4NZWB

Crystal structure of stk25-mo25 complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
282
structure length
266
Chain Sequence
HSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLAAFGVAGTPFWMAPEVIKQYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase activator/transferase
molecule keywords Calcium-binding protein 39
publication title Structural insights into regulatory mechanisms of MO25-mediated kinase activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 266
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nzwB02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nzwB01
3VHKA 4NM5A 4X2NA 2NRYA 3G6HA 2F57A 3H4JA 2CN5A 5DNRA 3TTJA 4RJ3A 3UP7A 5IPJA 4ACMA 3PJ2A 4E93A 2JKKA 4DG2E 3GGFA 4AT3A 2I0YA 1QL6A 3FE3A 3KMMA 4GH2A 4BICA 4D9TA 4EWQA 2B7AA 3LFFA 4D2VA 2OGVA 3A4PA 2YWPA 5KMIA 1W82A 2WMQA 3QWKA 4U6RA 4EK4A 5L2WA 3LFDA 3QUDA 3O71A 4FSYA 5M56A 3FPQA 4X3FB 3GCVA 3QCXA 2UW8A 1E1VA 4FYNA 3UC4A 4E5AX 3KREA 2HZ4A 4NTTA 4IFGA 3QZHA 2VUWA 1ZMVA 3QTXA 2B52A 3GFEA 4KIKB 2J5EA 1DAYA 2OLCA 2BAJA 3SXRA 4N0SA 3BKBA 2YAAA 1OM1A 3GVUA 2V62A 4ARKA 3FMJA 3P86A 3R22A 3NIEA 4FVPA 4W9XA 4L53A 3UP2A 3AG9A 2ZB0A 3SW7A 3RPRA 4FSMA 4EONA 4FT5A 4HW7A 2QOQA 4JBVA 3NR9A 4CTCA 4M84A 3ZEPA 2C5VA 4BDFA 2W7XA 4HVIA 5DT0A 4TWCA 2C5OA 4CYJA 2X39A 3EQHA 5CU2A 4FNWA 5DE2A 2ITOA 3PIZA 4YJTA 2QOHA 1WBWA 1PXIA 3MFTA 2HZ0A 3HLLA 3N9XA 5HBJA 3D4QA 5HTCA 4YLJA 4G3FA 1F0QA 4D58A 4BKYA 2PULA 5FXSA 3V6SA 5HE2A 4L3LA 2WTCA 1O6KA 4FTOA 2W1GA 2JGZA 2QOKA 2VTMA 3M2WA 3TNIA 4IAYA 1X8BA 1WBSA 3FMKA 3ALNA 4E3CA 1FVVA 4C35A 2QG7A 4OTRA 3ORZA 5M4IA 4YSJA 1M52A 4GW8A 1JVPP 3ZU7A 5J7HA 3QQUA 1PF8A 2WMWA 1VZOA 4TW9A 5G6VA 1OUKA 3VRYA 1H4LA 3FSFA 4TNBA 3UNJA 4O0RA 4U9AA 1BX6A 5ICPA 3EFJA 3PRFA 3UODA 3QRKA 4MNEA 4RQVA 3PSBA 3QLGA 3QKMA 3R2YA 2PMOX 4IVDA 4J52A 1PXKA 3FZ1A 3G6GA 5HVJA 3QRTA 3RHXA 1FINA 3P78A 4JDHA 5CNNA 4CXAA 3W2QA 4M67A 4BI0A 3PY0A 4CFVA 4EH2A 3QCQA 3VBTA 4C37A 4Z16A 4K33A 5B0XA 3AMAA 3V01A 1U5RA 3AC8A 3FZTA 3LHJA 4BVUA 3RKBA 3UPZA 5FG8A 5HIEA 2V22A 2ZV9A 3F5UA 3K5UA 3LFQA 4RVKA 5A14A 3GU6A 1FPUA 1JSTA 1OIYA 2RIOA 3BHHA 3W8LA 2BFXA 4TTHB 2XNOA 1STCE 5TKDA 4IX3A 1U5QA 3B8QA 1CTPE 3ORNA 4G9RA 4IM0A 5C01A 3R8PA 3QQLA 3TEIA 4JG7A 1VJYA 5GZ8A 5AA8A 2XNMA 2BIYA 2XCKA 4XV9A 3BX5A 4I4EA 3ZSHA 4OBPA 5C03A 1OL2A 3KXHA 3JPVA 1KV1A 2VTIA 4DITA 4CV9A 5DH3A 2VWVA 4AS0A 4FV1A 4OT5A 4W4YA 3HDNA 4AW0A 2O5KA 4XV1A 2XKFA 3WYXA 4UV0A 3DQXA 2RF9A 2X81A 4B6LA 5M57A 3C0HA 5HNGA 2QC6A 4C61A 3F3WA 4RVLA 5IEXA 2Z02A 4O0SA 2WQEA 5HZNA 2BKKA 1H1RA 1I09A 2J0JA 3OXZA 1M2PA 1BMKA 2F2UA 2OBJA 4FL2A 4HPTE 3ULIA 4BKJA 2XKEA 5AUTA 5KUPA 4XP2A 3KRJA 4ZP5A 2JDSA 2WTVA 2XEZA 1ZYSA 3QX2A 5HQ0A 5EM7A 3LM0A 3QQKA 3M42A 1AQ1A 4L9IA 4AA0A 2W1EA 3LE6A 3QTZA 4RRVA 2CLXA 3N4UA 4BWKA 2AC3A 3OG7A 4XRLA 3O7LD 4HYHA 3S00A 5BMMA 2VWUA 1Y57A 3FZRA 3AT2A 4FMQA 4HCUA 4H58A 3S2PA 2B9JA 4O0UA 5A4LA 3DBDA 4LRKA 1KOBA 2J50A 2R3IA 3KRRA 4BGQA 4EOQA 2WKMA 3I6WA 2GQGA 5CI7A 4RJ5A 4KSPA 2CCIA 2C1BA 3FZSA 4K0YA 3HV3A 3UG2A 5IA3A 2RSVA 5EW8A 2VTPA 4I5CA 1UKIA 2YLEA 4X2FA 3TJCA 5H2UA 5KBQA 2ITYA 3FI2A 4NKSA 2J0IA 3ZO2A 4PF4A 3WILA 5IQAA 1NVSA 2GU8A 2BPMA 3BZ3A 3C50A 4AOTA 4HCTA 3A61A 2Z2WA 2BKZA 2W9FB 3B2WA 3MB6A 4GMYA 5D11A 5EI6A 3BEGA 5HNBA 4D0XA 2KTYA 4QP2A 3R30A 5C1QB 3U9NA 2B53A 5IQHA 2NP8A 2XK4A 4G34A 3ID6C 4ZTLA 3CGOA 3L8VA 1FGIA 2QR8A 3H9RA 4OGRA 4PPCA 4PRJA 3GBZA 5CS6A 5FWKK 2XJ1A 2RL5A 3TI1A 1GZKA 4U44A 5HI2A 1VEBA 3KRWA 1LP4A 2Y4IC 1REJA 4MXCA 4C2WA 3NYXA 3MFUA 2XNEA 4GV1A 2JIIA 4XNEA 3V5WA 2V7AA 1IA9A 1ZOGA 4TT7A 3SRVA 1OBGA 4L01A 3VIDA 3R9NA 2XUUA 3FUPA 3NW7A 3QYZA 4MNEB 4QMXA 3Q9XA 3Q9ZA 4IZ7A 4MF0A 4D4VA 2CNUA 2C5NA 3KK8A 3PYYA 1KE5A 4FSQA 4M12A 1YVJA 3PXZA 3KK9A 5FGKA 1H27A 1LEZA 2VTRA 4XLIA 3UYTA 3W10A 4O86A 3BBTB 3GT8A 3O2MA 3BLHA 1ZOHA 2CMWA 3R1QA 4BCQA 2ONLC 4QQJA 1R0EA 1BUHA 1OKWA 1FOTA 2VN9A 3KXNA 4RIYA 3VNTA 2ZV8A 4PMTA 4HVSA 1B38A 4TYHA 2QONA 3DXPA 3U55A 4FTJA 3CD8A 5J9ZA 4NW5A 3ZO1A 3DT1A 5CEOA 3OY3A 3OTUA 5HVKA 2R3RA 2QO9A 2YEXA 3I0OA 2PVFA 5CF5A 5I9XA 2QU5A 3ZTXA 1XH5A 4F09A 1G8SA 2Y4IB 5J79A 3KRLA 5AV4A 2REIA 4OTWA 2RFNA 5BNJA 4I3ZA 2J9MA 4AZFA 1Z9XA 3JUHA 4K1BA 3TCPA 3UIMA 1W7HA 3ZRLA 3C4CA 1UU8A 3AQVA 5A4CA 5CF8A 3R04A 3C0IA 4BCHA 2FYSA 4CKRA 3B8RA 4O7WA 3GQLA 5E8UA 2UVZA 2WO6A 4F0FA 5JZNA 4Z7GA 4ZLYA 2ITQA 3QTIA 2PVHA 4OTQA 5HEZA 1PXNA 3FLSA 4MWHA 3R73A 4EHZA 3EQIA 2VD5A 3HAMA 5M53A 1P2AA 4ITJA 4K18A 2I0HA 3RAHA 3BE9A 5B2KA 3RK5A 4U3ZA 5M4UA 4R3CA 4ASZA 2IW8A 2Y8OA 2OXXA 5T6KA 3NUPA 4FI1A 4BTFA 4NM7A 3BU6A 3IK3A 2C1AA 5FM3A 4Y8DA 1GOLA 3BEAA 4IADA 3RJCA 2E9UA 5L8KA 1OIQA 4JBOA 3R9HA 1VR2A 3KVXA 3Q4CA 3MH1A 4TKSA 3DFAA 3EZVA 1V0OA 5LQFA 1YKRA 4GT3A 2VO7A 5AUWA 1OL6A 3KCKA 4AWIA 2ETRA 4WNPA 2BRNA 3MPAA 3JVRA 3RNIA 4F9BA 4UB7A 1TQPA 3CPBA 4BCFA 5JFXA 3NWWA 3OEZA 3R7YA 4N4SA 2Z8CA 2XK9A 5JFSA 3BU3A 1GJOA 4RGJA 4RZVA 4NZWB 2VWBA 5TT7A 3RZFA 3M1SA 3LZBA 2O0UA 5DVRA 5IQEA 2ZVAA 4NW6A 4CG9A 5BPYA 4DF3A 1YWNA 2C69A 2JDVA 3BV2A 3NAYA 5HU9A 4G2FA 4P2KA 5HE1A 3FLZA 4A9SA 2XNBA 1WMKA 2BCJA 4AOJA 1M2QA 3R02A 3OEFX 5J1WA 1JLUE 4EOPA 3ODYX 4CG8A 3P1AA 2XIXA 4S31A 3AOXA 4OR5A 2W1CA 4C8BA 2WIPA 1ZLTA 2JFMA 2XEYA 3D9VA 3L8XA 3PXFA 3DLZA 4FOCA 4K11A 5DG5A 1GAGA 3BHVA 2CKQA 3WF9A 5HTBA 4MD7E 4E6AA 4PDPA 5IH6A 5HLWA 3SRVB 2NO3A 2RKUA 3UO5A 2GNGA 1Q99A 5CX9A 5D41A 5CWZA 3A7GA 2OSCA 3I4BA 4AP7A 4FSZA 2I7QA 4AFEA 3NPCA 4B99A 4OTGA 3FI3A 5B2MA 4FKSA 1GZOA 3E7OA 4EOSA 4M97A 1H24A 5AP4A 5L6WL 2V0DA 3O17A 3QQFA 2X8IA 4ZJIA 2HIWA 2VTJA 4IWPA 4EKLA 4DCEA 1Q5KA 1R3CA 4DH3A 1UNGA 3PP1A 4PUZA 4RIYB 4C4FA 1MRYA 4DFUA 3RCDA 3LMGA 2J5FA 4FUXA 5LMKA 4WD5A 2H96A 1FQ1B 4IACA 1W83A 4BL1A 3OWKA 4C4JA 3HEGA 4X0MA 1MRUA 5I3RA 3I5ZA 1NW1A 4DE4A 4KNBA 3TJDA 3PG3A 5AP6A 3NUNA 1SNXA 1R0PA 3CJGA 4AGCA 1IG1A 4WG3A 4YPSA 3QTRA 4AN2A 1PMUA 3ZH8A 4B9DA 4BDGA 4F6SA 4RFYA 3LCDA 3UG1A 3NZ0A 4PMSA 3UVPA 2GS6A 2PE2A 1XBAA 2O8YA 3JXWA 3KVWA 3KULA 2E9NA 2XIYA 4E5WA 3QRJA 3QCYA 3RWPA 2YCRA 4DEHA 3PPKA 4IX5A 5AR5A 2PUNA 2PMLX 4YTFA 2HELA 2CHLA 2UV2A 5FTOA 3HZTA 3G90X 2PY3A 4PY1A 1S9IA 2R3NA 4NT4A 3VS5A 4C3PA 2ZDUA 2UW9A 5CU3A 2BRHA 4EH4A 3FV8A 1TQMA 3D7ZA 3I7BA 4GL9A 4F4PA 5KMOA 1H00A 2UW7A 3HV5A 3PP0A 4JDJA 3DB8A 5KMKA 3BLQA 2VX1A 3CTJA 4BRXA 5E8YA 4QMPA 2WU7A 5BQ0A 3GI3A 4EH7A 3MI9A 2FSMX 4N70A 4TZRA 5EI8A 2PUPA 4MXZA 3UPXA 4GT5A 3IW6A 2JIUA 5AUUA 3GU4A 5I3OA 2W05A 4NTSA 4BHZA 5HLPA 1ZYJA 4ENXA 4L45A 4FSUA 3A62A 1JOWB 4EQMA 4JDKA 1A48A 2WEIA 3A7IA 3ZSIA 4DEIA 4IM3A 3ODZX 3NUYA 4D4SA 5I4NA 1OI9A 2Y6MA 2QURA 3DNEA 4YR8A 3UNKA 4J1RA 4HYUA 2R0IA 1XO2B 2ZMDA 2OXDA 2PHKA 3FQEA 3DOGA 2G15A 3QA0A 3R83A 4NUSA 3MY1A 2C6TA 3UIBA 2SRCA 1OL7A 5M44A 4FKGA 4EHVA 2BZJA 3W8QA 4IX4A 5HORA 1YXSA 4AZWA 5EDQA 5CALA 1URCA 5B7VA 3H3CA 5KMLA 4D0WA 3TM0A 3UTOA 2WELA 3GOPA 4CEGA 5A6NA 3OT3A 4IJPA 4JLCA 3WIGA 1AD5A 2BFYA 3MY5A 4NFMA 3RPVA 4KRDA 3UOHA 4CTBA 4EZ3A 4WRSA 3P08A 4YTIA 5J9LA 2QVSE 3HECA 4FKUA 4BB4A 4RWLA 4D55A 4QMQA 1BKXA 3ZEWA 2CLQA 3HNGA 2HK5A 2YCFA 3MY0A 4M0YA 1SMHA 3N51A 2WTKC 1HOWA 4I5HA 5LJJA 2BZIB 3ITZA 4YJNA 5AP3A 3VUKA 5CEPA 3UOJA 3SD0A 3AGLA 3IO7A 3DK6A 4UMQA 4I6FA 4EOOA 3GC7A 3G9NA 3GCPA 3CQWA 1H1PA 2J6MA 3I81A 3IGOA 5LOHA 2XF0A 3JY0A 4FSNA 3LIJA 1Q62A 4BWXA 4IDTA 4KKGA 1PYXA 2UW0A 3NUXA 3OF0A 3HVCA 2YIRA 4I0RA 5CVFA 4ENYA 2C0IA 3E5AA 4LMUA 3ZXZA 1Z57A 5IZFA 2OJGA 3D0EA 4LI5A 2OFVA 4O82A 2VX0A 4G9CA 5HBHA 4AU8A 3D7TA 5LVOA 4JG8A 2YZLA 5IISA 1QPCA 1ZRZA 2XK8A 5J87A 5B2LA 5L8LA 3NW6A 3KEXA 5JZJA 4NKAA 3V8WA 4IW0A 3ZZEA 4GKHA 3DCVA 3DGKA 4KS7A 5ACKA 3ANQA 3BGQA 3G2FA 3F66A 1JNKA 4GIIA 5EYMA 5HD7A 4ZY6A 4CT2A 1YDRE 3QUEA 3HRCA 4DCAA 2R3MA 4MNFA 3KULB 3QXPA 1Y6BA 5GJGA 3TN8A 3QL8A 4FK3A 4DT8A 4EK6A 2WTKB 1XWSA 2DYLA 3E93A 2CDZA 4GK4A 4JX3A 4D2WA 5HOAA 4CFNA 2GS2A 3QRUA 3TV6A 4M13A 4EH5A 4IAIA 4OUCA 4W4XA 3FMLA 4JI9A 5DFPA 3BLRA 3ORMA 4LV8A 1QPJA 3CLYA 3EKNA 5LWMA 5F94A 1R78A 2Y4PA 2BALA 1OGUA 3BYVA 4GUEA 4KBCA 2C68A 5M09A 3ZMMA 3BELA 4NSTA 1OIUA 5JT2A 2W4OA 4MBLA 4C0TA 4HZSA 2I0EA 2YM8A 4F08A 4DLJA 3L9PA 3N4TA 4LL0A 4XG7A 4RJ8A 3VQHA 5M4CA 4K9YA 5AX3A 1YOLA 2R7IA 3IW7A 3LQ8A 2QODA 2CNQA 1PMVA 1P4FA 2UVXA 4QMZA 2XS0A 4WG4A 4D2RA 3LXKA 5CEIA 3E8CA 1ERKA 4O6LA 5I9UA 3AT3A 3G51A 3ERKA 3MH3A 2BROA 3OUNB 4NCTA 3OVVA 4R7BA 5L2TA 4O0WA 3CGFA 5AIKA 5KMMA 3K54A 5LVNA 2J51A 5AR3A 3Q5IA 3FYKX 3Q4ZA 5M4FA 3SOCA 2R3PA 5CVHA 5JK3A 2WOUA 3HDMA 4U7ZA 4CT1A 1UU9A 2UZUE 5K4IA 2A0CX 2A2AA 4FEVA 4MQ1A 2WMBA 4MTAA 1DAWA 4C36A 4I5PA 3IOPA 3ATTA 4MWIA 2I40A 1IASA 4G17A 4YBJA 3W1FA 4WKQA 3Q5ZA 5AAFA 4XJ0A 3TZ7A 4DFZE 1PXMA 2J0LA 4FV5A 2X9FA 4FV3A 3NNUA 2F7XE 2VO3A 4IB0A 2EB3A 3NX8A 2X8EA 4ORKA 3H0ZA 2WQNA 1OKYA 2ESMA 3LLAA 3Q9WA 2W5AA 2C5XA 4EH9A 4H36A 4P4CA 5FEQA 3SQQA 5DYJA 4DTKA 3ENHA 2IW9A 4OTHA 4E20A 2DQ7X 2Z7SA 5EM6A 4ERKA 5M08A 3HX4A 4F70A 2GNHA 1R1WA 4A9TA 4IAFA 5BYYA 3VW6A 4F1TA 3RNYA 3ZC6A 1YHSA 3FLWA 2C6OA 4DH5A 2OZOA 5CSVA 4MEDA 4OT6A 5I0BA 5JQ5A 1YI4A 4QPSA 4OBQA 5CSHA 3JR1A 1Q8TA 4FZAB 3VAPA 1XBCA 3EZRA 3R8VA 4XHKB 5DR9A 3D7TB 2W1ZA 4ZY4A 5HO6A 3RK7A 4BN1A 2H8HA 2VWZA 4XUFA 1LUFA 4XS2A 4U45A 5DRBA 3RPOA 4D28A 1Y6AA 4Q5HA 3L8PA 5KHXA 5HO8A 3R7IA 4Y95A 2Y9QA 4C59A 3U6JA 2PU8A 5E1EA 2VNYA 2R7BA 3DZQA 5AV2A 4BCIA 5AJQA 4F0GA 1SNUA 2BILB 2WMTA 4FTRA 4DGNA 4QMNA 3G9LX 1DM2A 3GCUA 4ANQA 5HX6A 2YERA 2ZOQA 4LMNA 5L3AA 5BVKA 3DXNA 4EOMA 2XP2A 4FEQA 4GG7A 2C6KA 1R39A 3GU8A 5DOSA 3OW4A 3OW3A 5AP2A 3WZUA 2EXCX 3COMA 1NY3A 2X7GA 2GNFA 3HMOA 5CSWA 3MDYA 3FQHA 4ZY5A 3DK7A 1W98A 4TNDA 3BGPA 5EHOA 4MBJA 5F20A 4Z7HA 3FYJX 4ERWA 3U6HA 1H0WA 3LMHA 2X2MA 4CCUA 2BDJA 2OXYA 1XH8A 4DG0E 4QOXA 2R9SA 4QQTA 4BDBA 1WBVA 1ZYDA 4H05A 3SA0A 4JOAA 4O7ZA 3Q6UA 4FIGA 4QTAA 5EM5A 4Z55A 2R3LA 4BDKA 1YI3A 4R3PA 3GEQA 4FSWA 2QKWB 1WCCA 3R8LA 3BWFA 4AX8A 3Q60A 5CAVA 5IQBA 2WTJA 3F2AA 3SG9A 3FHRA 5TE0A 3TG1A 5EYKA 2C5YA 4IC8A 2R3OA 3QZFA 3MS9A 4XG2A 5DR2A 2A4LA 3P7CA 3QHRA 1LEWA 3QA8A 3W55A 2E9PA 3BCEA 4JBQA 1OVEA 4Y46A 3W33A 4F9AA 2XJ2A 4IFCA 4TWOA 3KQ7A 2ITNA 3II5A 2VU3A 5E8XA 4R1VA 3FXZA 3CCNA 4YJVA 5EDRA 3TV7A 2UVYA 4DGOA 4RLKA 5AP1A 4PDOA 4E6QA 3NYNA 4BY9E 4YNOA 5EW9A 4QYFA 1OUYA 4FKQA 5FUTA 2GMXA 3EFWA 4JDIA 3VO3A 2HW6A 4AT5A 1JKSA 5AFVA 4YZMA 4QMYA 3SVVA 2PMIA 5JGBA 4B7TA 1SVGA 2FSOX 3JS2A 4GK3A 4L6QA 3V8SA 3ZLYA 4Q9ZA 4FTQA 1J7IA 3GOKA 3OTVA 4QP9A 3NVMB 3RM6A 3EN5A 3KXMA 1V0PA 2WPAA 4WNOA 2E2BA 4TYGA 2HWPA 1URWA 3BHTA 1ZWSA 2YISA 3VJOA 4CRLA 3UYSA 3FMHA 1P14A 2FUMA 5IH4A 2YZAA 4ZSAA 3PVWA 5HKMA 4V01A 1H8FA 1W8CA 2AC5A 1ZXEA 3VBXA 4FV7A 4C58A 3MB7A 2Y6OA 2WMXA 4HPUE 3NNXA 2W06A 3H0YA 2P4IA 3HMMA 3H9FA 2DWBA 3HA6A 3D83A 4BDHA 3DY7A 1G5SA 5J8IA 4C2VA 2F4JA 5HD4A 2BAKA 4CFFA 2OZAA 3PPJA 4NU1A 3COKA 3QHWA 1Z5MA 2CGWA 3MYGA 5AR2A 2UZLA 5C9CA 2OIBA 4JS8A 4DFYA 4D1ZA 2X8DA 2G9XA 4XV3A 2UZWE 2JDRA 4DFNA 2PE0A 3F5XA 3TIYA 3UIUA 4PV0A 2OJ9A 1WVYA 5E91A 5GHVA 2QOOA 2XKDA 2HZNA 3R0TA 1Q61A 3C4FA 3TKIA 3QWJA 3F9NA 2O65A 4LYNA 4O22A 2R2PA 3VS1A 1GIIA 3C5IA 2I0VA 3ACKA 3I1AA 2PUIA 1Q3WA 3V5QA 3NGAA 3Q2MA 2EVAA 3KF4A 3MA6A 1YOMA 1WZYA 4RZWA 1M7NA 3VVHA 3NW5A 5J7BA 3F3TA 3SX9A 3GU5A 4YNEA 2CKOA 1HCKA 2J0MB 5GIPE 3PLSA 4YJRA 5A4QA 1FMOE 2VX3A 5L6PA 3LJ0A 4WSYA 2ERZE 2PVRA 3F3VA 1UVRA 2EXEA 4C3FA 3P7BA 3O0GA 2C3KA 2B9FA 4M14A 4YURA 1PXOA 4DEDA 1H25A 3BRBA 2VWWA 5BVNA 3CEKA 4YJOA 2JBOA 2PVYA 3PWYA 3D5UA 3F5GA 2HY81 2X9EA 4OTPA 2W5HA 4C33A 2ZAZA 4YZDA 2WQBA 4HJOA 4EBVA 4AE6A 1WAKA 4AUAA 3GCSA 4GVJA 3FKLA 2H9VA 3NUAA 4IH8A 1A9UA 4IWDA 4KWPA 4RVTA 5EFQA 2Q83A 2AYPA 4XX9A 3GCQA 2E9OA 1W84A 3TWJA 4F9CA 3PJ8A 3M11A 4OTDA 4KRCA 4P7EA 4RSSA 2JBPA 2X4ZA 2OIQA 2R5TA 2X2LA 3OXTA 4L52A 3ZHPC 3VBQA 4XMOA 4FZ6A 5DWRA 5E8ZA 3Q9YA 4R77A 4FZDB 2BRGA 3NCZA 1OIRA 3PY3A 3GC9A 4MK0A 4U8ZA 3D2IA 3DAKA 3DTWA 4KA3A 3PA5A 4RC3A 4MVFA 3PUPA 2FB8A 3D2KA 2IJMA 3VS0A 3A7JA 3VBYA 5DEYA 3BU5A 4AQCA 4BTJA 4RG0A 4AG8A 2P0CA 2RFEA 4AZEA 1XH9A 5IQDA 2GHGA 4ZS0A 1K9AA 4LRMA 3QGWA 1BL6A 3NCGA 2WMRA 2Z60A 3C51A 2O64A 4RMZA 4U97A 3TNWA 3B2TA 3AXWA 3FLQA 4ZTQA 3ORKA 3DBCA 4G6OA 2NRUA 3VUGA 2CGVA 4I93A 3UQFA 2W99B 1OPJA 2X2KA 1CKJA 3R7GA 3AC3A 4JXFA 4JX7A 3D14A 3DTCA 3LQ5A 1QMZA 1GIHA 2YACA 5HICA 5CASA 3Q2JA 4HNFA 3ORLA 3VUHA 3NEWA 1H0VA 2YCSA 4WG5A 4UWYA 3ZS5A 4QRCA 3GC8A 3SKCA 1IEPA 4CMTA 1M17A 2XM8A 4UY9A 4DG3E 3LLTA 5C8MA 3IW4A 3LPBA 4MBIA 2JKMA 5E8VA 4XOYA 4MHAA 3BPRA 4FKVA 4WBOA 3SAYA 3OWLA 3R28A 2ITZA 1YW2A 2BTRA 3UGCA 3TV4A 3Q32A 4E8AA 5HO7A 3QGYA 1WBPA 4YPDA 2R3HA 3MW1A 1FMKA 2JKQA 5T3QA 4EEVA 5ANIA 2C6MA 2YDIA 5HX8A 3KA0A 4J95A 5LVPA 3RAWA 2YITA 4XLVA 3L8SA 4OAVB 4ZMFA 4FK6A 4GFMA 3SW4A 4Q2AA 1DI8A 1IA8A 4PPBA 3WIKA 3EFKA 2OK1A 1PXJA 3TZMA 4O96A 4XV2A 5AUXA 1Q8ZA 5KE0A 4RJ6A 2HCKA 4BDDA 3FHIA 4ITHA 4QNAA 3G0EA 3GUBA 4BIDA 3PXYA 4YZBA 3NLBA 5HE0A 4BDEA 2VWIA 3IW5A 4RJ4A 4FTCA 4U0IA 2QQ7A 5K0KA 2I6LA 4CFMA 4OTIA 3V5JA 4KABA 2WHBA 3KF7A 5AA9A 4ZIMA 1XJDA 4PTCA 3KCFA 4JL9A 3KN5A 3WBLA 4PTGA 2WMVA 3EQFA 1NVRA 2IZUA 3L1SA 4GSBA 4I0TA 4QT1A 3S4QA 3VC4A 3E87A 4B8MA 2VNWA 4IHPA 4O7LA 3DB6A 4G1WA 2W9ZB 5DLSA 4YC6A 1TQIA 1O6LA 5JRQA 2IVSA 1T45A 4LRJA 4FZFB 2JAVA 3E92A 3QRIA 2PUUA 4ZS4A 5JN2A 2NNWB 2OG8A 4A4OA 4E4XA 1U54A 2XBAA 4ALVA 2DS1A 3FC1X 2XCHA 5AAGA 3HV4A 1YHWA 3HGKA 3MPMA 2HXLA 3PY1A 4JRVA 4W9WA 4ZSJA 2ITUA 2HZIA 4LV5A 3VS6A 4UYNA 2WOTA 3P5KA 1JPAA 3CJFA 3OCSA 3NIZA 1XH7A 2HYYA 5ETIA 4DEGA 2ZMCA 3DNDA 5EW3A 3V5LA 2R64A 3RHKA 3HAVA 1VYWA 1F3MC 4R7HA 3OOMA 3E62A 4R6VA 5ITAA 3FQSA 4XOZA 2JAMA 2P33A 3C0GA 3E3PA 4O7SA 3HP2A 4AA5A 4YJPA 3FI4A 5L2QA 4QP3A 4AT4A 4FL3A 4XYFA 4EYMA 4DGGA 4G3EA 3EYGA 4GUBA 4RA5A 3ZRMA 4ASEA 4EL9A 5CAQA 5CAUA 2F2CB 3LMIA 2QR7A 3ELJA 3MVJA 2C4GA 2CGXA 5CT7A 4FG8A 2WD1A 1JQHA 1NVQA 3SHEA 2YM5A 3G5DA 3UZPA 4QMVA 4D4RA 4DEEA 2XMYA 4C7TA 2QLQA 4F0IA 5IEVA 2ZDTA 2J7TA 1YOJA 3A8XA 2QI8A 3PIXA 4QNYA 3F5PA 4J97A 2UZEA 3U8WA 4F7SA 4ZLZA 2PVLA 5FEEA 1WBOA 1KSWA 4DFLA 1L3RE 2VRXA 4I6HA 4OBOA 3U51A 3EQPA 4NM0A 2IZSA 3GQIA 3HV7A 1UA2A 2XRUA 5BVFA 4X3JA 4PNIA 4C62A 3V04A 3RALA 4R7IA 5BUEA 3EN7A 3PXQA 3W2CA 4CFXA 3ZFYA 1YRPA 2R3QA 2F9GA 5E7RA 3FXWA 4AA4A 2B0QA 1OECA 4Y5QA 5AP0A 3COIA 3FSKA 3POZA 1YXXA 5J1VA 3WOWA 4NM3A 1UNLA 4TYHB 5D9HA 4YC8A 3A4OX 3TNQB 5HIDA 4U5JA 1Q8YA 2W0JA 3EIDA 3WZEA 3AC1A 4H3PA 4QMMA 5CF4A 1OB3A 4Q5EA 3MIYA 3E3BX 5DT4A 3OCTA 4XH6A 5L2SA 4W8DA 2YM6A 4GYGA 1MQ4A 2X1NA 3HA8A 4KKHA 3CXWA 3JVSA 3F3UA 2YM7A 1CKPA 3TNPC 3ZLSA 4D1XA 4FIFA 3QFVA 3FEGA 2UW5A 5M06A 4LM5A 1REKA 4UZHA 5HG9A 3R71A 4RIWA 4RWIA 3FLYA 2BZKB 3T9TA 1UV5A 3MJ2A 4HGTA 2P2HA 4JIKA 1LPUA 4FVQA 3EQDA 5C8KA 4B0GA 4BIEA 5JGAA 3ZO4A 1A06A 2PVKA 3OWPA 4DEAA 1OKZA 2OJIA 3DKCA 3W32A 2G2FA 3R63A 3DS6A 4IAKA 3AD6A 1JSVA 3LCTA 5AX9A 3RPYA 2YLFA 4X6QC 2OKRA 5JMSA 4EOKA 2V7OA 4FV0A 4FV9A 2PZYA 5GJDA 3Q6WA 3EQBA 4E4NA 2PE1A 4YMJA 5E4HA 2XH5A 1JKLA 4FIJA 4A07A 1NT2A 4WHZA 2WB8A 5HG8A 1I44A 4EZ5A 5IF1A 1XBBA 4FA2A 3LFSA 4FZ7A 5LARA 3DFCB 2DUVA 3OT8A 5E1SA 5HU3A 2JKOA 2WIHA 5FQDC 3FY2A 1CM8A 2QO2A 3F2RA 4O21A 3POOA 3WYYA 4JQ8A 1XHAA 2J4ZA 3PPZA 5HIBA 4AF3A 4FIEA 3KMWA 3ZLWA 3JYAA 2CN8A 2BRBA 4NH1A 2R3JA 4IIRA 4WNMA 5HGIA 4FTTA 3GENA 4QYGA 1KUTA 5C4LA 4U43A 4M69A 2NPQA 5IQCA 5CI6A 2IWIA 5AUVA 2UZTA 5KKRC 4GG5A 4UN0C 3FDNA 3QD4A 2BTSA 2XNPA 4RBLA 3ZC5A 3RWQA 4EWHA 4O0YA 3E63A 3HUCA 4G3DA 4CFUA 4EK3A 2HY0A 4QD6A 4H3QA 5LMKC 3E88A 2PL0A 3ET7A 4PDYA 4MF1A 4BI1A 3PA4A 2GQSA 4FTLA 3DV3A 3PJ3A 4WIHA 3WARA 3IG7A 4FKIA 4G5JA 4D2PA 3EHAA 5L2IA 5BX0A 4QMOA 3FMMA 4K77A 4CD0A 4MAOA 3QU0A 5IUHA 4EC8A 3KRXA 4JR3A 4E6DA 4YU2A 3AMYA 1ZARA 2XIRA 4FSTA 4FT0A 4QYYA 2BMCA 5LCKA 3UOLA 4CLJA 3C5UA 2OFUA 2W4KA 2XRWA 3QC9A 5E8TA 3W2SA 3TUDA 4LGDA 4YZNA 2VTTA 2YA9A 3EQCA 4BBEA 5IA0A 1O6YA 2VV9A 4TXCA 5DRDA 2EWAA 5DA3A 4AE9A 4RX7A 4O7RA 4IBMA 5EQPA 4CGAA 4ALUA 5HLNA 3ZYAA 5CZHA 4V0GA 3ZRKA 3AC2A 4WUAA 4E7WA 4EQUA 2EB2A 3CC6A 5FLFA 5FBNC 4EKKA 2QOIA 2W5BA 4YLKA 2QOFA 5KKRB 5F4NA 2PK9A 4KSQA 4AW5A 2VTQA 4P5ZA 2GNIA 4UX9A 3OCBA 1K2PA 5I9ZA 3WF6A 1F5QA 2WXVA 1BYGA 2YAKA 4O84A 3ORPA 4FIHA 2V5QA 3CTQA 2YM4A 2BDWA 4JQ7A 4KIQA 4W4VA 4USFA 3BE2A 4EJ7A 3NMUF 4FTNA 1EH4A 2WGJA 1ATPE 4V05A 2JFLA 1YDSE 3TACA 1ZZLA 1YXVA 2YM3A 1Q24A 3NVKI 1PYEA 5FXRA 1Q8WA 3UMXA 3NUUA 3DKOA 5BUJA 2ZM1A 4G6NA 1CMKE 5IMEA 4ONAA 5IA4A 3OUKA 4H3BA 4FF8A 4V04A 4ZSGA 3TL8A 5H8EA 3V3VA 2OICA 3FZPA 4U41A 4XG3A 4J8NA 4AZTA 1Q3DA 3WZDA 3C13A 4F1OA 5EI2A 3UDBA 1ZY5A 3QQHA 3EYHA 3FKOA 4RC2A 4IZYA 4CKIA 3I0QA 4NL0A 5KMNA 1HCLA 1TKIA 2O3PA 3VULA 3ZCLA 3QAME 5CVGA 3K5VA 3KU2A 4ZEGA 5AAEA 4USDA 4YSMA 2OF2A 3LOKA 3MN3A 4WO5A 3BGZA 1SYKA 3VF9A 3ZONA 2IPXA 4ZLOA 4FGRA 1OPKA 3FZOA 3U9CA 2G2HA 4O2PA 2FA2A 2B55A 3S95A 3FMNA 3RGFA 4MD8E 5CQWA 4J98A 3BHUA 4KINA 3V6RA 4WSQA 4YLLA 3R7UA 5TO8A 3I79A 1ZY4A 3TXOA 5EQEA 2ZV2A 3NSZA 5J95A 5EKOA 5JFVA 4LOPA 1U59A 2Z7LA 4A9YA 2PZIA 4LG4A 4HVDA 5CEQA 1GZNA 5T68A 5K9IA 5FXQA 2HWOA 3S1HA 2GFCA 5HVYA 4ACHA 4NIFA 4EH6A 5HHWA 4TY1A 5CLPA 4M69B 4YHFA 4DFBA 4IX6A 2OI4X 4LUDA 5CEKA 3WE8A 2Y0AA 4JIAA 4X3FA 2W4JA 3P0MA 3HKOA 4DH7A 5CEMA 1P5EA 3LXPA 5CZIA 4UMPA 2WAJA 3QTSA 5DN3A 3V8TA 2VTSA 5AR8A 4HYSA 4RC4A 2X7FA 4D2SA 2PYWA 3LCOA 4KIKA 5GNKA 4GRBA 3FJQE 4BC6A 5GJFA 3ORTA 1JKTA 2VTLA 3QKKA 5AADA 4N6YA 1FBNA 4NJDA 1G8AA 4D5HA 1GIJA 1MRVA 2PVJA 3GC0A 3R9DA 5I9WA 2F49A 4L00A 4N57A 4BCGA 5DR6A 4ZK5A 4L3JA 5HCZA 5JGDA 3OWJA 3UC3A 3LJ1A 5H9BA 1K3AA 2WMAA 2ITWA 2QU6A 3PSDA 2GDOA 5KZIA 4MYGA 3OC1A 1YXUA 2YIWA 4TYJA 5CF6A 4DFXE 3BHYA 3PA3A 3QUPA 4O91A 1DI9A 4MQ2A 4BHNA 4DA5A 5GINE 5HG7A 5TOZA 4Y83A 2JDOA 3BYUA 3EFLA 2C47A 3EMGA 3SC1A 3D5VA 3MVHA 2YN8A 4UWBA 4BYIA 4MXAA 3AC4A 4I6BA 2X6EA 3FAAA 1JBPE 3GP0A 4HCVA 4LQMA 3VWAA 4A4XA 3ZDUA 3EOCA 2OU7A 3MV5A 3Q52A 3AD4A 5CAPA 2O63A 2UUEA 4QMLA 2PPQA 3DJ7A 3FKNA 3QQJA 4RVMA 3KB7A 3ANRA 4BZOA 3K2LA 4Q9SA 1W0XC 3D15A 3R6XA 4IC7A 3SLSA 4D4YA 1QPDA 3SXFA 4RA4A 4U42A 5L6OA 2BR1A 3QC4A 3O96A 1QPEA 2HXQA 3PIYA 3NNWA 4IWQA 5ANDA 2VTHA 4RIXA 4BDAA 5BVOA 4ANSA 4BR3A 3HYHA 2IZTA 4FV4A 3CTHA 3LFBA 4S30A 4GT4A 3T3VA 3TIZA 1OL5A 4RFZA 5HBEA 4HGSA 4Y72A 3ZUVA 4BFMA 4O7VA 4ZTSA 4NCTC 3CY2A 3W2RA 3DJ5A 4BZDA 2ZV7A 4L44A 4ZJJA 1SVHA 1V0BA 3OHTA 3ZLXA 3R7EA 3P79A 4JAJA 4CZTA 3LXNA 3I7CA 5DHJA 3EKKA 4II5A 2J2IB 3E8NA 3IW8A 3DDPA 5KMJA 4IEBA 3Q4UA 3EN4A 1UNHA 4X2JA 5LVLA 4ALWA 5H3QA 4IAZA 4KBKA 3OD6X 4WOVA 4ZTNA 2W1DA 4AACA 2I1MA 4NYEA 1OZ1A 3A7FA 3CBLA 1J3HA 4CNHA 2RGPA 4LGGA 2VWYA 3ETAA 2JDTA 2BRMA 3FXXA 3PTGA 2IVVA 4I1ZA 4QMWA 4YZ9A 2GTMA 3ZOSA 4NJ3A 3LVPA 2XK7A 2EUFB 3AMBA 4ANMA 3OBGA 4HZRA 5DI1A 2C6DA 4FE2A 4FBXA 4C57A 4H1MA 4RIOA 3FMEA 5CAOA 2Z7QA 4BBFA 1ZZ2A 3ZBFA 2QNJA 4KKEA 5KCVA 3QZIA 2QCSA 3VW8A 5ETFA 3UOKA 4C02A 2GPHA 5K5XA 3MFSA 4I23A 5KX8A 5FM2A 4QYEA 4S2ZA 5DIAA 4DH8A 4F99A 2WQMA 4I20A 4BCNA 4P90A 3DLSA 4GU6A 4DINA 3RAKA 4KBAA 1ZMWA 4NIFB 4Y85A 2C0OA 3EN6A 4W4WA 5EM8A 4FGBA 4UXLA 2CJMA 4MXXA 1KE9A 4GK2A 2HAKA 3VN9A 2ZM3A 3FMDA 4BCOA 3UVQA 5I5ZA 1GZ8A 1PMEA 3UO6A 5FTGA 1CDKA 3RK9A 4FC0A 4AGDA 4UXQA 1ND4A 5CU4A 1PRYA 4O6EA 4UMTA 4TYEA 4EI4A 4DT9A 1UWHA 3OP5A 5K0XA 4FTMA 5IQIA 4ZZOA 2C30A 3H30A 2ZYBA 4O0TA 2W1FA 3DU8A 4X6RA 5EH0A 4IJ9A 5GZAA 3OFMA 5M07A 3NNVA 1B6CB 2G2IA 3LFCA 4AZSA 4BIBA 4FODA 4JAIA 3QD0A 4U81A 5ANEA 3BYSA 5F95A 4FIIA 5C4KA 1KE7A 3MTFA 3P23A 3LKMA 3T9IA 4FKOA 2FH9A 3PFQA 5EOBA 2R0UA 3MVLA 4J96A 3HRBA 4K8AA 3VJNA 4C34A 5DT3A 4QTDA 4PMPA 5KO1A 2UW4A 3HP5A 4TWNA 2OWBA 4CRSA 4YC3A 5HCYA 3IDPA 3N4VA 2HOGA 4A4LA 2QOCA 4FICA 5FRIA 3R00A 3TT0A 3F7ZA 3FC2A 3R2BA 5CYIA 3T3UA 4E5BA 2WFYA 2XM9A 2IG7A 3RI1A 4GKIA 4XG4A 2RFSA 2QOLA 2R3GA 3LM5A 3VHEA 2PTKA 4B4LA 4FT7A 3QKLA 5E90A 2CCHA 4DEBA 4OTFA 2XZSA 1JKKA 2FVDA 3VRZA 3QTUA 3CY3A 4AN3A 2WMSA 4CCBA 1M7QA 3QF9A 3VS2A 2J0KA 4HOKA 4U80A 5D10A 3WF5A 5F9EA 4PMMA 4RIXB 4FEXA 3TDVA 3DA6A 4EHEA 1U4DA 2XYUA 3Q53A 5EHLA 4DGMA 4GFGA 5EYCA 3PG1A 4FSRA 4J8MA 1J7UA 2ZJWA 3I6UA 4X2GA 2ITXA 5AR4A 4BKZA 3H9OA 1CKIA 4KS8A 3Q96A 2YCQA 5A4EA 4UWCA 4AFJA 2YWVA 4WT6A 3MTLA 5TR6A 5LCJA 4F6WA 2GS7A 3E7VA 4FKTA 2QHNA 4ZXTA 3RINA 3PDTA 3I5NA 4HVGA 1J91A 5K4JA 1IAJA 4HGEA 3BI6A 3E64A 4JVGA 4FR4A 3SOAA 3WI6A 3ZZWA 4PP7A 1OITA 3ALOA 3O23A 1RJBA 4U79A 4ZTMA 4MXOA 3HMNA 2QLUA 4TYIA 3BIZA 4DN5A 5AR7A 3F82A 5D1JA 3MWUA 3U4WA 3EH9A 1LR4A 5C27A 4E4MA 1Y91A 3EJ1A 4PTEA 5CNOA 2BIKB 5K3YA 4R78A 3MIAA 3FLNC 3NAXA 3OXIA 1BI7A 2R3FA 4F65A 3CSVA 2X4FA 4H1JA 3PXKA 5C8NA 3AD5A 1IAHA 1IR3A 5JH6A 4O1OA 2GSFA 3C9WA 3SG8A 2GNJA 4ZSEA 4L46A 4I24A 3TUCA 2IW6A 2OIDA 4OLIA 4IQ6A 4FOBA 4I41A 4QYHA 4FV2A 2ITPA 3VS3A 4JQEA 4MCVA 4EC9A 1H01A 4IM2A 5M51A 3IQ7A 2IVUA 4KD1A 2WZJA 4U3YA 3FY0A 3O50A 1Q97A 4WA9A 4I4FA 3AT4A 4AW1A 3DXQA 4QTEA 1AGWA 2ONLA 4S32A 5G1XA 2QKRA 3LCSA 1H08A 4ANBA 1WVWA 3FI8A 3KXGA 5E9EA 1UKHA 2ITVA 3OBJA 5CT0A 3QD3A 4FV6A 4BZNA 5BUIA 1XH6A 4NWMA 3DKGA 2FGIA 4DH1A 2ZB1A 1JSUA 4ZAUA 4GEOA 3QQGA 4FKJA 4MXYA 4HVHA 2YJSA 2H34A 2P2IA 2VAGA 5A6OA 4FT3A 1WFCA 3BQRA 3L9LA 3IDCA 4I5MA 3RTPA 4UMRA 1ZYLA 5IA2A 2R3KA 1WVXA 3TTIA 4XG6A 5J5TA 4XP0A 3CS9A 3VS7A 3UQGA 2ERKA 5CENA 4EK5A 4RJ7A 3ROCA 3DAJA 1PY5A 2F7ZE 3ZDIA 3CPCA 4E1ZA 1XQZA 2C3LA 5CANA 4FTKA 1H1SA 2QD9A 4GYIA 4DC2A 3H10A 5LMAA 1RDQE 4R1YA 4YHJA 3CQEA 3QYWA 3DKFA 3L9NA 4YP8A 5EKNA 4FX3A 4C4GA 4EUTA 3COHA 5IDNA 3GNIB 4C3RA 2UZNA 3OOGA 1P4OA 4EZ7A 2G01A 1YWVA 3LW0A 4IZ5A 4AGUA 4BWPA 1KE6A 4YHTA 3WZJA 4XBRA 1E9HA 1JAMA 4X2KA 4XP3A 4O1PA 3FBVA 2OZAB 5EYDA 3SV0A 2X7OA 1OKVA 1SM2A 3C4ZA 5E92A 2F7EE 4R8QA 2JD5A 3KL8A 4D5KA 4DTAA 5LMBA 4IDVA 2GCDA 4M68A 2B9IA 2PZ5A 3PVBA 3WE4A 4JNWA 4FKPA 1BL7A 4L7FA 3G0FA 3UO4A 3ZM9A 1PW2A 3P4KA 4LGHA 5IMXA 4HYIA 3EQGA 5ANOA 2Z7RA 3ZXTA 2A1AB 4UYAA 4YJUA 3TZ9A 2IVTA 4I22A 4BDJA 4EBWA 2B54A 4O81A 2OO8X 5DMZA 5GZ9A 3DK3A 1UU3A 2YIYA 3VUTA 5IEYA 2VWXA 2HENA 3DJ6A 2WNTA 2LGCA 4IAAA 3CP9A 4O27B 3O7LB 2XIZA 4FTUA 2B9HA 4J53A 2BHHA 4D9UA 4EORA 4FEWA 5D7AA 3W2OA 1XR1A 3RZBA 4D2TA 4PDSA 1RE8A 4ANNA 4CYIA 4E73A 4EQCA 4FKLA 4G16A 1H1QA 5D7VA 3Q04A 4EHGA 2UW6A 3F7WA 3FL4A 3DAEA 3LCKA 5E8SA 5A4TA 5E8WA 1PMNA 3OMVA 4ZTHA 3KGAA 3NS9A 5HESA 2B4SB 1GY3A 4H39A 4IWOA 2OW3A 5AP5A 1G3NA 5HCXA 4GFOA 3GU7A 4K2RA 3CKWA 3KXXA 3IOKA 5A3XA 3VUMA 1Q8UA 3G33A 3K3JA 3TKUA 4Y73A 5AMNA 4ANOA 3C1XA 1Y8YA 5IA5A 3RPSA 4F7LA 3CKXA 4M3QA 5CSXA 3CR0A 4IXPA 4M15A 4EUUA 5L8JA 1FGKA 1PJKA 3F6XA 3O8PA 3QCSA 5JRSA 3UBDA 4AXAA 4CLIA 2R4BA 2BUJA 4J71A 4XG9A 3K3IA 3C4WA 1RQQA 2XYNA 3QALE 3G15A 1GNGA 1TVOA 5DGZA 4ZMEA 2LAVA 1O9UA 5IQGA 2ACXA 3R9OA 1XH4A 4E6CA 3THBA 4PPAA 2IO6A 1PHKA 5J9YA 4GU9A 4O2ZA 2YABA 5KBRA 4PL4A 4JJRA 3C4XA 2PWLA 4G3CA 3HMIA 2YJRA 2QG5A 4M66A 4ASXA 3CE3A 4FNXA 2W17A 3QXOA 4JG6A 3REPA 1KE8A 2JLDA 4LFIA 3HMPA 4HGLA 4UEUA 4CFWA 5J5SA 4BCJA 4F64A 2RFDA 4KIOA 1XKKA 4UALA 4F63A 3MSSA 2WEVA 4Z3VA 2XK3A 3FWQA 3O8UA 3ULZA 4A7CA 4CMUA 5H8GA 1IRKA 4QP7A 2H6DA 3HL7A 4IVAA 1H1WA 3PZHA 4JRNA 1Y8GA 2VTNA 3QD2B 2XIKA 3TDWA 1WBNA 4FL1A 4QTBA 3TZ8A 4NEUA 4ZZNA 5CU0A 3PSCA 2WU6A 4S34A 2QO7A 3OCGA 4KIPA 4CZYB 3AC5A 4IVCA 1APME 2GFSA 4GS6A 3ZBXA 4RX8A 4PWNA 4O7NA 5A46A 4F7NA 1T46A 3MESA 3E8DA 5AV1A 1DS5A 1V1KA 4QPAA 3ORIA 2CSNA 3ZSGA 3GB2A 4ASDA 1J1CA 2QOBA 5IUIA 1J1BA 4LOQA 3U4UA 4ZSLA 2WTIA 3CD3A 3QTWA 4C4HA 5FBOA 4I94A 4CSVA 2W96B 4ZZMA 4EK8A 2GNLA 4IMYA 5ANKA 4AAAA 4F6UA 3VUDA 1PXLA 1PKDA 3KKVA 5GIOE 4R5YA 3IGGA 2C0TA 2BAQA 4DYMA 3VQUA 2OJJA 5JFWA 4R5SA 5FDPA 2C3JA 5FP5A 2G1TA 3IKAA 3PE2A 3KXZA 4WBBB 3C4EA 3MH0A 3A2CA 4G6LA 2PVNA 4D1SA 4TRLA 4EOIA 4RX5A 4FG9A 2RG6A 5A9UA 5AV3A 3UE4A 3GXLA 4R3RA 4W8EA 5EG3A 5A54A 2C6IA 2W1IA 4A9UA 4ID7A 3S0OA 5DBXA 3MGYA 4PL5A 5FD2A 4YZCA 4N6ZA 5JSMA 1PKGA 2UZDA 4E4LA 4OW8A 2YDJA 3R21A 3R7VA 4A06A 4YUQA 4FEUA 4ACDA 2XNGA 3PVUA 1OL1A 3C7QA 4O0XA 5H8BA 4BTMA 3F88A 3PVGA 4MKCA 4YJQA 4AN9A 3QBNA 4UMUA 4USEA 2J90A 2FSTX 2UZVA 2VGOA 4YO6A 1CSNA 2OF4A 3RVGA 4J99A 1WBTA 3VBWA 4PQNA 4IANA 5FP6A 3P7AA 2W1HA 3DBEA 3HRFA 3PZEA 1U54B 4UBAA 4EJNA 2C3IB 4YGAA 3VS4A 4IB5A 3UJGA 4I92A 4XRJA 4F9WA 4PX6A 5I9VA 4MD9E 4U40A 2XKCA 4MH7A 2BZHB 3KMUA 2VTAA 5K5NA 3LXLA 3JY9A 5KZ0A 4FTIA 2X6DA 4K6ZA 4CQEA 2PZRA 3DPKA 3LAUA 5EQYA 4QTCA 1UWJA 4HNIA 4CMOA 3NUSA 4RPVA 2GQRA 3D5WA 5CTPA 3ZFMA 3VUIA 4I0SA 1YDTE 2UZOA 4AGWA 2JC6A 1H28A 3ORXA 1PXPA 4UZDA 4O7TA 4EH8A 5IU2A 5CY3A 1ZOEA 2UZBA 5M55A 5LWNA 4QP4A 3MPTA 3IPHA 3QZGA 3V5PA 2PZPA 5BYZA 5HTIA 3GFWA 5AV0A 3MBLA 3UVRA 4IZAA 2A27A 2ETMA 4C38A 4BBMA 4XCUA 5HE3A 4BCMA 2ETKA 4DGLC 3UMWA 1YI6A 3ZUTA 3EL8A 5ACBC 3SGCA 3TNHA 2VGPA 4JR7A 4QQCA 3ZM4A 5LXMA 4FYOA 1SVEA 3NRMA 2OJFE 3A60A 1M14A 4FVRA 4L42A 4LOOA 4NFNA 4XG8A 2VO0A 2OH0E 2A19B 4QMSA 5CQUA 4ZOGA 3V51A 4JBPA 4F1MA 4GJ3A 3UZRA 2WMUA 3L9MA 1E1XA 5EOLA 4G31A 5JEBA 5IUGA 2Q0BA 1ZAOA 1FVRA 3ZO3A 3ATSA 3LJ2A 2CNVA 4I21A 4YJSA 3F3ZA 5ETCA 4O83A 3PJCA 5F1ZA 5AWMA 3U87A 5JKGA 4DHFA 4QP6A 1ZMUA 4FTAA 3RM7A 2BHEA 5L4QA 3EB0A 3QTQA 2IZRA 3F2NA 1L8TA 5IG1A 4XBUA 5HG5A 5BVWA 3FL5A 3R1SA 4F9YA 5BMSA 4QPMA 1NA7A 4S33A 3RP9A 3BYOA 4EH3A 3BWJA 4BYJA 1M2RA 4WUNA 3LFNA 5AUYA 4YO4A 5JQ8A 2KULA 3BV3A 4RX9A 4QP1A 3A99A 2Y7JA 4FKRA 4GCJA 1KOAA 5FEDA 5HNIX 4DAWA 4MX9A 4RIWB 1Q41A 3LFAA 3R8UA 3KC3A 2C6LA 3MJ1A 4C4IA 1QCFA 4BDCA 3U6IA 4RT7A 1VYZA 2X0GA 3RAIA 4CZUA 2UW3A 4AW2A 3SDJA 3R1YA 1B39A 3IDBA 3Q4TA 4OAUC 2CKPA 3MH2A 4M8TA 4QMUA 3OZ6A 2XB7A 4FUYA 3WZKA 3MVMA 2B1PA 4L3PA 1RW8A 2GTNA 4WRGA 3R9RA 4ACGA 4GJ2A 4L67A 3R8ZA 3DBFA 3A8WA 4X7QA 5CXZA 4JT3A 4O7YA 2VZ6A 2YDKA 4IB3A 4L43A 5DEWA 1MQBA 3OY1A 4RWJA 3RMFA 1YHVA 4EOLA 4YTCA 4J7BA 2IN6A 3RBWA 2P3GX 4PNKA 3RCJA 3NYVA 4G5PA 4L7SA 2VO6A 4TN6A 1YQJA 1YXTA 5CU6A 2XA4A 1MUOA 4L8MA 3EN9A 4TL0A 5CXHA 2FSLX 4IVBA 5IQFA 1YWRA 5ETAA 1H26A 4AZVA 1SZMA 4PP9A 3BQCA 1MP8A 1OMWA 1Q4LA 5BVDA 5C26A 4Y5HA 4C4EA 5ANGA 2JEDA 1U46A 1FVTA 2WQOA 4O0VA 4BGGA 3W2PA 4APPA 3LQ3A 4ITIA 4M7IA 1KWPA 3E8EA 4TWPA 5LVMA 2XBJA 2WTDA 4BTKA 4XEYA 3IECA 3ZUUA 2VTOA 5AM7A 1BLXA 2CKEA 3W18A 5AUZA 3PE1A 4BI2A 5IDPA 3O8TA 3OROA 2Q0NA 1OBDA 3R1NA 2WTWA 3ROYA 3UNZA 4CQGA 3R7OA 3O51A 4G3GA 2BVAA 2HW7A 3UZTA 4FG7A 2EU9A 3AGMA 5FDXA 5AEPA 4ZTRA 3ZFXA 3R01A 3KFAA 4B8LA 3KN6A 3D5XA 3F69A 4QQ5A 4X21A 3V5TA 5BYLA 2P55A 3ACJA 1KV2A 3SXSA 4FNYA 3BBWA 2JIVA 3P9JA 5KNJA 3QX4A 4BCKA 3D94A 3FPMA 4V0GB 4RWKA 4DTBA 4IB1A 5AM6A 3R8MA 3WF8A 2ITTA 4DBNA 4ACCA 2PSQA 3DQWA 4KB8A 4KAOA 4E26A 4FKWA 3S3IA 4WNKA 3NDMA 1NXKA 4ZJVA 1BI8A 2PVMA 2XJ0A 3UQCA 3PJ1A 4L68A 4QO9A 3W16A 2AUHA 4BF2A 2YFXA 3DBQA 3KY2A 2FO0A 3U54A 4CVAA 2BDFA 4FV8A 4DLIA 4DBXA 2C6EA 2ZM4A 4RQKA 3DDQA 3CIKA 4BDIA 5I9YA 2EXMA 2CPKE 4CKJA 1JWHA 4O38A 1UU7A 2OH4A 5AIRA 2JITA 4QP8A 4CV8A 4LL5A 3WF7A 4EYJA 3T8OA 4GVAA 2GHLA 3PXRA 5BVEA 4EOJA 5KHWA 2RG5A 2YIQA 4Z9LA 3TUBA 2PMNX 3HUBA 4FNZA 3VBVA 3DZOA 3NYOA 5EK7A 2XNNA 3TKHA 2V55A 3F61A 3OS3A 3PLAE 3ENMA 2XVDA 4RFMA 4X3FC 2YHVA 3MFRA 3EWHA 1S9JA 3Q3BA 3QLFA 4F7JA 3EL7A 4BCPA 4RLLA 4YTHA 2YIXA 1OPLA 2GHMA 3IS5A 3EQRA 3BYMA 5TF9A 4ANLA 4AOIA 2QHMA 5D12A 4A9RA 5EDPA 4BGHA 3CQUA 4PL3A 4APCA 4LUEA 4KUJA 4P5QA 3A7HA 5ANJA 3I60A 4GIHA 2XK6A 3PRIA 5AP7A 3HV6A 5CSPA 4FT9A 2E9VA 3MA3A 4QMTA 4YBKA 5IA1A 4NK9A 3UIXA 2O2UA 5FTQA 1J7LA 4TPTA 5DPVA 3VF8A 5IH5A 5IKWA 3LFEA 1ZYCA 5EHYA 1H07A 4M0ZA 3PWDA 4I6QA 2CGUA 3IONA 4IE9A
chains in the Genus database with same CATH superfamily
3VHKA 4NM5A 4X2NA 4MUQA 2NRYA 3G6HA 2F57A 3H4JA 2CN5A 5DNRA 3TTJA 4RJ3A 3UP7A 5IPJA 4ACMA 3PJ2A 4E93A 2JKKA 4DG2E 3GGFA 4AT3A 2I0YA 1QL6A 3FE3A 3KMMA 4GH2A 4BICA 4D9TA 4EWQA 2B7AA 3LFFA 4D2VA 2OGVA 3A4PA 2YWPA 5KMIA 1W82A 2WMQA 3QWKA 4U6RA 4EK4A 5L2WA 3LFDA 3QUDA 3O71A 4FSYA 5M56A 3FPQA 4X3FB 3GCVA 3QCXA 2UW8A 1E1VA 4FYNA 3UC4A 4E5AX 3KREA 2HZ4A 4NTTA 4IFGA 3QZHA 2VUWA 1ZMVA 3QTXA 2B52A 3GFEA 4KIKB 2J5EA 1DAYA 2OLCA 2BAJA 3SXRA 4N0SA 4O4CA 3BKBA 2YAAA 1OM1A 3GVUA 2V62A 4ARKA 3FMJA 3P86A 3R22A 3NIEA 4FVPA 4W9XA 4L53A 3UP2A 3AG9A 2ZB0A 3SW7A 3RPRA 4FSMA 4EONA 4FT5A 4HW7A 2QOQA 4JBVA 3NR9A 4CTCA 4M84A 3ZEPA 2C5VA 4BDFA 2W7XA 4HVIA 5DT0A 4TWCA 2C5OA 4CYJA 2X39A 3EQHA 5CU2A 4FNWA 5DE2A 2ITOA 3PIZA 4YJTA 2QOHA 1WBWA 1PXIA 3MFTA 5BV3A 2HZ0A 3HLLA 3N9XA 5HBJA 3D4QA 5HTCA 4YLJA 4G3FA 1F0QA 4D58A 4BKYA 2PULA 5FXSA 3V6SA 5HE2A 4L3LA 1ST4A 2WTCA 1O6KA 4FTOA 2W1GA 2JGZA 2QOKA 2VTMA 3M2WA 3TNIA 4IAYA 1X8BA 1WBSA 3FMKA 3ALNA 4E3CA 1FVVA 4C35A 2QG7A 4OTRA 3ORZA 5M4IA 4YSJA 1G8JA 1M52A 4GW8A 1JVPP 3ZU7A 5J7HA 3QQUA 1PF8A 2WMWA 1VZOA 4TW9A 5G6VA 1OUKA 3VRYA 4DDIA 1H4LA 3FSFA 4TNBA 3UNJA 4O0RA 4U9AA 1BX6A 5ICPA 3EFJA 3PRFA 3UODA 3QRKA 4MNEA 4RQVA 3PSBA 3QLGA 3QKMA 3R2YA 2PMOX 4IVDA 4J52A 1PXKA 3FZ1A 3G6GA 5HVJA 3QRTA 3RHXA 1FINA 3P78A 4JDHA 5CNNA 4CXAA 3W2QA 4M67A 4BI0A 3PY0A 4CFVA 4EH2A 3QCQA 3VBTA 4C37A 4Z16A 4K33A 5B0XA 3AMAA 3V01A 1U5RA 3AC8A 3FZTA 3LHJA 4BVUA 3RKBA 3UPZA 5FG8A 5HIEA 2V22A 2ZV9A 3F5UA 3K5UA 3LFQA 4RVKA 5A14A 3GU6A 1FPUA 1JSTA 4O4BB 1OIYA 2RIOA 3BHHA 3W8LA 2BFXA 4TTHB 2XNOA 1STCE 5TKDA 4IX3A 1U5QA 3B8QA 1CTPE 3ORNA 4G9RA 4IM0A 5C01A 3R8PA 3QQLA 3TEIA 4JG7A 1VJYA 5GZ8A 4AXEA 5AA8A 2XNMA 2BIYA 2XCKA 4XV9A 3BX5A 4I4EA 3ZSHA 4OBPA 5C03A 1OL2A 3KXHA 3JPVA 1KV1A 2VTIA 4DITA 4CV9A 5DH3A 2VWVA 4AS0A 4FV1A 4OT5A 4W4YA 3HDNA 4AW0A 2O5KA 4XV1A 2XKFA 3WYXA 4UV0A 3DQXA 2RF9A 2X81A 4B6LA 5M57A 3C0HA 5HNGA 2QC6A 4C61A 3F3WA 4RVLA 5IEXA 2Z02A 4QDVA 4O0SA 2WQEA 5HZNA 2BKKA 1H1RA 1I09A 2J0JA 3OXZA 1M2PA 1BMKA 2F2UA 2OBJA 4FL2A 4HPTE 3ULIA 4BKJA 2XKEA 5AUTA 5KUPA 4XP2A 3KRJA 4ZP5A 2JDSA 2WTVA 2XEZA 1ZYSA 3QX2A 5HQ0A 5EM7A 3LM0A 3QQKA 3M42A 1AQ1A 4L9IA 4AA0A 2W1EA 3LE6A 3QTZA 4RRVA 2CLXA 3N4UA 4BWKA 2AC3A 3OG7A 4XRLA 3O7LD 4HYHA 3S00A 5BMMA 2VWUA 1Y57A 3FZRA 3AT2A 4FMQA 4HCUA 4H58A 3S2PA 2B9JA 4O0UA 5A4LA 3DBDA 4LRKA 1KOBA 2J50A 2R3IA 3KRRA 4BGQA 1TFFA 4EOQA 2WKMA 3I6WA 2GQGA 5CI7A 4RJ5A 4KSPA 2CCIA 2C1BA 3FZSA 4K0YA 3HV3A 3UG2A 5IA3A 2RSVA 5EW8A 2VTPA 4I5CA 1UKIA 2YLEA 4X2FA 3TJCA 5H2UA 5KBQA 2ITYA 3FI2A 4NKSA 2J0IA 3ZO2A 4PF4A 3WILA 5IQAA 1NVSA 2GU8A 2BPMA 3BZ3A 3C50A 4AOTA 4HCTA 3A61A 2Z2WA 2BKZA 2W9FB 3B2WA 3MB6A 4GMYA 5D11A 5EI6A 3BEGA 5HNBA 4D0XA 2KTYA 4QP2A 3R30A 5C1QB 3U9NA 2B53A 5IQHA 2NP8A 2XK4A 4G34A 3ID6C 4ZTLA 3CGOA 3L8VA 1FGIA 2QR8A 3H9RA 4OGRA 4PPCA 4PRJA 3GBZA 5CS6A 5FWKK 2XJ1A 2RL5A 3TI1A 1GZKA 4U44A 5HI2A 1VEBA 3KRWA 1LP4A 2Y4IC 1REJA 4MXCA 4C2WA 3NYXA 3MFUA 2XNEA 4GV1A 2JIIA 4XNEA 3V5WA 2V7AA 1IA9A 1ZOGA 4TT7A 3SRVA 1OBGA 4L01A 3VIDA 3R9NA 2XUUA 3FUPA 3NW7A 3QYZA 4MNEB 4QMXA 3Q9XA 3Q9ZA 4IZ7A 4MF0A 4D4VA 2CNUA 2C5NA 3KK8A 3PYYA 4AXCA 1KE5A 4FSQA 4M12A 1YVJA 3PXZA 3KK9A 5FGKA 1H27A 1LEZA 2VTRA 4XLIA 3UYTA 3W10A 4O86A 3BBTB 3GT8A 3O2MA 3BLHA 1ZOHA 2CMWA 3R1QA 4BCQA 2ONLC 4QQJA 1R0EA 1BUHA 1OKWA 1FOTA 2VN9A 3KXNA 4RIYA 3VNTA 2ZV8A 4PMTA 4HVSA 1B38A 4TYHA 2QONA 3DXPA 3U55A 4FTJA 3CD8A 5J9ZA 4NW5A 3ZO1A 3DT1A 3UDTA 5CEOA 3OY3A 3OTUA 5HVKA 2R3RA 2QO9A 2YEXA 3I0OA 2PVFA 5CF5A 5I9XA 2QU5A 3ZTXA 1XH5A 4F09A 1G8SA 2Y4IB 5J79A 3KRLA 5AV4A 2REIA 4OTWA 2RFNA 5BNJA 4I3ZA 2J9MA 4AZFA 1Z9XA 3JUHA 4K1BA 3TCPA 3UIMA 1W7HA 3ZRLA 3C4CA 1UU8A 3AQVA 5A4CA 5CF8A 3R04A 3C0IA 4BCHA 2FYSA 4CKRA 3B8RA 4O7WA 3GQLA 5E8UA 2UVZA 2WO6A 4F0FA 5JZNA 4Z7GA 4ZLYA 2ITQA 3QTIA 2PVHA 4OTQA 5HEZA 1PXNA 3FLSA 4MWHA 3R73A 4EHZA 3EQIA 2VD5A 3HAMA 5M53A 1P2AA 4ITJA 4K18A 2I0HA 3RAHA 3BE9A 5B2KA 3RK5A 4U3ZA 5M4UA 4R3CA 4ASZA 2IW8A 2Y8OA 2OXXA 5T6KA 3NUPA 4FI1A 4BTFA 4NM7A 3BU6A 3IK3A 2C1AA 5FM3A 4Y8DA 1GOLA 3BEAA 4IADA 3RJCA 2E9UA 5L8KA 1OIQA 4JBOA 3R9HA 1VR2A 3KVXA 3Q4CA 3MH1A 4TKSA 3DFAA 3EZVA 1V0OA 5LQFA 1YKRA 4GT3A 2VO7A 5AUWA 1OL6A 3KCKA 4AWIA 2ETRA 4WNPA 2BRNA 3MPAA 3JVRA 3RNIA 4F9BA 4UB7A 1TQPA 3CPBA 4BCFA 5JFXA 3NWWA 3OEZA 3R7YA 4DHIB 4N4SA 2Z8CA 2XK9A 5JFSA 3BU3A 1GJOA 4RGJA 4RZVA 4NZWB 2VWBA 5TT7A 3RZFA 3M1SA 3LZBA 2O0UA 5DVRA 5IQEA 2ZVAA 4NW6A 4CG9A 5BPYA 4DF3A 1YWNA 2C69A 2JDVA 3BV2A 3NAYA 5HU9A 4F78A 4G2FA 4P2KA 5HE1A 3FLZA 4A9SA 4DHJA 2XNBA 1WMKA 2BCJA 4AOJA 1M2QA 3R02A 3OEFX 5J1WA 1JLUE 4EOPA 3ODYX 2AEGA 3P1AA 2XIXA 4S31A 4CG8A 3AOXA 4OR5A 2W1CA 4C8BA 2WIPA 1ZLTA 2JFMA 2XEYA 3D9VA 3L8XA 3PXFA 3DLZA 4FOCA 4K11A 5DG5A 1GAGA 3BHVA 2CKQA 3WF9A 5HTBA 4MD7E 4E6AA 4PDPA 5IH6A 5HLWA 3SRVB 2NO3A 2RKUA 3UO5A 2GNGA 1Q99A 5CX9A 5D41A 5CWZA 3A7GA 2OSCA 3I4BA 4AP7A 4FSZA 2I7QA 4AFEA 3NPCA 4B99A 4OTGA 3FI3A 5B2MA 4FKSA 1GZOA 3E7OA 4EOSA 4BJJA 4M97A 1H24A 5AP4A 5L6WL 2V0DA 3O17A 3QQFA 2X8IA 4ZJIA 2HIWA 2VTJA 4IWPA 4EKLA 4DCEA 1Q5KA 1R3CA 4DH3A 3W0QA 1UNGA 3PP1A 4PUZA 4RIYB 4C4FA 1MRYA 4DFUA 3RCDA 3LMGA 2J5FA 4FUXA 5LMKA 4WD5A 2H96A 1FQ1B 4IACA 1W83A 4BL1A 3OWKA 4C4JA 3HEGA 4X0MA 1MRUA 5I3RA 3I5ZA 1NW1A 3AKLA 4KNBA 3TJDA 4DE4A 3PG3A 5AP6A 3NUNA 1SNXA 1R0PA 3CJGA 4AGCA 1IG1A 4WG3A 4YPSA 3QTRA 4AN2A 1PMUA 3ZH8A 4B9DA 4BDGA 4F6SA 4RFYA 3LCDA 3UG1A 3NZ0A 4PMSA 3UVPA 2GS6A 2PE2A 1XBAA 2O8YA 3JXWA 3KVWA 3KULA 2E9NA 2XIYA 4E5WA 3QRJA 3QCYA 3RWPA 2YCRA 4DEHA 3PPKA 4IX5A 5AR5A 2PUNA 2PMLX 4YTFA 2HELA 2CHLA 2UV2A 5FTOA 3HZTA 3G90X 2PY3A 4PY1A 1S9IA 2R3NA 4NT4A 3VS5A 4C3PA 2ZDUA 2UW9A 5CU3A 2BRHA 4EH4A 3FV8A 1TQMA 3D7ZA 3I7BA 4GL9A 4F4PA 5KMOA 1H00A 2UW7A 3HV5A 3PP0A 4JDJA 3DB8A 5KMKA 3BLQA 2VX1A 3CTJA 4BRXA 5E8YA 4QMPA 2WU7A 5BQ0A 3GI3A 4EH7A 4ZS4A 3MI9A 2FSMX 4N70A 4TZRA 5EI8A 2PUPA 4MXZA 3UPXA 4GT5A 3IW6A 2JIUA 5AUUA 3GU4A 5I3OA 2W05A 4NTSA 4BHZA 5HLPA 1ZYJA 4ENXA 4L45A 4FSUA 3A62A 1JOWB 4EQMA 4JDKA 1A48A 2WEIA 3A7IA 3ZSIA 4DEIA 4IM3A 3ODZX 3NUYA 4D4SA 5I4NA 1OI9A 2Y6MA 2QURA 3DNEA 4YR8A 3UNKA 4J1RA 4HYUA 2XALA 2R0IA 1XO2B 2ZMDA 2OXDA 2PHKA 3FQEA 3DOGA 2G15A 3QA0A 3R83A 4NUSA 3MY1A 2C6TA 3UIBA 2SRCA 1OL7A 5M44A 4FKGA 4EHVA 2BZJA 3W8QA 4IX4A 5HORA 1YXSA 4AZWA 5EDQA 5CALA 1URCA 5B7VA 3H3CA 5KMLA 4D0WA 3TM0A 3UTOA 2WELA 3GOPA 4CEGA 5A6NA 3OT3A 4IJPA 4JLCA 3WIGA 1AD5A 2BFYA 3MY5A 4NFMA 3RPVA 4KRDA 3UOHA 4CTBA 4EZ3A 4WRSA 3P08A 4YTIA 5J9LA 2QVSE 3HECA 4FKUA 4BB4A 4RWLA 4D55A 4QMQA 1BKXA 3ZEWA 4AXDA 2CLQA 3HNGA 2HK5A 2YCFA 3MY0A 4M0YA 1SMHA 3N51A 2WTKC 1HOWA 4I5HA 5LJJA 2BZIB 3ITZA 4YJNA 5AP3A 3VUKA 5CEPA 3UOJA 3SD0A 3AGLA 3IO7A 3DK6A 4UMQA 4I6FA 4EOOA 3GC7A 3G9NA 3GCPA 3CQWA 1H1PA 2J6MA 3I81A 3IGOA 5LOHA 2XF0A 3JY0A 4FSNA 3LIJA 1Q62A 4BWXA 4IDTA 4KKGA 4BJJB 1PYXA 2UW0A 3NUXA 3OF0A 3HVCA 2YIRA 4I0RA 5CVFA 4ENYA 2C0IA 3E5AA 4LMUA 3ZXZA 1Z57A 5IZFA 2OJGA 3D0EA 4LI5A 2OFVA 4O82A 2VX0A 4G9CA 5HBHA 4AU8A 3D7TA 5LVOA 4JG8A 2YZLA 5IISA 1QPCA 1ZRZA 2XK8A 5J87A 5B2LA 5L8LA 3NW6A 3KEXA 5JZJA 4NKAA 3V8WA 4IW0A 3ZZEA 4GKHA 3DCVA 3DGKA 4KS7A 5ACKA 3ANQA 3BGQA 3G2FA 3F66A 1JNKA 4GIIA 5EYMA 5HD7A 4ZY6A 4CT2A 4FJVA 1YDRE 3QUEA 3HRCA 4DCAA 2R3MA 4MNFA 3KULB 3QXPA 1Y6BA 5GJGA 3TN8A 3QL8A 4FK3A 4DT8A 4EK6A 2WTKB 1XWSA 2DYLA 3E93A 2CDZA 4GK4A 4JX3A 4D2WA 5HOAA 4CFNA 2GS2A 3QRUA 3TV6A 4M13A 4EH5A 4IAIA 4OUCA 4W4XA 3FMLA 4JI9A 5DFPA 3BLRA 3ORMA 4LV8A 1QPJA 3CLYA 3EKNA 5LWMA 5F94A 1R78A 2Y4PA 2BALA 1OGUA 3BYVA 4GUEA 4KBCA 2C68A 5M09A 3ZMMA 3BELA 4NSTA 1OIUA 5JT2A 2W4OA 4MBLA 4C0TA 4HZSA 2I0EA 2YM8A 4F08A 4DLJA 3L9PA 3N4TA 4LL0A 4XG7A 4RJ8A 3VQHA 5M4CA 4K9YA 5AX3A 1YOLA 2R7IA 3IW7A 3LQ8A 2QODA 2CNQA 1PMVA 1P4FA 2UVXA 4QMZA 2XS0A 4WG4A 4D2RA 3LXKA 5CEIA 3E8CA 1ERKA 4O6LA 5I9UA 3AT3A 3G51A 3ERKA 3MH3A 2BROA 3OUNB 4NCTA 3OVVA 4R7BA 5L2TA 4O0WA 3CGFA 5AIKA 5KMMA 3K54A 5LVNA 2J51A 5AR3A 3Q5IA 3FYKX 3Q4ZA 5M4FA 3SOCA 2R3PA 5CVHA 5JK3A 2WOUA 3HDMA 4U7ZA 4CT1A 1UU9A 2UZUE 5K4IA 2A0CX 2A2AA 4FEVA 4MQ1A 2WMBA 4MTAA 1VLRA 1DAWA 4C36A 4I5PA 3IOPA 3ATTA 4MWIA 2NYAA 2I40A 1IASA 4G17A 4YBJA 3W1FA 4WKQA 3Q5ZA 5AAFA 4XJ0A 3TZ7A 4DFZE 1PXMA 2J0LA 4FV5A 2X9FA 4FV3A 3NNUA 2F7XE 2VO3A 4IB0A 2EB3A 3NX8A 2X8EA 4ORKA 3H0ZA 2WQNA 1OKYA 2ESMA 3LLAA 3Q9WA 2W5AA 2C5XA 4EH9A 4H36A 4P4CA 5FEQA 3SQQA 5DYJA 4DTKA 3ENHA 2IW9A 4OTHA 4E20A 4O4FA 2DQ7X 2Z7SA 5EM6A 4ERKA 5M08A 3HX4A 4F70A 2GNHA 1R1WA 4A9TA 4IAFA 5BYYA 3VW6A 4F1TA 3RNYA 3ZC6A 1YHSA 3FLWA 2C6OA 4DH5A 2OZOA 5CSVA 4MEDA 4OT6A 5I0BA 5JQ5A 1YI4A 4QPSA 4OBQA 5CSHA 3JR1A 1Q8TA 4FZAB 1W2FA 3VAPA 1XBCA 3EZRA 3R8VA 4XHKB 5DR9A 3D7TB 2W1ZA 4ZY4A 5HO6A 3RK7A 4BN1A 2H8HA 2VWZA 4XUFA 1LUFA 4XS2A 4U45A 5DRBA 3RPOA 4D28A 1Y6AA 4Q5HA 3L8PA 5KHXA 5HO8A 3R7IA 4Y95A 2Y9QA 4C59A 3AKKA 4JMQA 3U6JA 2PU8A 5E1EA 2VNYA 2R7BA 3DZQA 5AV2A 4BCIA 5AJQA 4F0GA 1SNUA 2BILB 2WMTA 4FTRA 4DGNA 4QMNA 3G9LX 1DM2A 3GCUA 4ANQA 5HX6A 2YERA 2ZOQA 4LMNA 5L3AA 5BVKA 3DXNA 4EOMA 2XP2A 4FEQA 4GG7A 2C6KA 1R39A 3GU8A 5DOSA 3OW4A 3OW3A 5AP2A 3WZUA 2EXCX 3COMA 1NY3A 2X7GA 2GNFA 3HMOA 5CSWA 3MDYA 3FQHA 4ZY5A 3DK7A 1W98A 4TNDA 3BGPA 5EHOA 4MBJA 5F20A 4Z7HA 3FYJX 4ERWA 3U6HA 4DDGA 1H0WA 3LMHA 2X2MA 4CCUA 2BDJA 2OXYA 1XH8A 4DG0E 4QOXA 2R9SA 4QQTA 4BDBA 1WBVA 1ZYDA 4H05A 3SA0A 4JOAA 4O7ZA 3Q6UA 4FIGA 4QTAA 5EM5A 4Z55A 2R3LA 4BDKA 1YI3A 4R3PA 3GEQA 4FSWA 2QKWB 1WCCA 3R8LA 3BWFA 4AX8A 3Q60A 5CAVA 5IQBA 2WTJA 3F2AA 3SG9A 3FHRA 5TE0A 3TG1A 5EYKA 2C5YA 4IC8A 3W0NA 2R3OA 3QZFA 3MS9A 4XG2A 5DR2A 2A4LA 3P7CA 3QHRA 1LEWA 3QA8A 3W55A 2E9PA 3BCEA 4JBQA 1OVEA 4Y46A 1ST0A 3W33A 4F9AA 2XJ2A 4IFCA 4TWOA 3KQ7A 2ITNA 3II5A 2VU3A 5E8XA 4R1VA 3FXZA 3CCNA 4YJVA 5EDRA 3TV7A 2UVYA 4DGOA 4RLKA 5AP1A 4PDOA 4E6QA 3NYNA 4BY9E 4YNOA 5EW9A 4QYFA 1OUYA 4FKQA 5FUTA 2GMXA 3EFWA 4JDIA 3VO3A 2HW6A 4AT5A 1JKSA 5AFVA 4YZMA 4QMYA 3SVVA 2PMIA 5JGBA 4B7TA 1SVGA 2FSOX 3JS2A 4GK3A 4L6QA 3V8SA 3ZLYA 4Q9ZA 4FTQA 1J7IA 3GOKA 3OTVA 4QP9A 3NVMB 3RM6A 3EN5A 3KXMA 1V0PA 2WPAA 4WNOA 2E2BA 4TYGA 2HWPA 1URWA 3BHTA 1ZWSA 2YISA 3VJOA 4CRLA 3UYSA 3FMHA 1P14A 2FUMA 5IH4A 2YZAA 4ZSAA 3PVWA 5HKMA 4V01A 1H8FA 1W8CA 2AC5A 1ZXEA 3VBXA 4FV7A 4C58A 3MB7A 2Y6OA 2WMXA 4HPUE 3NNXA 2W06A 3H0YA 2P4IA 2A98A 3HMMA 3H9FA 2DWBA 3HA6A 3D83A 4BDHA 3DY7A 1G5SA 5J8IA 4C2VA 2F4JA 5HD4A 2BAKA 4CFFA 2OZAA 3PPJA 4NU1A 3COKA 3QHWA 1Z5MA 2CGWA 3MYGA 5AR2A 2UZLA 5C9CA 2OIBA 4JS8A 4DFYA 4D1ZA 2X8DA 2G9XA 4XV3A 2UZWE 2JDRA 4DFNA 2PE0A 3F5XA 3TIYA 3UIUA 4PV0A 1XMLA 2OJ9A 1WVYA 5E91A 5GHVA 2QOOA 2XKDA 2HZNA 3R0TA 1Q61A 3C4FA 3TKIA 3QWJA 3F9NA 2O65A 4LYNA 4O22A 2R2PA 3VS1A 3VONA 1GIIA 3C5IA 2I0VA 3ACKA 3I1AA 2PUIA 1Q3WA 3V5QA 3NGAA 3Q2MA 2EVAA 3KF4A 3MA6A 1YOMA 1WZYA 4RZWA 1M7NA 3VVHA 3NW5A 5J7BA 3F3TA 3SX9A 3GU5A 4YNEA 2CKOA 1HCKA 2J0MB 3O5AA 3PLSA 4YJRA 5A4QA 5GIPE 1FMOE 2VX3A 5L6PA 3LJ0A 4WSYA 2ERZE 2PVRA 3F3VA 1UVRA 2EXEA 4C3FA 3P7BA 3O0GA 2C3KA 2B9FA 4M14A 4YURA 1PXOA 4DEDA 1H25A 3BRBA 2VWWA 5BVNA 3CEKA 4YJOA 2JBOA 2PVYA 3PWYA 3D5UA 3F5GA 2HY81 2X9EA 4OTPA 2W5HA 4C33A 2ZAZA 4YZDA 2WQBA 4HJOA 4EBVA 4AE6A 1WAKA 4AUAA 3GCSA 4GVJA 3FKLA 2H9VA 3NUAA 4IH8A 1A9UA 4IWDA 4KWPA 4RVTA 5EFQA 2Q83A 2AYPA 4XX9A 3GCQA 2E9OA 1W84A 3TWJA 4F9CA 3PJ8A 3M11A 4OTDA 4KRCA 4P7EA 4RSSA 2JBPA 2X4ZA 2OIQA 2R5TA 2X2LA 3OXTA 4L52A 3ZHPC 3VBQA 4XMOA 4FZ6A 5DWRA 5E8ZA 3Q9YA 4R77A 4FZDB 2BRGA 3NCZA 1OIRA 3PY3A 3GC9A 4MK0A 4U8ZA 3D2IA 3DAKA 3DTWA 4KA3A 3PA5A 4RC3A 4MVFA 3PUPA 2FB8A 3D2KA 2IJMA 3VS0A 3A7JA 3VBYA 5DEYA 3BU5A 4AQCA 4BTJA 4RG0A 4AG8A 2P0CA 2RFEA 4AZEA 1XH9A 5IQDA 2GHGA 4ZS0A 1K9AA 4LRMA 3QGWA 1BL6A 3PFYA 3NCGA 2WMRA 2Z60A 3C51A 2O64A 4RMZA 4U97A 3TNWA 3B2TA 3AXWA 3FLQA 4ZTQA 3ORKA 3DBCA 4G6OA 2NRUA 3VUGA 2CGVA 4I93A 3UQFA 2W99B 1OPJA 2X2KA 1CKJA 3R7GA 3AC3A 4JXFA 4JX7A 3D14A 3DTCA 3LQ5A 1QMZA 1GIHA 2YACA 5HICA 5CASA 3Q2JA 4HNFA 3ORLA 3VUHA 3NEWA 1H0VA 3W0RA 2YCSA 4WG5A 4UWYA 3ZS5A 4QRCA 3ML1A 3GC8A 3SKCA 1IEPA 4CMTA 1M17A 2XM8A 4UY9A 4DG3E 3LLTA 5C8MA 3IW4A 3LPBA 4MBIA 2JKMA 5E8VA 4XOYA 4MHAA 3BPRA 4FKVA 4WBOA 3SAYA 3OWLA 3R28A 2ITZA 1YW2A 2BTRA 3UGCA 3TV4A 3Q32A 4E8AA 5HO7A 3QGYA 1WBPA 4YPDA 2R3HA 3MW1A 1FMKA 2JKQA 5T3QA 4EEVA 5ANIA 2C6MA 2YDIA 5HX8A 3KA0A 4J95A 5LVPA 3RAWA 2YITA 4XLVA 3L8SA 4OAVB 4ZMFA 4FK6A 4GFMA 3SW4A 4Q2AA 1DI8A 1IA8A 4PPBA 3WIKA 3EFKA 2OK1A 1PXJA 3TZMA 4O96A 4XV2A 5AUXA 1Q8ZA 5KE0A 4RJ6A 2HCKA 4BDDA 3FHIA 4ITHA 4QNAA 3G0EA 3GUBA 4BIDA 3PXYA 4YZBA 3NLBA 5HE0A 4O4DA 4BDEA 2VWIA 3IW5A 4RJ4A 4FTCA 4U0IA 2QQ7A 5K0KA 2I6LA 4CFMA 4OTIA 3V5JA 4KABA 2WHBA 3KF7A 5AA9A 4ZIMA 1XJDA 4PTCA 3KCFA 4JL9A 3KN5A 3WBLA 4PTGA 2WMVA 3EQFA 1NVRA 2IZUA 3L1SA 4GSBA 4I0TA 4QT1A 3S4QA 3VC4A 3E87A 4B8MA 2VNWA 4IHPA 1G8KA 3DB6A 4O7LA 4G1WA 2W9ZB 5DLSA 4YC6A 1TQIA 1O6LA 2X0QA 2IVSA 1T45A 4LRJA 4FZFB 2JAVA 3E92A 3QRIA 2PUUA 5JRQA 5JN2A 3W0SA 2NNWB 2OG8A 4A4OA 4E4XA 1U54A 2XBAA 4ALVA 2DS1A 3FC1X 2XCHA 5AAGA 3HV4A 1YHWA 3HGKA 3MPMA 2HXLA 3PY1A 4JRVA 4W9WA 4ZSJA 2ITUA 2HZIA 4LV5A 3VS6A 4UYNA 2WOTA 3P5KA 1JPAA 3CJFA 3OCSA 3NIZA 1XH7A 2HYYA 5ETIA 4DEGA 2ZMCA 3DNDA 5EW3A 3V5LA 3P5JC 2R64A 3RHKA 3HAVA 1VYWA 1F3MC 4R7HA 3OOMA 3E62A 4R6VA 5ITAA 3FQSA 4XOZA 2JAMA 2P33A 3C0GA 3E3PA 4O7SA 3HP2A 4AA5A 4YJPA 3FI4A 5L2QA 4QP3A 4AT4A 4FL3A 4XYFA 4EYMA 4DGGA 4G3EA 3EYGA 4GUBA 4RA5A 3ZRMA 4ASEA 4EL9A 5CAQA 5CAUA 2F2CB 3LMIA 2QR7A 3ELJA 3MVJA 2C4GA 2CGXA 5CT7A 4FG8A 2WD1A 1JQHA 1NVQA 3SHEA 2YM5A 3G5DA 3UZPA 4QMVA 4D4RA 4DEEA 2XMYA 4C7TA 2QLQA 4F0IA 5IEVA 2ZDTA 2J7TA 1YOJA 3A8XA 2QI8A 3PIXA 4QNYA 3F5PA 4J97A 2UZEA 3U8WA 4F7SA 4ZLZA 2PVLA 5FEEA 1WBOA 1KSWA 4DFLA 1L3RE 2VRXA 4I6HA 4OBOA 3U51A 3EQPA 4NM0A 2IZSA 3GQIA 3HV7A 4QDEA 4AAYA 1UA2A 2XRUA 5BVFA 4X3JA 4PNIA 4C62A 3V04A 3RALA 4R7IA 5BUEA 3EN7A 3PXQA 3W2CA 4CFXA 3ZFYA 1YRPA 2R3QA 2F9GA 5E7RA