4R3CA

Crystal structure of p38 alpha map kinase in complex with a novel isoform selective drug candidate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
349
structure length
335
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Targeting human central nervous system protein kinases: An isoform selective p38 alpha MAPK inhibitor that attenuates disease progression in Alzheimer's disease mouse models.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 335
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4r3cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4r3cA01
1XJDA 4M66A 3DB8A 4MWHA 4FNWA 4ITJA 2XJ1A 5EK7A 5TF9A 3MJ2A 3OW4A 4EC8A 5CF5A 5EM6A 4D2SA 2IZRA 3PG3A 3QD0A 3SXSA 3VUHA 4B9DA 4D4VA 4O7SA 3EH9A 3QBNA 1DAWA 2YZAA 4FKSA 4K0YA 2WAJA 5FWKK 4C38A 5BYZA 3FV8A 4WIHA 4QPAA 5GNKA 4H3BA 1YI6A 4D58A 4QTCA 3K3IA 4O0VA 5C1QB 1ZRZA 3UTOA 4MNFA 3TUDA 2ETRA 2OI4X 1JOWB 2JBPA 2VN9A 2AC3A 2GMXA 2X39A 3BU5A 4MXZA 4OTWA 2BDJA 2C6OA 3OF0A 3Q53A 3Q5IA 4RC3A 5E4HA 3U6IA 4UBAA 4IVBA 3D15A 4PP9A 3EQIA 3BHVA 3P08A 1T46A 4JBPA 2FSMX 1XQZA 2C0IA 5CNNA 3DS6A 1LEZA 2R3LA 5F20A 4ALWA 4X2FA 1CTPE 3C4XA 4TWOA 5E8WA 3VRYA 4DF3A 3TZ7A 1P2AA 4Y5HA 1KE5A 1U46A 1FVRA 2EXEA 3VUIA 3QZGA 3QWJA 4P2KA 3W8QA 5A54A 4O38A 4ASXA 3MW1A 1UVRA 4BI2A 4ZTNA 3FZ1A 3L9NA 3NR9A 4YJPA 5AR4A 3NS9A 3ULIA 3MH2A 4CT1A 4MVFA 4LGDA 4NSTA 4C0TA 1T45A 4JIAA 3DB6A 2QHMA 3CIKA 4NKAA 5HEZA 4I5CA 2OWBA 2VAGA 4R6VA 3QX4A 4PTGA 2DUVA 1NVSA 2PWLA 2XNEA 4DGOA 2CDZA 3P0MA 5CLPA 4G2FA 4ZAUA 2Y4IB 2Z7SA 4F4PA 5E90A 2W1GA 2IVSA 4RA5A 2YLEA 2WZJA 3SG8A 2ZJWA 4C36A 3FUPA 3DPKA 5EDRA 2JKMA 2ERZE 2HY81 3H0ZA 3NYNA 1GZ8A 4MXAA 4QTAA 2GPHA 4JG7A 4FEUA 4I5MA 4M12A 5F94A 3V3VA 4QMUA 5HG5A 5AP2A 1TQMA 3GC9A 2XM8A 4YTHA 3VJNA 4BKZA 4AE9A 3RALA 4C8BA 5KMNA 3TDWA 1YXSA 4FC0A 4FIHA 4M97A 3BHTA 5D7VA 2PVKA 1J1BA 4ENXA 3G0FA 2RG5A 4XV1A 2C47A 2J51A 1GZKA 4DFNA 5CF4A 3FMEA 3KA0A 2YN8A 2PVJA 2QR8A 3D0EA 2OBJA 3FY0A 4IM3A 4MKCA 4BGGA 1SYKA 3UZRA 1JKSA 3PIXA 5L6OA 1A48A 3PJ2A 3QZFA 3TTIA 1UNLA 3VQHA 4YZNA 4PTEA 3NUNA 2RFDA 2XK9A 4XLIA 3O7LD 5E1EA 4BWXA 3IOPA 3PXKA 3OHTA 3CLYA 4FUXA 5F4NA 5FEDA 3PP0A 3QWKA 1CM8A 3HEGA 1GAGA 3O17A 4RG0A 2ZDTA 5ACBC 4D5HA 1RE8A 4ALUA 3C0GA 3V5PA 5J5SA 2XK6A 3BGZA 3OBJA 4EHVA 4FX3A 3KL8A 1O6YA 5FM3A 1YXVA 3I6UA 4GT3A 3RHXA 3E8EA 4BFMA 2OJJA 4IVAA 3RCDA 5DT3A 3LKMA 2YLFA 3PA5A 5ANDA 4AA5A 4I20A 4NW6A 3VBVA 3I7CA 3V04A 4PPBA 5L8JA 5EW9A 3BGPA 4B6LA 4UMTA 3E92A 1WBVA 2QO7A 3QKKA 3UOJA 1IEPA 3OCGA 3KREA 2YERA 5IQFA 1SVEA 3OVVA 4GCJA 4JR3A 1OZ1A 3HUBA 5JKGA 1R0EA 4OTPA 4YUQA 1Q61A 1HCLA 3QCQA 5DFPA 2H34A 3Q52A 3MB6A 2WQNA 4BL1A 5KMKA 3ODYX 3QF9A 4QMWA 3R7YA 4F65A 4FTKA 4IM0A 1GOLA 3SAYA 3ZZWA 3VBYA 4C7TA 2WQOA 4QTDA 1F3MC 4U0IA 2ITVA 3UDBA 2X81A 3QQFA 3PY3A 2OF2A 4QP8A 2WTDA 4IIRA 4CTBA 1NA7A 2ZAZA 2Y4IC 1U5QA 3IS5A 4FKJA 4A07A 4ZJVA 1GIIA 4WNMA 5L2WA 4HVSA 4TW9A 4EH2A 3BE9A 3NCZA 4M69A 2PY3A 5AUVA 4USEA 2JBOA 1H4LA 3DGKA 4GVAA 4R7IA 2X2KA 3QTRA 5BPYA 2ITXA 3BYSA 1M17A 2XA4A 3HMMA 3KMUA 4QQCA 5ANEA 1QL6A 5A4EA 2YM8A 5E1SA 2XNOA 3G5DA 2R9SA 3ENMA 4JQ8A 3ZDIA 4JBQA 4L6QA 4WD5A 5CSWA 3RK7A 2XCHA 1YDSE 4I6QA 5CZHA 2C69A 3SVVA 5FRIA 3ZLXA 2X6EA 3FLQA 4DBXA 4Z55A 2JD5A 3MBLA 4O0RA 5AUZA 1BL7A 4KRDA 1OECA 2W17A 1F0QA 4ANLA 4KWPA 2IW8A 5DVRA 4EH6A 4LMNA 4DT9A 3RGFA 1W98A 3ATSA 1VEBA 3Q96A 5HZNA 4BR3A 2W0JA 1GIHA 3OT3A 4PL5A 4L46A 4TT7A 5HHWA 5IDNA 4IX4A 4BDJA 3DA6A 5FLFA 1DI8A 1UU9A 4AW2A 1UKHA 2PVFA 2VTNA 2WU6A 3LMHA 4CFVA 5E8YA 3AC2A 4OUCA 5LVOA 2E9UA 1OIUA 4IZYA 3WILA 4EK6A 4CV9A 4G17A 3QX2A 3QTZA 4F9YA 4MQ1A 4UXLA 2OJFE 4G6NA 1ZYJA 2RG6A 4DFBA 4MBLA 1H26A 1KWPA 1Q8UA 5AUTA 3BIZA 5CXZA 3OW3A 4EOMA 3TV4A 4IZ7A 3C9WA 2I40A 3ANQA 3BLQA 3HA8A 3JS2A 4JAJA 4O96A 3DQXA 2W1FA 3TV6A 4CYJA 2OICA 2UZOA 3GU5A 3LCKA 3G90X 2UZNA 3GB2A 4FBXA 1OPJA 4RVLA 3ZC6A 4JR7A 5AMNA 3FY2A 2YIQA 4GYIA 3ROCA 4A4XA 2UZWE 4LG4A 4W4XA 2JGZA 2BCJA 4PNKA 2F4JA 4NIFA 4EH4A 2DWBA 3BI6A 1YDTE 2WKMA 4NCTA 3FDNA 3V51A 4ANMA 4C02A 3KK8A 4Z7HA 3CKXA 5IEXA 1H25A 4UWYA 4YTFA 2FA2A 5CS6A 3VO3A 2CKQA 1FMOE 3GU7A 4HGSA 2PTKA 3MY1A 4WRSA 5CXHA 5CQUA 1Y6AA 3TZ8A 3L1SA 4AGUA 3CTQA 3O51A 4IX6A 5KX8A 3VWAA 4GIIA 4RLKA 4A06A 4ZS4A 3AT4A 3F7ZA 4FKUA 4ANNA 3IQ7A 4BTMA 2UW4A 3AXWA 3NW7A 2PK9A 3PIZA 4IAZA 4G9RA 4ZEGA 2YISA 4FZ7A 5BVNA 2G1TA 4XOYA 3DLSA 4FSNA 5EYMA 4LL5A 2BKZA 5FP5A 3LFFA 1BMKA 4JXFA 4AXAA 2GHLA 4WT6A 1OKVA 1YXUA 4FYNA 4FV1A 4Y5QA 1O6KA 4GYGA 2XKEA 4DH7A 3BRBA 2VX0A 5CSPA 3KRWA 2CGUA 1P14A 4EJNA 3DBEA 4U42A 2YWVA 1KE9A 4ZJIA 3DJ6A 4NIFB 2RFEA 4OW8A 1JKKA 4DG3E 4CG9A 3Q2MA 4DC2A 5IQIA 3EN4A 3WF5A 4CMTA 4L8MA 2F49A 4EK8A 4A9YA 5FM2A 4FF8A 2CLQA 5KHWA 3SW7A 3RNIA 1V1KA 4QMPA 3ZXZA 3QCSA 4J95A 4FK3A 4RLLA 1PY5A 3VRZA 3EL8A 4ZTMA 5IU2A 2VTIA 1JSUA 5EM5A 4K11A 2Y7JA 4TZRA 3ZYAA 4CCBA 5EDQA 1PYXA 3OBGA 3I79A 3PY0A 4JDKA 5JZNA 3UO4A 4DFLA 2JFLA 2X2MA 3KRLA 4I4FA 2XBAA 4RJ7A 5CU6A 3VULA 3C1XA 1Q8ZA 3V5WA 4AZEA 3MWUA 2UV2A 4FIGA 4DTKA 5HVJA 1OKWA 3DZOA 3LM5A 3TDVA 3AT3A 4FKRA 5CU2A 4MF1A 5M57A 3LFDA 3R7VA 1PXPA 4DHFA 5E92A 2WMSA 3SXRA 3ZRLA 3CY2A 5FDPA 4CSVA 4AE6A 3FMHA 4DEDA 3A7HA 3V8SA 2FB8A 4F09A 3FLWA 2WEVA 3W2RA 3MA3A 3CY3A 4U5JA 5J79A 3L9PA 1J7LA 2DQ7X 5HD7A 3GCQA 2GHMA 3D83A 3VUDA 4FI1A 4JNWA 2YIYA 2IZUA 5HICA 3ORIA 2C0OA 4X2NA 4G16A 4KKEA 5LMBA 5LCJA 3NCGA 2UW6A 3ZRKA 3L8XA 4DGNA 2CKOA 4LOPA 2P4IA 5IKWA 4IHPA 5L2TA 3OCTA 4WHZA 3DJ7A 5E8VA 4ZK5A 3HUCA 4V0GA 1XH4A 4OT5A 4QO9A 2WGJA 3T9IA 3H0YA 3A8XA 2JC6A 4CKRA 2QOIA 2OZAA 3TUBA 5FGKA 4L3JA 3R7EA 4RWLA 3F2NA 4W4YA 3UG2A 2I0YA 4M15A 4A9TA 4ARKA 1BI7A 5IZFA 3UPZA 5DYJA 5CAQA 2ZV8A 3TJDA 4IC7A 5KMMA 1O6LA 3AC1A 2BKKA 1AD5A 3HV3A 2WHBA 5TKDA 2CNQA 1YOJA 3VS6A 2X2LA 2XS0A 3QLGA 4BBFA 4E5AX 3PWDA 5EYDA 5FTOA 4BDGA 4D9TA 4DGGA 4CVAA 1PXNA 3WF6A 2IWIA 3MVJA 1OVEA 2XYNA 2G2FA 3PVWA 4FV6A 4QMMA 2IW9A 2NP8A 1DAYA 3R01A 4IB0A 4KBKA 4ASZA 2XK7A 5E8SA 3LXLA 3UGCA 4EH8A 2JAMA 1ZAOA 2QHNA 3IECA 4XP2A 1OL1A 4J71A 4QT1A 4BIBA 4QMVA 3CKWA 4ANSA 5K9IA 4TPTA 4RSSA 3IW8A 4O7VA 2BZHB 4U45A 2JAVA 3IW5A 4PRJA 4YJQA 5IH4A 3TI1A 4ZS0A 2VO7A 3MH3A 3VS5A 5M08A 3A4PA 3R6XA 4V0GB 3T3UA 5CSXA 5D12A 5FXSA 3QQKA 2OZAB 3UO5A 2R64A 3G51A 1PXIA 3GVUA 2I0HA 2P3GX 3RPSA 4TWNA 4BRXA 4YZCA 5GZ8A 3UQCA 1OMWA 2HZIA 3PUPA 3W55A 4EI4A 1P5EA 3NW5A 4DEAA 3OXZA 1YOLA 4C2WA 5DMZA 4MXOA 1FBNA 1NT2A 4NWMA 5ANJA 3ZBXA 3ZLWA 2OXDA 3ANRA 4HYSA 4IX3A 1U5RA 4PMTA 4Q5HA 4I93A 3OY3A 4FYOA 1H08A 3OS3A 4ZY6A 4GKIA 3D5XA 5CI7A 3RNYA 5I9UA 4PMMA 2Z2WA 2WQEA 2W5HA 4RA4A 4L44A 4E6AA 4ONAA 5BUIA 1IG1A 5IUGA 1S9IA 5CU3A 2Y0AA 3I5NA 5AWMA 3F9NA 1XBCA 1OPKA 4HVDA 1KE6A 2UW3A 2HXQA 4KB8A 4FSRA 3LLAA 3NSZA 4S32A 2UZTA 2WPAA 4JAIA 4MWIA 4F1MA 4FIEA 3N4VA 3F5GA 3LJ1A 5EHOA 3AC8A 4R7HA 2Z7QA 3Q9ZA 2R3GA 1PF8A 4BI0A 3DOGA 5KMOA 3CP9A 2XK4A 2IVUA 4TKSA 3QTIA 5KUPA 3SOAA 1OM1A 2XKDA 5ETCA 4ASEA 3VC4A 3PRFA 3EZVA 5D9HA 3EN9A 3UIMA 2R3KA 2YM4A 4KINA 3UOHA 4F9BA 2BZKB 4DT8A 3OP5A 4S33A 1GJOA 2GU8A 1YHWA 2AUHA 2UZDA 4BCQA 3PLSA 4FNZA 3WF7A 2I6LA 4RVKA 4BI1A 3C50A 3QZHA 3MGYA 1ZMUA 3FI8A 5TR6A 3C51A 4F0GA 4AWIA 1AQ1A 1EH4A 2A27A 2J50A 3B2WA 3G6GA 2GQGA 4RIWA 3PLAE 3LW0A 3ZONA 4P5ZA 3G0EA 2C5YA 2A4LA 4XMOA 3AC5A 3A62A 3DDPA 4JX3A 5AJQA 3REPA 4EUTA 3TKHA 4HCUA 3R9HA 4DYMA 1E1VA 2ZMCA 2BIKB 3TV7A 4IZ5A 3VUMA 1H8FA 4O91A 2Z8CA 4K77A 1NVQA 5ETFA 3PA4A 1UV5A 2F7XE 4BIDA 4X7QA 1J1CA 5DG5A 1PW2A 5J9LA 4YO4A 4KABA 1GZOA 1DI9A 3AD4A 3L8PA 3KF4A 3CEKA 1K2PA 2C3LA 3FMLA 4P90A 4QP6A 3ORTA 4XRJA 3PVGA 2X7FA 2CPKE 4D4SA 4BDKA 5C9CA 4NYEA 2WTKB 4WSYA 4AS0A 3ACJA 3GT8A 1G3NA 2YEXA 2O63A 4ZSGA 4FZAB 3U4UA 3WBLA 4FGRA 1RJBA 1SNXA 3SXFA 2OIQA 4Z16A 2BHEA 5AUWA 2ESMA 3PXRA 5C03A 5A14A 2ZV9A 2ITNA 3DNEA 4O6LA 4W9XA 4X21A 3GI3A 2A0CX 2HZNA 5E8ZA 2QURA 3LXKA 2AC5A 2H8HA 4IFGA 5HIDA 4YU2A 2B9IA 2W1IA 4EQCA 4YJSA 3TACA 4HPUE 3I81A 4TYGA 5AP7A 3RM7A 4EZ3A 3ELJA 3G15A 4DEEA 4JDIA 2JDTA 4XS2A 4RPVA 2VWBA 4WNPA 4W9WA 5ANKA 5CF8A 3LM0A 4WUNA 5KO1A 3F3VA 4HGTA 4DTAA 4XYFA 3BLHA 1KSWA 1Q62A 2LGCA 3DFAA 3POZA 4OAUC 3FI4A 3QC4A 3D7TA 1PKDA 4F99A 1OPLA 2WMXA 2XNNA 3TJCA 4Z7GA 4BWPA 2YCQA 4GVJA 4C4HA 2C6TA 3UVRA 3ZEWA 5CYIA 3O7LB 4EJ7A 3HV7A 2X8DA 4UYNA 4ZTQA 2VX3A 2VO3A 4O22A 5HLWA 3GENA 3SGCA 3FKLA 3FMDA 3I1AA 2XIYA 3W16A 1W0XC 5AV4A 2CNUA 4HYHA 3RHKA 2R4BA 4B8LA 4I94A 5I9XA 1B39A 4C3PA 1J91A 4YP8A 2ZB1A 3EN6A 1RDQE 5FTGA 2J0IA 4BGHA 5IISA 3G6HA 1HCKA 2QO2A 5L6PA 3U4WA 1ZARA 3D5WA 4AF3A 5CX9A 2G2IA 2VTJA 3EQFA 4RZWA 4U8ZA 5JRQA 4GUEA 3QUEA 4IAFA 4QQ5A 2OSCA 3ZH8A 4BKYA 5IMXA 1OL6A 2YFXA 4FT5A 3GC0A 4JBOA 5DT0A 3ZU7A 4NK9A 4IJPA 5A4TA 4Y95A 2W9FB 1WBNA 4RIOA 3R8LA 4FTCA 4QD6A 3N4UA 4FKLA 4DCAA 5BX0A 5BVWA 5EOLA 4YJRA 3BPRA 2ZV7A 2X8IA 4DEGA 1UA2A 2CSNA 4AGCA 3KRRA 2WTIA 2B1PA 2GNGA 2B52A 3R02A 3QRIA 5F1ZA 1PKGA 3QQHA 4FTTA 4HYUA 4MQ2A 3GU8A 1W8CA 2ONLA 4DEHA 1NW1A 4J53A 2WTKC 2RF9A 4FT7A 3UO6A 4D2VA 2EXMA 4N4SA 5IA2A 1FVVA 1YXTA 4FICA 1IA9A 3ZO2A 3UODA 2B54A 5TT7A 3EHAA 3FXWA 5LXMA 5EHYA 4J8NA 3MIAA 3U9CA 4G34A 2EB2A 3EKNA 4G9CA 4IVDA 1O9UA 2QNJA 3EQRA 3JVSA 1JWHA 3LIJA 5HBJA 3RAKA 4DFXE 2E9VA 4C3FA 4RJ6A 3VNTA 3HKOA 4FEQA 3NRMA 5GZAA 5B2LA 3FXXA 3F88A 3RPOA 1Q8TA 4TXCA 2QQ7A 5I9WA 1QMZA 3LFSA 3QTQA 3CQUA 1YRPA 3BE2A 3R1QA 3UP7A 2BRHA 3LFAA 3RPYA 2R3RA 5K3YA 3M1SA 2UW5A 4UWBA 4QTEA 2HENA 4W8EA 4WNKA 4ZTHA 2GS6A 2VTRA 1FPUA 3VAPA 4ZZNA 4D2RA 3LLTA 2PVRA 3QQLA 3K5UA 1JKLA 4FSUA 5AIKA 1QPJA 3IK3A 4C59A 3PTGA 3V5QA 4YC3A 5J7BA 2PSQA 4BN1A 1UWJA 2QODA 4FG7A 3GQIA 2GNJA 1MRVA 4YHFA 4AZSA 3NYOA 4BDAA 4GEOA 4D1ZA 3Q32A 4YBKA 4EOLA 1ZYDA 4U43A 1G8SA 1KV2A 5CVFA 5J9YA 3P79A 4HGLA 4DFUA 4PUZA 3LJ0A 2ZM4A 4CFUA 3C5IA 2VX1A 5HORA 3QD2B 4QPMA 1H28A 4X0MA 3ZUUA 4E73A 1CKPA 3D94A 2V7AA 4KNBA 2A2AA 4E6QA 4F6WA 2X8EA 4FSYA 3QRUA 4MH7A 4HCVA 1KOAA 4L45A 2CCIA 4W8DA 5IEVA 3COHA 1WBTA 1V0BA 2RGPA 3TM0A 4O6EA 4M0YA 4L67A 4XG6A 5DA3A 1ZXEA 5CVGA 1UU3A 3PWYA 5H8BA 3DK3A 5GJGA 3NUYA 3L9MA 4L7SA 3LCSA 1KE7A 1Y8GA 5DT4A 4TNBA 3W10A 4JT3A 4E5WA 1XBAA 3ODZX 3F6XA 2W1HA 4H3PA 4UZHA 4G3CA 5AAGA 3EN5A 4RX8A 4A9SA 3QD3A 3EQGA 4KBCA 2BFYA 2PPQA 3MDYA 4QMQA 2BROA 3QQJA 2XIRA 4BTKA 5HIEA 4DA5A 4HNIA 2WQBA 3NVKI 4QNYA 3GCUA 2X7OA 4WKQA 1OBDA 1J3HA 4ZY5A 2HZ0A 3UOLA 1KV1A 1OL2A 5CT7A 2BAQA 3HGKA 4RBLA 2G01A 3S1HA 4MNEA 3TL8A 3MPAA 3BV3A 1RW8A 4FT0A 4QMOA 3ZSHA 4CRLA 2QKWB 4MD7E 3L9LA 5EYCA 4NM5A 2VGOA 3M11A 3NGAA 4FVQA 2OU7A 1PXJA 2OFUA 1OUKA 2W5AA 3CC6A 4FR4A 4EONA 2IG7A 4EWHA 5IF1A 3RPRA 5M51A 5B2KA 5CEPA 3MB7A 3OCSA 4YGAA 3KVXA 3GNIB 5M4FA 4PQNA 5IPJA 3AQVA 5AP6A 5I9YA 2OO8X 5HGIA 4GFOA 1WVXA 4Q2AA 2OH4A 4WRGA 3R8ZA 1Q3DA 3QC9A 4JBVA 4QMSA 4O27B 4YURA 3A7IA 1R0PA 2NPQA 3F5UA 3MFUA 3MVLA 2CKEA 4HYIA 4L3PA 4W4WA 2OG8A 3V6SA 4BDEA 3WF8A 4EYMA 3BHYA 3PYYA 2PYWA 4DINA 5K0XA 3HYHA 4MF0A 4C33A 5A9UA 2UW0A 4CFMA 5JFVA 1LUFA 1H00A 1H1QA 4NU1A 5IA3A 4K8AA 2WMBA 5CEQA 3CPCA 3QAME 4EHEA 1H24A 4MAOA 3VS1A 4X2JA 5CANA 2R7IA 4MNEB 3MV5A 3NWWA 2ONLC 3LMIA 2WO6A 5ITAA 3LE6A 3BLRA 4ZMEA 2X1NA 5IH6A 5IQAA 4YJUA 4HVIA 5J1WA 2Y8OA 1OL5A 2XH5A 4ORKA 3BYMA 4JDJA 5LVNA 5CAUA 3QTSA 1JAMA 1GY3A 3E62A 3FWQA 3DBFA 3HRBA 3OUKA 5BUJA 5ICPA 2W5BA 4HPTE 4QP2A 3DKFA 3NIEA 4X2GA 4BDHA 4D9UA 5JGAA 3UG1A 3EWHA 3FJQE 5I3RA 5FBNC 4I6FA 3I7BA 4V04A 1PHKA 5EI8A 4BTFA 5H3QA 3HZTA 3NLBA 3GCPA 3HV5A 3TEIA 4MD8E 3O8UA 3R8VA 3N9XA 3WIKA 1JLUE 2HWOA 2XNBA 4O21A 3OROA 4R1VA 3WZKA 2YDKA 3DAJA 5AP0A 4O7LA 1E1XA 2C68A 2WTVA 3BQCA 3ERKA 4NEUA 4O83A 3NNUA 4KUJA 4UMPA 2AYPA 2FGIA 4TRLA 3DKCA 2YIWA 5FUTA 4RT7A 3U9NA 4UN0C 5I3OA 3EZRA 2PMOX 4PX6A 4QMYA 4OGRA 4XH6A 4AAAA 1YVJA 2ZOQA 4D1XA 4E93A 3ID6C 3FLZA 4FV2A 3P78A 3DU8A 5DEWA 4L9IA 3TTJA 4UV0A 4U97A 4AOTA 4FL1A 3O23A 2PVMA 3FLSA 5CNOA 2C6KA 3NZ0A 2P33A 4GG7A 5KZIA 4F9WA 4YNOA 3P23A 3ZMMA 2O64A 4BBMA 4OR5A 5CEIA 4HOKA 4XV9A 4FGBA 5DR9A 4APCA 4IACA 3SW4A 3ZO4A 1Q3WA 3QRTA 3AMYA 4EUUA 5AUYA 4UXQA 4YHJA 4E6DA 4O82A 4EH9A 5JMSA 3P7AA 3WE4A 4I21A 5ETIA 4ZZMA 3QA0A 1BUHA 4R3PA 5AX9A 4ERKA 4R78A 4YMJA 4CG8A 4CZTA 4E8AA 4KKHA 4EH5A 2OIDA 4RGJA 2C5VA 3CBLA 2UVZA 4HZSA 5M55A 4OTDA 1UNGA 3GXLA 4NJ3A 3BYUA 3NAXA 4K33A 1H0VA 4J52A 2J9MA 4YJTA 4B8MA 3LZBA 3KXNA 4WG5A 5LQFA 5DOSA 4BCNA 4EBVA 3H30A 4FTRA 3Q4TA 3WZUA 4PDOA 2FO0A 3OZ6A 3MVMA 3KN5A 3MFRA 4LV8A 1G5SA 1SVHA 2XRUA 4RQKA 1WVYA 3DAKA 5IH5A 3BEGA 3ZSIA 2WMAA 2V55A 2FH9A 3FZSA 1H1SA 3TT0A 5CEKA 1H1WA 4TY1A 3COIA 2ZV2A 2GCDA 3LQ5A 3OWPA 2IW6A 3E63A 1MUOA 3FI3A 4RWJA 2C3KA 2B9JA 1KOBA 1Y91A 4FTJA 1M7NA 2CGVA 3VIDA 4OBOA 4OAVB 2VNWA 5AA8A 3UIUA 5HBHA 2ITYA 4EBWA 4NM0A 1BX6A 5KMLA 3HV6A 5FXQA 4H58A 5BUEA 4XLVA 4BHNA 3DV3A 3KRXA 3RINA 2I0VA 4XUFA 1VR2A 3TZMA 2R0IA 3PG1A 3H9RA 2P2IA 4AT3A 1OKZA 4ACDA 5JQ8A 1H07A 4FL3A 4IANA 4UEUA 2C5XA 4Y46A 3LCTA 4BIEA 1YOMA 2R7BA 3SG9A 2GFSA 2ITQA 5AR8A 3NPCA 4IZAA 2W1CA 3VUGA 4YSJA 2W7XA 1OUYA 1SVGA 2BIYA 4YSMA 4FV3A 1XR1A 2VU3A 3C4CA 3K2LA 4KIQA 3UYTA 2XKFA 4CZYB 2Q83A 4FA2A 4A9RA 5K5NA 2XIXA 3MTLA 4RWKA 1PMUA 2UVXA 2VWZA 2B4SB 1A06A 3NNVA 4ZMFA 3NNXA 4AA4A 5F95A 2QU5A 3KU2A 3Q9YA 5H8EA 4A7CA 4BCPA 2ETKA 1K9AA 2WMUA 2XP2A 5ANIA 4R3CA 3HAMA 3C4FA 3OEZA 2VTQA 4IWOA 1L8TA 2ZM3A 3G33A 4G5JA 4XX9A 3FLYA 4GU9A 3BHUA 2X4ZA 2PVLA 2BDWA 2C1BA 2O0UA 5I5ZA 3U51A 3JUHA 1BL6A 1MQBA 2QD9A 2UZVA 2FYSA 5JFSA 1XWSA 4JQ7A 4LOOA 3UJGA 4R77A 3KMWA 1PMNA 3R8PA 5FXRA 3PVBA 4IMYA 4IB1A 1M14A 3HVCA 2XM9A 3PXQA 4FODA 4CD0A 4FT3A 4U40A 4IADA 3FBVA 2DYLA 2NO3A 4LGGA 5HQ0A 4QMLA 4YPSA 2P2HA 4LGHA 3R71A 3PXFA 2J5EA 2WMWA 3QXPA 4IDTA 4N0SA 4O7YA 2OFVA 4D2WA 2QOQA 5I4NA 3F66A 3I60A 4WOVA 3G9NA 4IVCA 5DBXA 3GC8A 4EOJA 5CZIA 5M07A 4E4XA 4DFYA 5C4LA 4JS8A 3K5VA 3WYXA 2QOBA 3GCSA 5C26A 1TVOA 3ZS5A 4M14A 3KULB 2ERKA 3A7GA 4MYGA 4N70A 4MD9E 4FSQA 5KCVA 4PWNA 3RWQA 3CTHA 5LOHA 3E3BX 4U9AA 1WVWA 2HELA 2R0UA 5GJDA 3I5ZA 2VWXA 3MPMA 4E26A 4F1OA 1WCCA 3HMIA 4Y8DA 2IJMA 2QONA 3KGAA 3SA0A 4O0TA 1P4FA 1FOTA 3NVMB 5J7HA 5ANGA 4YHTA 3NEWA 4OTQA 5AV3A 5AEPA 3VS2A 4NH1A 4A4LA 4ZSAA 4QNAA 4IEBA 2VO0A 4CEGA 2W1ZA 4RJ5A 1OI9A 2F7ZE 4O0YA 5AP3A 5JT2A 3THBA 3W18A 3ZTXA 4FV9A 4EK5A 2ITUA 2OIBA 2G2HA 4ENYA 2PMLX 3CCNA 2PUNA 3EQDA 2O65A 4DH8A 4AZVA 4ZSLA 4EOQA 1MRUA 1OITA 4ZXTA 4EZ7A 3TXOA 2C3IB 4QP7A 4F70A 2V62A 1QPCA 4NT4A 5HE1A 2HWPA 3PE1A 4F6UA 4ZSJA 3VBQA 5FD2A 1A9UA 5J87A 4F9CA 1YDRE 3DK7A 3SRVB 3RBWA 3FKNA 5EFQA 3A61A 3Q4CA 4PMPA 5AUUA 5CQWA 1Y6BA 4YJVA 3W33A 4K9YA 3WE8A 2Z7LA 4NFMA 5HBEA 3R28A 2WD1A 2WQMA 2WTWA 4WBBB 3F3ZA 3TG1A 3PJ1A 4AFEA 2XF0A 4MXYA 4CLIA 4QYGA 3SV0A 3PXYA 4K18A 1QPEA 4DH3A 3CQEA 2OJ9A 4UX9A 4F7LA 4FV4A 2PUPA 4CT2A 4S30A 3FC2A 4F9AA 5JK3A 1SNUA 3Q6WA 4I4EA 4UMRA 4I23A 5DH3A 4YPDA 4BCKA 3PJ8A 4LM5A 5IQDA 2DS1A 2VWWA 3OCBA 4JL9A 5DGZA 5J1VA 4R5SA 4TWPA 4UMUA 5EQPA 4RC2A 1GIJA 4C4JA 3E8NA 3QCXA 3JPVA 1Q41A 2EB3A 3KF7A 2OGVA 5HO8A 3VHKA 4YLLA 4G31A 3DXNA 3JR1A 3KRJA 3N4TA 3AOXA 2J7TA 3VQUA 2CMWA 2PHKA 1DM2A 4I3ZA 2W1DA 4FNYA 4FKTA 1URWA 2X9FA 4IB3A 2OH0E 3V8WA 3WARA 5BMSA 2P55A 5AP1A 4C34A 4PDYA 1ZWSA 2V5QA 3DQWA 4GV1A 5HU3A 5KBQA 3PJCA 4WUAA 4FNXA 4RMZA 4ZTRA 4RFYA 2ZM1A 4Y83A 5L2QA 3ZLYA 2OKRA 3G9LX 4BCFA 5JN2A 4AZWA 5M09A 2IVVA 4CMUA 2YM5A 3FYKX 3JYAA 4IW0A 1GZNA 4TWCA 4YJOA 5DNRA 4D4YA 4F0FA 1UNHA 2CGWA 5HLNA 1JPAA 5JQ5A 4U81A 4BYJA 1M52A 3QCYA 4MX9A 3ALNA 4YJNA 2B0QA 4DGMA 4J8MA 5HI2A 4EWQA 1JKTA 4CV8A 3P5KA 2CKPA 2ITZA 2JIVA 3MFSA 3IO7A 4EH7A 3BZ3A 3FAAA 4FV0A 4QP3A 5FTQA 1Q8YA 5M53A 3VF8A 1QCFA 5GZ9A 2OJIA 2QG5A 2XRWA 3FZOA 4RX7A 5LMAA 4HVHA 2Y4PA 4JG8A 4GW8A 4TNDA 3O71A 3DXPA 4LQMA 3SX9A 3F3WA 3WYYA 3DNDA 1PMVA 2EU9A 4O7ZA 5KMJA 2XVDA 2F9GA 1UKIA 2HY0A 2B9FA 2Y6MA 3VBTA 4DGLC 1IA8A 3PY1A 5HCYA 5D1JA 2XNMA 3FQHA 4J1RA 3WOWA 2WNTA 5H8GA 4F7JA 2WIHA 3PVUA 3LXPA 3COMA 4O0SA 3E8CA 4RIYB 5DWRA 3W1FA 4C37A 4F7NA 4FTUA 1OIRA 4BCHA 4RFMA 2XIZA 3I0QA 4DAWA 4U3ZA 3OY1A 4Z3VA 4ZLOA 5ACKA 4IM2A 4RZVA 3TN8A 4KIPA 3C0HA 5A6NA 3K54A 2XNPA 2JIUA 4OBQA 4FZFB 1R78A 2VWIA 1LPUA 4UY9A 2OXXA 2PE1A 5CI6A 4MTAA 2PVHA 3R7UA 5HCXA 3OT8A 4EL9A 5BVFA 3PA3A 5J5TA 3B2TA 4C57A 3VUKA 4DLIA 3E87A 2R3FA 4O0XA 1DS5A 4LFIA 4OTFA 4C2VA 3QTXA 2RL5A 2JLDA 3CGFA 5DPVA 2W4JA 5GJFA 3R8MA 5L8KA 3AD5A 2BPMA 1H27A 2VZ6A 1KE8A 3OOGA 4XEYA 3WZJA 4B7TA 3T8OA 4YZDA 3EQBA 4EKKA 2CLXA 5HESA 3NUPA 5A4CA 3V5JA 1GNGA 3QD4A 3VN9A 3QTWA 4AN3A 3CSVA 4FEVA 4Q5EA 1UU7A 4E1ZA 4TL0A 4PL4A 3V01A 1WZYA 4KS7A 4CFXA 3W32A 3FZPA 5HG8A 2BAKA 2YAAA 1Q99A 3ZUTA 4AUAA 3LVPA 3TIZA 1R39A 2VGPA 3P1AA 3PFQA 5IEYA 4ALVA 3E7VA 3QFVA 5CEMA 5AV0A 4GK3A 2YIXA 2QC6A 4FKVA 1JNKA 3QQUA 4FEWA 3LOKA 4X3FA 2NRYA 4I0SA 1YI3A 4O2ZA 4ZSEA 3L8VA 4Y85A 2VO6A 5AAEA 1JSVA 1YKRA 3KFAA 2JDVA 4JJRA 4JVGA 1L3RE 4KKGA 2X6DA 4NTTA 5D41A 3QQGA 2YDIA 5IQHA 1V0OA 5B2MA 3O0GA 4YC6A 1AGWA 2IO6A 4FG8A 5CWZA 4O7WA 3NUSA 4CFNA 1ZOGA 3C4EA 4GIHA 3OXIA 3MY5A 5LVMA 1WBSA 5FQDC 2QLUA 1XH8A 4C4IA 5IA4A 3KK9A 1NVRA 2I1MA 4YO6A 4BWKA 4XG2A 3GP0A 2YJRA 4GJ2A 2VWYA 4PTCA 1J7UA 2EWAA 5HLPA 3H10A 3NX8A 5HKMA 3KCFA 3IW7A 4IE9A 5A4QA 4CCUA 1IAHA 1XH5A 5TOZA 3GFWA 3KEXA 4G6LA 4AACA 1VYZA 4U79A 5EKNA 3F82A 5BYYA 5KMIA 2BZIB 4AZFA 4C35A 3O8PA 3PP1A 4P5QA 4O86A 3D7ZA 3IDBA 3VVHA 1TKIA 4X3FB 4NM7A 4D2PA 4RVTA 4O2PA 2C5OA 4C4GA 4H1MA 2W99B 3P9JA 5C27A 3ZEPA 2YJSA 4CFWA 2R3JA 5EDPA 4AGDA 2OLCA 3IPHA 1UWHA 2JIIA 3CJFA 4BF2A 1ZMWA 4E5BA 3E88A 3OD6X 2B55A 4FV7A 5T68A 1ZOEA 3RZFA 3DKOA 2VTTA 3OG7A 4AOIA 4FE2A 2RSVA 2WMQA 3Q9WA 3R7GA 4XV2A 4E4MA 4BY9E 2XIKA 4ANOA 5IA5A 5HU9A 4M67A 2J90A 4II5A 3OFMA 2FSLX 3A8WA 4P7EA 4X6QC 2R3PA 3D2IA 3KXXA 3PZEA 4XG3A 2QOHA 3Q9XA 4GRBA 2ZMDA 4C4EA 3VBXA 3UNJA 5A4LA 2XYUA 2WTCA 2YWPA 3A7FA 5AR7A 3CE3A 5T6KA 2PUIA 3LQ3A 4ZLYA 5DRBA 4G3GA 3FEGA 5M44A 2QI8A 5DR2A 4CQEA 2NRUA 3SHEA 4C4FA 3IDCA 4L00A 4BCIA 3R83A 5I9ZA 2C6EA 3GEQA 5BVOA 4F7SA 2QOCA 1WBPA 3S3IA 4FIIA 3BX5A 3LFNA 3UIBA 4G3FA 2WELA 3TWJA 3UPXA 2X0GA 4PP7A 2YITA 4U80A 3UZPA 5HO6A 3TKUA 4L68A 5AR2A 2R3NA 1JSTA 2GS2A 4XV3A 3PRIA 2HAKA 4IAKA 3ET7A 2B9HA 3PSCA 1YHSA 2PE2A 3UIXA 4JIKA 1LEWA 5J9ZA 1CDKA 2JKOA 4YBJA 2WOUA 3HDMA 1REKA 5AV2A 4CYIA 3Q60A 2OZOA 4DG2E 3U54A 4R7BA 1M2QA 3ORKA 3R8UA 5AA9A 5EQYA 4HNFA 1TQPA 1CKJA 4GU6A 4L53A 1FINA 4BZNA 4NTSA 5AM7A 4ID7A 4V01A 1R1WA 3ETAA 1VYWA 4M68A 4XBRA 4H1JA 4M13A 2WB8A 4EQMA 3QALE 4O1PA 3P86A 4WA9A 4RIXB 4CGAA 4CMOA 4I41A 3TNHA 3OWJA 5EW3A 5T3QA 1U4DA 4L7FA 5HIBA 5CAVA 4ACGA 4IAIA 1YXXA 2OJGA 2UZBA 2W96B 3MN3A 3BQRA 3DFCB 2EVAA 3SD0A 3CR0A 4X3FC 2W1EA 3DCVA 4AT4A 4E4LA 3BGQA 3QXOA 5ANOA 2I7QA 2PZ5A 3SDJA 2GSFA 2PUUA 2UZUE 2PZPA 1ZLTA 3R22A 5HNBA 3AGMA 4BDBA 4ASDA 2XK8A 4I92A 1Q4LA 4XOZA 3HAVA 3E8DA 3QKMA 3W2QA 3D2KA 1CMKE 1JVPP 4ZIMA 5B0XA 4F6SA 3HL7A 5CY3A 3V5LA 3FE3A 4RJ3A 1ZYCA 2PU8A 3BWJA 2YA9A 4XG9A 2OK1A 4J96A 3HNGA 1OIYA 3TCPA 3LFEA 4QP1A 4ACCA 3R00A 1BLXA 3RTPA 3HRCA 5ETAA 4FTMA 4GMYA 2OXYA 3HP2A 2IVTA 2HOGA 2CN8A 2RFSA 2W06A 3AD6A 4EOSA 5M06A 1XBBA 3RMFA 1SZMA 4G3EA 5AP5A 4QYHA 5KZ0A 5E8UA 4DH5A 2IN6A 4D55A 4ACHA 3AC3A 4MXXA 3BEAA 3C13A 4B99A 2JDSA 4CFFA 1ZY4A 3DJ5A 4AU8A 3KC3A 3FSKA 4TYJA 3VJOA 4DITA 2BTRA 4AA0A 2R2PA 2V22A 3O8TA 1FMKA 2C6IA 4G1WA 3DK6A 3R9NA 4S31A 4EHGA 2PVNA 3IGGA 4O81A 4QMZA 2VV9A 4S34A 3ZXTA 4IWDA 4M0ZA 4NKSA 4XJ0A 3RAIA 3W8LA 3ZOSA 4AZTA 5L4QA 3VHEA 5CVHA 4PV0A 3OXTA 2CCHA 4G3DA 4EQUA 4FSZA 4I5HA 1IAJA 3BBWA 3PIYA 1XH7A 3VS0A 5M4CA 4DTBA 4YLJA 4H05A 5K4IA 2O8YA 2VTHA 3VUTA 5AFVA 2J0KA 2VD5A 3GGFA 3A99A 2VTSA 4IDVA 4RX9A 4UYAA 2FUMA 3D5UA 3N51A 5LVLA 4HZRA 5TO8A 3UYSA 4QMNA 1SM2A 1V0PA 2G15A 3A7JA 5H2UA 4CNHA 4QRCA 2IPXA 3WIGA 3QYWA 3LFQA 3FLNC 3E3PA 3LQ8A 4R5YA 5B7VA 3ZO1A 2V7OA 4QYYA 5FG8A 2SRCA 3EN7A 1MRYA 3DBQA 4L3LA 4I0TA 1FGKA 2FSTX 4EOOA 2Z60A 1JQHA 2JEDA 1OBGA 4ZZOA 3B8RA 3NYVA 3R0TA 4OTRA 2GHGA 3LAUA 2W9ZB 1W82A 2B7AA 3ZFMA 3F7WA 1M2RA 2HCKA 2IZTA 1FGIA 2GDOA 3AC4A 1PXKA 2FVDA 2OW3A 5HCZA 3EYGA 2WMTA 5A3XA 1H1RA 4FTIA 4XP0A 5IA0A 2GQRA 3Q2JA 4DH1A 3RP9A 5AADA 4GK4A 3NDMA 4PDPA 3QL8A 3GFEA 1FVTA 4LRJA 1BYGA 2GS7A 4JDHA 2F2UA 3PSDA 4O0UA 5AR3A 2C4GA 4EC9A 4J99A 3D14A 1R3CA 5DHJA 1W84A 4QTBA 2C6MA 3PXZA 2J6MA 5HOAA 3RM6A 2KULA 3DTCA 2KTYA 4J97A 5L8LA 4YZMA 4C62A 2PZIA 3HMNA 4FZ6A 2ZDUA 3HX4A 3W2OA 5HX8A 2QOKA 3OMVA 5AX3A 4JRNA 3BYVA 2W4OA 1U54A 4IJ9A 5EI6A 5IUIA 3ZLSA 4ANBA 2YM3A 4DN5A 4D28A 4BHZA 3OWKA 4LOQA 4V05A 4FKQA 2ZB0A 5JGBA 5HG9A 5HD4A 5IQBA 2XJ2A 2BRBA 4FKOA 3JXWA 4W4VA 3GC7A 3OTVA 4CRSA 3D4QA 3HRFA 3ZC5A 5KNJA 2PMIA 4KIKA 2C0TA 2ZYBA 4FSWA 1ZZLA 3NNWA 4PPAA 1WBOA 3CXWA 2V0DA 3QUPA 2VUWA 4XG4A 2Q0BA 2UZLA 3L8SA 4G6OA 2UW9A 4XG8A 4IWPA 4IX5A 4NJDA 3RCJA 5A6OA 3F5XA 3UVQA 4BCOA 4GUBA 4DBNA 4IFCA 4F63A 2UUEA 3T3VA 5KE0A 5K5XA 4MBJA 4E3CA 1YQJA 5CALA 4YNEA 2QCSA 3P7BA 4GT5A 4FTLA 4CQGA 4USDA 4CXAA 3UZTA 3UE4A 1S9JA 1U54B 2BALA 4RFZA 5FP6A 2VWVA 4GFMA 3OC1A 4HGEA 5CU4A 4TN6A 4F64A 4O7RA 4GH2A 3OUNB 4KA3A 4UWCA 3QRKA 2GNIA 3S95A 1X8BA 4WG3A 4IAYA 2ITOA 3PSBA 5HE2A 4F1TA 2E2BA 2C6DA 3UP2A 3UVPA 1PYEA 1J7IA 3EJ1A 3H4JA 3CQWA 4X2KA 5DI1A 5C01A 4BKJA 5EM8A 1IR3A 3KXGA 4I0RA 4NM3A 2PZYA 3NUUA 3ORNA 4KIKB 3FI2A 4M84A 4KS8A 4AGWA 2YIRA 2YACA 5DRDA 4KBAA 2JKQA 3KMMA 4RVMA 4UALA 5HO7A 5E8TA 3QRJA 3G2FA 4G5PA 4PDSA 5E91A 3UOKA 1Z9XA 3TNPC 2GNLA 5AP4A 4I5PA 2R3MA 3M42A 1PMEA 4Y72A 2XUUA 5CSVA 4FKGA 4QPSA 4R1YA 3MYGA 4D0WA 4CKJA 4GS6A 2QG7A 3C4ZA 2A1AB 1U59A 5CT0A 5CAPA 5H9BA 3GUBA 3TUCA 1OB3A 5C8NA 5I0BA 3VBWA 4TYEA 2BILB 1STCE 5LCKA 1SMHA 1QPDA 2VTPA 3LXNA 3EIDA 1YWNA 2PVYA 2EUFB 3IW6A 5BMMA 3TZ9A 1ERKA 3AMBA 3GU6A 3Q04A 2XJ0A 3KULA 4FV5A 4UMQA 4B4LA 5LJJA 2Y6OA 1REJA 4AN2A 5HE3A 1IRKA 2F7EE 3GCVA 3F2RA 4RWIA 4EEVA 4DE4A 4CKIA 4M69B 5FDXA 5HNGA 3W2PA 3F3UA 3Q4UA 5IDPA 5EI2A 4D2TA 4LRMA 4CTCA 1PXMA 4KD1A 5E7RA 3F3TA 4OTIA 3FQEA 3I6WA 4D1SA 3UQGA 3KY2A 2EXCX 3OEFX 5LWNA 1Z5MA 4FIJA 3MI9A 2BTSA 1CSNA 1MP8A 1WMKA 3V6RA 4BB4A 1YWRA 2JITA 1ZY5A 4X3JA 3FL5A 3R21A 4BDIA 2ACXA 2CHLA 3PJ3A 4YLKA 2GNHA 2A19B 3EL7A 4GFGA 3R73A 2R3OA 4FKIA 1YI4A 4U7ZA 4AT5A 2ITTA 4EH3A 2JKKA 4RX5A 2PMNX 1ND4A 3SQQA 3KCKA 5GIOE 2XK3A 2UVYA 3S4QA 4M7IA 2GQSA 2J0LA 4FTQA 2LAVA 2XZSA 3ZDUA 4EOIA 2E9OA 2VTLA 3C7QA 3PPKA 3CD8A 3SKCA 3SRVA 4BZOA 5GIPE 3FMMA 4APPA 3EB0A 3KB7A 4FTNA 4RC4A 4ZJJA 5DLSA 3EFWA 3DXQA 4EKLA 3UBDA 3F61A 2BFXA 4GSBA 4DG0E 5IA1A 4FVPA 4PY1A 4EK3A 4I22A 3DT1A 4I1ZA 4IH8A 1M2PA 4ZY4A 3UNZA 2JDRA 4KAOA 3R30A 2C1AA 5IQEA 3BBTB 3QUDA 2X7GA 4BVUA 3E5AA 4GKHA 4FK6A 5BVKA 4OLIA 3W2CA 3RVGA 4MXCA 5IQCA 3KKVA 1HOWA 4NFNA 3ALOA 3QKLA 1E9HA 3IONA 3ORXA 3BKBA 4BDDA 2REIA 4YTIA 2Z7RA 3EQPA 2XB7A 4E7WA 4EYJA 3FZRA 3DY7A 4OTGA 3AT2A 5EYKA 4FT9A 4MCVA 4XHKB 5DE2A 3H9OA 3POOA 5HX6A 2QLQA 2XNGA 3IDPA 4O0WA 3ULZA 5K4JA 3DDQA 4A9UA 5HTIA 3CTJA 2VRXA 2XMYA 3GOKA 5D11A 1XH9A 5HE0A 5CASA 2GFCA 2VTMA 4YZ9A 3MY0A 4IXPA 2RKUA 3PPJA 4LL0A 2PL0A 3U6HA 4BCMA 2HK5A 3FL4A 3O96A 4BCGA 3U6JA 2FSOX 4DEBA 3MESA 4FSMA 1Q5KA 4BDCA 2BRNA 3UQFA 2J0MB 2O2UA 4TTHB 2VWUA 3ROYA 1Q24A 3O50A 3QGWA 1M7QA 5JRSA 4NW5A 1XHAA 3KXMA 4FIFA 5HTBA 4FUYA 3JY9A 4JX7A 4IC8A 5AAFA 2H96A 2BVAA 2PE0A 4HVGA 3DAEA 3LFBA 4BYIA 4EK4A 3Q6UA 3D9VA 4IAAA 1APME 1H1PA 4GT4A 4X6RA 5AM6A 4AP7A 4YZBA 3NW6A 3Q4ZA 2F2CB 3PPZA 3ZBFA 3RK9A 2Z02A 3VW6A 3ZSGA 3EKKA 3FZTA 4J7BA 4D4RA 1G8AA 3PZHA 3R7OA 3HMPA 4RQVA 3ORPA 4O7TA 1VZOA 2I0EA 2BRGA 3DBDA 2YM6A 5D10A 2BMCA 3FPQA 4YTCA 5HVKA 3R9OA 2RFNA 3RAHA 2VTOA 1LR4A 2YABA 3P4KA 5EH0A 3RAWA 4RIYA 3E93A 1PJKA 3OTUA 4GL9A 2ITPA 3ENHA 3K3JA 4E4NA 4FOBA 2VTAA 4H39A 4PMSA 4RRVA 4XRLA 2P0CA 5CSHA 5L2IA 4JRVA 4EHZA 4E6CA 4IQ6A 3D5VA 4C61A 2J0JA 2YAKA 1F5QA 3F2AA 5GHVA 1PXOA 3O2MA 1W7HA 3LMGA 1Y8YA 3UC4A 3MH1A 4MHAA 2HZ4A 3OWLA 4WO5A 3BU6A 3RZBA 2CN5A 1Q97A 2WU7A 1MQ4A 2UW8A 2GTNA 2JFMA 4FV8A 2HW6A 3BV2A 3R1NA 4U6RA 1OKYA 4NCTC 4HJOA 4M3QA 4NUSA 4D5KA 1ZZ2A 3BELA 3TNIA 5DR6A 3MFTA 3WZDA 3ORZA 2C3JA 3AMAA 1WBWA 4XP3A 4FTOA 2HYYA 5JFWA 5J95A 3ATTA 5FEQA 2HW7A 4USFA 5KBRA 1XKKA 2WMVA 4HCTA 2W4KA 2Y9QA 3EOCA 4Q9SA 5CTPA 3HLLA 3UNKA 4ZP5A 3AGLA 5BVDA 4QP9A 3LFCA 3V8TA 3AG9A 3BHHA 3RWPA 5IQGA 1BKXA 1H0WA 3QHWA 4ZOGA 5HTCA 3FHRA 2XEZA 3P7CA 2H6DA 3Q3BA 2OF4A 3MTFA 3TKIA 4DCEA 5F9EA 2O3PA 4ZTLA 4D0XA 5IG1A 3RI1A 3EMGA 3LHJA 4GK2A 1OL7A 2BRMA 3SOCA 4ANQA 4FSTA 3ZHPC 4KIOA 3E64A 2QOFA 2BR1A 2PULA 5TE0A 5L3AA 2YCSA 5KKRB 4ACMA 2XKCA 5EQEA 4P4CA 2UZEA 3BCEA 5LMKA 4K2RA 3RJCA 4YC8A 3COKA 4AW1A 4U41A 2Q0NA 5KHXA 5DN3A 4K6ZA 3S00A 4GJ3A 3HA6A 2PZRA 3SC1A 3CGOA 4QQTA 4AX8A 2WTJA 4IB5A 3DKGA 3CS9A 4FG9A 3II5A 4AFJA 2ETMA 3DLZA 3NIZA 3H9FA 4JI9A 4H36A 5EKOA 3RKBA 3UC3A 5IUHA 3ZCLA 3W2SA 4AQCA 3NUAA 5C4KA 3I0OA 5AV1A 4E20A 4FEXA 3ZFXA 2WXVA 3ZUVA 3CD3A 2G9XA 2CGXA 1KUTA 1WFCA 3R9RA 2JDOA 3MS9A 2X9EA 1YWVA 4FOCA 3I4BA 2HIWA 4B0GA 4LRKA 2CJMA 2WMRA 3EFJA 4MEDA 3LCOA 4KRCA 4L42A 2W05A 3KXZA 5CU0A 3QGYA 4KSQA 4I6HA 3F69A 3SLSA 3IKAA 3NAYA 2QO9A 4ITHA 3BU3A 4I24A 3WF9A 1Z57A 1NY3A 1YHVA 2BAJA 4PF4A 5EHLA 3A60A 3RK5A 5L2SA 5BVEA 2WFYA 5DIAA 2B53A 5DEYA 3FC1X 3ZRMA 3HECA 4EOPA 4UB7A 2J4ZA 3FQSA 2H9VA 2NNWB 2C30A 3ORLA 5JGDA 4UZDA 3ZO3A 5C8KA 3ZM4A 3EFKA 3EQHA 3HV4A 4DEIA 5BQ0A 3U87A 3U55A 4H3QA 2YM7A 5LARA 2E9NA 5JZJA 4XCUA 5JFXA 3QTUA 2C6LA 3R2YA 3ACKA 3GU4A 4JLCA 3MA6A 4HW7A 4ZLZA 2UW7A 3ZM9A 5HNIX 3R7IA 3DZQA 1UU8A 2HXLA 4FVRA 5L6WL 4FMQA 1BI8A 4AG8A 1RQQA 3V5TA 4K1BA 3R63A 5I9VA 4BICA 3QYZA 3ZZEA 5JEBA 2CNVA 5G1XA 4QYFA 3EYHA 4LUDA 3IW4A 4AN9A 1PRYA 4CLJA 5E8XA 4WG4A 5AR5A 2XEYA 1ZOHA 3DBCA 4L01A 3GOPA 3QU0A 5G6VA 1ZMVA 1ZYLA 4AW5A 2QOLA 3HP5A 3S0OA 1ATPE 5EG3A 2ITWA 4XBUA 3S2PA 1Y57A 3C5UA 4WNOA 3QLFA 2ZVAA 4AW0A 4O84A 3JY0A 4IBMA 4LV5A 1P4OA 2XBJA 2E9PA 4PNIA 2QR7A 5JH6A 3DTWA 2BDFA 4QOXA 3A4OX 3E7OA 2YHVA 4RIWB 4I6BA 3PE2A 5KKRC 3T9TA 5M4IA 4C58A 1NXKA 3C4WA 3QA8A 5AUXA 5EOBA 5LVPA 5EM7A 4ZTSA 2YCRA 3MIYA 2QU6A 3MSSA 4DLJA 4WBOA 1B6CB 3BYOA 1CKIA 2BUJA 2YCFA 3IOKA 4BTJA 1YW2A 4S2ZA 4R8QA 4NZWB 4BGQA 4LUEA 4F0IA 3FMKA 4J98A 4MBIA 2WOTA 3IGOA 3R1YA 4QP4A 3BWFA 3TIYA 3NUXA 4GG5A 4NL0A 1ZYSA 5CAOA 2R5TA 3QZIA 1WAKA 4DFZE 3KQ7A 4C3RA 4MK0A 4RJ4A 3VF9A 3ITZA 3FMNA 3U8WA 3GQLA 5K0KA 1LP4A 2R3QA 4QMTA 1IASA 2BHHA 5E9EA 4BCJA 3NMUF 4KSPA 4R3RA 3C0IA 3FKOA 3UMWA 3VS4A 4N57A 5HG7A 3MH0A 3CJGA 4BDFA 4Z9LA 3R1SA 4FKWA 5JSMA 4RIXA 2J5FA 4QQJA 4EOKA 4FL2A 3B8QA 3WZEA 1B38A 3HMOA 4L43A 5M4UA 5CF6A 2GTMA 4LYNA 3EFLA 4JG6A 4M8TA 4TYHA 5CENA 3WI6A 4A4OA 4ERWA 5J8IA 2QVSE 3RPVA 1JBPE 1XO2B 4FTAA 1URCA 3CPBA 3FSFA 3R2BA 4JQEA 4OBPA 5M56A 2XCKA 5LMKC 3F5PA 4LI5A 3KN6A 4L52A 2O5KA 2R3HA 4CZUA 4YR8A 2J2IB 3LCDA 3PDTA 3VW8A 3FXZA 3FPMA 4N6ZA 1I44A 3LPBA 5BYLA 2BZJA 2YDJA 4N6YA 4OT6A 4QYEA 5IMEA 4FKPA 2C5NA 3D7TB 5FEEA 1W83A 3H3CA 3Q5ZA 1OGUA 5FBOA 4U3YA 4AOJA 3JVRA 4OTHA 4Y73A 4EORA 4RJ8A 4LMUA 4FZDB 3VS7A 1PXLA 1OIQA 4Q9ZA 1Q8WA 3NYXA 5A46A 1H01A 4PL3A 4QMXA 4U44A 1FQ1B 4O1OA 5D7AA 3MJ1A 4BZDA 5GINE 3MPTA 3KXHA 5AIRA 3VS3A 3KVWA 4WSQA 4IWQA 3FMJA 5LWMA 1TQIA 2VNYA 2YZLA 3FYJX 5EW8A 3TNWA 4TYIA 4BC6A 3MVHA 4JOAA 4XG7A 3ORMA 4TYHB 4PPCA 3HDNA 4F08A 4ITIA 3LJ2A 3TNQB 2F57A 3A2CA 4XNEA 3FHIA 5HVYA 2WIPA 5C8MA 4O7NA 1XH6A 4EZ5A 2R3IA 2QKRA 3GBZA 5CEOA 2IZSA 2WEIA 2QOOA 3M2WA 5BNJA 2GNFA 2RIOA 3IG7A 3OOMA 3ZFYA 1K3AA 3UMXA 4BBEA 3R04A 2X4FA 3R9DA 1I09A 1VJYA 3EQCA 3QHRA
chains in the Genus database with same CATH superfamily
1XJDA 4M66A 3DB8A 4MWHA 4FNWA 4ITJA 2XJ1A 5EK7A 5TF9A 3MJ2A 3OW4A 4EC8A 5CF5A 5EM6A 4D2SA 2IZRA 3PG3A 3QD0A 3SXSA 3VUHA 4B9DA 4D4VA 4JMQA 4O7SA 3EH9A 3QBNA 1DAWA 2YZAA 4FKSA 4K0YA 2WAJA 5FWKK 4C38A 5BYZA 3FV8A 4WIHA 4QPAA 5GNKA 4H3BA 1YI6A 4D58A 4QTCA 3K3IA 4O0VA 5C1QB 1ZRZA 3UTOA 4MNFA 3TUDA 2ETRA 2OI4X 1JOWB 2JBPA 2VN9A 2AC3A 2GMXA 2X39A 3BU5A 4MXZA 4OTWA 2BDJA 2C6OA 3OF0A 3Q53A 3Q5IA 4RC3A 5E4HA 3U6IA 4UBAA 4IVBA 3D15A 4PP9A 3EQIA 3BHVA 3P08A 1T46A 4JBPA 2FSMX 1XQZA 2C0IA 5CNNA 3DS6A 1LEZA 2R3LA 5F20A 4ALWA 4X2FA 1CTPE 3C4XA 4TWOA 5E8WA 3VRYA 4DF3A 3TZ7A 1P2AA 4Y5HA 1KE5A 1U46A 1FVRA 2EXEA 3VUIA 3QZGA 3QWJA 4P2KA 3W8QA 5A54A 4O38A 4ASXA 3MW1A 1UVRA 4BI2A 4ZTNA 3FZ1A 3L9NA 3NR9A 4YJPA 5AR4A 3NS9A 3ULIA 3MH2A 4CT1A 4MVFA 4LGDA 4NSTA 4C0TA 1T45A 4JIAA 3DB6A 2QHMA 3CIKA 4NKAA 5HEZA 4I5CA 2OWBA 2VAGA 4R6VA 3QX4A 4PTGA 2DUVA 1NVSA 2PWLA 2XNEA 4DGOA 3UDTA 2CDZA 3P0MA 5CLPA 4G2FA 4ZAUA 2Y4IB 2Z7SA 4F4PA 5E90A 2W1GA 2IVSA 4RA5A 2YLEA 2WZJA 3SG8A 2ZJWA 4C36A 3FUPA 3DPKA 5EDRA 2JKMA 2ERZE 2HY81 3H0ZA 3NYNA 1GZ8A 4MXAA 4QTAA 2GPHA 4JG7A 4FEUA 4I5MA 4M12A 5F94A 3V3VA 4QMUA 5HG5A 5AP2A 1TQMA 3GC9A 2XM8A 4YTHA 3VJNA 4BKZA 4AE9A 3RALA 4C8BA 5KMNA 3TDWA 1YXSA 4FC0A 4FIHA 4M97A 3P5JC 3BHTA 5D7VA 2PVKA 1J1BA 4ENXA 3G0FA 2RG5A 4XV1A 2C47A 2J51A 1GZKA 4DFNA 3KIOC 5CF4A 3FMEA 3KA0A 2YN8A 2PVJA 2QR8A 3D0EA 2OBJA 3FY0A 4IM3A 4MKCA 4BGGA 1SYKA 3UZRA 1JKSA 3PIXA 5L6OA 1A48A 3PJ2A 3QZFA 2NYAA 3TTIA 1UNLA 3VQHA 4YZNA 4PTEA 3NUNA 2RFDA 2XK9A 4XLIA 3O7LD 5E1EA 4BWXA 3IOPA 3PXKA 3OHTA 3CLYA 4FUXA 5F4NA 5FEDA 3PP0A 3QWKA 1CM8A 3HEGA 1GAGA 3O17A 4RG0A 2ZDTA 5ACBC 4D5HA 1RE8A 4ALUA 3C0GA 3V5PA 5J5SA 2XK6A 3BGZA 3OBJA 4EHVA 4FX3A 3KL8A 1O6YA 5FM3A 1YXVA 3I6UA 4GT3A 3RHXA 3E8EA 4BFMA 2OJJA 4IVAA 3RCDA 5DT3A 3LKMA 2YLFA 3PA5A 5ANDA 4AA5A 4I20A 4NW6A 3VBVA 3I7CA 3V04A 4PPBA 5L8JA 5EW9A 3BGPA 4B6LA 4UMTA 3E92A 1WBVA 2QO7A 3QKKA 3UOJA 1IEPA 3OCGA 3KREA 2YERA 5IQFA 1SVEA 3OVVA 4GCJA 4JR3A 1OZ1A 3HUBA 5JKGA 1R0EA 4OTPA 4YUQA 1Q61A 1HCLA 3QCQA 5DFPA 2H34A 3Q52A 3MB6A 2WQNA 4BL1A 5KMKA 3ODYX 3QF9A 4QMWA 3R7YA 4F65A 4FTKA 4IM0A 1GOLA 3SAYA 3ZZWA 3VBYA 4C7TA 2WQOA 4QTDA 1F3MC 4U0IA 2ITVA 3UDBA 2X81A 3QQFA 3PY3A 2OF2A 4QP8A 2WTDA 4IIRA 4CTBA 1NA7A 2ZAZA 2Y4IC 1U5QA 3IS5A 1W2FA 4FKJA 4A07A 1GIIA 4WNMA 4ZJVA 5L2WA 4HVSA 4TW9A 4EH2A 3BE9A 3NCZA 4M69A 2PY3A 5AUVA 4USEA 2JBOA 1H4LA 3DGKA 4GVAA 4R7IA 2X2KA 3QTRA 5BPYA 2ITXA 3BYSA 1M17A 2XA4A 3HMMA 3KMUA 4QQCA 5ANEA 1QL6A 5A4EA 2YM8A 5E1SA 2XNOA 3G5DA 2R9SA 3ENMA 4JQ8A 3ZDIA 4JBQA 4L6QA 4WD5A 5CSWA 3RK7A 2XCHA 1YDSE 4I6QA 5CZHA 2C69A 3SVVA 5FRIA 3ZLXA 2X6EA 3FLQA 4DBXA 4Z55A 2JD5A 3MBLA 4O0RA 5AUZA 4LV7A 1BL7A 4KRDA 1OECA 2W17A 1F0QA 4ANLA 4KWPA 2IW8A 3O5AA 5DVRA 4EH6A 4LMNA 4DT9A 3RGFA 1W98A 3ATSA 1VEBA 3Q96A 5HZNA 4BR3A 2W0JA 1GIHA 3OT3A 4PL5A 4L46A 4TT7A 5HHWA 5IDNA 4IX4A 4BDJA 3DA6A 5FLFA 1DI8A 1UU9A 4AW2A 1UKHA 2PVFA 2VTNA 2WU6A 1XMMA 3LMHA 4CFVA 5E8YA 3AC2A 4AXEA 4OUCA 5LVOA 2E9UA 1OIUA 4IZYA 3WILA 4EK6A 4CV9A 4G17A 3QX2A 3QTZA 4F9YA 4MQ1A 4UXLA 2OJFE 4G6NA 1ZYJA 2RG6A 4DFBA 4MBLA 1H26A 1KWPA 1Q8UA 5AUTA 3BIZA 5CXZA 3OW3A 4EOMA 3TV4A 4IZ7A 3C9WA 2I40A 3ANQA 3BLQA 3HA8A 3JS2A 4JAJA 4O96A 3DQXA 2W1FA 3TV6A 4CYJA 2OICA 2UZOA 3GU5A 3LCKA 3G90X 2UZNA 3GB2A 4FBXA 1OPJA 4RVLA 3ZC6A 4JR7A 5AMNA 3FY2A 2YIQA 4GYIA 3ROCA 4A4XA 2UZWE 4LG4A 4W4XA 2JGZA 2BCJA 4PNKA 2F4JA 4NIFA 4EH4A 2DWBA 3BI6A 1YDTE 2WKMA 4NCTA 3FDNA 3V51A 4ANMA 4C02A 3KK8A 4Z7HA 3CKXA 5IEXA 1H25A 4UWYA 4YTFA 2FA2A 5CS6A 3VO3A 2CKQA 1FMOE 3GU7A 4HGSA 2PTKA 3MY1A 4WRSA 5CXHA 5CQUA 1Y6AA 3TZ8A 3L1SA 4AGUA 3CTQA 3O51A 4IX6A 5KX8A 3VWAA 4GIIA 4RLKA 4A06A 4ZS4A 3AT4A 3F7ZA 4FKUA 4ANNA 3IQ7A 4BTMA 2UW4A 3AXWA 3NW7A 2PK9A 3PIZA 4IAZA 4G9RA 4ZEGA 2YISA 4FZ7A 5BVNA 2G1TA 4XOYA 3DLSA 4FSNA 5EYMA 4LL5A 2BKZA 5FP5A 2X0QA 3LFFA 1BMKA 4JXFA 4AXAA 2GHLA 4WT6A 1OKVA 1YXUA 4FYNA 4FV1A 4Y5QA 3W0PA 1O6KA 4GYGA 2XKEA 4DH7A 3BRBA 2VX0A 5CSPA 3KRWA 2CGUA 1P14A 4EJNA 3DBEA 4U42A 2YWVA 1KE9A 4ZJIA 3DJ6A 4NIFB 2RFEA 4OW8A 1JKKA 4DG3E 4CG9A 3Q2MA 4DC2A 5IQIA 3EN4A 3WF5A 4CMTA 4L8MA 2F49A 4EK8A 4A9YA 5FM2A 4FF8A 2CLQA 5KHWA 3SW7A 3RNIA 1V1KA 4QMPA 3ZXZA 3QCSA 4J95A 4FK3A 4RLLA 1PY5A 3VRZA 3EL8A 4ZTMA 5IU2A 2VTIA 3PUFC 1JSUA 5EM5A 4K11A 2Y7JA 4TZRA 3ZYAA 4CCBA 5EDQA 1PYXA 3OBGA 3I79A 3PY0A 4JDKA 5JZNA 3UO4A 4DFLA 2ZFYA 2JFLA 2X2MA 3KRLA 4I4FA 2XBAA 4RJ7A 5CU6A 3VULA 3C1XA 1Q8ZA 3V5WA 4AZEA 3MWUA 2UV2A 4FIGA 4DTKA 5HVJA 1OKWA 3DZOA 3LM5A 3TDVA 3AT3A 4FKRA 5CU2A 4MF1A 5M57A 3LFDA 3R7VA 1PXPA 4DHFA 5E92A 2WMSA 3SXRA 3ZRLA 3CY2A 5FDPA 4CSVA 4AE6A 3FMHA 4DEDA 3A7HA 3V8SA 2FB8A 4F09A 3FLWA 2WEVA 3W2RA 3MA3A 3CY3A 4U5JA 5J79A 3L9PA 1J7LA 2DQ7X 5HD7A 3GCQA 2GHMA 3D83A 3VUDA 4FI1A 4JNWA 2YIYA 2IZUA 5HICA 3ORIA 2C0OA 4X2NA 4G16A 4KKEA 5LMBA 5LCJA 3NCGA 2UW6A 3ZRKA 3L8XA 4DGNA 2CKOA 4LOPA 2X0OA 2P4IA 5IKWA 4IHPA 5L2TA 3OCTA 4WHZA 3DJ7A 5E8VA 4ZK5A 3HUCA 3AKJA 4V0GA 1XH4A 4OT5A 4QO9A 2WGJA 3T9IA 3H0YA 3A8XA 2JC6A 4CKRA 2QOIA 2OZAA 3TUBA 5FGKA 4L3JA 3R7EA 4RWLA 3F2NA 4W4YA 3UG2A 2I0YA 4M15A 4A9TA 4ARKA 1BI7A 5IZFA 3UPZA 5DYJA 5CAQA 2ZV8A 3TJDA 4IC7A 5KMMA 1O6LA 3AC1A 2BKKA 1AD5A 3HV3A 2WHBA 5TKDA 2CNQA 1YOJA 3VS6A 2X2LA 2XS0A 3QLGA 4BBFA 4E5AX 3PWDA 5EYDA 5FTOA 4BDGA 4D9TA 4DGGA 4CVAA 1PXNA 3WF6A 2IWIA 3MVJA 1OVEA 2XYNA 2G2FA 3PVWA 4FV6A 4QMMA 2IW9A 2NP8A 1DAYA 3R01A 4IB0A 4KBKA 4ASZA 2XK7A 5E8SA 3LXLA 3UGCA 4EH8A 2JAMA 1ZAOA 2QHNA 3IECA 4XP2A 1OL1A 4J71A 4QT1A 4BIBA 4QMVA 3CKWA 4ANSA 5K9IA 4TPTA 4RSSA 3IW8A 4I6LA 4O7VA 2BZHB 4U45A 2JAVA 3IW5A 4PRJA 4YJQA 5IH4A 3TI1A 4ZS0A 2VO7A 3MH3A 3VS5A 3BL9A 5M08A 3A4PA 3R6XA 4V0GB 3T3UA 5CSXA 5D12A 5FXSA 3QQKA 2OZAB 3UO5A 2R64A 3G51A 1PXIA 3GVUA 2I0HA 2P3GX 3RPSA 4TWNA 4BRXA 4YZCA 5GZ8A 3UQCA 1OMWA 2HZIA 3PUPA 3W55A 4EI4A 1P5EA 3NW5A 4DEAA 3OXZA 1YOLA 4C2WA 5DMZA 4MXOA 1FBNA 1NT2A 4NWMA 5ANJA 3ZBXA 3ZLWA 2OXDA 3ANRA 4HYSA 4IX3A 1U5RA 4PMTA 4Q5HA 4I93A 3OY3A 4FYOA 1H08A 3OS3A 4ZY6A 4GKIA 3D5XA 5CI7A 3RNYA 5I9UA 4PMMA 2Z2WA 2WQEA 2W5HA 4RA4A 4L44A 4E6AA 4ONAA 5BUIA 1IG1A 5IUGA 1S9IA 5CU3A 2Y0AA 3I5NA 5AWMA 3F9NA 1XBCA 1OPKA 4HVDA 1KE6A 2UW3A 2HXQA 4KB8A 4FSRA 3LLAA 3NSZA 4S32A 2UZTA 2WPAA 4JAIA 4MWIA 4F1MA 4FIEA 3N4VA 3F5GA 3LJ1A 5EHOA 3AC8A 4R7HA 2Z7QA 3Q9ZA 3W0OA 2R3GA 1PF8A 4BI0A 3DOGA 5KMOA 3CP9A 2XK4A 2IVUA 4TKSA 3QTIA 5KUPA 3SOAA 1OM1A 2XKDA 5ETCA 4ASEA 3VC4A 3PRFA 3EZVA 5D9HA 3EN9A 3UIMA 2R3KA 2YM4A 4KINA 3UOHA 4F9BA 2BZKB 4DT8A 3OP5A 4S33A 1GJOA 2GU8A 1YHWA 2AUHA 2UZDA 4BCQA 3PLSA 4FNZA 3WF7A 2I6LA 4RVKA 4BI1A 2AQXA 3C50A 3QZHA 3MGYA 1ZMUA 3FI8A 5TR6A 3C51A 4F0GA 4AWIA 1AQ1A 1EH4A 2A27A 2J50A 3B2WA 3G6GA 2GQGA 4RIWA 3PLAE 3LW0A 3ZONA 4P5ZA 3G0EA 2C5YA 2A4LA 4XMOA 3AC5A 3A62A 3DDPA 4JX3A 5AJQA 3REPA 4EUTA 3TKHA 4HCUA 3R9HA 4DYMA 1E1VA 2ZMCA 2BIKB 3TV7A 4IZ5A 3VUMA 1H8FA 4O91A 4BJJB 2Z8CA 4K77A 1NVQA 5ETFA 3PA4A 1UV5A 2F7XE 4BIDA 4X7QA 1J1CA 5DG5A 1PW2A 5J9LA 4YO4A 4KABA 1GZOA 1DI9A 3AD4A 3L8PA 3KF4A 3CEKA 1K2PA 2C3LA 3FMLA 4P90A 4QP6A 3ORTA 4XRJA 3PVGA 2X7FA 2CPKE 4D4SA 4BDKA 5C9CA 4NYEA 2WTKB 4WSYA 4AS0A 3ACJA 3GT8A 1G3NA 2YEXA 2O63A 4ZSGA 4FZAB 3U4UA 3WBLA 4FGRA 1RJBA 1SNXA 3SXFA 2OIQA 4Z16A 2BHEA 5AUWA 2ESMA 3PXRA 5C03A 5A14A 2ZV9A 2ITNA 3DNEA 4O6LA 4W9XA 4X21A 3GI3A 2A0CX 2HZNA 5E8ZA 2QURA 3LXKA 2AC5A 2H8HA 4IFGA 5HIDA 4YU2A 2B9IA 2W1IA 4EQCA 4YJSA 3TACA 4HPUE 3I81A 4TYGA 5AP7A 3RM7A 4EZ3A 3ELJA 3G15A 4DEEA 4JDIA 2JDTA 4XS2A 4RPVA 2VWBA 4WNPA 4W9WA 5ANKA 5CF8A 3LM0A 4WUNA 5KO1A 3F3VA 4HGTA 4DTAA 4XYFA 3BLHA 1KSWA 1Q62A 2LGCA 3DFAA 3POZA 4OAUC 3FI4A 3QC4A 3D7TA 1PKDA 4F99A 1OPLA 2WMXA 2XNNA 3TJCA 4Z7GA 4BWPA 2YCQA 4GVJA 4C4HA 2C6TA 3UVRA 3ZEWA 5CYIA 3O7LB 4EJ7A 3HV7A 2X8DA 4UYNA 4ZTQA 2VX3A 2VO3A 4O22A 5HLWA 3GENA 3SGCA 3FKLA 3FMDA 3I1AA 2XIYA 3W16A 1W0XC 5AV4A 2CNUA 4HYHA 3RHKA 2R4BA 1TFFA 4B8LA 4I94A 5I9XA 1B39A 4C3PA 1J91A 4YP8A 2ZB1A 3EN6A 1RDQE 5FTGA 2J0IA 4BGHA 5IISA 3G6HA 1HCKA 2QO2A 5L6PA 3U4WA 1ZARA 3D5WA 4AF3A 5CX9A 2G2IA 2VTJA 3EQFA 4RZWA 4U8ZA 5JRQA 4GUEA 3QUEA 4IAFA 4QQ5A 2OSCA 3ZH8A 4BKYA 5IMXA 1OL6A 2YFXA 4FT5A 3GC0A 4JBOA 5DT0A 3ZU7A 4NK9A 4IJPA 5A4TA 4Y95A 2W9FB 1WBNA 4RIOA 3R8LA 4FTCA 4QD6A 3N4UA 4FKLA 4DCAA 5BX0A 5BVWA 5EOLA 4YJRA 3BPRA 2ZV7A 2X8IA 4DEGA 1UA2A 2CSNA 4AGCA 3KRRA 2WTIA 2B1PA 2GNGA 2B52A 3R02A 3QRIA 5F1ZA 1PKGA 3QQHA 4FTTA 4HYUA 4MQ2A 3GU8A 1W8CA 2ONLA 4DEHA 1NW1A 4J53A 2WTKC 2RF9A 4FT7A 3UO6A 4D2VA 2EXMA 4N4SA 5IA2A 1FVVA 1YXTA 4FICA 1IA9A 3ZO2A 3UODA 2B54A 5TT7A 3EHAA 3FXWA 5LXMA 5EHYA 4J8NA 3MIAA 3U9CA 4G34A 2EB2A 3EKNA 4G9CA 4IVDA 1O9UA 2QNJA 3EQRA 3JVSA 1JWHA 3LIJA 5HBJA 3RAKA 4DFXE 2E9VA 4C3FA 4RJ6A 3VNTA 3HKOA 4FEQA 3NRMA 5GZAA 5B2LA 3FXXA 3F88A 3RPOA 1Q8TA 4TXCA 2QQ7A 5I9WA 1QMZA 3LFSA 3QTQA 3CQUA 1YRPA 3BE2A 3R1QA 3UP7A 2BRHA 3LFAA 3RPYA 2R3RA 5K3YA 3M1SA 2UW5A 4UWBA 4QTEA 2HENA 4W8EA 4WNKA 4ZTHA 2GS6A 2VTRA 1FPUA 3VAPA 4ZZNA 4D2RA 3LLTA 2PVRA 3QQLA 3K5UA 1JKLA 4FSUA 5AIKA 1QPJA 3IK3A 4C59A 3PTGA 3V5QA 4YC3A 5J7BA 2PSQA 4BN1A 1UWJA 2QODA 4FG7A 4MUQA 3GQIA 2GNJA 1MRVA 4YHFA 4AZSA 3UDSA 3NYOA 2XAOA 4BDAA 4GEOA 4D1ZA 3Q32A 4YBKA 4EOLA 1ZYDA 4U43A 1G8SA 1KV2A 5CVFA 5J9YA 3P79A 4HGLA 4DFUA 4PUZA 3LJ0A 2ZM4A 4CFUA 3C5IA 2VX1A 5HORA 3QD2B 4QPMA 1H28A 4X0MA 3ZUUA 4E73A 1CKPA 3D94A 2V7AA 4KNBA 2A2AA 4E6QA 4F6WA 2X8EA 4FSYA 3QRUA 4MH7A 4HCVA 1KOAA 4L45A 2CCIA 4W8DA 5IEVA 3COHA 1WBTA 1V0BA 2RGPA 3TM0A 4O6EA 4M0YA 4L67A 4XG6A 5DA3A 1ZXEA 5CVGA 1UU3A 3PWYA 5H8BA 3DK3A 5GJGA 3NUYA 3L9MA 4L7SA 3LCSA 1KE7A 1Y8GA 5DT4A 4TNBA 3W10A 4JT3A 4E5WA 1XBAA 3ODZX 3F6XA 2W1HA 4H3PA 4UZHA 4G3CA 5AAGA 3EN5A 4RX8A 4A9SA 3QD3A 3EQGA 4KBCA 2BFYA 2PPQA 3MDYA 4QMQA 2BROA 3QQJA 2XIRA 4BTKA 5HIEA 4DA5A 4HNIA 2WQBA 3NVKI 4QNYA 3GCUA 2X7OA 4WKQA 1OBDA 1J3HA 4ZY5A 2HZ0A 3UOLA 1KV1A 1OL2A 5CT7A 2BAQA 3HGKA 4RBLA 2G01A 3S1HA 4MNEA 3TL8A 3MPAA 3BV3A 1RW8A 4FT0A 4QMOA 3ZSHA 4CRLA 2QKWB 4MD7E 3L9LA 5EYCA 4NM5A 2VGOA 3M11A 3NGAA 4FVQA 2OU7A 1PXJA 2OFUA 1OUKA 2W5AA 3CC6A 4FR4A 4EONA 2IG7A 4EWHA 5IF1A 3RPRA 5M51A 5B2KA 5CEPA 3MB7A 3OCSA 4YGAA 3KVXA 3GNIB 5M4FA 4PQNA 5IPJA 3AQVA 5AP6A 5I9YA 2OO8X 5HGIA 4GFOA 1WVXA 4AAYA 4Q2AA 2OH4A 4WRGA 3R8ZA 1Q3DA 3QC9A 4JBVA 4QMSA 4O27B 4YURA 3A7IA 1R0PA 2NPQA 3F5UA 3MFUA 3MVLA 2CKEA 4HYIA 4L3PA 4W4WA 2OG8A 3V6SA 4BDEA 3WF8A 4EYMA 4QEBA 3BHYA 3PYYA 2PYWA 4DINA 5K0XA 3HYHA 4MF0A 4C33A 5A9UA 2UW0A 4CFMA 5JFVA 1LUFA 1H00A 1H1QA 4NU1A 5IA3A 4K8AA 2WMBA 5CEQA 3CPCA 3QAME 4EHEA 1H24A 4MAOA 3VS1A 4X2JA 5CANA 2R7IA 4MNEB 3MV5A 3NWWA 2ONLC 3LMIA 2WO6A 5ITAA 3LE6A 3BLRA 4ZMEA 2X1NA 5IH6A 2AEGA 5IQAA 4YJUA 4HVIA 5J1WA 2Y8OA 1OL5A 2XH5A 4ORKA 3BYMA 4JDJA 5LVNA 5CAUA 3QTSA 1JAMA 1GY3A 3E62A 3FWQA 3DBFA 3HRBA 3OUKA 5BUJA 5ICPA 2W5BA 4HPTE 4QP2A 3DKFA 3NIEA 4X2GA 4BDHA 4D9UA 5JGAA 3UG1A 3EWHA 3FJQE 5I3RA 5FBNC 4I6FA 3I7BA 4V04A 1PHKA 5EI8A 4BTFA 5H3QA 3HZTA 3NLBA 3BL7A 3GCPA 3HV5A 3TEIA 4MD8E 3O8UA 3R8VA 3N9XA 3WIKA 1JLUE 2HWOA 2XNBA 4O21A 3OROA 4R1VA 3WZKA 2YDKA 3DAJA 5AP0A 4O7LA 1E1XA 2C68A 2WTVA 3BQCA 3ERKA 4NEUA 4O83A 3NNUA 4KUJA 4UMPA 2AYPA 2FGIA 4TRLA 3DKCA 2YIWA 5FUTA 4RT7A 3U9NA 4UN0C 5I3OA 3EZRA 2PMOX 4PX6A 4QMYA 4OGRA 4XH6A 4AAAA 1YVJA 2ZOQA 4D1XA 4E93A 3ID6C 3FLZA 4FV2A 3P78A 3DU8A 5DEWA 4L9IA 3TTJA 4UV0A 4U97A 4AOTA 4FL1A 3O23A 2PVMA 3FLSA 5CNOA 2C6KA 3NZ0A 2P33A 4GG7A 5KZIA 4F9WA 4YNOA 3P23A 3ZMMA 2O64A 4BBMA 4OR5A 5CEIA 4HOKA 4XV9A 4FGBA 5DR9A 4APCA 4IACA 3SW4A 3ZO4A 1Q3WA 3QRTA 3AMYA 4EUUA 5AUYA 4UXQA 4YHJA 4E6DA 4O82A 4EH9A 5JMSA 3P7AA 3WE4A 4I21A 5ETIA 4ZZMA 3QA0A 1BUHA 4R3PA 5AX9A 4ERKA 4R78A 4YMJA 4CG8A 4CZTA 2XALA 4E8AA 4KKHA 4EH5A 2OIDA 4RGJA 2C5VA 3CBLA 2UVZA 4HZSA 5M55A 4OTDA 1UNGA 3GXLA 4NJ3A 3BYUA 3NAXA 4K33A 1H0VA 4J52A 2J9MA 4YJTA 4B8MA 3LZBA 3KXNA 4WG5A 5LQFA 5DOSA 4BCNA 4EBVA 3H30A 4FTRA 3Q4TA 3WZUA 4PDOA 2FO0A 3OZ6A 3MVMA 3KN5A 3MFRA 4LV8A 1G5SA 1SVHA 2XRUA 4RQKA 1WVYA 3DAKA 5IH5A 3BEGA 3ZSIA 2WMAA 2V55A 2FH9A 3FZSA 1H1SA 3TT0A 5CEKA 1H1WA 4TY1A 3COIA 2ZV2A 2GCDA 3LQ5A 3OWPA 2IW6A 3E63A 1MUOA 3FI3A 4RWJA 2C3KA 2B9JA 1KOBA 1Y91A 4FTJA 1M7NA 3W0NA 2CGVA 3VIDA 4OBOA 4OAVB 2VNWA 5AA8A 3UIUA 5HBHA 2ITYA 4EBWA 2IF8A 1BX6A 4NM0A 5KMLA 3HV6A 5FXQA 4H58A 5BUEA 4XLVA 4BHNA 3DV3A 3KRXA 3RINA 2I0VA 4XUFA 1VR2A 3TZMA 2R0IA 3PG1A 3H9RA 2P2IA 4AT3A 1OKZA 4ACDA 5JQ8A 1H07A 4FL3A 4IANA 4UEUA 2C5XA 4Y46A 3LCTA 4BIEA 1YOMA 2R7BA 3SG9A 2GFSA 2ITQA 5AR8A 3NPCA 4IZAA 2W1CA 3VUGA 4YSJA 2W7XA 1OUYA 1SVGA 2BIYA 4YSMA 4FV3A 1XR1A 2VU3A 3C4CA 3K2LA 4KIQA 3UYTA 2XKFA 4CZYB 2Q83A 4FA2A 2A98A 4A9RA 5K5NA 2XIXA 3MTLA 4RWKA 1PMUA 4AXCA 2UVXA 2VWZA 2B4SB 1A06A 3NNVA 4ZMFA 3NNXA 4AA4A 5F95A 2QU5A 3KU2A 3Q9YA 5H8EA 4A7CA 4BCPA 2ETKA 1K9AA 2WMUA 2XP2A 5ANIA 4R3CA 3HAMA 3C4FA 3OEZA 2VTQA 4IWOA 1L8TA 2ZM3A 3G33A 4G5JA 4XX9A 3FLYA 4GU9A 3BHUA 2X4ZA 2PVLA 2BDWA 2C1BA 2O0UA 5I5ZA 3U51A 3JUHA 1BL6A 1MQBA 2QD9A 2UZVA 2FYSA 5JFSA 1XWSA 4JQ7A 4LOOA 3UJGA 4R77A 3KMWA 1PMNA 3R8PA 5FXRA 3PVBA 4IMYA 4IB1A 1M14A 3HVCA 2XM9A 3PXQA 4FODA 1TZDA 4CD0A 4FT3A 4U40A 4IADA 3FBVA 2DYLA 4AQKA 2NO3A 4LGGA 5HQ0A 4QMLA 4YPSA 2P2HA 4LGHA 3R71A 3PXFA 2J5EA 2WMWA 3QXPA 4IDTA 4N0SA 4O7YA 2OFVA 4D2WA 2QOQA 5I4NA 3F66A 3I60A 4WOVA 3G9NA 4IVCA 5DBXA 3GC8A 4EOJA 5CZIA 5M07A 4E4XA 4DFYA 5C4LA 4JS8A 3K5VA 3WYXA 2QOBA 3GCSA 5C26A 1TVOA 3ZS5A 4M14A 3KULB 2ERKA 3A7GA 4MYGA 4N70A 4MD9E 4FSQA 5KCVA 4PWNA 3RWQA 3CTHA 5LOHA 3E3BX 4U9AA 1WVWA 2HELA 2R0UA 5GJDA 3I5ZA 2VWXA 3MPMA 4E26A 4F1OA 1WCCA 3HMIA 4Y8DA 2IJMA 2QONA 3KGAA 3SA0A 4O0TA 1P4FA 1FOTA 3NVMB 5J7HA 5ANGA 4YHTA 3NEWA 4OTQA 5AV3A 5AEPA 3VS2A 4NH1A 4A4LA 3W0SA 4ZSAA 4QNAA 4IEBA 2VO0A 4CEGA 2W1ZA 4RJ5A 1OI9A 2F7ZE 4O0YA 5AP3A 5JT2A 3THBA 3W18A 3ZTXA 4FV9A 4EK5A 2ITUA 2OIBA 2G2HA 4ENYA 2PMLX 3CCNA 2PUNA 3EQDA