CM8A 3OZ6A 3QWKA 3V51A 4EOKA 5BYZA 3VC4A 4AOTA 2PVYA 4IJPA 4CQEA 4FIEA 4L3PA 2BFYA 1I09A 2C6LA 4RIYA 4E20A 3OMVA 2HELA 2RGPA 2XNEA 3N9XA 1XQZA 3FI8A 2UZDA 3GVUA 1Y6AA 4F1MA 4MEDA 2WTJA 4U41A 3UMWA 4LL5A 3VVHA 1PXOA 3IGOA 3EOCA 3QXPA 3WE8A 4A9TA 4BBFA 5KMNA 4FV6A 4CV9A 1YOJA 2BAKA 4PDPA 3A7IA 3RZBA 5ITAA 2CN5A 1Q5KA 4I94A 4IBMA 4IMYA 3HV3A 2BRMA 4B6LA 3KGAA 5BX0A 4I0TA 5AR4A 4TY1A 5CX9A 4H36A 5L6WL 3NVKI 4JBPA 2B52A 1OMWA 3TXOA 3UVPA 3KXZA 4ZTLA 2ESMA 1ZYSA 2IZRA 3IKAA 3CBLA 4GRBA 4F63A 5KKRB 4D1XA 2CNQA 4RWIA 2EB3A 3U9NA 3R1YA 3RP9A 2V5QA 3L9MA 3RAWA 3P1AA 3UZRA 2VWYA 2OJGA 3HDNA 2O3PA 3K2LA 4OTRA 1BKXA 3KULB 4FTKA 5E8XA 2UW5A 3GFWA 3TKIA 1RW8A 4EC8A 5KMJA 3HYHA 3BHVA 1ZY4A 5DH3A 4O21A 3CQEA 3PXRA 4FICA 3RM7A 3PJCA 4DCEA 4IB1A 3UP2A 3WF6A 4BGHA 4XOZA 5AA9A 2C0IA 4G1WA 1OBDA 2J7TA 4WG3A 3FMJA 4I21A 3ET7A 3OWKA 4O27B 4RIOA 5DLSA 5HO7A 3LFSA 4G9RA 3BHYA 4IZAA 2ZV7A 5FDPA 5DR2A 3DQWA 2C69A 1E1XA 4FT5A 3PPJA 4FTAA 2GTMA 3E88A 4W4YA 4XRJA 3E64A 3ZEWA 4KB8A 3ZXTA 4MX9A 2XIXA 4C4IA 2NPQA 5IG1A 3R7UA 3OY3A 4AG8A 5C1QB 2IO6A 3ZO3A 3BE2A 1YI4A 5BUJA 5HNGA 3ZLXA 5I9WA 2PK9A 5EW9A 3BYSA 3DPKA 1BL6A 2O5KA 5DMZA 4FV7A 3NCGA 4U80A 2YIWA 1FGKA 4MKCA 1A48A 4WT6A 2R5TA 4WRGA 5CAUA 3LMIA 4KA3A 1PXNA 5J9YA 3GC9A 3ITZA 4GCJA 4BWKA 5M56A 2C6IA 2YDJA 3QX4A 4IAKA 2F4JA 4YSMA 3QLGA 3LIJA 3AC5A 1YHSA 3UOKA 1KE9A 1OGUA 3LFFA 3AC2A 3FHIA 3I5ZA 5CSWA 5HTCA 5HVYA 4JAIA 5T68A 4BI2A 5C26A 3DT1A 2OF2A 3DFAA 4ANSA 4C38A 3DGKA 3LLTA 5EI2A 3KREA 2IJMA 2QR8A 2XIRA 3NNXA 3OW4A 4KWPA 3R9DA 4CFWA 2QG7A 3CD3A 1BL7A 4DF3A 4KBKA 5L8JA 2DUVA 3F61A 5CWZA 5AFVA 1W8CA 2YJRA 3LM5A 2ZV9A 4YHJA 4FIIA 3EJ1A 2PMLX 4JQ7A 3UO6A 2QVSE 1H8FA 5DN3A 2VAGA 4YR8A 4IW0A 1WBSA 3R6XA 3ZFYA 2C0TA 2ITTA 4I3ZA 4C34A 4BKZA 4ASEA 2Z7RA 5GIPE 1PW2A 4S31A 3L9LA 4W4WA 5HX8A 2PZ5A 1KOBA 4CZYB 5K5XA 3OOGA 3OC1A 4F9BA 5BYLA 5DIAA 3G0EA 5CAOA 1CKIA 1ZYDA 2XP2A 4DGNA 5I5ZA 4FOBA 4CLJA 5LVPA 2QOLA 4FKGA 3A8WA 3C4CA 3LXPA 2XKEA 4IVBA 3R83A 3ACJA 4GV1A 4UMQA 3UOHA 1YOMA 3SG9A 2XK8A 5CYIA 2UW8A 3ZS5A 1AD5A 5ANKA 2VTIA 2A4LA 3HNGA 3G90X 5FEDA 3DDPA 2IZUA 5A4CA 3VBTA 5FEQA 4HCTA 3KF7A 3COIA 2BAJA 3GENA 4LUDA 2YWVA 4O0RA 1OKYA 1R1WA 2A19B 4RIWA 4YJSA 2R0UA 5EHOA 3VRZA 5A3XA 4AX8A 5A14A 4CFNA 3HKOA 1OITA 2W96B 5TT7A 3DKGA 4EH3A 3K3JA 4ZLZA 3DZOA 1OIYA 3NRMA 2YLEA 4O0TA 2QI8A 4WHZA 4V0GA 2VO7A 5C4KA 3DB8A 2QOCA 4XG4A 2R64A 4ZEGA 4IXPA 1TQPA 2GS6A 3KMWA 3VS4A 3BYVA 4MWIA 4ACCA 4AN9A 3EQFA 2C5VA 4BRXA 4M97A 4BCIA 4QMYA 4EOIA 4GG5A 3TT0A 4BF2A 3IONA 4NFMA 4BKYA 4A4OA 4LG4A 2VV9A 3MJ2A 4NKAA 5FP5A 3UVQA 4CFMA 4JG7A 2WELA 1KV2A 2YDKA 4YJQA 5KKRC 2DS1A 3F66A 2CN8A 3FZ1A 3ZLSA 5L6PA 3TTJA 2X81A 4XLIA 2E9UA 3W32A 4A9YA 4TYHB 3VQUA 4IC8A 2HZNA 3GI3A 4IH8A 5FD2A 2W5HA 2HAKA 5CEMA 5JRQA 1W82A 3QA0A 4DG2E 1CMKE 1OPKA 4DT8A 4RFYA 4LRKA 1OL6A 1KE7A 1GZNA 2XMYA 2VWVA 4E6DA 3LKMA 2IW9A 1FQ1B 2JBOA 4YZNA 1XH5A 1QPJA 2A1AB 2R3NA 5ACBC 2OIBA 3OG7A 3GGFA 5GZ8A 2QO2A 2UZTA 4CG9A 2I0YA 3QQLA 2O65A 2ERZE 5E7RA 3MA6A 3PXFA 3QD0A 4YZDA 4ACHA 3V8SA 2O8YA 4H3BA 4M67A 3SXRA 4FKRA 2UV2A 4DFYA 3ZDIA 4CGAA 3KL8A 2WNTA 5AUZA 3VNTA 4O91A 4FE2A 5DT0A 4PY1A 3DK6A 2CDZA 1JPAA 1V1KA 3PWYA 4TN6A 2X7OA 3SXFA 4AOIA 4MHAA 1ZARA 4C2WA 3QRKA 3EQIA 4KKHA 5EDRA 5HBEA 3Q6WA 1FOTA 5CU0A 4QPAA 5BUIA 5M07A 1YHWA 3CQUA 1UWJA 3CTJA 2FSMX 2BPMA 4FNYA 4QP6A 4QP2A 5E8SA 5DFPA 5HBJA 4YBKA 5K3YA 3W18A 4IWQA 5HTBA 3RPRA 1Q3DA 2XNNA 3OW3A 4M13A 5C8NA 4WO5A 4I6HA 5HIBA 4D1SA 2W9FB 5FM2A 3TWJA 3QQGA 4QP8A 3VUGA 3GU7A 3CS9A 4G6OA 2Y4IB 3DJ5A 3V6SA 4I4EA 3WF5A 4FSYA 4F6UA 4OBOA 3HA8A 3LJ1A 5DEWA 1XH8A 4YTFA 3W10A 2VNYA 4R6VA 3CPBA 3FMMA 1XBCA 3E5AA 3VBQA 3NVMB 1OVEA 4OGRA 1M14A 1FGIA 2WKMA 3SDJA 2YZLA 4RWJA 3PVBA 4E5WA 5CQUA 4FTMA 2OXYA 5AUVA 3MYGA 4TNDA 1UNGA 5HLNA 2PZRA 4PMPA 4FG8A 3GXLA 1H28A 4G6NA 1XWSA 1OM1A 2XJ0A 3FMKA 4FG7A 4O0UA 5FDXA 3ZUTA 4E26A 1GIIA 3QZFA 4GMYA 3SXSA 3FL5A 5IA5A 3ZSHA 4E6QA 4FYOA 3HX4A 4MXXA 2VTTA 2J5EA 2W9ZB 2V7OA 3ZM4A 4M0ZA 3VJNA 2VTNA 4S30A 4D4VA 4ZS4A 4FZDB 4DFUA 3EQDA 4L44A 1FVTA 3GQIA 4U3YA 4PTEA 2OXDA 3LXNA 3C0IA 2VTAA 4I6QA 2VWBA 1ZYLA 3Q9YA 4P7EA 4C61A 2YM4A 2FUMA 4LV8A 4CXAA 1GZ8A 2V0DA 4FI1A 5EOLA 3UOLA 3R30A 1JKKA 4I5HA 5FTQA 3CTHA 2I0VA 3G9NA 4XH6A 4D58A 3CQWA 4RWLA 2GS2A 1JOWB 3SA0A 3A8XA 3FMHA 4ZP5A 5LVNA 2KULA 4X6QC 3RGFA 3CLYA 1XBAA 4QYGA 3HECA 3Q5ZA 4C0TA 4W4VA 3UTOA 5AP6A 3PTGA 3DV3A 1PXPA 4MNFA 3GP0A 5HQ0A 5I9YA 1JWHA 1Z9XA 4TZRA 3JY9A 2GDOA 2YZAA 2P2IA 4KD1A 3LCOA 4I6BA 4FT0A 4PNIA 3V5TA 4BDDA 4DBNA 2HZIA 4CG8A 4EQCA 3VJOA 3DKOA 3CY3A 3WI6A 4C36A 4YJPA 4GUBA 4K77A 3F2AA 1Z5MA 3TNQB 2WD1A 4I4FA 4J95A 1WFCA 3OVVA 2CKOA 3E8EA 4BHNA 4G3CA 5FXRA 3RHKA 4EYJA 1OKWA 5EQEA 4JQEA 4EC9A 5JSMA 5TR6A 3PP0A 1WZYA 3BEGA 3NAYA 3VF9A 3WF8A 4DTKA 2WIPA 2GNLA 4XX9A 3AD6A 3ZONA 5IQDA 1OL2A 2OGVA 3MGYA 4Z7GA 3O17A 2XM9A 4KAOA 3UC4A 5E8YA 4DE4A 1TQIA 2YLFA 2C6KA 1GJOA 4F70A 5K0XA 4NJDA 3A2CA 4XG6A 3U6IA 1Z57A 2XCHA 3RWQA 1IAHA 4RIWB 3E63A 3OBJA 4JDJA 4O6EA 4HYIA 1W0XC 2WQBA 4BCGA 4BCQA 5L6OA 4K1BA 2EXCX 4FK6A 5AAGA 5CQWA 5HGIA 3DNEA 4QMSA 4V0GB 5K0KA 3PG1A 3NZ0A 2PZIA 1QL6A 4UY9A 5HCZA 3SV0A 3SQQA 5M4CA 3N4TA 1ZZ2A 3GU6A 5M4UA 2HY81 4CTCA 4EUUA 5LCJA 1KOAA 5FP6A 2QOHA 4DGOA 4QTBA 5AEPA 4RT7A 4XLVA 2Y9QA 5DWRA 1OUKA 2OBJA 4GSBA 5I3RA 1H26A 4QQJA 5IA3A 4APCA 2QR7A 1MQBA 4AP7A 2HCKA 4E5AX 3RTPA 4EBVA 1GNGA 4MAOA 5DI1A 3OFMA 4ZTRA 4EH2A 3DCVA 4FL1A 3DXQA 3R7GA 3AT2A 4IX5A 1JBPE 4AT5A 4CV8A 2F49A 4FSNA 2BCJA 1WBTA 3DTCA 4ZK5A 3SVVA 2WTCA 4ITIA 2J2IB 4BIEA 5EYDA 4Y5HA 1P14A 2ITNA 1H24A 1E9HA 1R3CA 3POOA 3B2TA 4IM3A 3VW8A 3C4EA 4FV4A 4I22A 3JS2A 4YGAA 2OSCA 2XKFA 3JXWA 3BLRA 3QX2A 3LLAA 2PVKA 1K2PA 2B1PA 2BALA 3IW6A 1IASA 5DRDA 3G33A 3F3UA 3ERKA 5A4LA 4RFMA 3QTSA 1U5QA 5HE0A 5JZNA 5CU3A 4ENYA 2XK4A 5DGZA 1VEBA 2CNUA 4O2ZA 3PUPA 4QMZA 2OFVA 5A54A 5J79A 2OJJA 1ZYJA 2XEYA 3O7LD 3PPKA 4BCKA 4F64A 4F7NA 5GZAA 3BCEA 3NUAA 3V3VA 4U44A 4FTUA 4YTHA 2WMSA 4ZZNA 2JBPA 2DWBA 3LFEA 1ZMUA 5EM7A 2J4ZA 2BDWA 3R7IA 2BKZA 4PTGA 4WUNA 4AFJA 4D2RA 3U9CA 3RAIA 4ACGA 4X3FA 3WIKA 3ENHA 4C4EA 3BRBA 4FSRA 4EWQA 2B0QA 5IEXA 3C0GA 4C62A 5TKDA 3ZO1A 5IDNA 2QQ7A 4ZY5A 4GKHA 3KMUA 4O86A 3UE4A 4OBQA 3COMA 4C3PA 4HPTE 3D83A 4PPAA 4RLLA 4EHGA 4RVMA 4ZY4A 4U5JA 4Y73A 3JPVA 1PXLA 4D2SA 4EH8A 4BFMA 1F3MC 2UZNA 3H3CA 1WBVA 3POZA 4FT3A 2XNPA 4K9YA 4XP2A 4ACDA 3ZM9A 3TDVA 4USDA 3RI1A 2YM5A 4FV9A 1BUHA 2C3LA 4IADA 1S9JA 4BCMA 4QTEA 2GHLA 3DNDA 3R0TA 5AAEA 3AD5A 2AC3A 2PMIA 4MF0A 4L42A 3SKCA 4WBBB 4GUEA 4BCNA 3PIZA 2HK5A 3TDWA 3ZCLA 1MQ4A 5B2LA 3CKXA 4GFGA 5J5TA 3PJ3A 1OPLA 1FMOE 1PYXA 4IEBA 3RPVA 2Z2WA 4LGGA 5H8EA 1YI3A 4OAUC 4OTHA 4L3JA 4BYJA 2J0LA 3ZU7A 2W4KA 3WF9A 5ACKA 3PA4A 2GTNA 4QMPA 3RM6A 3QGYA 4BDAA 2PUUA 2X8EA 4JJRA 5M57A 2J50A 4RX9A 5AA8A 1R78A 1UWHA 2JKMA 4RSSA 4TWNA 3KU2A 1M2PA 4U9AA 3RCJA 2E2BA 4A4XA 1CKPA 5EDPA 1P4FA 5TF9A 3BBWA 5LXMA 2R3GA 2XIKA 4MNEA 3PSBA 4FIFA 3WZEA 4JNWA 3LQ5A 5I9UA 3ZZEA 4D4SA 3QZGA 3FZPA 4J99A 3FXZA 1IR3A 2W1GA 4RJ7A 3WILA 3DXPA 3DFCB 4XG3A 4AGUA 3SGCA 4J8MA 4DT9A 1OKZA 2X7GA 2BDFA 3BEAA 4MBLA 5L2IA 1W7HA 2H96A 3Q04A 3ZTXA 3O96A 4FTTA 4LOQA 2YCQA 4QP3A 3AG9A 2Z7QA 5IUHA 5JZJA 4QMMA 3AC1A 4HNFA 3QALE 4EOOA 3MVLA 3R7EA 2CSNA 4UV0A 5HU9A 3FKOA 2JDSA 4GVJA 4CMUA 2EWAA 4D2TA 4KBAA 4F0FA 3QCXA 5M09A 3PVWA 2YISA 3M1SA 3CXWA 3OT3A 3QD3A 3QWJA 3KRRA 3LCTA 3SRVA 1UU3A 1OB3A 3FE3A 4RX7A 4WA9A 4L67A 3BIZA 4NW6A 4G6LA 3FV8A 4PRJA 1URCA 3DQXA 4IAYA 1PKDA 3MA3A 4C7TA 4NU1A 2C1BA 3PXZA 3R1NA 4FZ6A 5LWNA 2XBAA 2WO6A 4LOPA 3TUCA 3C9WA 2IWIA 4X3JA 3BV2A 3HUBA 2WMTA 1PMVA 1MRYA 5TOZA 3EHAA 4GK4A 5HO6A 4OTGA 2JDRA 5CSHA 3KCKA 3U54A 4CTBA 4FYNA 2LAVA 4GK3A 2HW6A 4G5JA 4QMTA 1O6KA 4JRNA 4IB3A 3QTRA 2ONLA 5JRSA 4R7BA 2PULA 2R3HA 3UNZA 4ZAUA 4AA4A 3LMHA 2OG8A 4PTCA 3NYNA 4DHFA 4DAWA 4ASXA 3QZIA 4X2FA 4RGJA 5DT3A 4ZMEA 4WOVA 4E5BA 4IFCA 4YZ9A 3FXWA 2XK3A 4CFXA 3MS9A 4E4XA 3SC1A 3G5DA 3UNJA 5BQ0A 5BVFA 5LVMA 3UZPA 4NCTA 4USFA 5DR9A 3E3BX 1JSTA 4MXYA 4M68A 3LFQA 4ALWA 3DLZA 4X7QA 5G1XA 2A0CX 2YERA 4PP9A 4BBEA 3G51A 4R7IA 3Q9ZA 2F2UA 1V0OA 4BTJA 4YMJA 5HNIX 3VW6A 1ZMVA 5BPYA 3FPQA 2QURA 4U45A 3Q4TA 5L2TA 2G2FA 2VGPA 4LMUA 4GT5A 4PDOA 4U81A 3EQPA 3ORNA 5ICPA 3BWJA 4KIPA 1J7IA 2BVAA 4PWNA 4CNHA 1H00A 4QQ5A 3PVGA 4TW9A 4D9TA 4Z3VA 3PWDA 3VS6A 4IZ7A 3MV5A 4CVAA 1MP8A 4QMUA 4YHFA 3U6HA 2BZKB 2BHHA 2ZMCA 3GB2A 4FK3A 4IVCA 4WSQA 3UQGA 2HXLA 3CC6A 3I81A 3KY2A 2BDJA 2GNFA 3QL8A 2R3KA 2GNGA 2P55A 4M8TA 5AP1A 4AA5A 4DG0E 3VF8A 5CI6A 4C8BA 5AP0A 5IH6A 4E4LA 2WMBA 3AC3A 4AQCA 2X0GA 2WQMA 3KK8A 1H4LA 2JFLA 2X4FA 3KA0A 4IANA 2B9FA 3BELA 3RJCA 4XP0A 3IW7A 4HVIA 5E92A 5ETIA 3R1SA 2C47A 3FYJX 4BIDA 4CKRA 4GU6A 5I9ZA 2PUNA 2BRBA 3O50A 2X1NA 2ITWA 3TKHA 1P2AA 4N6YA 4RG0A 4IVAA 3PG3A 4FKLA 4RRVA 5HE2A 4PMSA 2W1HA 2YIQA 2QOOA 1TKIA 3QLFA 3PLSA 4IAFA 4IJ9A 4FIGA 3EQBA 5CS6A 4BDIA 1WBNA 5IQEA 4ZTSA 3QUDA 1EH4A 4LI5A 2ZM3A 4RX5A 2UVYA 1KE5A 2O2UA 3GCPA 3E93A 4QP4A 4DG3E 2X4ZA 2PVMA 4U43A 3QUPA 3A4OX 1LEZA 4E4MA 2HIWA 3ZSIA 2C3JA 1Q8ZA 3K3IA 4AF3A 3LJ0A 1ZRZA 3BV3A 4XEYA 1YI6A 2OH4A 3QXOA 5JQ8A 1VZOA 2ZB0A 2VTSA 1PXMA 3DB6A 4D0XA 4HVGA 3ZHPC 3PE1A 2XNMA 3QA8A 4NFNA 2WGJA 2UW0A 1YDSE
chains in the Genus database with same CATH superfamily
3VQHA 3LQ3A 4HVDA 1VYWA 4YSJA 5F95A 5IUIA 4D2WA 5IMXA 5EW3A 4FX3A 2H9VA 3DK3A 2VNWA 4J97A 4JT3A 4WNKA 3ZC6A 3NYOA 3BYUA 4Y72A 2RL5A 2C3KA 4MYGA 3W0MA 5KZIA 5HEZA 2FH9A 3ANQA 4ANMA 4OT5A 5I9VA 4XCUA 4O83A 1UVRA 3ZZWA 4BGGA 1ST4A 4EQUA 1WVWA 4K0YA 4MNEB 3HA6A 3EFJA 5LMKA 2VX1A 1OPJA 4YLLA 4BDFA 4O4EA 2PTKA 5B2MA 3IS5A 3BGQA 4QP9A 1UNLA 5LWMA 3EKNA 4JL9A 5D9HA 3DBDA 2H6DA 2C5XA 3G6GA 1G3NA 3M42A 4FGBA 4PDSA 4DGMA 4YHTA 3DS6A 3R8UA 1Q3WA 2CGVA 4IB5A 4PMTA 3UPXA 4EK3A 1NA7A 3CGOA 4NK9A 4P5ZA 4X21A 5EI6A 2RFNA 3IDCA 1FVRA 3P23A 3UO4A 2C3IB 4L52A 4Y85A 5CF6A 3F88A 3W1FA 3OXZA 2UW7A 1IEPA 3CGFA 4ZZMA 5GZ9A 3Q32A 4R1YA 2I6LA 2WTDA 4V01A 4O6LA 4ZOGA 3FY0A 1H1QA 3R2YA 2R3IA 1OKVA 2YM6A 2V7AA 3PJ8A 3DJ6A 2CGXA 4M3QA 5DVRA 4FSWA 5HG9A 4EWHA 4TYIA 3Q2JA 1YQJA 1ZAOA 5FUTA 5G6VA 1H1PA 2OZAB 4U79A 1APME 5IPJA 3CP9A 4KKEA 3R63A 2A2AA 2QOQA 1FMKA 1SNXA 2ZM1A 3NUSA 4N6ZA 4GW8A 5IH5A 3N4UA 1DAYA 2ZM4A 4DFXE 3PSCA 2YFXA 4EOPA 4P5QA 3QTIA 2JDVA 3UQCA 1JVPP 3F7ZA 4ZSJA 5CXZA 3GEQA 4ITJA 5DBXA 3OCTA 4HYUA 2JLDA 2E9VA 2G1TA 4C3RA 2J51A 2C6OA 2R9SA 1J7LA 3OUKA 2EU9A 4RQKA 4DH3A 2HOGA 2VRXA 4O2PA 3W16A 4EZ7A 2PVLA 4USEA 5L3AA 2X8IA 3MFSA 4XYFA 4JR7A 1LR4A 2VTOA 1XKKA 2GFSA 4BIBA 4ANNA 3ORMA 2RF9A 3HP5A 3NDMA 4EH7A 3MFUA 4EZ3A 4M12A 5AAFA 1CSNA 2JDOA 3AT4A 2W17A 3E92A 5J7BA 5JMSA 4JDHA 3R9HA 5IKWA 3IO7A 4MXCA 3PE2A 2W4JA 5B0XA 5HE1A 1OUYA 3H0ZA 5AV1A 5T3QA 4BI0A 4F65A 4I24A 3R8LA 3F2NA 5CEKA 2BKKA 2RFSA 3IDPA 4GKIA 2BHEA 5CF5A 5DRBA 2R7IA 4X3FC 3RALA 3KK9A 4AW5A 4C4FA 4D9UA 4DGLC 3DKCA 4AE9A 2CKPA 3EQCA 3PFQA 4QPSA 4QQCA 3GCSA 4XHKB 4JVGA 4TPTA 4UYAA 4ANOA 3PXYA 2CHLA 4O22A 5DG5A 5T6KA 1H25A 4MBIA 3O8TA 2FA2A 1V0BA 2VD5A 4QYFA 2YCFA 2AQXA 5CSXA 1XR1A 2VN9A 4LQMA 4BBMA 4DITA 4O81A 4FKVA 2HXQA 1YXVA 1G8SA 5ANDA 3O8PA 1W2CA 4B8MA 1SYKA 4DEEA 3AC8A 3QRIA 2X8DA 3UDTA 3D5UA 3Q6UA 2X2KA 2AC5A 4QMNA 4O7LA 2WQNA 3PPZA 3P5JC 2XZSA 3HMNA 4KSQA 3TZ8A 2PUPA 3ATTA 4FNZA 3TV7A 1RE8A 3GBZA 3IW4A 3TL8A 4E3CA 1WBOA 4AGCA 4MQ1A 2GFCA 4M69B 4GS6A 2VTHA 3C4WA 3OEZA 2Y6MA 4K6ZA 2FSLX 4QRCA 3F9NA 5AP2A 3RAHA 3TACA 4O7TA 1O6LA 2RFDA 3UODA 4EHEA 5M55A 4XG7A 1MRUA 2FYSA 2VUWA 5ETAA 2BZIB 2OJIA 2QC6A 3BGZA 2I7QA 4FUXA 2IPXA 2FVDA 4HCVA 4U42A 1GIJA 2I1MA 4FZAB 5A46A 3PY0A 1M2QA 4NKSA 4A9RA 1MUOA 2Q0BA 4J1RA 2UW4A 3A7FA 4FTNA 3QQUA 4RJ6A 4AGWA 3IW5A 2XM8A 3E8NA 5JN2A 2XIZA 5EW8A 3W8QA 3MB7A 1PMEA 1W98A 5HZNA 4FKSA 4FUYA 4BN1A 1M7QA 1YKRA 3G6HA 4I5MA 4RIYB 4IVDA 1OIQA 2UZOA 4EOSA 3K5UA 2XS0A 4CMTA 5C8MA 4NM5A 5BVKA 2PPQA 5BMSA 2QODA 3FEGA 3FQSA 4GK2A 4X2NA 3TNPC 2IG7A 3IK3A 4EQMA 4ZTQA 1CKJA 4IB0A 4PPCA 3QC9A 5HKMA 4XBUA 2XJ1A 3L9NA 1FINA 2W1FA 4I23A 4DH7A 1K9AA 3Q96A 2IW6A 3CY2A 3LHJA 4IAZA 4M14A 3LM0A 4O7NA 4G3DA 4Z16A 2GCDA 4G16A 4XP3A 3ACKA 3TN8A 4O1PA 2A27A 3COKA 4QT1A 4EK4A 4B7TA 2XIYA 4GIHA 1Y8GA 2XYUA 5GJGA 4J7BA 2VTMA 3HV7A 1PJKA 3FWQA 4MXOA 4YC8A 3MY5A 3HAMA 2Z60A 1DI9A 3U87A 5IQGA 4FIJA 4O0SA 2W5AA 4R1VA 1RQQA 1JKSA 1YW2A 3QUEA 2VO3A 3TNHA 4D4YA 4LRJA 5HD7A 4MTAA 5C01A 5A4TA 4KIQA 4ZXTA 5BMMA 5JEBA 2ONLC 5KO1A 4JBOA 2UW6A 1JLUE 5AJQA 1S9IA 3R71A 1WBWA 1XH6A 3UO5A 3W2RA 3NAXA 1QCFA 2ERKA 4CYJA 3E3PA 3BHUA 3MH1A 3EQHA 4C57A 5EDQA 2X6DA 3KVXA 2ETKA 3KRWA 2NRYA 3NUPA 3QGWA 4YZMA 4EH9A 3MWUA 4UB7A 3VRYA 2WAJA 1U5RA 2C5NA 3II5A 2YJSA 4OTIA 5FBNC 5CT0A 3RK5A 4DFBA 2SRCA 3GC0A 1W2FA 3I5NA 1WMKA 3R7OA 3QQJA 3F3WA 3VAPA 3KQ7A 3E62A 4QMQA 5J8IA 3ETAA 3FKNA 2R4BA 4W8DA 5BVNA 2VTRA 4IFGA 4BC6A 3PYYA 3RPSA 5HG7A 2W4OA 4FKJA 4PL3A 4YJOA 4FV8A 5HI2A 3HZTA 3MBLA 3NIEA 3LE6A 2PWLA 3MH3A 3MPMA 4O0YA 4UWCA 5E8ZA 4XV1A 4F6WA 2XJ2A 4BCFA 4U97A 3RNYA 4J98A 4FKQA 3OXTA 4ZMFA 1BYGA 4LM5A 3CEKA 1ZMWA 3AMYA 3QCQA 4FMQA 4QYHA 5HOAA 1IA8A 2Y0AA 4IACA 3LJ2A 5IQIA 4RIXA 3I79A 3U51A 5FEEA 5CEOA 2ITQA 4X6RA 3VUTA 1Q97A 2R3PA 4YJRA 4X2KA 5FTOA 4UYNA 2GHGA 5ANJA 4EOQA 4O1OA 4ANBA 5CNOA 3F82A 3E8CA 4ZSLA 4QP7A 4U6RA 3VS7A 3SOCA 2VO0A 5HO8A 4EBWA 5K5NA 4I0SA 4F7SA 5FLFA 3QCYA 3FZOA 2YIYA 5AUYA 2J0IA 1TQMA 4YURA 4S32A 4XG2A 4CT2A 3FDNA 4NT4A 5C8KA 5CSPA 4A7CA 1ZY5A 3BI6A 4TTHB 3R01A 1U54A 5A4EA 1J7UA 3I6UA 1H0WA 4CQGA 2VWUA 4UMRA 2YM7A 3OCGA 4R77A 3T3VA 2C5YA 3CKWA 2VGOA 4I1ZA 4JBQA 4JLCA 5E8UA 2CJMA 4LMNA 3BYOA 3AT3A 1IG1A 3F3VA 3GU4A 3KKVA 2BIKB 4G3FA 4XMOA 5FG8A 3ZEPA 1XMMA 4YTIA 2XKDA 2ZOQA 3ZBFA 3S2PA 1XH7A 3IOKA 5EG3A 5IDPA 3JR1A 4JX7A 2ETMA 4F4PA 3OD6X 2QD9A 4FC0A 3VHKA 3RNIA 3DDQA 4B4LA 2QU5A 4TYJA 4YNOA 3FI4A 3VS5A 5IQBA 2WEIA 5CU6A 1OI9A 3GCQA 3EMGA 4UMPA 2B53A 4BDBA 4IM0A 1FBNA 3ALOA 2F7XE 2ITXA 1J1BA 2OF4A 3R04A 4FV2A 4QTDA 3CTQA 3L9PA 5AV2A 1YOLA 5D7AA 3Q4CA 3ZUUA 1LEWA 1JSUA 2HZ0A 3DBQA 4IC7A 3ORIA 4AN3A 1H27A 3R8VA 3ZRKA 4A9SA 4FZ7A 5JFVA 1H1SA 4S33A 2XB7A 3D5VA 3E7VA 4BTKA 2W0JA 3G2FA 5E8TA 4GYIA 3NW6A 4A07A 2WTIA 1YWRA 4FG9A 4OTWA 2QO7A 4EORA 4Z9LA 4D55A 2GNIA 3ZOSA 1UKHA 2RSVA 5CT7A 3W33A 2JITA 4FEXA 2RIOA 3BL9A 4H1MA 5E1SA 3G15A 3I7BA 3D4QA 4DEDA 4O0VA 4GFMA 4MD9E 4O82A 4E4NA 3RZFA 5LMKC 3VUKA 3BHHA 4EYMA 2C30A 1QPEA 3IG7A 4MXAA 2QO9A 3BQCA 4F9CA 4O4CA 4RC4A 5KMIA 4TWPA 3GFEA 1U46A 3DKFA 5KNJA 2YCSA 4ORKA 5IQHA 3PIYA 4UXLA 4UZHA 4C58A 1WAKA 4IX4A 3C1XA 4RLKA 1OBGA 5ANGA 5A6OA 1KV1A 2QHNA 4AXCA 4ASDA 5AX9A 4FSZA 4O0WA 4H05A 4E7WA 5LJJA 4AFEA 4C2VA 3OHTA 3ZYAA 4ZTHA 3Q53A 1RDQE 1YVJA 3M2WA 2OH0E 4FT9A 3RWPA 4GT4A 2H34A 1BI7A 3MVMA 4FNWA 4DHJA 1AGWA 1NVSA 1U4DA 4FKOA 4ID7A 5BVDA 5J9ZA 1HCLA 5GHVA 1L3RE 1OZ1A 3E7OA 4RVLA 4NZWB 4UWBA 4UWYA 3TV6A 2BTRA 2R0IA 2VX0A 3A99A 4EH5A 5L8LA 2EVAA 3MTLA 5AV4A 4CLIA 4J53A 3VS2A 4EOJA 5CY3A 1XH4A 3S00A 2ZV8A 2XK6A 1W2DA 4AT4A 5CZIA 2HY0A 1FVVA 3H9OA 3MVHA 3WYXA 1Y91A 1YWVA 4FVRA 4J71A 5AV0A 3NR9A 5LMBA 5J87A 1P5EA 2IVTA 4QYYA 4KINA 4EL9A 2DQ7X 3I0OA 3QYWA 4KBCA 3DU8A 4KSPA 4R3CA 3HV6A 5DT4A 3FMEA 3TZMA 4C4JA 3OXIA 4G17A 4KRDA 3U55A 2G01A 4S34A 5CF4A 4RA4A 2IVVA 3ZC5A 4LDTA 5ANIA 1VYZA 1XBBA 2PVNA 4L7SA 5E9EA 2CCHA 2HWPA 5FXQA 4F7JA 1PHKA 3H10A 4BKJA 4A4LA 4AZSA 5EKNA 2BIYA 4ZSEA 4JS8A 4FODA 5E91A 1ST0A 4DHZA 3TIZA 5CENA 3T9IA 3VHEA 5LVOA 4I0RA 4L45A 2P0CA 2I40A 3EQRA 5HORA 1M17A 1Q41A 4PDYA 3S1HA 3D7TA 4QDEA 4KS7A 3I4BA 4UEUA 2WQEA 3EIDA 3H4JA 4U40A 3FI2A 2XYNA 5HVJA 3TKUA 4LFIA 3QRJA 1LP4A 4BDEA 5H8BA 4BYIA 4E73A 4AGDA 2UZWE 4Q5HA 5DNRA 3PIXA 2WTKB 3C4FA 4BCOA 5IU2A 4QTAA 5KX8A 2Y7JA 4RJ8A 2NP8A 4F7LA 1G8JA 1URWA 1T46A 3DBCA 4OUCA 5KE0A 4IX3A 3V5LA 3QKMA 4CFUA 5FGKA 2IEWA 2GNHA 3A7JA 3HMMA 3DTWA 3MH0A 4GG7A 4Z55A 5AUUA 5CALA 4D2PA 4Q5EA 3TZ7A 3EL8A 3TZ9A 4N57A 3D7ZA 3HMPA 3EKKA 1M2RA 1MRVA 4ONAA 2B9IA 5HNBA 4TT7A 2CKQA 4I41A 2Z02A 3FYKX 3K5VA 4O7SA 4EJ7A 4F0GA 3HRBA 1J1CA 1ZXEA 3P9JA 3NSZA 1A9UA 3GOKA 4E6CA 2PVFA 1K3AA 5JFXA 1PMUA 3CD8A 3QBNA 4ZZOA 3KN6A 4BY9E 3KVWA 4WUAA 3NFGB 3LFAA 5EHYA 3KXMA 3EN4A 3R7YA 3BWFA 2JGZA 4I5PA 3LPBA 1U54B 5CZHA 5DR6A 3F6XA 4RA5A 5ETFA 4YLKA 3A60A 3V6RA 2AYPA 3VO3A 3HRFA 2ITUA 5EYKA 3O2MA 4CCUA 1U59A 4YC3A 4A06A 3FY2A 4GH2A 3R9NA 1UV5A 4LYNA 5FM3A 2ZFYA 4FV0A 3ZRLA 4TKSA 5DEYA 4CZTA 1OL5A 5HHWA 2R3LA 3C4XA 2HZ4A 3LZBA 4DEAA 2ZDUA 5J1WA 2OWBA 2E9OA 4JG6A 4GYGA 3UGCA 5J9LA 5AIKA 1DM2A 1SMHA 3KXHA 5J7HA 5LARA 1XMLA 3I6WA 3ANRA 4W9WA 5CLPA 2KTYA 4WG5A 4AW2A 5BUEA 4ZSGA 4PX6A 5J1VA 5H2UA 4B9DA 2WOTA 4FV5A 2YA9A 4ALVA 1Q8TA 2WU6A 3CR0A 4KIKA 3UDBA 3VUHA 2WZJA 5IA4A 5HCXA 2WU7A 2XK9A 2P4IA 4GIIA 2EXMA 4JR3A 4L9IA 3DBEA 3D5WA 2PZPA 2YM3A 2GQRA 2RFEA 4BDHA 3R21A 4AW0A 2WHBA 1JKTA 4N4SA 5TE0A 3VONA 3DBFA 1ZOGA 4I5CA 3P79A 4MD8E 3NX8A 3PA5A 5CASA 3N4VA 2H8HA 5C9CA 5F4NA 5CEQA 4NM0A 2OKRA 3EWHA 4OTDA 1ATPE 3RKBA 4DEIA 2XUUA 1SZMA 4L01A 4BDKA 1GAGA 1TZDA 3UIBA 3F5PA 4XV2A 1SVHA 5DE2A 3FSKA 2B55A 4IX6A 5AX3A 2J6MA 5DYJA 4ZJJA 4CMOA 3VN9A 2Y6OA 3FI3A 5AUTA 3QU0A 1F5QA 4HYSA 3FHRA 3EN9A 1LUFA 2ZAZA 4JDIA 4FBXA 2W1ZA 5F9EA 3ML1A 4RC2A 4KKGA 3ZUVA 4CZUA 4L43A 4M7IA 4GU9A 1B6CB 2PVJA 4TYGA 5J5SA 5H3QA 3RAKA 3FLNC 3QAME 3H9RA 4QTCA 3OTVA 3FPMA 1ERKA 5AP7A 4CEGA 3O23A 4DTAA 5AP3A 5AWMA 5IQFA 5L2QA 4AN2A 5J95A 4DEGA 2GHMA 2ZMDA 2Y4PA 3BPRA 2WQOA 3P7BA 3KC3A 1OECA 4NW5A 1G5SA 3BLQA 2VU3A 3Q9WA 3ORZA 4TYEA 5GJFA 2C4GA 4FVPA 5HCYA 4HCUA 2JEDA 4YPSA 4AZFA 4XJ0A 4MUQA 4I6FA 2YIXA 2QKRA 2WTKC 3QQHA 4X2GA 1XH9A 2BZHB 2PVHA 1WVXA 4C3FA 3OWPA 4DH8A 4G34A 4F09A 3UG1A 3C5UA 4X3FB 4F9WA 3TNWA 5IA0A 4L68A 3PXQA 3QTZA 3F5XA 3R8PA 2O63A 4R3RA 4CFFA 3Q52A 4YJVA 3FC2A 1KE8A 3ZO2A 2BROA 1BI8A 5LCKA 3BHTA 4FSQA 5FTGA 5HESA 3SHEA 5M4FA 3PRIA 2C0OA 5EOBA 4QO9A 5FXSA 5M44A 3VBWA 2WXVA 1NW1A 4WIHA 4KUJA 1Q8WA 4IWDA 4JAJA 3UIXA 1H01A 2AEGA 2YABA 4ZTNA 2ITYA 3FAAA 5AR2A 3W2QA 5L8KA 1W84A 1KWPA 2QLQA 4HGLA 3KCFA 4YP8A 5KBQA 4XBRA 3DK7A 4HOKA 3RK7A 4FTLA 3EYHA 1IAJA 3D7TB 4O96A 4ZJVA 2G9XA 3FMLA 2B9JA 5HLPA 3ZLWA 4DYMA 5A6NA 4V04A 5KMKA 3ID6C 3DXNA 4FL3A 2LGCA 4HZSA 5IUGA 4TYHA 3ORKA 4R8QA 4HJOA 4YBJA 2W5BA 3HLLA 4O0XA 4XG9A 3ALNA 4RX8A 5M53A 3VULA 4BVUA 3D2KA 3EH9A 1JKLA 4Y8DA 3MFTA 1CTPE 4DFZE 3ZFMA 4NH1A 1QPCA 4BI1A 2E9NA 3NYVA 2VWXA 4LOOA 4N0SA 5KMOA 3OF0A 2ITPA 4J52A 2ZV2A 3BLHA 4KS8A 4BB4A 5JGBA 5EI8A 3F3TA 5JGAA 4DFLA 4DLIA 2GQGA 1X8BA 2PMNX 4I6LA 3BQRA 5BYYA 4H58A 4B0GA 4L6QA 3PA3A 1PXKA 4I93A 3JUHA 4L53A 3ZMMA 4FIHA 4D4RA 1LPUA 2XA4A 3U8WA 2BRHA 1PKGA 3B8RA 3MTFA 4GL9A 3QYZA 4DFNA 2J0KA 2R3QA 2O0UA 5AM6A 4RVTA 5EYCA 3TYKA 5FBOA 4FTQA 3FMDA 3V5JA 3RBWA 3QD2B 4FL2A 3V8WA 1IA9A 3Q3BA 5KMMA 4D28A 4QMLA 3SRVB 5GJDA 5EFQA 2RKUA 4FKWA 2PE1A 4YU2A 2C6DA 2VTJA 4W4XA 1UU8A 2W06A 3PY1A 3ORLA 3EZRA 2X2LA 4QP1A 4WNPA 5AIRA 3ZFXA 2QOBA 4QNYA 4F9AA 1Q24A 2J5FA 5AR7A 4PP7A 4MVFA 3FXXA 2F9GA 3GUBA 3V01A 1Q99A 2ACXA 4F1TA 5IMEA 3UPZA 4AUAA 4U8ZA 2QG5A 2VZ6A 4W9XA 3G9LX 1KSWA 3R9OA 5D11A 1WCCA 3AQVA 4QDVA 3PDTA 1Q8UA 4HNIA 4BJJA 1Q61A 2XK7A 3EFKA 3K54A 4RMZA 5HBHA 3OCBA 3KRXA 5IEVA 3R7VA 2VO6A 3VS3A 2G2HA 1ZYCA 2XH5A 4YZCA 1XJDA 4R5YA 1PF8A 2REIA 4EOLA 2WTWA 3AC4A 4TWCA 5CVFA 1IRKA 3EFWA 3ELJA 5D41A 4KIKB 4ITHA 4JBVA 1BLXA 2OIQA 3NUUA 1YDTE 4K11A 2OJ9A 3EFLA 1J3HA 3OCSA 4CRLA 3CE3A 4NIFA 4EK5A 3QQKA 2OXXA 3WIGA 4FTCA 3CJGA 1ZOHA 1A06A 3HGKA 3FLZA 2PVRA 5TO8A 3RCDA 3GCUA 5AADA 2DYLA 2G2IA 3VS0A 3QZHA 2YDIA 4YJNA 3QRTA 4IZYA 4O84A 4FTIA 4YZBA 2PE0A 2UZLA 2W1CA 4AZTA 4E1ZA 3OEFX 2X39A 3W0RA 4GJ2A 3PXKA 1KE6A 4GJ3A 3A4PA 4H39A 4IE9A 4UZDA 4ZY6A 3UJGA 4E8AA 5M08A 3O51A 1M52A 3UZTA 4Q2AA 3TJCA 1RJBA 2RG5A 2B4SB 1YXUA 3L1SA 3P0MA 4IQ6A 5FQDC 4FGRA 4NSTA 2WTVA 4FNXA 4QYEA 4KNBA 4AAAA 4LUEA 4EOMA 2PUIA 2UW9A 3PSDA 4KABA 5LMAA 3D9VA 5BVEA 3F3ZA 4L00A 3BU3A 2XRUA 3KFAA 3FLYA 3QCSA 4WD5A 4JG8A 4Y83A 4DBXA 3GC7A 3AMAA 3MIAA 4DLJA 3S0OA 3BLAA 4ZLOA 4EH6A 4JIAA 4S2ZA 5CI7A 3T3UA 4ZSAA 4CD0A 3CIKA 3ORPA 3MPTA 2R3RA 3ODYX 4NTSA 4QOXA 5E8VA 4H1JA 4IDVA 4JDKA 5C4LA 3LFNA 5AR8A 2JFMA 3ODZX 3GU5A 4QD6A 5AR3A 3I0QA 2GNJA 5CAVA 2QOKA 4JXFA 4AXFA 2BILB 3OS3A 4JIKA 4RJ5A 4BGQA 4ENXA 2Z7SA 2CKEA 4MF1A 3HUCA 5EM8A 3KF4A 3BBTB 4AU8A 3FBVA 5AUWA 4J8NA 2HENA 3HEGA 5L4QA 3RPOA 5L2SA 4AZVA 3C7QA 3B8QA 3QF9A 4HYHA 4Y5QA 4CYIA 3D94A 3KMMA 5L2WA 5EYMA 1Q62A 2R3FA 4HPUE 5DA3A 2WMXA 3QHWA 4U3ZA 3QD4A 5AP4A 4CSVA 3W0PA 4JQ8A 3W0OA 2UW3A 3WF7A 5A9UA 2BTSA 3BZ3A 4YLJA 2FB8A 2BAQA 3DAKA 3PJ1A 4C02A 3P86A 5JH6A 1PXIA 1OIUA 2GPHA 3TG1A 3U4UA 4BICA 2UVXA 2VX3A 3PRFA 2XARA 3O8UA 3D15A 2GSFA 5HVKA 2NNWB 2IVSA 2ITZA 4BWXA 3ORXA 4BWPA 2PZYA 3BKBA 3G0FA 3UDZA 1WVYA 4NTTA 3D14A 4UALA 2CGWA 3TEIA 4G3GA 4WNOA 1G8AA 2Q0NA 3EZVA 3H0YA 3NYXA 3OOMA 1QPDA 3P7AA 3NGAA 4OT6A 2UZBA 3Q60A 4OTPA 4RPVA 2QOFA 4XG8A 4NUSA 2B7AA 3DAEA 3JYAA 1O9UA 2XKCA 2IF8A 2VTQA 1Y8YA 1REJA 5K4JA 2NRUA 3O7LB 2WMAA 3A7GA 1AQ1A 4U0IA 4WSYA 4XRLA 3EL7A 4YNEA 1PY5A 3NUXA 5KCVA 1TVOA 4OAVB 4D1ZA 5AMNA 2WMRA 1PYEA 3S3IA 3MI9A 4O7YA 3NS9A 4U7ZA 4XV9A 3O5AA 2GMXA 2YWPA 2QKWB 4DINA 4JI9A 2CCIA 2YAAA 4EKLA 3UYTA 2EB2A 3VS1A 3ZRMA 5HD4A 3NUNA 3LFCA 4Q9ZA 3R9RA 2FGIA 2HWOA 4MH7A 3JVSA 4W8EA 4WRSA 1XHAA 1B38A 3AMBA 4NL0A 1KUTA 4N70A 2OO8X 3L8XA 4BDGA 4RFZA 4NEUA 3EYGA 3F69A 2JAMA 4AQKA 3FKLA 1JAMA 3QTXA 3MJ1A 4RQVA 3BYMA 4ERWA 3U6JA 4BDCA 4WKQA 3LAUA 3QKKA 3QTUA 4R7HA 2IZSA 4EK8A 1OGYA 2WMUA 4FTJA 2R7BA 3D5XA 2ZYBA 1JQHA 3EN7A 3EB0A 5D10A 4KRCA 4BHZA 4AZEA 3MFRA 4NCTC 2XCKA 3SOAA 3R8MA 3V5PA 4AW1A 5HU3A 2JD5A 3BGPA 3C0HA 1Q4LA 3TJDA 2F7ZE 4PPBA 5HG5A 4CCBA 3VUIA 4ARKA 4NYEA 2W05A 1B39A 4BL1A 2ZB1A 4TL0A 1SVGA 4UN0C 5KHWA 4FEUA 2C6MA 2YACA 4BCPA 4YTCA 5CU2A 3UQFA 1NT2A 5H8GA 4AZWA 4BJJB 2QU6A 3CPCA 2W1EA 2JKKA 2YN8A 4UX9A 4DGGA 3V5WA 3HV4A 2QONA 1H07A 3SX9A 5FWKK 2X7FA 5KZ0A 4F1OA 2Z7LA 2YITA 5IA1A 5HLWA 2JKOA 1VR2A 2X6EA 3NW7A 3FLWA 4RVKA 5M51A 3FL4A 5E4HA 2FSOX 3TV4A 3W2CA 4HGSA 4M15A 4JX3A 4IM2A 4AT3A 4F08A 4ZLYA 1PRYA 4II5A 1O6YA 2ETRA 2OI4X 2WFYA 5IF1A 4O7ZA 5IEYA 1BX6A 4IAAA 5B2KA 3ROCA 1PMNA 4NIFB 2BUJA 3NUYA 3I60A 4D0WA 3VBXA 5AR5A 4ZS0A 3RVGA 3LCKA 4C59A 4F99A 3QFVA 2IN6A 2WIHA 4GFOA 5CSVA 3F5GA 2YM8A 5HX6A 4P90A 4ZJIA 2HW7A 5CU4A 3RPYA 3QTWA 1NVRA 2HYYA 2J0JA 3PFYA 3FSFA 3GU8A 4FZFB 5D12A 4BTFA 5IZFA 2OZOA 3OY1A 3QHRA 5E90A 3Q4ZA 4P4CA 3Q2MA 2VWZA 4BZOA 3BE9A 3IQ7A 4F9YA 4LGHA 2PE2A 3GT8A 5A4QA 3IGGA 2BZJA 2OJFE 3ZSGA 1YHVA 2EUFB 2PY3A 3LFBA 3KRLA 3NCZA 3REPA 3UIUA 3MW1A 3QC4A 4YC6A 3ZDUA 2JIIA 3LCDA 3R00A 2IW8A 3BU6A 4DH5A 5HICA 4FA2A 3TMOA 4MXZA 1ZZLA 3OP5A 5HIEA 3DOGA 3FQHA 4AXEA 4FKPA 3ZXZA 2X0OA 4K8AA 1H1RA 4FV3A 3V8TA 1HOWA 5KMLA 1P4OA 4QNAA 4O7WA 2BR1A 3TI1A 5F94A 3WZKA 3PJ2A 4R78A 4GEOA 2F7EE 3O71A 4I20A 2BMCA 5JK3A 1J91A 4RZWA 4UBAA 1ND4A 1SM2A 4TWOA 5EHLA 1R0EA 4FJVA 5JGDA 1YDRE 3UOJA 2J9MA 4MCVA 3AGLA 2R3OA 2P3GX 3NIZA 1ZLTA 2YEXA 4G9CA 1WBPA 3L8VA 4O7VA 5IQCA 3FZTA 2F57A 4ZTMA 2OLCA 1YRPA 2UUEA 3UVRA 2P2HA 4FOCA 3C5IA 3TTIA 1HCKA 4FT7A 4HZRA 2PMOX 2C6TA 3S4QA 1YXTA 3PVUA 4QMXA 3P5KA 4EJNA 2JC6A 3N51A 3OWLA 5ANEA 4V05A