1PYXA

Gsk-3 beta complexed with amp-pnp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
352
structure length
343
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogen synthase kinase-3 beta
publication title Structural characterization of the GSK-3beta active site using selective and non-selective ATP-mimetic inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 343
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1pyxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1pyxA01
2Y6OA 4IZ7A 4YP8A 3RK5A 1FGKA 3FC2A 3K5UA 3MPMA 4OTIA 5E91A 2ZB1A 4YTFA 5JH6A 3ALOA 3EQDA 4BCMA 5LVMA 4FR4A 3GCVA 3R9RA 4C36A 3WOWA 3SRVA 4L7FA 3MJ2A 5FEEA 4DEAA 1OGUA 3KN5A 5BMSA 1U5RA 1O6LA 4YJQA 2BZIB 1E9HA 3IW8A 3MJ1A 4M69B 4FKWA 5FRIA 4IIRA 4EH4A 4QMLA 3ID6C 3NNUA 4KAOA 3QC9A 3VUMA 4RIOA 2ZV8A 3WE8A 1U54B 3IKAA 5EM6A 2HOGA 3FWQA 4NIFB 1URCA 2ZB0A 1PMUA 2A2AA 2C6EA 2WTWA 1YWNA 5D41A 4IZAA 2HENA 4FKLA 4RFMA 1UVRA 3FEGA 1M7NA 3ZDIA 4DEIA 3GGFA 2JDRA 3MVMA 3NW6A 4DG0E 1GIIA 4X6QC 5B0XA 4UYAA 5AP2A 2GHMA 3CKWA 5HLNA 3H3CA 4IZYA 4KIOA 2IWIA 3LOKA 2E9VA 1ZRZA 1BL7A 3OROA 4QMWA 5HO8A 3C1XA 3CGFA 4BKJA 3H9RA 2JBOA 2RIOA 2XNBA 2XRUA 3E88A 4JT3A 3N4UA 4IX6A 3ZEPA 2VGPA 2R64A 4CCBA 4QTDA 4JAIA 4XLVA 1H01A 4J8MA 2YM5A 3H9OA 4XV2A 3K5VA 4I0TA 3TNWA 4FTLA 4ITJA 3IW7A 4OT6A 5I3RA 4EH8A 4DTBA 3FSKA 5EI6A 5HIDA 5HE0A 2C47A 3QBNA 4IC7A 4RQVA 1Q4LA 3VS4A 1Q41A 3D14A 3NUYA 1ATPE 3A62A 4XNEA 1XBAA 3BIZA 1Q8YA 3JS2A 5CAUA 5HD7A 3QCYA 3JYAA 3DB8A 1K2PA 4XG7A 4EZ5A 3IDCA 4ALVA 2F9GA 1ZYDA 1WFCA 1H1PA 4I6HA 5L6PA 4D4SA 3NWWA 5DRDA 2CCIA 1SNUA 3ZLWA 2VWVA 4TTHB 3GCSA 2W5AA 2PMIA 3JVSA 3BLRA 2C6IA 4ZZNA 4AZEA 2WTIA 4MNFA 3PVUA 3KC3A 2VTQA 4JAJA 1BL6A 3EQFA 3O8TA 3ETAA 3F61A 3QRTA 2RFNA 4FIHA 2WIPA 4DGMA 3QQJA 3VS5A 4QP2A 3PXZA 4QOXA 4GK3A 5ETIA 4O7NA 1Q97A 5IDNA 1OKWA 2VTAA 3POZA 1ZOEA 1M2RA 3R2BA 4MXCA 1NY3A 4ANSA 4MWIA 2OG8A 3EN4A 4O7SA 1IG1A 1OB3A 4E6AA 4F08A 2PVLA 4Y46A 4YUQA 1OPJA 5ETFA 4MEDA 3KXGA 5DFPA 3QD4A 4I0RA 3VBTA 1YWRA 4TWPA 3KFAA 3B8QA 3OCBA 4FL2A 5KX8A 3BRBA 4RWKA 1ZLTA 5HI2A 4HPTE 2PUUA 4UMQA 3EIDA 5IEVA 3HP5A 1P4OA 4F9AA 3V6RA 4D2WA 4NZWB 5JZNA 5M08A 2WTKC 3FZ1A 1PXNA 4S31A 4RWLA 1HCLA 4YTIA 3CD8A 4TYHA 5BQ0A 3CQWA 1O6KA 1LEZA 5IQBA 3ET7A 5EW3A 3H0YA 5G1XA 5CI6A 4NM5A 4L3LA 4ZLOA 3I0QA 3R7OA 3RPOA 2X2MA 1MP8A 3ALNA 2HY81 1JSVA 4KSQA 4KWPA 3E3PA 2C0TA 2QHNA 3EN7A 3OOMA 3OBGA 3MH3A 4HPUE 2UZUE 4Y73A 4ZP5A 2X2LA 4CTBA 3L9LA 2R7IA 4IJ9A 4TNDA 4QMSA 1XKKA 3OFMA 5FG8A 4BCJA 3R8UA 3F5GA 3LXKA 4NUSA 3VHEA 2R3RA 1DAWA 5HTBA 5GIOE 1UNLA 3NW5A 3C4EA 2OICA 3H4JA 1UKIA 4MF0A 4A4OA 5HBEA 3FI8A 5HG9A 2WMSA 5IA1A 3K54A 4DGNA 4FGBA 4FSMA 3TNPC 4OGRA 3MWUA 1Z9XA 3R1YA 1JKTA 3RHKA 3W2CA 4MBIA 2ZYBA 3UIMA 4LQMA 4BZDA 4FV7A 2QOQA 5L3AA 1PMEA 4GUEA 4YNEA 1GOLA 2BMCA 2QVSE 3TNHA 3VAPA 1ZXEA 3WF6A 3LXPA 4YZCA 3WILA 4AN3A 4QYFA 4XLIA 3FMEA 3Q6UA 1GZNA 4KIQA 3U54A 2R3OA 2IVSA 1CMKE 4BKZA 5A4EA 2WTVA 5A6OA 5L2IA 2E2BA 2R3IA 4OUCA 4WNMA 3CSVA 4PWNA 3QKKA 3MTFA 4B7TA 3SLSA 3UO6A 3R6XA 2XIYA 1H0WA 3ERKA 4OLIA 4C58A 4EHEA 4NCTA 5DLSA 4F6SA 1W7HA 3TWJA 2VTSA 4BCKA 4GFGA 4RJ4A 4WG5A 3EB0A 3ZHPC 4EH3A 4DH7A 5CF4A 3TZ9A 4HOKA 4PQNA 1OL1A 3AOXA 4RIXB 3D94A 4F9WA 1M2PA 3HMMA 3S00A 3JY0A 4R6VA 2W7XA 4OTDA 1YXSA 5D7AA 5ANIA 4A4XA 2QOLA 4ASEA 2Z7LA 5CU3A 4NW6A 5IA3A 2XIXA 3AC8A 2XK9A 4GJ2A 3LHJA 5BYZA 5HLWA 3DXNA 5HVKA 4FTTA 5T6KA 2BUJA 3CQUA 1Q8ZA 1J3HA 2OW3A 5LVLA 4O7LA 3P4KA 2JKQA 4FT5A 3UZTA 2JD5A 3NYNA 4FNZA 3QAME 4MXZA 4FVRA 2Z7RA 4UYNA 5I9ZA 2IPXA 2ZAZA 2R3NA 4YZDA 3P78A 3LCKA 3LCOA 5E8ZA 2BZJA 4RLKA 4C61A 3GCPA 3QGYA 4FGRA 4E7WA 2J0IA 4ZTHA 3NCZA 4UXLA 5IUIA 5HORA 3L9MA 4BYIA 3A7IA 1G3NA 3QWKA 4RQKA 2XNOA 3LMGA 4DLJA 2XK6A 3W32A 4FVQA 3ITZA 3AT3A 2UVYA 3CP9A 4L44A 4HGTA 4PPAA 3V01A 4B0GA 4BBFA 5AAEA 3F6XA 4JQ7A 3VJNA 4DFUA 5FM2A 2OGVA 1DS5A 2W17A 4O6EA 4Y5HA 5IDPA 2OI4X 2R3HA 4FG9A 1YDSE 4OTWA 3DKCA 3OWKA 4BI0A 3QTSA 4M12A 3W2SA 4PDOA 1ZOGA 3R7IA 2ETKA 3FMNA 5HZNA 2XYUA 4LL5A 4BKYA 4LGDA 2WU6A 3KULA 1PXPA 2WQMA 4TWNA 3L9NA 4WT6A 4E4XA 4K11A 4BZNA 5FTGA 5K0XA 4DE4A 4YGAA 3DJ6A 4XYFA 5C4LA 1M2QA 3Q04A 4HYSA 2J7TA 2EB3A 3G6HA 4LI5A 1OKZA 3U51A 3ZSIA 1XR1A 4BDAA 4C4FA 4O86A 3BE2A 2WO6A 1W82A 2XS0A 5C1QB 4R7IA 3UMXA 5I5ZA 4FNXA 1NA7A 2QCSA 3H9FA 4DEGA 4XBUA 3JXWA 5B2KA 3LKMA 4I41A 2CGUA 3DPKA 4K77A 4KKEA 4QPSA 1YXTA 1M52A 4YC6A 3QXOA 1WBSA 4PL3A 3ZO2A 3KCFA 2UW4A 2R5TA 3HDMA 2C6OA 5AR8A 2HW6A 3UNZA 2HYYA 3R71A 3PP1A 3TNIA 3VS3A 3QUPA 5DA3A 5LVOA 3ORZA 2CJMA 3FMLA 5CT0A 3Q4ZA 4F4PA 2G9XA 1SVEA 3HZTA 1BUHA 4G3CA 4FL1A 4G3EA 3WARA 3DAKA 5AAGA 4FV9A 3UE4A 1TQIA 2PVKA 4BCQA 2H96A 4WRSA 5J79A 5EM7A 3ZEWA 1RJBA 3IW6A 2WZJA 3DTCA 4K2RA 2J2IB 4U3YA 4GT3A 5AX9A 4BVUA 3KXHA 4G9RA 3RBWA 3L8SA 3MVLA 5K4JA 1FPUA 4XG8A 3VUDA 1J7IA 4PDYA 5B2LA 2WMAA 2IG7A 1M7QA 1PHKA 3LQ8A 3QFVA 4C8BA 4F6UA 3DGKA 3QQLA 2WEIA 4X3JA 4PMMA 3PJ3A 3DQXA 4RSSA 4CFFA 4RIYB 2HWOA 3ORKA 4W4XA 5E8XA 5AAFA 4EKKA 3KF7A 4ZTLA 4AZVA 2I40A 1W84A 4D0XA 4OTRA 4R3PA 5AV1A 3LQ3A 2BDJA 4U43A 5CEMA 5GJDA 3H0ZA 3VUGA 3E3BX 4CSVA 2Y0AA 2VWWA 4OBQA 2WNTA 5EQYA 1LEWA 2X8DA 2ITXA 2YCRA 3I0OA 3UOHA 3UYSA 1ND4A 4CV8A 2XNMA 4EOIA 2A0CX 4X2KA 3GENA 3W18A 3MY1A 4ZSLA 3LM5A 5FLFA 5HD4A 3OOGA 5EYDA 1PXKA 3A7FA 4FZAB 3SRVB 3LCTA 4PTEA 5CXZA 3QC4A 3KXXA 3QTUA 4XX9A 2WMRA 2X7GA 2QHMA 2GNLA 5LOHA 2R3KA 3ULZA 4D2SA 3BQRA 3CCNA 3KXNA 4BC6A 1UNGA 4L00A 2R3MA 4CKIA 3D5XA 3R8ZA 3NYXA 1V0BA 4FZFB 4RJ7A 5BVFA 3R63A 1FVVA 2VGOA 3P08A 4IQ6A 2WXVA 3AQVA 4ZJVA 3AD4A 3COHA 4GL9A 4LV5A 5E1EA 2VWZA 4U44A 3SXRA 4N6ZA 4GU9A 2WMWA 4S34A 2BRGA 2ITUA 5CSHA 2QO7A 3CXWA 4YPDA 5LVNA 5KKRB 1PYXA 3MA6A 4A7CA 4ANQA 2XF0A 2G15A 3R30A 5L2QA 4IX4A 3FMDA 3GU6A 4ONAA 2W9FB 3O71A 4JG6A 4GS6A 1PKDA 3OY3A 4RX5A 4BDCA 3D0EA 2PULA 1BX6A 2PVMA 3FLQA 5DMZA 4TNBA 4LMNA 4V01A 4KD1A 3W10A 3DK7A 3UVRA 4CVAA 3D7TA 3W8QA 5HE3A 4GV1A 4HVSA 3BKBA 3DK3A 3BPRA 4AE9A 2V22A 4QMUA 2R2PA 4FL3A 3ZUTA 4CV9A 3NS9A 5LCJA 2O0UA 5CWZA 5FTOA 2UW0A 4K33A 4JIAA 2X4FA 3LW0A 5DT4A 2J50A 4AFEA 2VO0A 2HIWA 4AW5A 2E9OA 3DOGA 3IPHA 3ZFMA 5C26A 3SVVA 2EXMA 2V62A 4UMUA 3NNWA 4WNOA 4R5SA 2XJ2A 3FYKX 5DT0A 5CENA 5CAQA 4KABA 3JPVA 1XHAA 2WMVA 2FSOX 4IADA 2YIRA 3PVGA 2C5NA 2W1CA 4G3DA 5FQDC 3F3ZA 4LUEA 4QP3A 3FPQA 3E8CA 3QD2B 5M07A 5M09A 1JPAA 5TF9A 3FMMA 4ZTNA 1KOAA 3NDMA 5AUZA 2XIRA 2ITTA 1JLUE 2WPAA 4YC3A 2REIA 3FI2A 4OTPA 4ZSJA 2O5KA 3TUDA 2XEYA 4HJOA 4GK2A 5E8UA 2IZSA 5CVGA 5A9UA 3HNGA 4JDJA 4O0VA 2QOIA 3HAMA 5FGKA 3MA3A 4BCFA 3EFLA 5HLPA 3TV7A 3ZM4A 2XKFA 3D2KA 2X9EA 2BZHB 4FKOA 3ZH8A 2RKUA 3E8EA 4GG5A 3SKCA 4KRDA 4HGEA 2I0EA 3NVKI 4RIWA 4TWCA 4C62A 5DEWA 4PNIA 4TYHB 4ZSGA 3RCJA 4CQGA 2GCDA 1OECA 2WD1A 3BX5A 1IRKA 3ZCLA 5BYYA 1URWA 5JFVA 2WTCA 3DB6A 1W8CA 3DBDA 4AACA 5B7VA 3G5DA 3PJ2A 2PZPA 1NVQA 1R0EA 3VBXA 4JL9A 3V5PA 4G31A 3E7VA 3PSDA 4H1MA 2QD9A 3NW7A 4IX3A 4QMMA 4V0GA 5KHWA 3QQUA 5L2SA 3KREA 3GU8A 4D2RA 3O7LD 1OITA 4CT1A 4BYJA 3AG9A 3I6UA 4FVPA 1P4FA 4PMSA 4AGDA 3I1AA 5TT7A 2W99B 3MIAA 2BKKA 2VX3A 4HYUA 5EI2A 4ZAUA 3WYXA 5L8LA 4HNFA 4DC2A 4FKSA 3NUAA 1SNXA 4RJ8A 5EHYA 3VVHA 4G34A 2XYNA 2HZ4A 5J5TA 1FBNA 3ZRLA 5FTQA 3O7LB 4FF8A 4YNOA 4YZNA 5HGIA 4RC4A 3U55A 2P2HA 5AM6A 5CVHA 3F2AA 5JFWA 3SOCA 2P2IA 4GW8A 3FMKA 4E8AA 3MFSA 3A2CA 5EKOA 4NKSA 3D5WA 2QU6A 4DFLA 1OPKA 4RA5A 3O23A 2H9VA 1WBOA 4U3ZA 4ZY6A 3GCQA 5DWRA 3FMJA 3MFUA 3OC1A 3PE1A 4XUFA 3LXNA 4V05A 3I5NA 3DAEA 4JVGA 4FX3A 5HOAA 1Y6BA 4QMOA 2BIYA 4MQ1A 1B39A 4F9BA 3VF8A 1VYWA 2YIWA 3BU5A 1IR3A 5CASA 1O9UA 2UZOA 3ANRA 5KBQA 5FBOA 4FYOA 1BYGA 1Y57A 3BYOA 4JI9A 2BHHA 5C8MA 5HBJA 2ONLC 3G15A 4C37A 1HOWA 2NPQA 2IJMA 2XA4A 5AUWA 4C57A 5AUUA 5AWMA 2FH9A 4FEUA 5A14A 3O96A 4TPTA 4X3FC 3JR1A 4F1MA 2YITA 4RGJA 3KXMA 4KB8A 5HCZA 5K5XA 1MUOA 1W0XC 2A19B 3RNIA 4IWDA 2OU7A 2FSTX 4M66A 4QP1A 3HV5A 3ENHA 2GNJA 4FICA 4NM3A 4QPAA 3OEZA 3E63A 4FTKA 3SA0A 4BHNA 3OZ6A 3VN9A 4UN0C 5D11A 5DRBA 5BPYA 3QTWA 4P4CA 4I6BA 1PXJA 3QYWA 4GJ3A 4OR5A 4EOMA 3Q6WA 5ANGA 4AZSA 5E8VA 3G0FA 4ZZMA 2IW6A 3ZO4A 5HU9A 4O7ZA 2XCHA 1YOLA 2ZJWA 1SM2A 1T45A 3BV2A 5EH0A 4QD6A 4CFMA 4AUAA 4G5JA 1KV2A 1BI8A 2YACA 2WQOA 4CLIA 2GS7A 3DBQA 4TKSA 1Y8YA 4RWJA 3MB7A 5EDQA 3QALE 3AGMA 2B9HA 3WF9A 2QODA 5TO8A 2HAKA 2YAAA 4ZTSA 2XIKA 2IZRA 4LRKA 4ITHA 5DH3A 4CG8A 4PL5A 4XEYA 3K3IA 2WQBA 3PG3A 4L42A 1REKA 5CEPA 2FUMA 2IVVA 3FMHA 3Q60A 4F6WA 3U6HA 1J7UA 4YJPA 4EUTA 1YVJA 2WU7A 2PMOX 3G2FA 3KQ7A 3ZRMA 4IACA 2CPKE 3GNIB 3P0MA 5AIRA 2I0VA 2IZUA 2Z60A 3F7ZA 4R5YA 2B0QA 4NK9A 2YIYA 1CKPA 3ENMA 4I23A 4YJVA 4DGLC 3PXRA 2V5QA 2C5OA 3HUCA 4ZS0A 3HRBA 4S30A 4HVDA 4DHFA 3KVXA 4BWKA 2JAVA 2C0IA 3E7OA 2JAMA 3KULB 1B6CB 3D83A 1A06A 1OIQA 3AC3A 2ZDUA 5AV3A 3GC8A 3ATSA 1OUKA 3UTOA 4KNBA 5EHLA 2ZMCA 3LJ2A 1CKJA 1OPLA 4D1ZA 4B9DA 5HG8A 4U5JA 5JMSA 4F7NA 2DS1A 3PRFA 3SXSA 5D10A 5CI7A 4O0RA 2NNWB 3R22A 3ZONA 5T68A 2DYLA 4G6OA 5A4CA 5H9BA 2JDSA 3V5LA 4FTAA 4LRJA 5HESA 3NCGA 1KOBA 4FIGA 4XV1A 3WBLA 2UZBA 3R9NA 3RJCA 3CPCA 2PSQA 4JXFA 3REPA 4FSNA 3A61A 1IAHA 2W4JA 4IZ5A 5E92A 5TR6A 4FTMA 3N51A 4CFWA 5G6VA 5LARA 3FKOA 4C4IA 4ZSAA 1KUTA 4WBBB 4BGHA 4EH9A 5E4HA 4NH1A 5C01A 3GFEA 4JBVA 1VYZA 2BPMA 3DU8A 3Q9XA 3HDNA 4ZLYA 3IECA 3VQHA 2EVAA 2UZWE 3DS6A 2BFXA 4RRVA 5FBNC 5DR9A 5DI1A 3R9DA 2W5BA 3IOKA 3GU5A 4RPVA 3F5PA 4CKRA 5EHOA 4QMYA 3ZSHA 4QYHA 3BCEA 3VC4A 2X6DA 5CQUA 2X2KA 4ZJIA 4FKIA 3UIUA 4JR3A 1FMKA 2BFYA 3PY1A 4G1WA 1YOMA 4QQJA 1H08A 4FKGA 2IW9A 4GYIA 3TZ8A 3PLAE 4JRNA 4ZMEA 5LVPA 5HG7A 4C34A 1L3RE 2BRHA 4YJSA 3PSBA 2QLQA 3GB2A 3EMGA 1JKSA 3EQBA 4XOYA 2XRWA 3IW4A 4USDA 1XO2B 1Q61A 2OZAB 4ID7A 4QPMA 3NSZA 4YBJA 4EC9A 5HE1A 2YCFA 4A9TA 3R2YA 4TW9A 3FSFA 3GXLA 3CTQA 4PPCA 4FEVA 1CM8A 3B8RA 4MXAA 3KN6A 5AR3A 2NRYA 4DCEA 2O8YA 3L8XA 4U7ZA 4E6QA 2YDKA 4NSTA 4QMZA 1KWPA 1R1WA 4FNWA 3HKOA 1OIUA 4O1OA 4KIPA 4RG0A 5F94A 2VU3A 1RE8A 4DFBA 3OBJA 3QWJA 4W8DA 5AUVA 3GU7A 4NEUA 1HCKA 3CE3A 4ALWA 5IQIA 1YHVA 3PXYA 1OL2A 3RM6A 2RSVA 1AGWA 1GY3A 3UC4A 4UMRA 2VTNA 5HX8A 1UU7A 5AUTA 5KMNA 2BHEA 3MY0A 1UA2A 4BWPA 3ZOSA 4ALUA 4DEHA 4GKHA 3RZBA 3EZVA 3R21A 3ZZEA 2CHLA 5IEXA 3F66A 4DFXE 1J1BA 3RPSA 4XG3A 2FB8A 3CEKA 4P5ZA 3QX4A 5H8GA 4UMPA 3S0OA 1YOJA 3BV3A 3NIZA 3PVBA 3BYSA 3ORPA 5AX3A 3GC0A 2PVYA 2B54A 2B7AA 2PUNA 4F1OA 3DLSA 4UY9A 5IA4A 5FDXA 3WZDA 3UGCA 2C4GA 3AGLA 3U8WA 3OCGA 2QU5A 2RGPA 4R7HA 4YLLA 3PWYA 4XG4A 5EYCA 1ZMWA 1SZMA 3D7TB 3HX4A 3OT8A 3WI6A 3M42A 3FAAA 4APPA 5GHVA 5KMLA 2J90A 2VTLA 4IDTA 3KA0A 3FLYA 3AXWA 5DPVA 3H30A 2F7ZE 5KMJA 4CEGA 1OL6A 3UQCA 5E8WA 4UWYA 4QP7A 3HMNA 4O0SA 1G5SA 2YDJA 3QZFA 3Q2JA 3BI6A 4AZTA 2J5EA 5IKWA 1YI6A 2XEZA 3KCKA 5HO7A 4OW8A 5D1JA 3EYHA 2PVNA 1H25A 4MK0A 3KGAA 1UV5A 4JNWA 4NWMA 5D12A 2LAVA 4EQMA 4G6NA 3I7BA 4I22A 5J95A 4AZFA 3EWHA 4YZBA 4F0IA 4N57A 4R7BA 5CEOA 1PXOA 2YABA 4K8AA 4D9TA 3NEWA 2R4BA 2X8IA 3ZO1A 5IH6A 2QURA 4E73A 1MRVA 3QZIA 4YSJA 4YSMA 2F2CB 4J99A 2CN8A 1ZAOA 2XP2A 1TQMA 5IA2A 4KUJA 3LJ0A 3TZMA 2OZOA 2VTJA 3DZOA 5TKDA 5CLPA 4JG8A 3DTWA 4GRBA 4IVAA 3GT8A 2KTYA 5LMKC 5EDPA 4FEQA 3DFAA 5ACBC 4O6LA 2GPHA 3OG7A 2GSFA 4C3PA 2BALA 4QYEA 3MBLA 5M44A 4NFNA 2B9JA 3UOKA 4BDHA 1CSNA 3RAHA 1ERKA 3NAXA 3FZSA 4GH2A 3FQEA 3GFWA 3KK8A 3E62A 3IO7A 4F1TA 3UVPA 2PY3A 3O0GA 4WRGA 4CT2A 2YWVA 3FY0A 3IW5A 4RIWB 3D5UA 3F88A 4GIIA 2JKOA 3PIZA 3OWLA 5ANKA 4OT5A 2XH5A 2P55A 3FZPA 4FUYA 2IW8A 4TT7A 5C8KA 3MY5A 1GJOA 1J91A 4CRSA 3A7GA 3P79A 4CYIA 4KIKB 3LIJA 3RVGA 3LFCA 3WF5A 1PXLA 2UW8A 4V0GB 5HCYA 3RI1A 3BWFA 3F9NA 4R78A 1G8AA 4JX3A 1YQJA 4AU8A 1B38A 1MQ4A 3P23A 1VZOA 2X39A 3LZBA 4EBVA 2Z02A 4RFYA 3II5A 3ANQA 3TV4A 4WG4A 3VS0A 3OTVA 2QG5A 4BIBA 4CG9A 4QYYA 5I0BA 5CEIA 3V5WA 5J9ZA 1SVHA 2GS6A 2A27A 3D2IA 4O0TA 4UBAA 2C3IB 4AOJA 5KNJA 2C1AA 3M1SA 3DNDA 3CR0A 4TRLA 3PDTA 4I0SA 4EWQA 3DBEA 3OUKA 4G2FA 3PIYA 4JS8A 4TYIA 2FYSA 1Y8GA 2PVJA 3C0HA 3DY7A 3I81A 3Q96A 2JGZA 3Q2MA 3VNTA 4EOQA 5JK3A 4I92A 3O17A 2P3GX 4DG3E 5AV0A 5JN2A 4A07A 3Q4UA 4MF1A 4I94A 4IAKA 3SXFA 4ACMA 1OL7A 1VJYA 4RX9A 3IGOA 5LXMA 5M4FA 3VJOA 3RM7A 3CC6A 2PWLA 3SG9A 3Q9YA 3PUPA 2JFMA 4IAZA 3QCQA 3TZ7A 5BYLA 3C4FA 4ARKA 4OTHA 3OF0A 1ZYLA 5HVYA 4OAVB 1WVYA 2BAJA 4PMPA 2GHLA 3KKVA 4L3JA 4WG3A 3Q9WA 4QT1A 4AGCA 1Y91A 2FA2A 4M7IA 4L43A 3GQIA 4IAFA 3ATTA 1UNHA 3IG7A 4BHZA 5L2WA 3C5IA 2O3PA 5HTIA 4RJ6A 5KMKA 3OCTA 5EDRA 4EH2A 2PZ5A 3EN5A 2RFEA 4CMUA 5I9WA 3FI4A 3ACKA 3I6WA 2WELA 3FZOA 4MD8E 4O0XA 4XP0A 4HVHA 4Q2AA 1CKIA 2GHGA 4AWIA 5DN3A 2GTNA 4O91A 1I09A 4TN6A 2QC6A 3BLHA 4QQ5A 1XH8A 2AC5A 3F5UA 3QRIA 5CF6A 3DJ5A 4EKLA 2J51A 5BUEA 2WAJA 4ACHA 1YKRA 2I1MA 3LJ1A 3QHRA 3V8WA 5JKGA 4LV8A 2EU9A 3BYVA 4DEBA 2X7OA 4FA2A 4HZRA 5CSPA 4XP2A 4FG7A 4F65A 3L9PA 4E5BA 2C0OA 3F7WA 3BWJA 3I4BA 3P86A 4U40A 4IB1A 3ZUVA 1OVEA 4O27B 3T9IA 3NRMA 4F0FA 4XG9A 5IQAA 4D28A 3LFQA 1ZOHA 2O2UA 4PX6A 3W1FA 5J9LA 5E7RA 4PP7A 4C38A 5HIBA 3LQ5A 4X2JA 5M4IA 4XS2A 2C6MA 1XQZA 4KSPA 3R00A 5LJJA 4BF2A 3CIKA 3W8LA 4EYJA 4CTCA 4H58A 2JIVA 3VBVA 4ASZA 2O63A 3DJ7A 3Q5ZA 5FEQA 3DXPA 4PNKA 1XJDA 2FSMX 3SQQA 2G2FA 4YHJA 4D5KA 3TUCA 2BDFA 2XM9A 1Q8TA 3DKOA 3DBFA 1Z57A 3ELJA 3P9JA 2W1GA 4KINA 4MBLA 5EG3A 1XH7A 3R8PA 3QGWA 4AN9A 4BCHA 4BTJA 4JDIA 3EQHA 3QQGA 4YU2A 4JBQA 3C5UA 3SC1A 2PMLX 3NPCA 4U0IA 2B9FA 3OEFX 3UOLA 5I9UA 4FV1A 5AV2A 2OKRA 2W5HA 5AUXA 3D15A 2ZM1A 3C0IA 3MV5A 3WZEA 4E1ZA 2CKOA 2CNUA 2YZAA 3OCSA 2YZLA 3LM0A 3QYZA 3UZPA 1YWVA 4YLJA 5JFSA 4FIFA 5HICA 4Z16A 3BBWA 4HGSA 4ZOGA 3TG1A 3VUHA 3IS5A 3TV6A 5CS6A 4MBJA 5CSXA 3MIYA 4RT7A 4EWHA 4FC0A 2O64A 3FI3A 3VO3A 4CFNA 3NVMB 1LUFA 5HKMA 5C03A 2R3LA 2VV9A 1LPUA 2XB7A 4MCVA 1ZMUA 4BCPA 4FV4A 3BHVA 3OW4A 4PUZA 3FKNA 2C5YA 2UW6A 3LFNA 3TEIA 4L01A 4E5WA 2I0YA 2J0LA 2Z7SA 1KSWA 1AD5A 2GS2A 2W4KA 2VN9A 4O96A 3LVPA 4F9YA 2ITZA 2OIBA 2UZTA 5CY3A 4Y85A 1E1VA 2DUVA 2XZSA 4D55A 4H3PA 4CZTA 3HGKA 3H10A 4WUNA 4R3CA 3ORNA 4O7RA 4RJ5A 2G2IA 4UMTA 4YJUA 5CAPA 3FV8A 3I60A 3LAUA 4O21A 4TZRA 4EI4A 3BEAA 1SYKA 2BKZA 2CGWA 2JKMA 4GK4A 1PY5A 4YR8A 2WEVA 4K18A 3CS9A 3TACA 4EHVA 5M56A 2Y4IB 2X8EA 5C4KA 5CQWA 4NM7A 4IX5A 3SD0A 4FTRA 4X21A 4EHGA 3E5AA 4IVCA 3F3VA 4YZMA 4C3RA 1H1WA 4FYNA 4IHPA 4ZTRA 5CTPA 4GKIA 3EHAA 3OP5A 4FOCA 5IZFA 2W0JA 2YISA 2PE2A 5BVWA 5KHXA 3ROCA 3IOPA 4YHFA 3RTPA 3CY2A 4FTUA 3RGFA 4E3CA 4EOKA 2WTKB 4ZY5A 4KKGA 3FXXA 5CEQA 1J7LA 4H1JA 3VS6A 3EJ1A 3TL8A 1XBBA 2QOCA 5IQDA 3QTZA 3TI1A 2OH4A 2QR8A 4G6LA 2XMYA 3RK7A 5CALA 4IANA 4TYGA 4KKHA 4DFNA 3CQEA 4K9YA 3UIBA 4RJ3A 5HE2A 4E93A 3EQGA 3TM0A 3D4QA 4ZK5A 5M53A 4M3QA 5EW8A 4FZ6A 5CAOA 3FJQE 4Y8DA 3FHIA 3COMA 3RPRA 3LLTA 5L6OA 5CSWA 5AA8A 4J53A 2OJGA 3TT0A 1KE9A 3HRCA 4ACDA 4EHZA 3R7VA 5IUGA 2ESMA 4EQUA 4O81A 3QXPA 3OUNB 3ZTXA 5TE0A 4CXAA 4E20A 4LOQA 1PMVA 2XIZA 3NYVA 2B1PA 4NTTA 4QMPA 4MXYA 2YLFA 2QI8A 2WFYA 4PRJA 5D7VA 3PIXA 1SVGA 3RAWA 2VO6A 1IAJA 3KRLA 2XNPA 5J1VA 4WIHA 1TVOA 5J1WA 5BVDA 4JBOA 4WD5A 3EKKA 3VS7A 5HIEA 2Y8OA 2QO9A 3Q4CA 3R02A 3CJFA 4Z9LA 5AP4A 3DFCB 2XBJA 5E8SA 4BCIA 4R1VA 2HZNA 3F2RA 4PV0A 3MYGA 1NT2A 4D5HA 3IQ7A 4RVLA 2R3FA 3R0TA 1F0QA 3S1HA 4IBMA 2C6LA 1W83A 5JT2A 1PXIA 1ZMVA 2QNJA 4DEEA 2YM4A 5IH4A 3OWJA 2CCHA 2ONLA 3ZFXA 4AXAA 4ZIMA 1H00A 3U4UA 5ANDA 5JFXA 1R78A 4U45A 4PPBA 4BFMA 4D9UA 3ODZX 1A48A 5ETCA 1WVWA 1XBCA 3QD3A 4X3FA 3THBA 1Q24A 5CSVA 1YDRE 1E1XA 1UWHA 4C2VA 4J95A 4G5PA 4AF3A 3KU2A 4C59A 4C7TA 5AR5A 4AS0A 2Z7QA 3E87A 1KE6A 3EZRA 5GJGA 3ZRKA 3R8VA 4C35A 4R77A 4XG2A 1PRYA 4IB0A 3R8MA 3AC5A 2YM7A 1IA9A 3S95A 3Q52A 1ZZ2A 3PY0A 4CKJA 3HMOA 1H27A 4AP7A 5BVKA 2ITPA 3MPTA 4WBOA 4FIJA 5F1ZA 3R7YA 4EOJA 3P5KA 3RK9A 5JQ5A 3GU4A 1H8FA 1H1SA 3M2WA 3PG1A 3DV3A 4FEWA 3C4XA 1YW2A 3MB6A 4AAAA 4I24A 5AR7A 5HCXA 5ACKA 4DITA 3AMBA 1ZWSA 2BRNA 4FV8A 3LLAA 3R73A 4C0TA 3CPBA 2F49A 2C30A 2PZIA 3V5TA 5JEBA 4DTAA 3FLNC 5F4NA 2JITA 3VUIA 4HZSA 2F7XE 2W1EA 3LFDA 5C27A 4FV0A 2GQGA 1LP4A 5HBHA 3MH0A 3EYGA 3PP0A 3HV4A 5HX6A 3E92A 3ZC6A 4YJOA 3L1SA 2W1DA 5J8IA 3TTJA 3COKA 4AT5A 4AW2A 4WA9A 2YCQA 2PPQA 4FV2A 4HYHA 1W98A 1Q62A 4G9CA 4J7BA 4FK3A 4UXQA 2W4OA 4C4GA 2X0GA 2HY0A 5CU0A 2VNWA 4JIKA 3UPZA 2R3GA 1J1CA 3FY2A 3QZGA 2PHKA 2WMUA 3F2NA 2XK7A 1KE5A 1L8TA 3COIA 3EL7A 4HGLA 3OXIA 4BDEA 4IWQA 4DH1A 2Y4PA 4ZTQA 3RAKA 4JDHA 3RZFA 2FSLX 3U6JA 5M4CA 4FSZA 4AN2A 3EKNA 5CU2A 2W06A 3S4QA 2VTRA 3MW1A 2ZDTA 4E26A 3PXKA 4X2FA 1BLXA 5JQ8A 4ZS4A 2CGVA 1V1KA 5HHWA 3ULIA 5DIAA 1OI9A 2BRMA 3KVWA 4JLCA 4XRJA 4QTEA 4LOOA 3RPVA 4IAYA 5JSMA 4O1PA 4O82A 4BBEA 4OTQA 3CJGA 1JOWB 2UUEA 2IVTA 2OXXA 4IWPA 4WNKA 2BAKA 2V55A 3GEQA 4Q5HA 4W4VA 4AGUA 2NP8A 3G0EA 3R7GA 4LG4A 3BU3A 4HVGA 3HYHA 2H6DA 4GEOA 2XK8A 2CNQA 4AX8A 3A8WA 3BGZA 4C4EA 5ANJA 4N6YA 5FM3A 2JBPA 3W2OA 2RFDA 2C3LA 2PU8A 3DDQA 3BHYA 5TOZA 1JWHA 3FYJX 2CNVA 5AR4A 5DBXA 2Q0BA 2OFUA 1K9AA 2R3PA 2X4ZA 2Y7JA 1OBDA 5FXQA 2ITVA 5E1SA 4X2GA 4EH5A 4FSYA 4FIIA 4AZWA 5KBRA 4LOPA 2PTKA 4D1SA 4JRVA 3ZYAA 3Q3BA 2VWXA 4KBCA 3V3VA 2PE0A 3UJGA 4J71A 4NT4A 1K3AA 3DQWA 4GT4A 4S2ZA 3V5JA 4AOTA 3MFRA 4CZYB 4FI1A 3R1NA 5CAVA 2QOKA 1WBVA 3AD6A 1S9IA 5I9YA 3R04A 2OJFE 3OXZA 4JDKA 3UC3A 5HQ0A 1H1RA 3DNEA 5FD2A 5H2UA 3E93A 2VO3A 4FBXA 4M67A 2F57A 4AG8A 5BVNA 3QCSA 2RF9A 2XJ1A 3A4PA 3TIZA 1FGIA 4FTJA 4NJDA 2YIQA 4Y83A 3EH9A 3MTLA 4F7LA 4WHZA 2UZLA 3QTQA 4DEDA 3MPAA 4I5HA 3Q5IA 4U8ZA 4Y95A 3RWQA 1VEBA 1IA8A 4BGGA 1ZY5A 3LMHA 4BDJA 4O0YA 3KMMA 2HCKA 3O8PA 4XRLA 3KRWA 2ETMA 4IDVA 2JFLA 3Q32A 3ZLYA 2E9NA 4E4NA 3QTRA 3CKXA 4ZLZA 4ASXA 2YA9A 4PDPA 4XV3A 3MGYA 1KV1A 1CTPE 3HP2A 1H24A 3MS9A 4O7WA 3N9XA 1I44A 2UZEA 4GVJA 4LYNA 4MWHA 3V51A 5I4NA 5DE2A 4JX7A 3SGCA 2J6MA 3ZBFA 2J0JA 4CCUA 5K4IA 4EK3A 4P90A 5CF5A 2J5FA 2W05A 3KXZA 3FHRA 4YURA 2J9MA 5LMBA 1P5EA 2UW7A 4L7SA 2JEDA 1H28A 2OWBA 2I6LA 3GC9A 3FLZA 4FT0A 3M11A 3SV0A 4L9IA 3OVVA 3RMFA 5CVFA 3CBLA 5JZJA 2VTOA 3HL7A 5AP1A 2UZVA 2QONA 4J1RA 4RC2A 2OJ9A 5EOBA 3C7QA 2ERKA 3PTGA 4IXPA 4EK6A 1PJKA 4GG7A 3FDNA 4KBKA 4O38A 4ERKA 1JKLA 1OKYA 5CNNA 3LXLA 2BDWA 4F99A 3LE6A 5BUJA 2HZ0A 2VNYA 3DT1A 3TXOA 3HV7A 3UPXA 4BCOA 4EC8A 5IQFA 2XNEA 4B8LA 4DT8A 3HA8A 2UVXA 3QTIA 3QQKA 3RAIA 2ITQA 4RIYA 2BRBA 3PA5A 4O22A 4EL9A 3ORXA 4MAOA 5L8KA 5KMMA 5JGAA 2YWPA 4MQ2A 3BELA 4EOOA 3PA4A 4QP4A 3ZO3A 5HEZA 4BI2A 4QQTA 4FSTA 3FC1X 4YO4A 5M06A 4FKVA 3QUEA 1BKXA 2EB2A 3A99A 5IQHA 5K9IA 4UB7A 3BHHA 2Y9QA 4ACGA 2OBJA 3CTHA 4AT3A 3LFSA 3MDYA 4AT4A 2YFXA 4F0GA 3UG1A 2WB8A 2WMQA 3WE4A 1A9UA 5FDPA 3GBZA 4FTOA 1G8SA 3T9TA 5KE0A 1JAMA 2H8HA 5H8BA 4YJNA 2IZTA 4DFZE 4QTAA 2VX0A 3VUKA 1IEPA 4NTSA 5LMKA 3U9CA 4RC3A 4E4MA 1NXKA 5BUIA 4KBAA 5ANEA 2WHBA 2QKRA 2V7AA 4EH6A 2W1FA 1S9JA 4UEUA 4AA0A 4QMVA 2YJSA 3GUBA 1ZARA 4N70A 5DGZA 2GDOA 2XM8A 3IDBA 2YAKA 4QMXA 4S32A 5A54A 1OMWA 5FP6A 3GP0A 4CNHA 3PPKA 4DG2E 3EOCA 3BZ3A 4A9YA 3MSSA 5AP0A 3RHXA 3DXQA 4DN5A 4EOSA 5T3QA 4IB3A 2QLUA 5CU6A 5IA5A 2PYWA 3PXQA 2P33A 4A9UA 2XBAA 2F4JA 3ZS5A 5L4QA 3TUBA 2HXQA 1JNKA 4NKAA 2W96B 2YCSA 4L8MA 3LFAA 5L6WL 5JGBA 3ZLXA 3ZXZA 2ZV9A 2VWBA 4HCUA 4XHKB 5GZAA 4ANLA 4L53A 4E6CA 1JBPE 3TDVA 4FT3A 3WF7A 4L6QA 2VRXA 4BI1A 4IB5A 3LCSA 4Y72A 3PLSA 5JRQA 3R7UA 1OIYA 1WBPA 2EXEA 3QRJA 3DK6A 2C6DA 3QRUA 4YTCA 5M51A 3TIYA 2I7QA 3QA0A 5CXHA 4U80A 1GZOA 5GJFA 4D2PA 4GVAA 3BLQA 5FEDA 3NZ0A 3B2WA 3QZHA 4MNEA 3SAYA 4H3BA 4FEXA 4EK4A 1PKGA 2R3QA 2RL5A 2OXYA 4EONA 4EZ3A 2OSCA 1U46A 3PZEA 4K0YA 4B6LA 5KMOA 3DAJA 2CN5A 3R28A 3FPMA 4HYIA 3SW4A 4U97A 5M55A 3UMWA 2VX1A 3MN3A 1BMKA 4D4RA 2WMTA 1M17A 2XK4A 3PA3A 1QL6A 3BYMA 4G3FA 4P7EA 5EYMA 5E8YA 5DYJA 4RZWA 4FTNA 3AC4A 4ANOA 3WIGA 4FE2A 2BROA 2Y4IC 5E9EA 4DBXA 2CMWA 4V04A 4I5CA 2Y6MA 4FNYA 1F5QA 3MH1A 4TWOA 3KL8A 5KKRC 3B2TA 4ZZOA 5EOLA 2IVUA 4GUBA 4I6FA 4UWCA 1GZ8A 2BVAA 1YI3A 3QX2A 4GFMA 4BY9E 4LFIA 1JQHA 4X3FB 1QPEA 4M15A 4IWOA 3VBQA 4DFYA 5A4QA 3S2PA 3W55A 4D1XA 3VWAA 4ZTMA 4Z55A 2OIDA 3KEXA 4M8TA 4AGWA 2WOUA 3FZRA 3MFTA 1WZYA 3A4OX 4FV3A 4PTGA 5DR6A 4I21A 2NO3A 3EQRA 2XCKA 3D9VA 4QNAA 3NIEA 2IO6A 3E64A 3ZBXA 1P2AA 2JDOA 5AP5A 2Q83A 2B53A 4BN1A 4FV6A 4I6QA 4O7VA 2RG5A 2YM3A 3AT2A 4IFCA 5IEYA 5EM8A 1JSUA 4H39A 5A4TA 3DKFA 4I93A 3RPYA 4C02A 5AR2A 4WKQA 2ITWA 4JJRA 4WOVA 3HMIA 1GIHA 2FGIA 4GT5A 4RVTA 3VW6A 3A7HA 2HWPA 2UW5A 3MI9A 4I4FA 4AW1A 4L45A 4W9WA 4BDFA 4NM0A 3VW8A 1APME 4IVBA 4F64A 4AQCA 1V0PA 5LWNA 4FMQA 4ANBA 3V8SA 3DKGA 2X1NA 3G6GA 4ACCA 3TTIA 4AW0A 4GCJA 4TYJA 3ZUUA 4UWBA 4PP9A 1RW8A 4IEBA 3UBDA 1VR2A 4FSUA 2WIHA 3MVJA 3NUUA 3VRZA 3Q53A 3W2QA 4ERWA 4CLJA 3MESA 3O51A 1MRUA 4HCVA 3UG2A 2Q0NA 3P7BA 4RBLA 4IM3A 2BILB 5A3XA 5A46A 4FSQA 1XH6A 5CZHA 3QHWA 2CKPA 2BCJA 4IE9A 5CF8A 3HAVA 3HLLA 4O7TA 1QPJA 3AMAA 3G9NA 3NNXA 4H3QA 2BR1A 2BZKB 3FL5A 5EQEA 4YLKA 1OM1A 2JDVA 4QQCA 2VUWA 4RA4A 4RMZA 4M14A 4E5AX 4DBNA 5ITAA 3PJ1A 2ZM4A 4EQCA 4FOBA 3L8PA 2XKCA 2HELA 5I9VA 5EM5A 3FQHA 3QL8A 4J96A 5L8JA 4GMYA 2H34A 3KRXA 2C5XA 2ERZE 5ANOA 4TXCA 3UP2A 4MTAA 3UOJA 2OFVA 2W1ZA 1NVRA 2XVDA 2YLEA 5K3YA 3VS1A 4BB4A 1PYEA 3ZDUA 1JVPP 2QO2A 5LMAA 2PK9A 3O2MA 3IK3A 5F95A 3BBTB 4RX8A 4XMOA 2YIXA 4DH5A 4P2KA 4WNPA 4YBKA 3D5VA 4HW7A 3EQPA 2UW3A 2GFSA 2V7OA 5JGDA 3Q4TA 1GNGA 3PY3A 3MH2A 3UZRA 3UNKA 3V8TA 1QMZA 2R0UA 3BGPA 2AYPA 1NVSA 4RZVA 4UALA 4O84A 5DR2A 2WOTA 3V04A 5IH5A 4QP9A 3IDPA 3G9LX 5IPJA 4RWIA 4D0WA 1UKHA 4DINA 3PFQA 3BE9A 2W1HA 5KZ0A 4JBPA 3WZKA 3PPZA 4EYMA 3LFBA 3NNVA 4LMUA 4IH8A 4QMNA 2EXCX 2LGCA 2VO7A 3I5ZA 4LGHA 1LR4A 4RVKA 4A06A 2C1BA 3NGAA 5C8NA 2CLQA 3OT3A 1ZY4A 3AT4A 4JG7A 3UDBA 5IG1A 2VTIA 3DZQA 5IU2A 3FZTA 3PYYA 5J87A 2ETRA 3F82A 2GU8A 5KZIA 2VZ6A 4DCAA 3KRRA 4F63A 3FQSA 2HXLA 4FKQA 2OF4A 2OJIA 4NCTC 1FMOE 2YJRA 4IC8A 4APCA 4ENYA 1Q8UA 4M84A 4FTIA 3FLWA 4FIEA 3SX9A 3TN8A 3DLZA 1Q8WA 2WQEA 3AC1A 3KY2A 4M13A 4FSWA 3WYYA 5AFVA 5EQPA 2ACXA 4DT9A 3KF4A 4F70A 5HTCA 4IW0A 4X2NA 3FL4A 2WMXA 3KMUA 1OBGA 3C51A 3R7EA 3RWPA 3ZMMA 4Q9ZA 4A9RA 2V0DA 4BWXA 1AQ1A 4KRCA 2ZMDA 4FZDB 4O7YA 3EFJA 2YEXA 3NLBA 2UV2A 3EQCA 4GFOA 4FKTA 4D2VA 4BCNA 2QOBA 4YMJA 3EQIA 4I4EA 3HRFA 2JDTA 5AP3A 4KS7A 5IUHA 4CQEA 4PTCA 4CMOA 2YHVA 2AUHA 3HECA 5GIPE 3PPJA 3EN6A 4FKRA 1PW2A 4FSRA 4KS8A 4M68A 4QP8A 4ZEGA 4F9CA 3NYOA 3V6SA 2GNFA 2PL0A 5AJQA 1RQQA 1H4LA 2PMNX 2VWUA 3OHTA 4UZHA 3VRYA 2OLCA 5IQEA 2GNHA 2OF2A 4IMYA 4L67A 2WGJA 2B52A 4XBRA 3IONA 3P7CA 3PJ8A 3DDPA 5IMEA 5IQGA 4A9SA 2QOHA 2QG7A 4E6DA 1DI8A 3DCVA 4D4VA 1DI9A 3QLGA 1BI7A 4X0MA 4QMTA 2W9ZB 1H07A 5GINE 4RVMA 4MXOA 2WQNA 4ZMFA 4U42A 2EUFB 3R1SA 1SMHA 1EH4A 4PF4A 5AADA 4N4SA 1MRYA 5BNJA 4F7JA 5J7HA 4YO6A 1RDQE 3ZLSA 2GTMA 3QF9A 4DH8A 5B2MA 4USFA 5DT3A 2VTPA 3OMVA 3U9NA 4IAIA 2YM6A 5LWMA 3HVCA 2OZAA 3FKLA 3PVWA 2C68A 4M69A 4W8EA 3QA8A 4J97A 4MHAA 4O0WA 4OTFA 3GQLA 4BDKA 4YC8A 3PXFA 5GZ9A 4NU1A 4XP3A 4DA5A 2PVFA 3UYTA 3VBYA 1ZYCA 1U54A 3TCPA 4EEVA 4OAUC 4NIFA 2J0MB 2UZNA 1T46A 4P5QA 5F20A 1FOTA 2XNNA 3R1QA 5HNIX 5H3QA 1YHSA 2WKMA 3TDWA 5DG5A 5K5NA 3QU0A 3RP9A 1FVRA 3RNYA 3BGQA 2RG6A 4CZUA 5AMNA 4I3ZA 3AMYA 3U4WA 3SW7A 5EI8A 4NW5A 2R3JA 2ZOQA 3GC7A 5DHJA 1R39A 3R8LA 3KRJA 1ZYSA 2CKEA 2X9FA 5HG5A 5LCKA 2VTTA 4UZDA 3JUHA 2HK5A 4ANMA 4USEA 1KE8A 2PVRA 4ZXTA 3UO4A 2F2UA 5A6NA 4EK5A 2G01A 4XG6A 4O83A 2R0IA 5J9YA 3UQFA 3WF8A 2A4LA 5CT7A 4I1ZA 2XUUA 2Z2WA 4EUUA 1MQBA 4RLLA 4FZ7A 3ROYA 4EH7A 2QKWB 4CFXA 2Z8CA 2ZVAA 3UP7A 3V5QA 3ZZWA 5AV4A 3TKIA 5BVEA 4PDSA 1FQ1B 2BIKB 4CGAA 3HEGA 4XV9A 1UU3A 5FWKK 5FP5A 5E8TA 5GZ8A 2PE1A 2XKEA 2PZYA 3HV3A 3OWPA 2PVHA 2I0HA 3UODA 4QO9A 4EZ7A 4ZSEA 2B4SB 4PL4A 1OIRA 4YZ9A 3RALA 2GQSA 2J4ZA 3NX8A 5CX9A 4GYGA 2C6TA 4H05A 4IFGA 3R83A 3WZUA 1PMNA 4FTQA 5CYIA 3JY9A 3T8OA 3NUXA 1DM2A 4GSBA 4J8NA 5EFQA 2GNIA 4ANNA 3FXWA 4BGQA 1R0PA 1U5QA 3R9HA 5IMXA 3EN9A 3DBCA 3RKBA 3PSCA 3DA6A 3O8UA 2CLXA 5HVJA 4EOLA 1OL5A 3QKMA 4ITIA 2E9PA 4W4YA 3ZU7A 4EBWA 4NYEA 4DAWA 2GMXA 3FUPA 4MNEB 3VUTA 3C50A 1XH5A 4XJ0A 1OKVA 2W1IA 3CTJA 3UQGA 3O50A 2XK3A 3ZFYA 4QMQA 3P7AA 3UO5A 4U41A 1FVTA 5I9XA 3FE3A 3ZSGA 4BICA 4BZOA 3T3UA 5HO6A 3PJCA 3MVHA 3S3IA 3W2PA 1H26A 5DNRA 3GCUA 3C4CA 5AEPA 4TYEA 3CY3A 3ZC5A 1X8BA 2IN6A 2HZIA 3BYUA 3LFEA 1UU8A 1FINA 2BTSA 2QOFA 4JQ8A 4EJ7A 5J7BA 1REJA 1JKKA 1WCCA 4FODA 4U81A 1STCE 3POOA 3LPBA 3IGGA 3G90X 3Q9ZA 4AFJA 4U79A 4YJRA 5FXSA 4R8QA 3VIDA 4R3RA 3T3VA 2VTMA 3TKUA 3UNJA 4ZY4A 5CEKA 4ORKA 1Q99A 2C5VA 3E8DA 3NUNA 3QLFA 3AC2A 2XKDA 2YM8A 3HV6A 4U6RA 3VULA 3W2RA 3R01A 4B4LA 5HNBA 4F09A 3D7ZA 5KCVA 5EKNA 3FLSA 4GU6A 3U87A 4FV5A 3TJCA 1V0OA 2ZM3A 1KE7A 4R1YA 5IQCA 3EFKA 4DH3A 4EOPA 3QQHA 1JSTA 5FUTA 3W16A 3AD5A 3KMWA 2DWBA 3QRKA 4LM5A 4HNIA 4CMTA 3VHKA 4KIKA 4I5PA 4K6ZA 2OK1A 4QYGA 2CKQA 2A1AB 2B9IA 4IAAA 1OUYA 4DGGA 2BAQA 4OBPA 4NL0A 2C6KA 4MD9E 1F3MC 4OBOA 3F69A 3R9OA 3EFWA 3EL8A 4BR3A 4WSQA 1PF8A 2OIQA 2P4IA 1IASA 2CDZA 2X6EA 4J52A 5DEYA 3SDJA 3SOAA 2VD5A 4G17A 3WZJA 2ITNA 3CLYA 4IM2A 3W33A 4O0UA 1WBTA 3SG8A 2FO0A 3CGOA 4BIDA 3PWDA 3OXTA 4ENXA 1P14A 1WVXA 4Q5EA 1ZYJA 2OXDA 3SHEA 5ICPA 3QUDA 2YN8A 2P0CA 3K3JA 3KK9A 1YXVA 2SRCA 2PZRA 4D58A 2PUIA 4BDDA 2CSNA 1TKIA 3C0GA 4CD0A 4FTCA 3TJDA 1YXXA 3I79A 4MVFA 1YHWA 3OY1A 4L68A 2OH0E 3FBVA 4G3GA 4Y5QA 5HNGA 3HA6A 3GVUA 4DGOA 1QPDA 2QQ7A 2VWYA 5IISA 4NJ3A 5CZIA 4IM0A 3RCDA 1Q3WA 4M97A 4FT7A 3BU6A 4B8MA 4E4LA 5AP6A 4C33A 2ZV2A 4CRLA 3GOPA 4DLIA 3NMUF 3UIXA 4AE6A 4RIXA 1XH9A 3BQCA 1CDKA 4N0SA 4MH7A 2VAGA 3VQUA 1ZZLA 2JKKA 3FXZA 4MX9A 1QCFA 4PY1A 4S33A 5E90A 3LCDA 3ZM9A 4MD7E 1GIJA 1WAKA 2YERA 3F5XA 3OS3A 4J98A 1H1QA 4QNYA 5BX0A 3QD0A 4BL1A 2PUPA 2FVDA 3NUPA 2QOOA 4XCUA 5BMMA 3VS2A 4BIEA 1O6YA 4YTHA 5H8EA 3HUBA 4BDIA 2X81A 1NW1A 4QP6A 2VTHA 4U9AA 5AM7A 5A4LA 2JC6A 3PE2A 4HVIA 5IA0A 1U4DA 3ZXTA 4FUXA 5F9EA 4LUDA 5IF1A 2ITYA 4CFVA 5C9CA 2EWAA 4IJPA 1QPCA 4F7SA 3NAYA 4L46A 4JQEA 3HMPA 4G16A 5I3OA 1TQPA 2O65A 4ZJJA 1Y6AA 2AC3A 4WO5A 3N4VA 4D4YA 4M0YA 3LMIA 4DTKA 2ITOA 4AA4A 3C4ZA 2C3JA 3G33A 1H0VA 2F7EE 4BTMA 3QTXA 3VF9A 3A7JA 2QR7A 4GIHA 3GI3A 4YJTA 5DOSA 4BTKA 3L8VA 3BHTA 2JIUA 3ORTA 1Q5KA 4QTBA 2XNGA 2C3KA 4FT9A 1WMKA 3F3WA 2HW7A 1XWSA 1YRPA 4LL0A 5EK7A 3ACJA 3BEGA 3C9WA 3A8XA 4FG8A 4FKPA 4OTGA 5AUYA 2B55A 2ZV7A 3K2LA 1UU9A 5KUPA 3G51A 4BDBA 5L2TA 4H36A 4K1BA 5K0KA 5FXRA 5M4UA 2YDIA 4BTFA 3F3UA 3ORLA 5CNOA 4BCGA 4D2TA 3U6IA 1Q3DA 4JOAA 4KA3A 5AIKA 4ASDA 3NUSA 4C4JA 4DYMA 1YDTE 5EYKA 2G1TA 3OD6X 1M14A 4W4WA 3PZHA 5AP7A 5J5SA 1GAGA 4X6RA 2G2HA 4FK6A 4FKUA 3UVQA 1UWJA 4BDGA 5KMIA 2GNGA 4XH6A 3C13A 1R3CA 2R9SA 4O2ZA 3CD3A 5CU4A 4IVDA 2CGXA 4C3FA 3ORMA 2JIIA 3KB7A 4Z3VA 3C4WA 3TNQB 2UW9A 4EJNA 5CANA 2UVZA 3QCXA 4PMTA 2BTRA 1GZKA 1OZ1A 2WTJA 3OTUA 2RFSA 5GNKA 4AA5A 3F3TA 5DVRA 3BHUA 3JVRA 4FKJA 3N4TA 3RINA 4RFZA 2OJJA 2JLDA 2J0KA 4Z7GA 4M0ZA 3LFFA 1YI4A 4LRMA 3QQFA 1Z5MA 4CYJA 4AOIA 2KULA 4C4HA 2GQRA 4HCTA 3VBWA 5ETAA 4LGGA 5JRSA 2R7BA 2WTDA 4BBMA 3PRIA 3TKHA 4JR7A 4Q9SA 5D9HA 4X7QA 5M57A 2DQ7X 3ODYX 2C69A 4EORA 5AA9A 4YHTA 5KO1A 3OW3A 4TL0A 4O2PA 2VWIA 4I5MA 3E8NA 4L3PA 5LQFA 4WSYA 4C2WA 2XJ0A 5EW9A 5BVOA 4DF3A 3QKLA 4EK8A 2WMBA 2NRUA 4RX7A 2UZDA 3WIKA 3NR9A 2OO8X 1PXMA 4MXXA 4UX9A 1WBNA 4I20A 4QRCA 4BRXA 1WBWA 3I7CA 4L52A 1U59A 4MKCA 4XOZA 5HU3A 3GOKA 2X7FA 4Z7HA 4YPSA 4TY1A 4UV0A 4QTCA 1XH4A 4B99A 1YXUA 3ORIA 4NFMA 4MYGA 4WUAA 4W9XA 2GFCA 2E9UA 3P1AA 4A4LA 4II5A 4CFUA 3A60A 1DAYA
chains in the Genus database with same CATH superfamily
2Y6OA 4IZ7A 4YP8A 4O4DA 3RK5A 1FGKA 3FC2A 3K5UA 3MPMA 4OTIA 5E91A 2ZB1A 4YTFA 5JH6A 3ALOA 3EQDA 4BCMA 5LVMA 2NYAA 4FR4A 3GCVA 3R9RA 4C36A 3WOWA 1TFFA 3SRVA 4L7FA 3MJ2A 5FEEA 4DEAA 1OGUA 3KN5A 5BMSA 1U5RA 1O6LA 4YJQA 2BZIB 1E9HA 3IW8A 3MJ1A 4M69B 4FKWA 3AKKA 5FRIA 4IIRA 3W0QA 4EH4A 4QMLA 3ID6C 3NNUA 4KAOA 3QC9A 3VUMA 4RIOA 2ZV8A 3WE8A 1U54B 3IKAA 5EM6A 2HOGA 3FWQA 4NIFB 1URCA 2ZB0A 1PMUA 2A2AA 2C6EA 2WTWA 1YWNA 5D41A 4IZAA 2HENA 4FKLA 4RFMA 1UVRA 3FEGA 1M7NA 3ZDIA 4DEIA 3GGFA 2JDRA 3MVMA 3NW6A 4DG0E 1GIIA 4X6QC 5B0XA 4UYAA 5AP2A 2GHMA 3CKWA 5HLNA 3H3CA 4IZYA 3W0PA 4KIOA 2IWIA 3LOKA 2E9VA 1ZRZA 1BL7A 3OROA 4QMWA 5HO8A 3C1XA 3CGFA 4BKJA 3H9RA 2JBOA 2RIOA 2XNBA 2XRUA 3E88A 4JT3A 3N4UA 4IX6A 3ZEPA 2VGPA 2R64A 4CCBA 4QTDA 4JAIA 4XLVA 1H01A 4J8MA 2YM5A 3H9OA 4XV2A 3K5VA 4I0TA 3TNWA 4FTLA 4ITJA 3IW7A 4OT6A 5I3RA 4EH8A 4DTBA 3FSKA 5EI6A 5HIDA 5HE0A 2C47A 3QBNA 4IC7A 4RQVA 1Q4LA 3VS4A 1Q41A 3D14A 3NUYA 1ATPE 3A62A 4XNEA 1XBAA 3BIZA 1Q8YA 3JS2A 5CAUA 5HD7A 3QCYA 3JYAA 3DB8A 1K2PA 4XG7A 4EZ5A 3IDCA 4ALVA 2F9GA 1ZYDA 1WFCA 1H1PA 4I6HA 5L6PA 4D4SA 3NWWA 5DRDA 2CCIA 1SNUA 2X0QA 3ZLWA 2VWVA 4TTHB 3GCSA 2W5AA 2PMIA 3JVSA 3BLRA 2C6IA 4ZZNA 4AZEA 2WTIA 4MNFA 3PVUA 3KC3A 2VTQA 4JAJA 1BL6A 3EQFA 3O8TA 3ETAA 3F61A 3QRTA 2RFNA 4FIHA 2WIPA 4F78A 4DGMA 3QQJA 3VS5A 4QP2A 3PXZA 4QOXA 4GK3A 5ETIA 4O7NA 1Q97A 5IDNA 1OKWA 2VTAA 3POZA 1ZOEA 1M2RA 3R2BA 4MXCA 1NY3A 4ANSA 4MWIA 2OG8A 3EN4A 4O7SA 1IG1A 1OB3A 4E6AA 4F08A 2PVLA 4Y46A 4YUQA 1OPJA 5ETFA 4MEDA 3KXGA 5DFPA 3QD4A 4I0RA 3VBTA 1YWRA 4TWPA 3KFAA 3B8QA 3OCBA 4FL2A 5KX8A 3BRBA 4RWKA 1ZLTA 5HI2A 4HPTE 2PUUA 4UMQA 3EIDA 5IEVA 3HP5A 1P4OA 4F9AA 3V6RA 4D2WA 4NZWB 5JZNA 5M08A 2WTKC 3FZ1A 1PXNA 4S31A 4RWLA 1HCLA 4YTIA 3CD8A 4TYHA 5BQ0A 3CQWA 1O6KA 1LEZA 5IQBA 4DHJA 3ET7A 5EW3A 3H0YA 5G1XA 5CI6A 4NM5A 4L3LA 4ZLOA 3I0QA 3R7OA 3RPOA 2X2MA 1MP8A 3ALNA 2HY81 1JSVA 4KSQA 4KWPA 3E3PA 2C0TA 2QHNA 3EN7A 3OOMA 3OBGA 3MH3A 4HPUE 2UZUE 4Y73A 4ZP5A 2X2LA 4CTBA 3L9LA 2R7IA 4IJ9A 4TNDA 4QMSA 1XKKA 3OFMA 5FG8A 4BCJA 3R8UA 3F5GA 3LXKA 4NUSA 3VHEA 2R3RA 1DAWA 5HTBA 5GIOE 1UNLA 3NW5A 3C4EA 2OICA 3H4JA 1UKIA 4MF0A 4A4OA 5HBEA 3FI8A 5HG9A 2WMSA 5IA1A 3K54A 4DGNA 4FGBA 4FSMA 3TNPC 4OGRA 3MWUA 1Z9XA 3R1YA 1JKTA 4O4BB 3RHKA 3W2CA 4MBIA 2ZYBA 3UIMA 4LQMA 4BZDA 4FV7A 2QOQA 5L3AA 1PMEA 4GUEA 4YNEA 1GOLA 2BMCA 2QVSE 3TNHA 3VAPA 1ZXEA 3WF6A 3LXPA 4YZCA 3WILA 4AN3A 4QYFA 4XLIA 3FMEA 3Q6UA 1GZNA 4KIQA 3U54A 2R3OA 2IVSA 1CMKE 4BKZA 5A4EA 2WTVA 5A6OA 5L2IA 2E2BA 2R3IA 4OUCA 4WNMA 3CSVA 4PWNA 3QKKA 3MTFA 4B7TA 3SLSA 3UO6A 3R6XA 2XIYA 1H0WA 3ERKA 4OLIA 4C58A 4EHEA 4NCTA 5DLSA 4F6SA 1W7HA 3TWJA 2VTSA 4BCKA 4GFGA 4RJ4A 4WG5A 3EB0A 3ZHPC 4EH3A 4DH7A 5CF4A 3TZ9A 4HOKA 4PQNA 1OL1A 3AOXA 4RIXB 3D94A 4FRFA 4F9WA 1M2PA 3HMMA 3S00A 3JY0A 4R6VA 2W7XA 4OTDA 1YXSA 5D7AA 5ANIA 4A4XA 2QOLA 4ASEA 2Z7LA 5CU3A 4NW6A 5IA3A 2XIXA 3AC8A 2XK9A 4GJ2A 3LHJA 5BYZA 5HLWA 3DXNA 5HVKA 4FTTA 5T6KA 2BUJA 3CQUA 1Q8ZA 1J3HA 2OW3A 5LVLA 4O7LA 3P4KA 2JKQA 4FT5A 3UZTA 2JD5A 3NYNA 4FNZA 3QAME 4MXZA 4FVRA 2Z7RA 4UYNA 5I9ZA 2IPXA 2ZAZA 2R3NA 4YZDA 3P78A 3LCKA 3LCOA 5E8ZA 2BZJA 4RLKA 4C61A 3GCPA 3QGYA 4FGRA 4E7WA 2J0IA 4ZTHA 3NCZA 4UXLA 5IUIA 5HORA 3L9MA 4BYIA 3A7IA 1G3NA 3QWKA 4RQKA 3VONA 2XNOA 3LMGA 4DLJA 2XK6A 3W32A 4FVQA 3ITZA 3AT3A 2UVYA 3CP9A 4L44A 4HGTA 4PPAA 3V01A 4B0GA 4BBFA 5AAEA 3F6XA 4JQ7A 3VJNA 4DFUA 5FM2A 2OGVA 1DS5A 2W17A 4O6EA 4Y5HA 5IDPA 2OI4X 2R3HA 4FG9A 1YDSE 4OTWA 3DKCA 3OWKA 4BI0A 3QTSA 4M12A 3W2SA 4PDOA 1ZOGA 3R7IA 2ETKA 3FMNA 5HZNA 2XYUA 4LL5A 4BKYA 4LGDA 2WU6A 3KULA 1PXPA 2WQMA 4TWNA 3L9NA 4WT6A 4E4XA 4K11A 4BZNA 5FTGA 5K0XA 4DE4A 4YGAA 3DJ6A 4XYFA 5C4LA 1M2QA 3Q04A 4HYSA 2J7TA 2EB3A 3G6HA 4LI5A 1OKZA 3U51A 3ZSIA 1XR1A 4BDAA 4C4FA 4O86A 3BE2A 2WO6A 1W82A 2XS0A 5C1QB 4R7IA 3UMXA 5I5ZA 4FNXA 1NA7A 2QCSA 3H9FA 4DEGA 4XBUA 3JXWA 5B2KA 3LKMA 4I41A 2CGUA 3DPKA 4K77A 4KKEA 1ST4A 4QPSA 1YXTA 1M52A 4YC6A 3QXOA 1WBSA 4PL3A 3ZO2A 3KCFA 2UW4A 2R5TA 3HDMA 2C6OA 5AR8A 2HW6A 3UNZA 2HYYA 3R71A 3PP1A 3TNIA 3VS3A 3QUPA 5DA3A 5LVOA 3ORZA 2CJMA 3FMLA 5CT0A 3Q4ZA 4F4PA 2G9XA 1SVEA 3HZTA 1BUHA 4G3CA 4FL1A 4G3EA 3WARA 3DAKA 5AAGA 4FV9A 3UE4A 1TQIA 2PVKA 4BCQA 2H96A 4WRSA 5J79A 5EM7A 3ZEWA 1RJBA 3IW6A 2WZJA 3DTCA 4K2RA 2J2IB 4U3YA 4GT3A 5AX9A 4BVUA 3KXHA 4G9RA 3RBWA 3L8SA 3MVLA 5K4JA 1FPUA 4XG8A 3VUDA 1J7IA 4PDYA 5B2LA 2WMAA 2IG7A 1M7QA 1PHKA 3LQ8A 3QFVA 4C8BA 4F6UA 3DGKA 3QQLA 2WEIA 4X3JA 4PMMA 3PJ3A 3DQXA 4RSSA 4CFFA 4RIYB 2HWOA 3ORKA 4W4XA 5E8XA 5AAFA 4EKKA 3KF7A 4ZTLA 4AZVA 2I40A 1W84A 4D0XA 4OTRA 4R3PA 5AV1A 3LQ3A 3AKJA 2BDJA 4U43A 5CEMA 5GJDA 3H0ZA 3VUGA 3E3BX 4CSVA 2Y0AA 2VWWA 4I6LA 4OBQA 2WNTA 5EQYA 1LEWA 2X8DA 2ITXA 2YCRA 3I0OA 3UOHA 3UYSA 1ND4A 4CV8A 2XNMA 4EOIA 2A0CX 4X2KA 3GENA 3W18A 3MY1A 3NFGB 4ZSLA 3LM5A 5FLFA 5HD4A 3OOGA 4AAYA 5EYDA 1PXKA 3A7FA 4FZAB 3SRVB 3LCTA 1G8JA 4PTEA 5CXZA 3QC4A 3KXXA 3QTUA 4XX9A 2WMRA 2X7GA 2QHMA 2GNLA 5LOHA 2XAMA 2R3KA 3ULZA 4D2SA 3BQRA 3CCNA 3KXNA 4BC6A 1UNGA 4L00A 2R3MA 4CKIA 3D5XA 3R8ZA 3NYXA 1V0BA 4FZFB 4RJ7A 5BVFA 3R63A 1FVVA 2VGOA 3P08A 4IQ6A 2WXVA 3AQVA 4ZJVA 3AD4A 3COHA 4GL9A 4LV5A 5E1EA 2VWZA 4U44A 3SXRA 4N6ZA 4GU9A 2WMWA 4S34A 2BRGA 2ITUA 5CSHA 2QO7A 3CXWA 4YPDA 5LVNA 5KKRB 1PYXA 3MA6A 4A7CA 4ANQA 3UDZA 2XF0A 2G15A 3R30A 5L2QA 4IX4A 3FMDA 3GU6A 4ONAA 2W9FB 3O71A 4JG6A 4GS6A 1PKDA 3OY3A 4RX5A 4BDCA 3D0EA 2PULA 1BX6A 2PVMA 3FLQA 5DMZA 4TNBA 4LMNA 4V01A 4KD1A 3W10A 3DK7A 3UVRA 4CVAA 3D7TA 3W8QA 5HE3A 4GV1A 4HVSA 3BKBA 3DK3A 3BPRA 4AE9A 2V22A 4QMUA 2R2PA 4FL3A 3ZUTA 4CV9A 3NS9A 5LCJA 2O0UA 5CWZA 5FTOA 2UW0A 4K33A 4JIAA 2X4FA 3LW0A 5DT4A 2J50A 4AFEA 2VO0A 2HIWA 4AW5A 2E9OA 3DOGA 3IPHA 3ZFMA 5C26A 3SVVA 2EXMA 2V62A 4UMUA 3NNWA 4WNOA 4R5SA 2XJ2A 3FYKX 5DT0A 5CENA 2X0PA 5CAQA 4KABA 3JPVA 1XHAA 2WMVA 2FSOX 4IADA 2YIRA 3PVGA 2C5NA 2W1CA 4G3DA 5FQDC 3F3ZA 4LUEA 4QP3A 3FPQA 3E8CA 3QD2B 5M07A 5M09A 1JPAA 5TF9A 3FMMA 4ZTNA 1KOAA 3NDMA 5AUZA 2XIRA 2ITTA 1JLUE 2WPAA 4YC3A 2REIA 3FI2A 4OTPA 4ZSJA 2O5KA 3TUDA 2XEYA 4HJOA 4GK2A 5E8UA 2IZSA 5CVGA 5A9UA 3HNGA 4JDJA 4O0VA 2QOIA 3HAMA 5FGKA 3MA3A 4BCFA 3EFLA 5HLPA 3TV7A 3ZM4A 2XKFA 3D2KA 2X9EA 2BZHB 4FKOA 3ZH8A 2RKUA 3E8EA 4GG5A 3SKCA 4KRDA 4HGEA 2I0EA 3NVKI 4RIWA 4TWCA 4C62A 5DEWA 4PNIA 4TYHB 4ZSGA 3RCJA 4CQGA 2GCDA 1OECA 2WD1A 3BX5A 1IRKA 3ZCLA 5BYYA 1URWA 5JFVA 2WTCA 3DB6A 1W8CA 3DBDA 4AACA 5B7VA 3G5DA 3PJ2A 2PZPA 1NVQA 1R0EA 3VBXA 4JL9A 3V5PA 4G31A 3E7VA 3PSDA 4H1MA 2QD9A 3NW7A 4IX3A 4QMMA 4V0GA 5KHWA 3QQUA 5L2SA 3KREA 3GU8A 4D2RA 3O7LD 1OITA 4CT1A 4BYJA 3AG9A 3I6UA 4FVPA 1P4FA 4PMSA 4AGDA 3I1AA 5TT7A 2W99B 3MIAA 2BKKA 2VX3A 4HYUA 5EI2A 4ZAUA 3WYXA 5L8LA 4HNFA 4DC2A 4FKSA 3NUAA 1SNXA 4RJ8A 5EHYA 3VVHA 4G34A 2XYNA 1XMLA 2HZ4A 5J5TA 1FBNA 3ZRLA 5FTQA 3O7LB 4FF8A 4YNOA 4QDEA 4YZNA 5HGIA 4RC4A 3U55A 2P2HA 5AM6A 5CVHA 3F2AA 5JFWA 3SOCA 2P2IA 4GW8A 3FMKA 4E8AA 3MFSA 3A2CA 5EKOA 4NKSA 3D5WA 2QU6A 4O4FA 1OPKA 4DFLA 4RA5A 3O23A 2H9VA 1WBOA 4U3ZA 4ZY6A 3GCQA 5DWRA 3FMJA 3MFUA 3OC1A 3PE1A 4XUFA 3LXNA 4V05A 3I5NA 3DAEA 4JVGA 4FX3A 5HOAA 1Y6BA 4QMOA 2BIYA 4MQ1A 1B39A 4F9BA 3VF8A 1VYWA 2YIWA 3BU5A 1IR3A 5CASA 1O9UA 2UZOA 3ANRA 5KBQA 5FBOA 4FYOA 1BYGA 1Y57A 3BYOA 4JI9A 2BHHA 5C8MA 5HBJA 2ONLC 3G15A 4C37A 1HOWA 2NPQA 2IJMA 2XA4A 5AUWA 4C57A 5AUUA 5AWMA 2FH9A 4FEUA 5A14A 3O96A 4TPTA 4X3FC 3JR1A 4F1MA 2YITA 4RGJA 3KXMA 4KB8A 5HCZA 5K5XA 1MUOA 1W0XC 2A19B 3RNIA 4IWDA 2OU7A 2FSTX 4M66A 4QP1A 3HV5A 3ENHA 2GNJA 4FICA 4NM3A 4QPAA 3OEZA 3E63A 4FTKA 1W2FA 3SA0A 4BHNA 3OZ6A 3VN9A 4UN0C 5D11A 5DRBA 5BPYA 3QTWA 4P4CA 4I6BA 1PXJA 3QYWA 4GJ3A 4OR5A 4EOMA 3Q6WA 5ANGA 4AZSA 5E8VA 3G0FA 4ZZMA 2IW6A 3ZO4A 5HU9A 4O7ZA 2XCHA 1YOLA 2ZJWA 1SM2A 1T45A 3BV2A 5EH0A 4QD6A 4CFMA 4AUAA 4G5JA 1KV2A 1BI8A 2YACA 2WQOA 4CLIA 2GS7A 3DBQA 4TKSA 1Y8YA 4RWJA 3MB7A 5EDQA 3QALE 3AGMA 2B9HA 3WF9A 2QODA 5TO8A 2HAKA 2YAAA 4ZTSA 2XIKA 2IZRA 4LRKA 4ITHA 5DH3A 4CG8A 4PL5A 4XEYA 3K3IA 2WQBA 3PG3A 4L42A 1REKA 5CEPA 2FUMA 2IVVA 3FMHA 3Q60A 4F6WA 3U6HA 1J7UA 4YJPA 4EUTA 1YVJA 2WU7A 2PMOX 3G2FA 3KQ7A 3ZRMA 4IACA 2CPKE 3GNIB 3P0MA 5AIRA 2I0VA 2IZUA 2Z60A 3F7ZA 4R5YA 2B0QA 4NK9A 2YIYA 1CKPA 3ENMA 4I23A 4YJVA 4DGLC 3PXRA 2V5QA 2C5OA 3HUCA 4ZS0A 3HRBA 4S30A 4HVDA 4DHFA 3KVXA 4BWKA 2JAVA 2C0IA 3E7OA 2JAMA 3KULB 1B6CB 3D83A 1A06A 1OIQA 3AC3A 2ZDUA 5AV3A 3GC8A 3ATSA 2AEGA 1OUKA 3UTOA 4KNBA 5EHLA 2ZMCA 3LJ2A 1CKJA 1OPLA 4D1ZA 4B9DA 5HG8A 4U5JA 5JMSA 4F7NA 2DS1A 3PRFA 3SXSA 5D10A 5CI7A 4O0RA 2NNWB 3R22A 3ZONA 5T68A 2DYLA 4G6OA 5A4CA 5H9BA 2JDSA 3V5LA 4FTAA 4LRJA 5HESA 3NCGA 1KOBA 4FIGA 4XV1A 3WBLA 4BJJA 2UZBA 3R9NA 3RJCA 3CPCA 2PSQA 4JXFA 3REPA 4FSNA 3A61A 1IAHA 2W4JA 4IZ5A 5E92A 5TR6A 4FTMA 3N51A 4CFWA 5G6VA 5LARA 3FKOA 4C4IA 4ZSAA 1KUTA 4WBBB 4BGHA 4EH9A 5E4HA 4NH1A 5C01A 3GFEA 4JBVA 1VYZA 2BPMA 3DU8A 3Q9XA 3HDNA 4ZLYA 3IECA 3VQHA 2EVAA 2UZWE 3DS6A 2BFXA 4RRVA 5FBNC 5DR9A 5DI1A 3R9DA 2W5BA 3IOKA 3GU5A 4RPVA 3F5PA 4CKRA 5EHOA 4QMYA 3ZSHA 4QYHA 3BCEA 3VC4A 2X6DA 5CQUA 2X2KA 4ZJIA 4FKIA 3UIUA 4JR3A 1FMKA 2BFYA 3PY1A 4G1WA 1YOMA 4LV7A 4QQJA 1H08A 4FKGA 2IW9A 4GYIA 1W2DA 3TZ8A 4JRNA 3PLAE 4O4CA 5LVPA 4ZMEA 5HG7A 4C34A 1L3RE 2BRHA 4YJSA 3PSBA 2QLQA 3GB2A 3EMGA 3AKLA 1JKSA 3EQBA 4XOYA 2XRWA 3IW4A 4USDA 1XO2B 1Q61A 2OZAB 4ID7A 4QPMA 3NSZA 4YBJA 4EC9A 3TMOA 5HE1A 2YCFA 4A9TA 3R2YA 4TW9A 3FSFA 3GXLA 3CTQA 4PPCA 4FEVA 1CM8A 3B8RA 4MXAA 3KN6A 5AR3A 2NRYA 4DCEA 2O8YA 3L8XA 4U7ZA 4E6QA 2YDKA 4NSTA 4QMZA 1KWPA 1R1WA 4FNWA 3HKOA 1OIUA 4O1OA 4KIPA 4RG0A 5F94A 2VU3A 1RE8A 4DFBA 3OBJA 3QWJA 4W8DA 5AUVA 3GU7A 4NEUA 1HCKA 3CE3A 4ALWA 5IQIA 3UDSA 1YHVA 3PXYA 1OL2A 3RM6A 2RSVA 1AGWA 1GY3A 3UC4A 4UMRA 2VTNA 5HX8A 1TZDA 1UU7A 5AUTA 5KMNA 2BHEA 3MY0A 1UA2A 4BWPA 3ZOSA 4ALUA 4DEHA 4GKHA 3RZBA 3EZVA 3R21A 3ZZEA 2CHLA 5IEXA 3F66A 4DFXE 1J1BA 3RPSA 4XG3A 2FB8A 3CEKA 4P5ZA 3QX4A 5H8GA 4UMPA 3S0OA 1YOJA 3BV3A 3NIZA 3PVBA 3BYSA 3ORPA 5AX3A 3GC0A 2PVYA 2B54A 2B7AA 2PUNA 4F1OA 3DLSA 4UY9A 5IA4A 5FDXA 3WZDA 3UGCA 2C4GA 3AGLA 3U8WA 3OCGA 2QU5A 2RGPA 4R7HA 4YLLA 3PWYA 4XG4A 5EYCA 1ZMWA 1SZMA 3D7TB 3HX4A 3OT8A 3WI6A 3M42A 3FAAA 4APPA 5GHVA 5KMLA 1VLRA 2J90A 2VTLA 4IDTA 3KA0A 3FLYA 3AXWA 5DPVA 3H30A 2F7ZE 5KMJA 4CEGA 1OL6A 3UQCA 5E8WA 4UWYA 4QP7A 3HMNA 4O0SA 3PUFC 1G5SA 2YDJA 3QZFA 3Q2JA 3BI6A 4AZTA 2J5EA 5IKWA 1YI6A 2XEZA 3KCKA 5HO7A 4OW8A 5D1JA 3EYHA 2PVNA 1H25A 4MK0A 3KGAA 1UV5A 4JNWA 4NWMA 5D12A 2LAVA 4EQMA 4G6NA 3I7BA 4I22A 5J95A 4AZFA 3EWHA 4YZBA 4F0IA 4N57A 4R7BA 5CEOA 1PXOA 2YABA 4K8AA 4D9TA 3NEWA 2R4BA 2X8IA 3ZO1A 5IH6A 2QURA 4E73A 1MRVA 3QZIA 4YSJA 4YSMA 2F2CB 4J99A 2CN8A 1ZAOA 2XP2A 1TQMA 5IA2A 4KUJA 3LJ0A 3TZMA 2OZOA 2VTJA 3DZOA 5TKDA 5CLPA 4JG8A 3DTWA 4GRBA 4IVAA 3GT8A 2KTYA 5LMKC 5EDPA 2XANA 4FEQA 3DFAA 5ACBC 4O6LA 2GPHA 3OG7A 2GSFA 4C3PA 2BALA 4QYEA 3MBLA 5M44A 4NFNA 2B9JA 3UOKA 4BDHA 1CSNA 3RAHA 1ERKA 3NAXA 3FZSA 4GH2A 3FQEA 3GFWA 3KK8A 3E62A 3IO7A 4F1TA 3UVPA 2PY3A 3O0GA 4WRGA 4CT2A 2YWVA 2XARA 3FY0A 3IW5A 4RIWB 3D5UA 3F88A 4GIIA 2JKOA 3PIZA 3OWLA 5ANKA 4OT5A 2XH5A 2P55A 3FZPA 4FUYA 2IW8A 4TT7A 5C8KA 3MY5A 1GJOA 1J91A 4CRSA 3A7GA 3P79A 4CYIA 4KIKB 3LIJA 3RVGA 3LFCA 3WF5A 1PXLA 2UW8A 4V0GB 5HCYA 3RI1A 3BWFA 3F9NA 4R78A 1G8AA 4JX3A 1YQJA 4AU8A 1B38A 1MQ4A 3P23A 1VZOA 2X39A 3LZBA 4EBVA 2Z02A 4RFYA 3II5A 3ANQA 3TV4A 4WG4A 3VS0A 3OTVA 2QG5A 4BIBA 4CG9A 4QYYA 5I0BA 5CEIA 3W0OA 3V5WA 5J9ZA 1SVHA 2GS6A 2A27A 3D2IA 4O0TA 4UBAA 2C3IB 4AOJA 5KNJA 2C1AA 3M1SA 3DNDA 3CR0A 4TRLA 3PDTA 4I0SA 4EWQA 3DBEA 3OUKA 4G2FA 3PIYA 4JS8A 4TYIA 2FYSA 1Y8GA 2PVJA 3C0HA 3DY7A 3I81A 3Q96A 2JGZA 3Q2MA 3VNTA 4EOQA 5JK3A 4I92A 3O17A 2P3GX 4DG3E 3O5AA 5AV0A 5JN2A 4A07A 3Q4UA 4MF1A 4I94A 4IAKA 3SXFA 4ACMA 1OL7A 1VJYA 4RX9A 3IGOA 5LXMA 5M4FA 3VJOA 3RM7A 3CC6A 2PWLA 3SG9A 3Q9YA 3PUPA 2JFMA 4IAZA 3QCQA 3TZ7A 5BYLA 3C4FA 4ARKA 4OTHA 3OF0A 1ZYLA 5HVYA 4OAVB 1WVYA 2BAJA 4PMPA 2GHLA 3KKVA 4L3JA 4WG3A 3Q9WA 4QT1A 4AGCA 1Y91A 2FA2A 4M7IA 4QEBA 4L43A 3GQIA 2A98A 4IAFA 3ATTA 1UNHA 3IG7A 4BHZA 5L2WA 3C5IA 2O3PA 5HTIA 4RJ6A 4AXDA 5KMKA 4AQKA 3OCTA 5EDRA 4EH2A 2PZ5A 3EN5A 2RFEA 4CMUA 5I9WA 3FI4A 3ACKA 3I6WA 2WELA 3FZOA 4MD8E 4O0XA 4XP0A 4HVHA 4Q2AA 1CKIA 2GHGA 4AWIA 5DN3A 2GTNA 4O91A 1I09A 4TN6A 2QC6A 3BLHA 4QQ5A 1XH8A 2AC5A 3F5UA 3QRIA 5CF6A 3DJ5A 4EKLA 2J51A 5BUEA 2WAJA 4ACHA 1YKRA 2I1MA 3LJ1A 3QHRA 3V8WA 5JKGA 4LV8A 2EU9A 3BYVA 4DEBA 2X7OA 4FA2A 4HZRA 5CSPA 4XP2A 4FG7A 4F65A 3L9PA 4E5BA 2C0OA 3F7WA 3BWJA 3I4BA 3P86A 4U40A 4IB1A 3ZUVA 1OVEA 4O27B 3T9IA 3NRMA 4F0FA 4XG9A 5IQAA 4D28A 3LFQA 1ZOHA 2O2UA 4PX6A 3W1FA 5J9LA 5E7RA 4PP7A 4C38A 5HIBA 3LQ5A 4X2JA 5M4IA 4XS2A 2C6MA 1XQZA 4KSPA 3R00A 5LJJA 4BF2A 3CIKA 3W8LA 4EYJA 4CTCA 4H58A 3ML1A 2JIVA 3VBVA 4ASZA 2O63A 3DJ7A 3Q5ZA 5FEQA 3DXPA 4PNKA 1XJDA 2FSMX 3SQQA 2G2FA 4YHJA 4D5KA 3TUCA 2BDFA 2XM9A 1Q8TA 3DKOA 3DBFA 1Z57A 3ELJA 3P9JA 2W1GA 4KINA 4MBLA 5EG3A 1XH7A 3R8PA 3QGWA 4AN9A 4BCHA 4BTJA 4JDIA 3EQHA 3QQGA 4YU2A 4JBQA 3C5UA 3SC1A 2PMLX 3NPCA 4U0IA 2B9FA 3OEFX 4QDVA 3W0RA 3UOLA 5I9UA 4FV1A 5AV2A 2OKRA 2W5HA 5AUXA 3D15A 2ZM1A 3C0IA 3MV5A 3WZEA 4E1ZA 2CKOA 2CNUA 2YZAA 3OCSA 2YZLA 3LM0A 3QYZA 3UZPA 1YWVA 4YLJA 5JFSA 4FIFA 5HICA 4Z16A 3BBWA 4HGSA 4ZOGA 3TG1A 3VUHA 3IS5A 3TV6A 5CS6A 1G8KA 4MBJA 5CSXA 3MIYA 4RT7A 4EWHA 4FC0A 2O64A 3FI3A 3VO3A 4CFNA 3NVMB 1LUFA 3KIOC 5HKMA 5C03A 2R3LA 2VV9A 1LPUA 2XB7A 4MCVA 1ZMUA 4BCPA 4FV4A 3BHVA 3OW4A 4PUZA 3FKNA 2C5YA 2UW6A 3LFNA 3TEIA 4L01A 4E5WA 2I0YA 2J0LA 2Z7SA 1KSWA 1AD5A 2GS2A 2W4KA 2VN9A 4O96A 3LVPA 4F9YA 2ITZA 2OIBA 2UZTA 5CY3A 4Y85A 1E1VA 2DUVA 2XZSA 4D55A 4H3PA 4CZTA 3HGKA 3H10A 4WUNA 4R3CA 3ORNA 4O7RA 4RJ5A 2G2IA 4UMTA 4YJUA 5CAPA 3FV8A 3I60A 3LAUA 4O21A 4TZRA 4EI4A 3BEAA 1SYKA 2BKZA 2CGWA 2JKMA 4GK4A 1PY5A 4YR8A