5ETAA

Structure of mapk14 with bound the kim domain of the toxoplasma protein gra24
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
351
structure length
336
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Structural Basis for the Subversion of MAP Kinase Signaling by an Intrinsically Disordered Parasite Secreted Agonist.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 336
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etaA01
3OTUA 4PP9A 3O96A 2UZBA 4MCVA 4U79A 4KIQA 3BV3A 1ZRZA 3RI1A 3LCSA 4R7IA 3ZMMA 2XNNA 3AMBA 1SNUA 1PMEA 2XIZA 5CSVA 5ANIA 3ORPA 5DRBA 4DT8A 3MDYA 3NX8A 4BDHA 4IVCA 2BAKA 4FL1A 3KA0A 2YM6A 5CF8A 4FKLA 1WBNA 3W18A 4DEEA 2QCSA 1J7IA 3NIEA 4LV8A 4KS8A 4U9AA 3N51A 1JSTA 5CYIA 3CPBA 2WD1A 3UVRA 3CBLA 4ZXTA 4EUUA 1Y57A 4W9WA 4HVHA 4PQNA 4B9DA 4DG0E 4QMMA 1A9UA 4K11A 4Y72A 2FSMX 4LMNA 3ZBFA 2VWWA 1X8BA 4QMLA 5AM6A 4MQ1A 4KKEA 2UZNA 5JFWA 1OIRA 4M69A 4U45A 4EHZA 4ASEA 2FSOX 3OWLA 2GNGA 4AFEA 1H27A 3MY0A 4AU8A 4RJ6A 1GZ8A 5FTGA 2H8HA 4NM7A 2VWYA 3DB8A 4FSZA 4CT2A 3ZFYA 3DAEA 5I3OA 2RG5A 3GU6A 3CD8A 2LGCA 3RPVA 4IZAA 4NM0A 3VQUA 2HZ0A 3UQFA 3DXNA 5L8JA 4FSYA 3HEGA 4I6FA 4EOIA 3DK7A 1UWJA 5HE0A 4YTCA 3L8SA 3UMWA 3F5PA 3KY2A 2OXYA 2OJ9A 5IA1A 3S1HA 4FKUA 4UMTA 2AYPA 5BVFA 4AZEA 4IB5A 4FA2A 3U8WA 4E4XA 4AAAA 3RBWA 2IVUA 5HVJA 3Q9XA 1YDTE 2VAGA 3RM7A 4O7WA 1E9HA 1UKHA 5CAPA 4DBNA 3G0EA 2C3JA 1HOWA 1WBTA 3REPA 3D15A 3GCSA 1T46A 3F3WA 2PMIA 4WG3A 5HG9A 4AFJA 4Q9ZA 3A61A 2Z7RA 2WQMA 3CJGA 4IVAA 4K1BA 4UN0C 4DEAA 2GHMA 4O0RA 5H8GA 3TJCA 3UQGA 4AX8A 1BYGA 5E8VA 3DV3A 1PXIA 3RNIA 4EBWA 2C0OA 1UNLA 2NP8A 3FQEA 2JD5A 3F6XA 3K2LA 2Q83A 2ONLC 1H0VA 2FVDA 3QLGA 3GOPA 5IQGA 2C4GA 4P90A 1U5QA 4ALWA 5E4HA 4CG9A 3TCPA 2C6TA 2V5QA 5GZ8A 4O81A 2X7FA 4AG8A 4YTFA 3ZDIA 3C4ZA 4FVPA 4M69B 3VUGA 1OUYA 4H39A 3QQFA 2XS0A 4DEIA 2QOIA 3Q32A 1QMZA 3CLYA 2IZUA 2Y0AA 4UMQA 5AP3A 4FV8A 3QTWA 4J71A 4LRJA 4QOXA 1XBBA 4HW7A 2JEDA 3DBFA 5HCZA 2J2IB 4MXAA 4NTSA 3FYKX 3SLSA 4BHNA 5FXRA 3PLSA 4AXAA 3GVUA 1IASA 1WZYA 2XKCA 3EL8A 2W1DA 2VO6A 5J8IA 3VS2A 4KSPA 4B4LA 3NPCA 4AW1A 5JH6A 5KKRB 1M7NA 1GZKA 5AUZA 2WQOA 2CNUA 1G8SA 2ITYA 4X2JA 5M51A 3TTJA 5M07A 2UZTA 2W1GA 1PYXA 2CN5A 3R9OA 3V8SA 1K3AA 4DCAA 2JGZA 2BFXA 2RL5A 5HG7A 2WMQA 2OJFE 4EH2A 4XG8A 3Q4CA 5M4CA 2O8YA 2VGPA 3L1SA 3L8PA 3KQ7A 1RW8A 3R7GA 3UOHA 3OFMA 1NA7A 5JQ8A 4WRSA 4WUAA 2C3KA 5H3QA 4D1ZA 4ZLOA 5A4EA 4TL0A 4F65A 3C0HA 4EONA 5HIEA 3UGCA 3DDPA 3BRBA 1PY5A 1ZY5A 1GNGA 4X6RA 1YOMA 3C1XA 3UNZA 4BWKA 5KUPA 4ZJJA 3W2SA 2E9VA 2ZMCA 4O0XA 4BCQA 3W2OA 4NL0A 3NMUF 4RJ8A 5F94A 2R7IA 5JK3A 5KBQA 4RQVA 3O0GA 4LI5A 2J5FA 4BC6A 5I9VA 4CV9A 2R9SA 5IUHA 3LFAA 4DFNA 2DQ7X 4LRKA 4QYGA 5I3RA 5BVOA 4YJPA 2ITNA 3MY5A 4RJ7A 2JITA 4R6VA 5C01A 5HI2A 2QO2A 3PVBA 4E6QA 3EN4A 3PZEA 2XK8A 5ANKA 5AUXA 2WU6A 2VUWA 5DFPA 3ZEWA 2QVSE 1V0PA 3R00A 2QOBA 5C4LA 2XK4A 2HY0A 5KMIA 4IX3A 2J51A 3KXMA 1P14A 4O2ZA 1VR2A 1YXXA 4QP6A 4DEBA 4IVBA 4NEUA 2RFEA 3GU4A 3IKAA 4GU6A 5CAUA 5LMKA 4B8MA 1WAKA 3T3UA 3FUPA 4JRVA 2BZKB 1PKDA 3EL7A 1J1BA 3HRFA 4OTPA 2VU3A 2YJSA 3OY1A 4RGJA 5ANGA 2Y4IB 3H10A 4PNIA 5CU6A 2YWVA 1XBCA 1ZMUA 3LQ3A 3RPSA 3A62A 3NZ0A 2PUUA 4ZLZA 4EWHA 5K4JA 4WOVA 2PUPA 2EB3A 3L9MA 4YJQA 5FXQA 4WNKA 4FTIA 4GFOA 3U87A 3H3CA 4HPUE 1Y6AA 3CTQA 5JFXA 3PIXA 1PXJA 2Y8OA 3O51A 3HRCA 3PXZA 4U40A 4JG8A 3T3VA 3QQLA 4M0ZA 3VS6A 4B6LA 4X21A 4BTKA 3VIDA 4ORKA 4NJ3A 4AQCA 1F3MC 2PVLA 4ZJIA 5EW3A 3QC9A 1YDSE 3P4KA 1M14A 3DKOA 3R1SA 4U6RA 3SC1A 4AZWA 2X6EA 4F09A 2C30A 3Q9WA 1YKRA 4FC0A 4GH2A 1BLXA 3OG7A 3O8TA 3POZA 4JT3A 4MD7E 1NVQA 4NFNA 5B2MA 2XKFA 3U9CA 3UO6A 4C3PA 4X2FA 2Z7QA 2XM8A 2YDJA 1GIIA 4HGTA 3R71A 2IVSA 5BVEA 4AA4A 1GY3A 4MNFA 5DEYA 2QOLA 3LOKA 5L4QA 3K3JA 2BILB 5I9ZA 2XM9A 4FIJA 4YBKA 5LVLA 4EK8A 3QYWA 5IISA 1H1RA 4JIAA 2WTKC 4EHEA 3R8PA 4L45A 4XMOA 4C34A 4LGGA 3UPZA 4J98A 3RTPA 4CQGA 4F7NA 5ICPA 5AX9A 2XYNA 4NU1A 4EOSA 5CSPA 1KE9A 2XK6A 3ZSIA 4AA0A 1U46A 4AZVA 5C1QB 5JEBA 4PUZA 4C58A 3A2CA 3CKXA 5EW8A 5M55A 3ZUTA 3Q9ZA 4DN5A 3CS9A 2CSNA 2C1AA 2EB2A 3A99A 3I6WA 3W8LA 4O82A 5BYLA 3AGLA 5FD2A 4HVSA 5CENA 4PX6A 4Z55A 5A3XA 3DY7A 2XRUA 4RWJA 5D11A 3MVMA 3TZ8A 3UVQA 5KO1A 3CIKA 4XBUA 1OIUA 2VNWA 5JZJA 4TWPA 3FZPA 3TNWA 4J53A 5CEKA 3I7BA 3I7CA 4DF3A 4ZSJA 2ITUA 3MPMA 4BWXA 3QX2A 4S33A 1KSWA 2J4ZA 4GIIA 2VV9A 5JGAA 5CS6A 3GP0A 2QKRA 4ANQA 5HGIA 4O1PA 4GUEA 3QCXA 1PF8A 2B0QA 4FZFB 3TI1A 3PXRA 3HP5A 4A06A 2GS6A 5KMMA 4YP8A 3O7LD 3BHHA 5A6OA 2HWPA 3DJ5A 4H3PA 4RA4A 4BN1A 4U3ZA 3BKBA 4BCGA 1SM2A 4OBOA 4MBIA 5I9UA 3HV5A 2YA9A 1OKVA 3KMMA 5A6NA 5I9XA 3DAKA 2HWOA 3BGQA 4QO9A 2JDVA 3B8QA 3FKOA 3CTHA 5AAFA 5HOAA 2YIWA 1XH7A 3EB0A 4ZTQA 4BBEA 3GENA 4BDCA 4L46A 2UW3A 3EQPA 3BWFA 3C9WA 3WZUA 3LFCA 5DT0A 5AFVA 1OPKA 4GFGA 4CYIA 1U59A 1UKIA 4S2ZA 2YIYA 2WQBA 3RINA 4TWNA 4D1XA 3HRBA 1BUHA 3EKNA 2OZAA 4IX4A 4HVDA 3F2NA 1A48A 2ESMA 1WVYA 4D2WA 5IEYA 2JDOA 4DGNA 4O83A 5M09A 3COIA 3FC2A 2BHEA 2R0UA 3BWJA 3I5NA 4FT9A 4JQ8A 2OIQA 2R3OA 2VTJA 4NK9A 3PJ1A 4YLKA 4WO5A 4O0UA 5HG8A 2HCKA 1AGWA 4EZ7A 3EQGA 2HELA 2X8DA 2BIYA 1OIYA 2YWPA 3G6GA 3UZTA 5HCYA 3IGOA 1WBSA 4IWOA 4MEDA 4KBAA 5ETIA 4FTMA 2VTRA 5CWZA 4O7TA 4QPMA 5E90A 4LV5A 2PL0A 3OWKA 5CALA 3EQFA 4X2KA 1ZYSA 4L43A 4AE9A 5IMXA 1R78A 2C5XA 4YZMA 3ATTA 3FI8A 4R1VA 3ZXTA 4DCEA 5KCVA 4HPTE 3GC8A 4UX9A 3UG2A 3HL7A 4YZ9A 4U0IA 4YNEA 5BVWA 4UMUA 4L8MA 5HU3A 4OT5A 3FXZA 2PYWA 1IEPA 2B9HA 2FYSA 4C7TA 4W4XA 5AADA 2GMXA 3RK9A 2VO7A 2P2IA 2P4IA 2WIPA 2Z7SA 3AT3A 5CY3A 2P55A 5FLFA 3PRFA 3ZZEA 1VZOA 2WKMA 1OL5A 5EOBA 2GHLA 2CNQA 4PL3A 3Q53A 3GGFA 3O71A 5M08A 3C50A 2JFLA 1JKKA 2KTYA 3BGPA 4NTTA 3I81A 1OL7A 4QP9A 3ENMA 4OUCA 4ZSLA 1ZYJA 3F3VA 2BAQA 4GYIA 3TV4A 1Y6BA 4GVJA 3R8VA 4ALVA 4D4RA 4F70A 3U55A 2BMCA 4LM5A 4GU9A 3ID6C 3FMHA 2NO3A 2Z8CA 2VN9A 4QP3A 3MFUA 2QOFA 4B8LA 4GW8A 2OZAB 4FOCA 2YM7A 2I6LA 1HCKA 3R9HA 3AC1A 5IA4A 3LXPA 4UMRA 3FHRA 4RX5A 4L7SA 3NYXA 4IM3A 4C4EA 4FKSA 4O0VA 3FI3A 2PULA 3AD4A 4R5SA 4NZWB 4E4LA 2GQGA 4QTBA 4JDJA 3FZSA 4V05A 4QMZA 1FGIA 4QQCA 2SRCA 1W82A 1QCFA 4IAYA 2XP2A 2R3MA 3FHIA 3ET7A 4OBPA 5J87A 3UG1A 3HGKA 2JFMA 4RG0A 4DGOA 2P33A 5C8KA 1J1CA 4XV2A 3GU8A 4Z7GA 1XH5A 4YLJA 5AMNA 4XHKB 4DHFA 4RBLA 3BE2A 3WZJA 3ZC6A 5EHLA 3KC3A 4BDKA 3A60A 4APCA 4CFUA 1IAHA 4JVGA 4C8BA 2R5TA 2EUFB 2HAKA 2BALA 2WMBA 3IPHA 1YI6A 4OTGA 3TWJA 3ZM4A 3MY1A 2QR7A 3FQHA 3MWUA 1PMUA 4PMSA 5HO6A 3E8EA 4D9UA 4BZDA 3C7QA 3KGAA 3LJ0A 5DG5A 2VZ6A 2X9FA 4PY1A 1IR3A 4MF0A 4R3RA 4U41A 4UWCA 5T6KA 4PP7A 4HVGA 4FKPA 5DYJA 2A1AB 1J3HA 5I9YA 2PMNX 3V8TA 3E63A 4G5PA 2H6DA 4OTHA 1Z9XA 2G2HA 2YAAA 4D0XA 1M7QA 5CNOA 4BKJA 2DS1A 3NRMA 4OTRA 4XYFA 3HMNA 3ZRKA 4O7YA 5IF1A 3LMIA 4HGEA 4O0TA 2GNIA 3UO4A 5CU2A 5FP5A 3ALOA 3D0EA 2PZRA 1H4LA 2C5OA 5KE0A 4CD0A 4ZMFA 5IQCA 3RWPA 4M0YA 3DTWA 1REJA 2HXQA 4C38A 1P4FA 3HLLA 4GRBA 4LQMA 2WMUA 4RJ4A 5C03A 2B52A 2W0JA 3FLWA 5M57A 4GUBA 5HTCA 4F0GA 4WNMA 2GFSA 1OVEA 3NAXA 3TZMA 3QD4A 3G9NA 4WBOA 1XH4A 2NPQA 2R4BA 3HECA 3P7AA 3NW6A 4AN9A 3FLNC 4ITIA 5FUTA 3GXLA 4EH6A 1YXVA 4J1RA 3PDTA 2BROA 3PG1A 3E3PA 4RFMA 1H1QA 5EDRA 2IVVA 4ZS0A 3R9RA 3BLRA 2X6DA 4ZSGA 5K0XA 1PXLA 5IG1A 4D4SA 4LG4A 2WTCA 4JBOA 2W1EA 2XZSA 2XMYA 3E3BX 3NUNA 5HVKA 3MVHA 3IW6A 5L6PA 3ACKA 4CFNA 5KMNA 5D7VA 2PK9A 4AF3A 3BQRA 4F0FA 3LAUA 2OLCA 3D5XA 2ITOA 3QLFA 2W1IA 4D5HA 3R7VA 3LXLA 4ERWA 1E1XA 2YACA 4A4OA 4BCOA 4CCBA 5D9HA 4BDFA 3A4OX 4O7NA 3MH2A 4QPSA 3OW4A 4F63A 4DEGA 3C4EA 4I4FA 3NUAA 1BKXA 5ETFA 2FUMA 4K77A 3QL8A 2GNLA 5AUUA 3QZIA 4M15A 2O63A 4HVIA 4KKGA 3BYMA 2C1BA 2NRUA 4KABA 4MWHA 2ZV7A 5JKGA 4UXQA 1MP8A 4E4MA 1JOWB 4I6BA 5AV1A 4FV7A 5JFSA 3FLZA 3NNXA 1ZXEA 2BUJA 4FV1A 2XCHA 4FYOA 4FZDB 2I0EA 4MXZA 4W9XA 3ULZA 3ZLXA 1J7LA 4X3FA 5IQFA 2EXCX 1NW1A 5K3YA 3RVGA 5FDPA 2OI4X 4O7RA 2VTQA 4L3PA 2OF2A 3KXNA 3ZEPA 5A9UA 1H28A 2C6OA 4O6EA 3PP0A 4CQEA 4DFBA 2J6MA 3PA4A 4FKTA 2V62A 2R3FA 2WMXA 3QZFA 3QTUA 4YLLA 5EK7A 1JLUE 5KZ0A 2W1CA 3E62A 4AP7A 3QALE 4MKCA 2WB8A 5HESA 4U44A 5L6OA 1MQBA 2HZIA 1FVRA 1YXSA 2QKWB 1IA8A 3MYGA 1KE6A 4KA3A 3F9NA 4QTDA 5J9YA 5M4UA 2IWIA 2RGPA 1U5RA 4D0WA 2BRHA 4ACDA 4RLKA 1FGKA 4FICA 3FC1X 3PG3A 4IWQA 3DFAA 3NCZA 3MW1A 3QKMA 3I60A 4YZBA 5E8SA 3SOAA 4E93A 2R3KA 3GCQA 2BDJA 2RFNA 5DI1A 5G1XA 4RRVA 4FTTA 3KXHA 2OG8A 2ERZE 3TUCA 2YM8A 2BVAA 3KKVA 3OMVA 4S31A 4XV9A 3PXKA 4JQ7A 4BCKA 4UMPA 1PRYA 2PE2A 2PVYA 4CCUA 4NW6A 5CEIA 1WBWA 4WIHA 3G51A 1NXKA 3VRYA 5E9EA 4L3LA 2G01A 3TL8A 3NYNA 2BCJA 3OXZA 3DKCA 3U4UA 1UU3A 4AACA 2UW5A 3VBWA 3WILA 4FT7A 3E87A 4UZHA 3NYOA 4C4IA 4EK3A 3NIZA 3R1NA 2PVFA 4F1OA 2W9ZB 4OTIA 2WMWA 2AC3A 4YHFA 5CEOA 2GS7A 5AR5A 4ASDA 4BCMA 4L01A 4CZYB 2HOGA 4GKIA 3WBLA 1CM8A 4K9YA 4QMXA 4X3FB 3CD3A 3PY3A 1LR4A 3IG7A 3MV5A 4DH7A 4RT7A 3FY2A 3BZ3A 4XRJA 2OK1A 3PPKA 4ASXA 2I1MA 4IX5A 2VRXA 4YJSA 1YVJA 2PTKA 2WAJA 5HO7A 1JSVA 3TZ9A 5GIPE 3R6XA 4H36A 5BUIA 4JDKA 2HYYA 1Z5MA 3EYGA 3ZRLA 4HGSA 4XRLA 4FE2A 4FZAB 1UVRA 3OCBA 3QD3A 5EDPA 3TEIA 2PWLA 2REIA 3D5WA 4BB4A 2FO0A 2VTTA 4CTBA 1Z57A 2XEYA 3KB7A 3FLSA 4AZSA 2RSVA 3GC7A 4A9SA 4RVMA 5IU2A 4BY9E 4CFMA 3GU5A 5AP2A 1PKGA 1SVHA 3M11A 5JN2A 3ZXZA 4WKQA 4QP7A 1JPAA 2QR8A 1IRKA 3P0MA 5CT7A 3NVKI 4XNEA 3FY0A 5HNGA 3PUPA 2WIHA 3A7HA 4I4EA 3I5ZA 4IM0A 4KIPA 5HVYA 2OJIA 2F7XE 5CQWA 5KMOA 1DI9A 4I0SA 4TWCA 2A19B 2UVYA 3EQRA 4U3YA 4YC8A 4X7QA 5H2UA 4I3ZA 4DC2A 4DE4A 4DAWA 3HA8A 1ZLTA 5L3AA 2C3LA 5D41A 3O8UA 3OXIA 5IUGA 4DTBA 4EHGA 3EZVA 4BCFA 5I5ZA 3BHTA 3PYYA 4O0WA 2R3IA 3CTJA 2WMAA 1UU8A 3QC4A 3ORLA 4K8AA 4UEUA 5FWKK 3FPQA 2X7GA 5LVNA 1P5EA 4O86A 1Q8UA 4ONAA 1URCA 2UZLA 5L8LA 3QD0A 5HZNA 4A9TA 4BDGA 5JRQA 4BCPA 2RFSA 4G2FA 2J0JA 3LCKA 4YHJA 4M7IA 3VJOA 1Q61A 2ZYBA 5AP6A 3V5TA 4GJ2A 4J7BA 2FH9A 2O2UA 2PHKA 2OJJA 1FINA 2P2HA 2QO7A 3KK9A 5C4KA 1U54A 2OBJA 2VD5A 2ONLA 4FTUA 4L42A 4IMYA 4O6LA 4RFYA 3N9XA 5KBRA 3MH1A 4I41A 3UO5A 4BZOA 2WMVA 3P79A 3R21A 4IBMA 2GHGA 5BPYA 5J7HA 2W4KA 5A14A 3MJ2A 5HBJA 3QKLA 5J9LA 2BKKA 2XIXA 2XNOA 3GCUA 4HNFA 4AOTA 3HDMA 4RC4A 5M06A 3VNTA 3VUTA 4MBLA 1PMNA 2UW6A 2ZB0A 3R0TA 3R7OA 4AWIA 4N57A 2P0CA 4TW9A 5TF9A 2X1NA 1OPJA 3ALNA 3LXKA 5J1WA 2CGXA 2G2IA 2JIIA 2V0DA 4FKGA 4DEHA 3EN7A 4WSQA 5EYMA 4IFCA 2GQSA 1OPLA 2CJMA 4GK2A 3ZC5A 2IPXA 4FSWA 2R7BA 5F1ZA 4D5KA 3ZDUA 4X3JA 3UQCA 4R5YA 3HV6A 3QWJA 3T9TA 4ZY4A 5AP5A 4H3BA 4TZRA 3KFAA 2WFYA 4JXFA 4FKIA 5HE2A 4G1WA 4IAKA 5DVRA 4F9WA 5AP0A 5EW9A 2WMTA 3VBVA 5LQFA 4H1JA 4CKRA 1YXTA 5IEVA 4KNBA 3TUDA 1FMOE 1XR1A 4U8ZA 3IW4A 1R1WA 4BWPA 3R8LA 4DGGA 4DT9A 3Q04A 4EH4A 5TT7A 5KMJA 1Y91A 4MXXA 2W5BA 4M97A 4FI1A 2Z02A 1U54B 1W83A 3R8UA 4H3QA 5AUTA 2JDTA 2OU7A 4IB0A 4LOOA 4ANNA 4ANLA 3EQCA 3ZUUA 3E93A 2X9EA 3TXOA 2C6DA 4W4YA 1W98A 5A54A 4O84A 3AC4A 4J8NA 3NW7A 3TM0A 3QTZA 5BX0A 3RPRA 4R7BA 5EOLA 2VTIA 4ZTRA 3W10A 4YBJA 3JPVA 5CU4A 3ZHPC 2GPHA 3DCVA 2RG6A 4ALUA 5CT0A 4BDAA 3MB6A 1WBVA 2YDIA 4G3FA 4PTEA 4C02A 3RHKA 4GT4A 1XWSA 3C5UA 4C4HA 2PZYA 5BUJA 4DA5A 5EYKA 5DE2A 4WD5A 3MPTA 2WOTA 4ACGA 4JS8A 3SHEA 4CT1A 2ACXA 3P9JA 5IDPA 3CGFA 2QG5A 5AAEA 5K5NA 5LMAA 4TYEA 4YHTA 2G1TA 3LVPA 3BEAA 1SMHA 3CE3A 4A4LA 4TY1A 1W84A 5CAQA 3TUBA 4L3JA 5C8MA 3VVHA 1G8AA 5CTPA 1Q41A 4BDDA 3EIDA 3OUNB 2XIYA 1CMKE 1JNKA 4QYYA 5GJDA 4ARKA 4XG2A 2J0LA 4FSTA 4G3EA 3RAHA 4OTFA 3GBZA 4ACHA 1FPUA 1VEBA 3PWDA 2YISA 4CFXA 4TT7A 3HV4A 1ATPE 4WA9A 1ZMWA 1OECA 5CSHA 4BIEA 5AAGA 5HLPA 3V5WA 1AD5A 5LOHA 5L2WA 4I94A 2W7XA 1STCE 4BYIA 4CFFA 4GEOA 3LM5A 4FSNA 3V5QA 3F88A 4NW5A 4XP3A 3ZH8A 3SG8A 3EFLA 3O50A 1LUFA 4E4NA 4EYJA 1YHWA 2PSQA 4LUDA 3QBNA 2W1FA 4L68A 4FUXA 5GHVA 2J0KA 3VC4A 3LFBA 1MQ4A 2CKEA 5DR2A 1PYEA 4CFWA 3NNWA 2FGIA 2C0TA 4O0YA 3DK3A 3FL5A 3TTIA 3UTOA 2CN8A 5HU9A 3LKMA 3AXWA 1TQPA 3RZBA 4MVFA 4F6WA 5JMSA 2YLEA 4XP2A 4YO6A 3VULA 2YFXA 3P08A 4D4VA 3DBQA 2ITZA 5AIRA 4L7FA 3FQSA 1JKTA 3FZRA 3W2QA 3Q96A 5ANJA 5BMMA 3MJ1A 3OP5A 5AUVA 3IW8A 1YOLA 2WXVA 3R9NA 4APPA 4XUFA 3FDNA 4BCJA 2HZ4A 4YO4A 4N6ZA 4BIBA 4K33A 2PVKA 2QURA 2WMRA 2XYUA 3DNEA 4FK6A 4IQ6A 4P5ZA 5ACKA 4D2TA 3PZHA 2X7OA 5KMLA 4HYSA 3HV7A 5IQDA 2BDWA 3PVUA 4NSTA 3S2PA 4EOKA 4U5JA 2R0IA 3AD6A 4FNXA 2PZIA 3BLHA 4HZRA 4QMUA 4AZTA 3TZ7A 3FEGA 3OOGA 4CFVA 2YIQA 3FMMA 2QNJA 5CASA 3SW7A 4JNWA 5KHWA 3PP1A 1Q24A 3QGYA 3NW5A 2IW8A 3OBJA 3F2RA 3ZZWA 3F3UA 3N4TA 2ZDTA 3VW8A 4ZTLA 3UODA 3LMGA 3P5KA 4J52A 4FODA 4KWPA 4NWMA 4J97A 5E91A 3KRJA 4ZTNA 5EQEA 2ITWA 3AMYA 3RAWA 2OKRA 4KAOA 5A4TA 5J9ZA 3EN9A 4IIRA 3O7LB 4C4GA 4EQMA 3POOA 3F5GA 4TYIA 2WTIA 4K2RA 5AV4A 2JAMA 3WYXA 3DU8A 3LM0A 3WF7A 1MRYA 4RZWA 2JBOA 4RFZA 3TT0A 4DTAA 5HLWA 4I92A 4RX8A 1KE8A 3FMDA 2BR1A 4QT1A 2PE0A 3VO3A 5M56A 4RJ5A 4MX9A 3R1QA 4ASZA 3L9LA 4BBMA 1O6LA 3KRWA 3WZKA 4IAIA 2B9JA 3OUKA 2W1ZA 3KCKA 2Y4IC 3RM6A 5JQ5A 1YDRE 4QRCA 4YPDA 3COMA 4GG7A 2R3GA 3AC3A 3FAAA 2PUNA 1VYZA 2XNGA 3GT8A 3MTFA 2BRBA 3AT2A 3GCVA 5AUWA 1F0QA 2FB8A 4I20A 3W55A 3SW4A 4QMNA 2CKPA 2CGWA 1YXUA 3MGYA 4GCJA 4Y73A 4C61A 4CLJA 4J96A 4BZNA 5CF4A 2YZLA 5IQHA 3R30A 4QMQA 3CY3A 2NRYA 3A7IA 4FTLA 4ZTSA 3P7BA 3UOKA 4TYGA 4AOIA 4FGRA 5DWRA 3SKCA 5EM7A 2E9PA 4M3QA 4FKOA 4D2PA 2XNBA 2OW3A 1UNHA 3EQHA 3DAJA 4AT5A 3LFFA 3VN9A 4ZIMA 3SOCA 1H24A 4JIKA 4N70A 4FTOA 1UWHA 4ITJA 3R9DA 4II5A 3ATSA 4GT5A 4X2GA 3LMHA 4I22A 4BCIA 3JR1A 2W4OA 5CEQA 4OAVB 2X8IA 3BYUA 4QTEA 5A4QA 3R1YA 2OJGA 3QAME 3MSSA 5EDQA 3PSCA 4JR3A 1O6YA 5AR3A 5IUIA 5IH4A 4QP4A 1OZ1A 3JVSA 4FX3A 5IH6A 2NNWB 1R0PA 3LFSA 4JBVA 5E92A 2QOOA 4O27B 3WIGA 4FMQA 4F9AA 5CAOA 3JY0A 5CVGA 2BZHB 3DGKA 2PUIA 4F4PA 5TO8A 3PA5A 4FZ7A 1YI3A 4PRJA 3VUHA 2YLFA 2VWXA 5LVPA 2PY3A 2XRWA 2OIDA 5E8ZA 4RIOA 2RIOA 3BYOA 4RSSA 3R8MA 3LQ8A 1KV1A 2XJ2A 3AT4A 1Q8YA 2RFDA 4FG7A 4I5MA 4EK4A 5AR7A 2GQRA 4IDVA 4UBAA 1KOBA 3LFNA 4A9UA 3VS7A 3U9NA 1YRPA 4A9YA 4IZ7A 1QPEA 5AX3A 4Q2AA 3H9FA 3DQXA 3HZTA 4UY9A 2GNFA 2W06A 1CKIA 3DA6A 3E5AA 3FSFA 3QCYA 3QX4A 5CNNA 2OXXA 5EM8A 3U4WA 4EQCA 4EWQA 1YHSA 5J79A 5B2KA 4G3GA 3I79A 3FV8A 3GC0A 3QGWA 4RIXA 3RNYA 3TNIA 4C2VA 3LCOA 2YCSA 1V1KA 3WZEA 4OTQA 4C3RA 4FIIA 3U6HA 3QTXA 4ZJVA 1OITA 4EEVA 2PVRA 4YZCA 2B55A 3OCGA 3Q4UA 5HLNA 3SX9A 4E6AA 3HMOA 4WBBB 4BI0A 2I0VA 3DJ7A 4L00A 5E8XA 4DLIA 2ZM1A 2BRNA 4IAZA 4XP0A 3VBYA 3GCPA 3IW7A 4I6HA 2VTSA 3UYSA 3NNVA 2YEXA 3W16A 1H26A 3I1AA 2V22A 4LGDA 3VJNA 4GMYA 4G5JA 4ZAUA 2C5NA 2R3NA 4EI4A 2C5YA 3FZTA 5IA0A 2CGUA 4PTGA 3G90X 5DEWA 5D10A 2UW4A 3BBTB 1Q3DA 2JBPA 4LGHA 3TNQB 3E64A 3NLBA 4FKVA 3R01A 4C0TA 2QLUA 1DAWA 2W1HA 4EK5A 3AG9A 4QMSA 2XK7A 4IANA 4WNPA 3F66A 2O5KA 2OF4A 3GEQA 4LMUA 4O96A 3RHXA 5HICA 3C0IA 2PVHA 3GFWA 3S0OA 2YHVA 4RC2A 3KF4A 4RWLA 3ZFXA 4M13A 4NUSA 3UIMA 3EQDA 3P78A 2ZOQA 4TTHB 4DEDA 2VO3A 3AMAA 3DB6A 4QTCA 3GUBA 4J95A 4LOPA 3C13A 4NFMA 4BGHA 2YCQA 4CSVA 5M4FA 4QYEA 1SNXA 5CU3A 5FQDC 4E20A 4N4SA 3I4BA 4N0SA 2E9NA 3ORKA 3BELA 5BVDA 4PMMA 2QOQA 1JSUA 3MTLA 5HG5A 4EQUA 4B99A 4CRLA 4O7SA 4RIXB 1T45A 2EU9A 3H0YA 3KVXA 4YZNA 3PSDA 1GZNA 3H4JA 3VF9A 2W5HA 2XK3A 3HKOA 3OT8A 3B2WA 5C27A 3ODZX 4Q5EA 3W2PA 2Q0NA 3WI6A 5AA9A 4M67A 3O23A 5IDNA 1AQ1A 4BGGA 1TKIA 4FYNA 4FTNA 1OIQA 1UU9A 4P4CA 4YJRA 2PU8A 3ZONA 5EG3A 1ZARA 3FXWA 2ETMA 4BRXA 3MH0A 4MBJA 2GU8A 3ZS5A 1FQ1B 4IAFA 4K18A 2UW8A 3DKGA 3D7TA 3GB2A 2IG7A 2RKUA 4JDIA 4PL4A 5DN3A 3R8ZA 3DZOA 4DINA 3PPZA 1XBAA 3QTRA 5K4IA 3MPAA 4HYHA 1OL6A 2JKQA 4XS2A 4K6ZA 4YTHA 4AGUA 4MAOA 3AC2A 3UE4A 3V5JA 5EKOA 4DFLA 4FKQA 2JKOA 4L9IA 1H01A 2JKKA 3LFQA 4NJDA 4D58A 3D7ZA 5ANDA 2E9OA 5IH5A 5EKNA 4USEA 5ANEA 2PVNA 5JGDA 4JR7A 3SXRA 5M53A 4A9RA 3UMXA 2W05A 5F20A 2QODA 2GFCA 4MD8E 1RQQA 4FEQA 1YWVA 3A7GA 4CRSA 2ETKA 5HD4A 4FSRA 4D55A 5LARA 2VTHA 4C4FA 3KK8A 1XH9A 2YM4A 3QRUA 2YM3A 3VBQA 5CANA 5L2IA 5GZAA 1BMKA 3F7ZA 1CKJA 3FKNA 4GV1A 3HVCA 4O38A 4AW5A 4D4YA 2FSLX 3TDWA 4L44A 3NUPA 4FR4A 4IDTA 2VTMA 4P2KA 3EFJA 3ELJA 3UZRA 4BCHA 1UV5A 2VO0A 3DLSA 1Q8ZA 2C6LA 3MFTA 4YSMA 1YHVA 2ITTA 5E1EA 5KZIA 4MH7A 2CLQA 1JKSA 2QC6A 4E5AX 4YU2A 5C26A 2X39A 2QD9A 1RJBA 2YCFA 3OEFX 2A2AA 1OBGA 3K3IA 2ZV2A 5A46A 2B54A 3OC1A 3D7TB 5DNRA 2PVJA 4C2WA 4FVRA 1CSNA 3ZO4A 4YJVA 5E8TA 4IXPA 3D4QA 3K54A 4BKYA 3N4UA 4TXCA 4TWOA 5K9IA 5IPJA 4EKLA 4QTAA 5FM3A 3WF9A 4E7WA 5CEMA 2BRMA 4UYNA 2G2FA 3TIZA 3KXXA 2XKDA 3S00A 1KUTA 4CV8A 4X2NA 1JKLA 1GZOA 2X81A 4I5HA 3COKA 3Q5ZA 4I0TA 5EFQA 5IMEA 4LUEA 2IZTA 4XV3A 3LJ1A 5DMZA 2WEVA 4IAAA 3KF7A 4U7ZA 5B0XA 5D1JA 3B2TA 4KIKA 3NGAA 5B7VA 5J7BA 2R2PA 2UZUE 3BLQA 4OLIA 1H1SA 3PXYA 5BQ0A 1NT2A 4G6NA 2PMOX 3VBTA 5JT2A 2QHNA 3GC9A 4JJRA 4FTKA 1YWNA 4MYGA 5EH0A 3KRLA 4ANOA 4P7EA 4FL2A 3UNKA 2UW9A 3AC5A 4LL5A 2UZDA 1SYKA 3A7FA 4OT6A 4HNIA 4E1ZA 3FZOA 2XKEA 3NR9A 3QUDA 4BDIA 4UV0A 4F9BA 2RF9A 1Q5KA 4YC6A 3TDVA 2XJ1A 2I7QA 3RAKA 3OW3A 5FXSA 3UC4A 5TE0A 4DH1A 3MESA 2XVDA 3QHWA 4LFIA 3LIJA 4EC8A 1LEWA 3C4CA 5DIAA 4KINA 3PPJA 4ZEGA 3DXQA 3P86A 4CYJA 3W8QA 3ZLWA 3BU5A 2OH4A 3V5PA 3F3ZA 4HJOA 4DG2E 4JG7A 1E1VA 2H34A 3FI2A 5AR8A 4DH3A 2CMWA 4TRLA 5FEDA 4E5BA 3B8RA 3W2RA 4GSBA 3OWJA 5KMKA 4GFMA 4QYFA 3HNGA 2BZJA 3KN5A 4U43A 1PJKA 3QF9A 2OFUA 3R83A 4R77A 3VS5A 1YWRA 5J1VA 1RDQE 4MK0A 3DXPA 2OGVA 2PZ5A 2UZWE 2V7OA 4BIDA 3UIUA 4DFUA 4EOPA 2DWBA 1G3NA 3CKWA 3PJ8A 2VWVA 3TNPC 4AA5A 2CHLA 3BEGA 2QU6A 4FIHA 4EJ7A 5DRDA 4S32A 1R3CA 4FOBA 4KIKB 2J9MA 3V5LA 4RX7A 3NUYA 4Z9LA 4AN2A 4E3CA 3IQ7A 4AE6A 4BVUA 4CGAA 3PLAE 4I5PA 3BHUA 5IKWA 5HD7A 2Y6MA 2JAVA 1FVTA 2X2MA 2BIKB 2XA4A 4FV3A 4QQ5A 3WIKA 4EH5A 4NKSA 3NAYA 5AIKA 2OFVA 4LRMA 4LYNA 2R3RA 1BI8A 1XQZA 4UZDA 5KHXA 3UIBA 1OGUA 5TKDA 3DT1A 4AUAA 4IE9A 4XG7A 1B39A 4QYHA 3Q2JA 4S34A 3DDQA 2C5VA 2YDKA 4IVDA 5CF6A 1TVOA 3FMKA 4YR8A 4QP2A 2VWZA 4FT3A 2HW6A 2HW7A 3DK6A 1VYWA 3CQEA 1Q62A 3DOGA 4KRDA 3ULIA 3KXZA 3VHKA 4RA5A 4NCTC 4DGLC 5EHYA 4I93A 3G9LX 3NUSA 3P1AA 3DPKA 2C6MA 2IO6A 1I09A 2R64A 1O9UA 3EHAA 1OKWA 3G5DA 3IECA 3PJ2A 1H07A 2QOCA 3L8VA 5CZHA 3E8CA 3UC3A 3IS5A 3OCTA 4OR5A 3MA6A 4X3FC 5LXMA 2OICA 3NCGA 3OD6X 3OCSA 2WTJA 2HK5A 3E8NA 4IM2A 5ANOA 2XIKA 5AA8A 4EZ5A 4CZUA 3I6UA 1JQHA 2OWBA 3Q4TA 2F9GA 3OT3A 4PNKA 2YN8A 1OBDA 2BTRA 4NH1A 3QA8A 4QNYA 2WOUA 5A4CA 2J90A 4Y95A 3VUDA 2XB7A 5JSMA 3BX5A 2CGVA 4IH8A 2B53A 4OAUC 5GJGA 3R2BA 3LZBA 4M14A 3CY2A 4BL1A 4QMPA 5AV3A 3V51A 5K5XA 3L9PA 4U81A 2YERA 4EOQA 5JRSA 3AC8A 4ZSAA 4K0YA 3UZPA 3QXOA 3K5UA 3PE1A 1Q97A 5FGKA 3ERKA 3R22A 2JDRA 3CQUA 2WZJA 1OI9A 5AUYA 1QPJA 4CNHA 2W17A 1FOTA 3IONA 5J5TA 2HENA 3L9NA 5GINE 3BIZA 3NS9A 3TNHA 3E7OA 4MXOA 3VS0A 3FJQE 4IB1A 4OW8A 3DLZA 4O7VA 4IJ9A 5AWMA 4C37A 2YM5A 4KKHA 3WF8A 4QMTA 4CEGA 4BTMA 5I9WA 4IJPA 5L8KA 3Q6UA 4G3DA 1M17A 4XEYA 3U6IA 4IACA 1W8CA 4USDA 4JLCA 5CVHA 1DM2A 2JIUA 1YQJA 2EXEA 3QQHA 1VJYA 4FEUA 2UVXA 2VTPA 2XH5A 2YCRA 5CU0A 4DH5A 3NNUA 2OXDA 4RWIA 2QO9A 3RZFA 3BHYA 1RE8A 2VWBA 2UVZA 3H9OA 2CLXA 4DG3E 3CR0A 3QRJA 4D1SA 4TKSA 3S4QA 2XNMA 3C4XA 3DJ6A 1ND4A 2HZNA 3OHTA 3HAMA 1I44A 2V7AA 5AP7A 3LPBA 4IZ5A 3EFKA 3NUUA 5FTQA 2WGJA 1ERKA 3DNDA 3LFEA 3PE2A 3PY1A 4FV9A 4PWNA 4A07A 4EH3A 2IW6A 4W4VA 2X4ZA 4YJTA 5LVMA 4F6UA 1XKKA 4TN6A 4PPBA 4QMVA 2R3HA 4M66A 5FTOA 3TIYA 1BL7A 5L2TA 5DLSA 1SZMA 1GIJA 2OSCA 2XBJA 3BCEA 4Y8DA 4DYMA 5I0BA 4CG8A 3FMNA 2R3LA 4YGAA 4WSYA 5CSXA 4MTAA 1GJOA 3F3TA 5AJQA 4FBXA 3FSKA 4EKKA 3VUKA 3G33A 3RKBA 4L53A 4BBFA 4F0IA 4GKHA 1PW2A 5BVNA 3NSZA 1GOLA 4F7JA 3FPMA 4E26A 4EJNA 4F9YA 4RLLA 2ZM3A 3MA3A 5FDXA 4AW2A 3F7WA 4UWYA 3JXWA 4EORA 5GIOE 1PXKA 3CEKA 4ENYA 3FYJX 1LP4A 1IAJA 4J99A 3NUXA 2YIXA 3Q5IA 2A0CX 4RVKA 2A27A 3D5UA 3F61A 3ORIA 3SAYA 5L2SA 3HAVA 3ZU7A 3NVMB 2JC6A 3DBCA 1WBOA 5BUEA 4G6OA 1A06A 2R3JA 4V0GA 3RCDA 1PXOA 3QCSA 1DS5A 3CP9A 3AD5A 4FV5A 4PV0A 5AM7A 3MN3A 4S30A 5ACBC 4ZMEA 3U6JA 3LCTA 5IQAA 4OBQA 4I23A 1P4OA 4BTJA 3FMLA 4RX9A 4NIFA 4ACMA 4DBXA 3FLYA 4U42A 4BF2A 4Z16A 4KUJA 4R8QA 1PMVA 4PF4A 3RPOA 3PVWA 4XG3A 1NVRA 1BL6A 3PXQA 4FK3A 4WHZA 5E1SA 5GZ9A 4MHAA 4FIFA 4PDYA 3OWPA 2J0MB 2QOHA 3P7CA 1KWPA 4FG9A 1H25A 4FKWA 1OUKA 4W4WA 2QQ7A 4ZSEA 3LLTA 1H0WA 1ZYCA 1P2AA 3OTVA 3JY9A 1LEZA 1Y8GA 2QU5A 4PL5A 4IHPA 4AGCA 3R7UA 4IZYA 4F1TA 5IQEA 4M12A 1WVXA 4W8DA 1PHKA 5DR6A 3BU6A 1WVWA 4RJ3A 2I40A 2ZM4A 4N6YA 2B4SB 4FKRA 4AZFA 3KVWA 4CKIA 3EJ1A 1TQMA 5AR4A 2Y4PA 1NVSA 2G9XA 3OS3A 5AP1A 4XG4A 2J0IA 4MQ2A 4Z3VA 3AQVA 2UZVA 3SQQA 3D9VA 3IOKA 4PDOA 4C57A 5LCJA 4OTWA 5EQPA 2QHMA 1YI4A 2CCHA 3GQLA 4JBPA 2Z2WA 3RMFA 2X2LA 4MNEA 4FSUA 3V04A 2Z60A 3V3VA 1ZOGA 3A8WA 4GIHA 3KRXA 3G0FA 5FM2A 2WEIA 3UVPA 4IW0A 4IX6A 3VHEA 4V0GB 3KCFA 2YABA 4HYUA 5HEZA 2F7ZE 5KKRC 3ORNA 4O7ZA 3HP2A 3OVVA 3MVLA 4XG6A 2WTVA 3FL4A 4NIFB 4RIYA 3WOWA 2YITA 3IDCA 4FTQA 1ZZ2A 3QRIA 4G6LA 2IW9A 3KN6A 4GL9A 4ZY5A 4ENXA 3CSVA 4QMWA 4MXCA 4AT4A 1ZY4A 3T9IA 2XBAA 5E8YA 3D2IA 4FTRA 1G5SA 5EHOA 5FBNC 4FGBA 1B38A 3HX4A 3QXPA 4IADA 4RWKA 5CI7A 3HA6A 5D7AA 2OZOA 3N4VA 3UYTA 4O2PA 5DPVA 2WMSA 2DYLA 1URWA 1XHAA 5CAVA 3QQKA 4O1OA 4KD1A 3GFEA 3EZRA 3TKUA 1L3RE 1OM1A 4BYJA 5AEPA 3DS6A 3ETAA 4EOJA 1XH6A 4FV2A 4FSQA 4RZVA 4ZOGA 3UOLA 2QLQA 3QQJA 2ZV8A 1W7HA 2BZIB 3WARA 5TR6A 5J5SA 4JRNA 4FL3A 4AOJA 4FF8A 5HX6A 4D2VA 5K0KA 2J5EA 3RK7A 4MNEB 4G17A 3D5VA 3VRZA 4G16A 3VBXA 4EH7A 5IA3A 4ITHA 3ZO1A 4QQTA 2UZOA 2BRGA 4FTCA 1REKA 3QUEA 4FVQA 3IGGA 4Y85A 1M2RA 5CSWA 5E8WA 5EYCA 4D2SA 3VWAA 3C4WA 5EI8A 2CCIA 3QHRA 3G6HA 5HE1A 4BDBA 4DTKA 5M44A 3KMUA 5H8BA 2WO6A 4MF1A 5IA2A 4AN3A 3PWYA 3Q9YA 4IWDA 3QYZA 4L6QA 4L67A 3GQIA 4RIYB 5D12A 4M8TA 1M2PA 4MD9E 2OH0E 1S9IA 4JG6A 1YW2A 3BPRA 2WTKB 1BX6A 4CKJA 2O64A 4I24A 4ZTHA 2GNJA 2VX1A 4JX7A 3G2FA 3VS1A 3DBEA 3RJCA 4IWPA 5DA3A 4D28A 3C4FA 3PTGA 2ZMDA 4EBVA 3WE8A 3MIAA 2KULA 4JBQA 2WPAA 3DKFA 3ZYAA 4YURA 3OBGA 2HY81 3DZQA 2GTMA 2ZVAA 4EC9A 5JFVA 1UNGA 3F82A 4XJ0A 3NWWA 3BU3A 3OF0A 4I21A 4O22A 4ZZNA 2B9IA 2PMLX 1R39A 3HYHA 4KBCA 4Y5HA 2XJ0A 4CMUA 1J7UA 1J91A 2J50A 5H9BA 3MIYA 1FVVA 4DLJA 4FKJA 1ZWSA 2PE1A 3I0OA 1ZYLA 3UIXA 4F9CA 3RK5A 4ZTMA 3ANQA 4HOKA 5LWMA 2WQNA 2GNHA 1APME 4C33A 4BR3A 3FE3A 5I4NA 3GI3A 4G9RA 1MUOA 5EQYA 2CNVA 2VTOA 3RCJA 4E8AA 2DUVA 4EUTA 2X2KA 5ETAA 2IZSA 3BGZA 4TYHA 5C9CA 2I0YA 3W2CA 2IZRA 2GS2A 4YNOA 5HE3A 3DFCB 5JZNA 3ZFMA 2FA2A 3QQUA 5HKMA 2UW7A 3QFVA 2XEZA 4GK4A 4RVTA 4DFZE 3JVRA 2W4JA 3PJ3A 2PPQA 4JOAA 3F69A 3SG9A 3V6SA 2H9VA 5LCKA 4E73A 1JBPE 2WTWA 4BDJA 4TNBA 1TQIA 2CPKE 3I0QA 5EI2A 5DHJA 4GVAA 4G34A 2EVAA 4I1ZA 4QNAA 2WHBA 4BKZA 4KIOA 3NDMA 1KE7A 5LMKC 1W0XC 4DFXE 3UJGA 4AT3A 3COHA 4TYJA 2F7EE 3ZCLA 4DH8A 1PXPA 2ZJWA 1F5QA 3C0GA 3QZHA 5E7RA 4NM3A 5IQBA 3ORXA 5A4LA 4JI9A 4CTCA 1B6CB 2C68A 3CJFA 4EZ3A 3EH9A 4HCTA 4ZZOA 3EQBA 4KSQA 4CMOA 4ZS4A 4DGMA 3DQWA 3EFWA 2ZDUA 5HX8A 3RGFA 4QMOA 1MRUA 4AGDA 4BTFA 1Q8TA 3WZDA 4F99A 3A7JA 3WE4A 3LE6A 2HIWA 4Y46A 1WFCA 4FNZA 4WNOA 3TV7A 2AC5A 4UYAA 2XNEA 3OY3A 4XCUA 1OKYA 4KBKA 4XOYA 4G9CA 3KRRA 1S9JA 3D14A 2Q0BA 3JYAA 4QP8A 2VNYA 3H0ZA 4FEXA 3LXNA 4IEBA 3M42A 3M2WA 3W33A 2R3QA 3D94A 4LL0A 1U4DA 4B7TA 4PMPA 3GOKA 3FMJA 1SVEA 4BFMA 2V55A 3FKLA 4M68A 2O0UA 4Y83A 1UU7A 3W32A 3QKKA 3MBLA 4OGRA 3FWQA 4TYHB 2GTNA 1Q99A 4EL9A 5EM5A 3HV3A 1ZAOA 4JAJA 3ROCA 1M2QA 3VUIA 2CKQA 4V01A 5CVFA 3NYVA 3TJDA 2R3PA 1FBNA 4YSJA 2HXLA 4NYEA 3TV6A 2PZPA 4GS6A 3Q4ZA 1K9AA 5HTIA 3IK3A 5GNKA 2JIVA 2WELA 3CCNA 3AOXA 3JUHA 5DT3A 4G3CA 3QQGA 3R28A 4FNYA 3RWQA 3P23A 4G31A 4FEVA 4IC7A 4JDHA 4MXYA 3IDBA 5EM6A 3C51A 2C69A 4I5CA 3LQ5A 1SVGA 3S3IA 5HORA 4YTIA 4CMTA 3V8WA 4CXAA 2QOKA 4R3CA 1NY3A 3D2KA 1Y8YA 3QRTA 1ZYDA 3QTSA 2BKZA 4A4XA 1DI8A 5CLPA 2VWUA 3RAIA 4WUNA 3GU7A 4Y5QA 4F1MA 5BNJA 5BMSA 5HQ0A 3Q52A 4HZSA 1XO2B 2VTLA 5CX9A 2P3GX 4NKAA 2ITPA 3BHVA 4YPSA 4ACCA 4CLIA 3EN6A 2X0GA 4RIWA 4YJUA 4AW0A 4BHZA 2J7TA 1QL6A 3R7YA 1OL1A 4EOOA 2I0HA 3R7IA 3ACJA 4F08A 3ZBXA 3PIYA 2UV2A 5G6VA 3UP7A 2BHHA 3ZO2A 1OKZA 1GIHA 2C3IB 2FSTX 2ZAZA 3BYSA 3ENHA 3L8XA 4I0RA 4XH6A 3FLQA 3OROA 3BV2A 4E6CA 4QMYA 5AV0A 2G15A 4F7LA 2GDOA 4FTAA 5BYZA 4YJOA 1IG1A 4TNDA 4GYGA 1V0BA 5KX8A 4WG4A 2WU7A 4PDSA 4ZZMA 1CDKA 1KE5A 3G15A 3WF6A 2A4LA 2O65A 3RPYA 4E5WA 4O0SA 3E92A 1H00A 5BYYA 3MS9A 2F57A 4ANBA 3CPCA 3OXTA 3SGCA 4AS0A 3C5IA 4JQEA 4USFA 3AGMA 4M84A 3ROYA 5CZIA 2VX0A 4HGLA 3ZUVA 4YMJA 2YJRA 4O7LA 3ORTA 3PXFA 4MWIA 2F2CB 3R73A 4FT0A 4WRGA 3EYHA 3R02A 5C8NA 5FRIA 3MFSA 2C6KA 3MH3A 1XJDA 4JL9A 4ZK5A 1H1PA 2C6IA 5AV2A 3ZRMA 3UNJA 3Q2MA 4BCNA 3SXSA 4WT6A 3HMIA 3RALA 3T8OA 3QCQA 4C36A 3F5UA 5FP6A 2O3PA 3ZTXA 4FEWA 3UDBA 4C3FA 3PSBA 1QPDA 4HYIA 4GG5A 2ZB1A 1XH8A 4RC3A 3FI4A 3FBVA 3H9RA 2GCDA 1Q3WA 1QPCA 1YOJA 4RIWB 4KB8A 2PVMA 4W8EA 3SXFA 2ITXA 4IFGA 1Q8WA 5LMBA 2F49A 3VS4A 2IJMA 4B0GA 3BQCA 4H1MA 1R0EA 1WCCA 2YIRA 2VTNA 3DTCA 4GJ3A 2QG7A 4AGWA 1Q4LA 3PJCA 3EWHA 3WF5A 3ZLYA 1MRVA 4L52A 3R2YA 4JX3A 1WMKA 1H1WA 5B2LA 2C47A 3OOMA 3VF8A 2C0IA 4XV1A 5L2QA 3U54A 2AUHA 1K2PA 3GNIB 3SRVA 3ZSGA 4I6QA 3II5A 4QD6A 1LPUA 3RP9A 2QI8A 3KULA 2BAJA 4FV4A 4YUQA 3F5XA 4C62A 5DOSA 1GAGA 4D9TA 3R63A 2ETRA 5LWNA 5FG8A 4Q9SA 5M4IA 1H08A 3LW0A 5HBHA 3ORMA 5KNJA 2W5AA 5CXZA 4XX9A 4YJNA 2XCKA 3VAPA 2X8EA 4XLVA 4YC3A 3SV0A 3VQHA 4FUYA 3KL8A 2YAKA 5CQUA 5TOZA 3CXWA 2XIRA 4GT3A 4OTDA 4QPAA 2BFYA 4DFYA 5HBEA 4RMZA 4C59A 5IA5A 3R04A 3M1SA 4R7HA 4CVAA 1DAYA 2JKMA 3FXXA 4O91A 2EWAA 5ETCA 4UWBA 3UOJA 4R78A 4FV0A 2LAVA 3TACA 4UXLA 5HIBA 4BICA 2XF0A 3U51A 4WG5A 3A4PA 3HMMA 3ITZA 3ZSHA 3ZLSA 2IVTA 3TG1A 1ZOEA 3QD2B 4X6QC 4ZP5A 2BDFA 3ZOSA 5IZFA 4FT5A 1H8FA 1OL2A 2W99B 4NCTA 5HCXA 1ZZLA 2CDZA 3SVVA 3WYYA 2OO8X 2H96A 1KV2A 3FZ1A 1O6KA 1BI7A 3ODYX 5EI6A 4EH9A 5ITAA 5DGZA 3UPXA 4XBRA 4R3PA 3ZO3A 2E9UA 4C35A 4F7SA 3V01A 5JGBA 3IDPA 3O17A 3E7VA 5F9EA 3PIZA 2Y9QA 1WBPA 5GJFA 3SRVB 1L8TA 3SA0A 3LCDA 4XLIA 5CI6A 3IOPA 2CKOA 4D2RA 2Y7JA 4E6DA 3IW5A 3KULB 4DITA 2ERKA 4KS7A 3S95A 3TKHA 4QP1A 1PXMA 4U80A 5LJJA 2GSFA 2WTDA 2Y6OA 4P5QA 1HCLA 3MFRA 2Z7LA 4ANSA 3A8XA 3E8DA 3ANRA 5CF5A 4R1YA 5IEXA 4U97A 4EH8A 3EOCA 2VX3A 5F4NA 3IO7A 2W96B 3HDNA 3PRIA 3D83A 3QWKA 3KU2A 1OB3A 4H58A 4PPAA 4ERKA 1PXNA 3Q6WA 4EOMA 3SDJA 4X0MA 2YZAA 5AP4A 3SD0A 1IA9A 1EH4A 4YZDA 5HNIX 3THBA 3HUCA 3VUMA 3Q3BA 3VW6A 4KRCA 5DH3A 4PPCA 3QTIA 4F6SA 4XOZA 5F95A 4ANMA 2ZV9A 4EHVA 3R7EA 2IN6A 4PTCA 1CKPA 3PY0A 3JS2A 5BVKA 3CC6A 3QUPA 4XG9A 4PDPA 2W9FB 5AR2A 4BDEA 2E2BA 4RQKA 4ZLYA 4LOQA 1UA2A 3FMEA 5FBOA 2EXMA 3QRKA 3MI9A 4ID7A 4V04A 5HIDA 5L6WL 4F64A 5HO8A 3K5VA 3KEXA 4UB7A 5FEEA 4A7CA 3EMGA 2B9FA 4C4JA 4HCUA 3LFDA 5EYDA 4H05A 2B1PA 4Q5HA 1JAMA 5CXHA 1V0OA 4RPVA 3W1FA 2VGOA 3HMPA 3EN5A 3LJ2A 4UALA 3VS3A 3OZ6A 5DBXA 3UP2A 4FZ6A 2XNPA 3H30A 5FEQA 3BE9A 3CGOA 3KXGA 3BI6A 5E8UA 5DR9A 4Z7HA 1JWHA 4IB3A 3F2AA 5DT4A 4RVLA 4BI1A 3DBDA 3LHJA 3QTQA 4EOLA 5T3QA 4FNWA 3UBDA 4CZTA 3KREA 2UUEA 4FTJA 3ZM9A 2JDSA 3TN8A 3HUBA 2BPMA 2WNTA 4NM5A 5J95A 3QA0A 5T68A 3E88A 3TKIA 1ZOHA 4GK3A 3LLAA 2F4JA 4HCVA 3CQWA 2ITQA 1JVPP 3MB7A 2OIBA 4J8MA 3ORZA 4TPTA 3KMWA 2ITVA 4FG8A 3QZGA 3PA3A 3O2MA 4PMTA 4FIEA 5HNBA 4BGQA 3EKKA 2UW0A 3OEZA 3V6RA 1ZMVA 4QQJA 2X4FA 2UZEA 4EK6A 2VTAA 2VWIA 2XK9A 3PVGA 4NT4A 4IC8A 4FIGA 3Q60A 3NEWA 2F2UA 2B7AA 1OMWA 1FMKA 3PFQA 1CTPE 4BI2A 3QU0A 4FSMA 2BTSA 5HHWA 4EYMA 5IQIA 1M52A 5HTBA 4O21A 3EQIA 5H8EA 3MVJA 5LVOA 2XUUA 4FV6A 1KOAA 3BYVA 3BBWA 2QONA 2JLDA 2WQEA 3O8PA 2C6EA 4ZY6A 5CEPA 4JAIA
chains in the Genus database with same CATH superfamily
3OTUA 4PP9A 3O96A 2UZBA 4MCVA 4U79A 4KIQA 3BV3A 1ZRZA 3RI1A 3LCSA 4R7IA 3ZMMA 2XNNA 3AMBA 1SNUA 1PMEA 2XIZA 5CSVA 5ANIA 3ORPA 5DRBA 4DT8A 3MDYA 3NX8A 4BDHA 4IVCA 2BAKA 4FL1A 3KA0A 2YM6A 5CF8A 4FKLA 1WBNA 3W18A 4DEEA 2QCSA 1J7IA 3NIEA 4LV8A 4BJJA 4KS8A 4U9AA 3N51A 1JSTA 5CYIA 3CPBA 2WD1A 3UVRA 3CBLA 4ZXTA 4EUUA 1Y57A 4W9WA 4HVHA 4PQNA 4B9DA 4DG0E 4QMMA 1A9UA 4K11A 4Y72A 2FSMX 4LMNA 3ZBFA 2VWWA 1X8BA 4QMLA 5AM6A 4MQ1A 4KKEA 2UZNA 5JFWA 1OIRA 4M69A 4U45A 4EHZA 4ASEA 4DHIB 2FSOX 3OWLA 2GNGA 4AFEA 1H27A 3MY0A 4AU8A 4RJ6A 1GZ8A 5FTGA 2H8HA 4NM7A 2VWYA 3DB8A 4FSZA 4CT2A 3ZFYA 3DAEA 5I3OA 2RG5A 3GU6A 3CD8A 2LGCA 3RPVA 4IZAA 4NM0A 3VQUA 2HZ0A 3UQFA 3DXNA 5L8JA 4FSYA 3HEGA 4I6FA 4EOIA 3DK7A 1UWJA 5HE0A 4YTCA 3L8SA 3UMWA 2IF8A 3F5PA 3KY2A 2OXYA 2OJ9A 5IA1A 3S1HA 4FKUA 4UMTA 2AYPA 5BVFA 4AZEA 4IB5A 4FA2A 3U8WA 4E4XA 4AAAA 3RBWA 2IVUA 5HVJA 3Q9XA 1YDTE 2VAGA 3RM7A 4O7WA 1E9HA 1UKHA 5CAPA 4DBNA 3G0EA 2C3JA 1HOWA 1WBTA 3REPA 3D15A 3GCSA 1T46A 3F3WA 2PMIA 4WG3A 5HG9A 4AFJA 4Q9ZA 3A61A 2Z7RA 2WQMA 3CJGA 4IVAA 4K1BA 4UN0C 4DEAA 2GHMA 4O0RA 5H8GA 3TJCA 3UQGA 4AX8A 1BYGA 5E8VA 3DV3A 1PXIA 3RNIA 4EBWA 2C0OA 1UNLA 2NP8A 3FQEA 2JD5A 3F6XA 3K2LA 2Q83A 2ONLC 1H0VA 2FVDA 3QLGA 3GOPA 5IQGA 2C4GA 4P90A 1U5QA 4ALWA 5E4HA 4CG9A 3TCPA 2C6TA 2V5QA 5GZ8A 4O81A 2X7FA 4AG8A 4YTFA 3ZDIA 3C4ZA 4FVPA 4M69B 3VUGA 1OUYA 4H39A 3QQFA 2XS0A 4DEIA 2QOIA 3Q32A 1QMZA 3CLYA 2IZUA 2Y0AA 4UMQA 5AP3A 4FV8A 3QTWA 4J71A 4LRJA 4QOXA 1XBBA 4HW7A 2JEDA 3DBFA 5HCZA 2J2IB 4MXAA 4NTSA 3FYKX 3SLSA 4BHNA 5FXRA 3PLSA 4AXAA 3GVUA 1IASA 1WZYA 2XKCA 3EL8A 1W2FA 3W0QA 5BV3A 2W1DA 2VO6A 5J8IA 3VS2A 4KSPA 4B4LA 3NPCA 4AW1A 5JH6A 5KKRB 1M7NA 1GZKA 5AUZA 2WQOA 3W0OA 2CNUA 1G8SA 2ITYA 4X2JA 5M51A 3TTJA 5M07A 2UZTA 2W1GA 1PYXA 2CN5A 3R9OA 3V8SA 1K3AA 4DCAA 2JGZA 2BFXA 2RL5A 5HG7A 2WMQA 2OJFE 4EH2A 4XG8A 3Q4CA 5M4CA 2O8YA 2VGPA 3L1SA 3L8PA 3KQ7A 1RW8A 3R7GA 3UOHA 3OFMA 1NA7A 5JQ8A 4WRSA 3PFYA 4WUAA 2C3KA 5H3QA 4D1ZA 4ZLOA 5A4EA 4TL0A 4F65A 3C0HA 4EONA 5HIEA 3UGCA 3DDPA 3BRBA 1PY5A 1ZY5A 1GNGA 4X6RA 1YOMA 3C1XA 3UNZA 4BWKA 5KUPA 4QEBA 4ZJJA 4DDIA 3W2SA 2E9VA 2ZMCA 4O0XA 4BCQA 3W2OA 4NL0A 3NMUF 4RJ8A 5F94A 2R7IA 5JK3A 5KBQA 4RQVA 4F78A 3O0GA 4LI5A 2J5FA 4BC6A 5I9VA 4CV9A 3TMOA 4O4CA 2R9SA 5IUHA 3LFAA 4DFNA 2DQ7X 4LRKA 4QYGA 5I3RA 5BVOA 4YJPA 2ITNA 3MY5A 4RJ7A 2JITA 4R6VA 5C01A 5HI2A 2QO2A 3PVBA 4E6QA 3EN4A 3PZEA 2XK8A 5ANKA 5AUXA 4JMQA 2WU6A 2VUWA 5DFPA 3ZEWA 2QVSE 1V0PA 3R00A 2QOBA 5C4LA 2XK4A 2HY0A 5KMIA 4IX3A 2J51A 3KXMA 1P14A 4O2ZA 1VR2A 1YXXA 4QP6A 4DEBA 4IVBA 4NEUA 2RFEA 3GU4A 3IKAA 4GU6A 5CAUA 5LMKA 4B8MA 1WAKA 3T3UA 3FUPA 4JRVA 2BZKB 1PKDA 3EL7A 1J1BA 3HRFA 4OTPA 2VU3A 2YJSA 3OY1A 4RGJA 5ANGA 2Y4IB 3H10A 4PNIA 5CU6A 2YWVA 1XBCA 1ZMUA 3LQ3A 3RPSA 3A62A 3NZ0A 2PUUA 4ZLZA 4EWHA 5K4JA 4WOVA 2PUPA 2EB3A 3L9MA 4YJQA 5FXQA 4WNKA 4FTIA 4GFOA 3U87A 3H3CA 4HPUE 1Y6AA 3CTQA 5JFXA 3PIXA 1PXJA 2Y8OA 3O51A 3HRCA 3PXZA 4U40A 4JG8A 3T3VA 3QQLA 4M0ZA 3VS6A 4B6LA 4X21A 4BTKA 3VIDA 4ORKA 4NJ3A 4AQCA 1F3MC 2PVLA 4ZJIA 5EW3A 3QC9A 1YDSE 3P4KA 1M14A 3DKOA 3R1SA 4U6RA 4DDGA 3SC1A 4AZWA 2X6EA 4F09A 2C30A 3Q9WA 1YKRA 4FC0A 4GH2A 1BLXA 3OG7A 3O8TA 3POZA 4JT3A 4MD7E 1NVQA 4NFNA 5B2MA 2XKFA 3U9CA 3UO6A 4C3PA 4X2FA 2Z7QA 2XM8A 2YDJA 1GIIA 4HGTA 3R71A 2IVSA 5BVEA 4AA4A 1GY3A 4MNFA 5DEYA 2QOLA 3LOKA 5L4QA 3K3JA 2XAMA 2BILB 5I9ZA 2XM9A 4FIJA 4YBKA 5LVLA 4EK8A 3QYWA 5IISA 1H1RA 4JIAA 2WTKC 4EHEA 3R8PA 4L45A 4XMOA 4C34A 4LGGA 3UPZA 4J98A 3RTPA 4CQGA 4F7NA 5ICPA 5AX9A 2XYNA 4NU1A 4EOSA 5CSPA 1KE9A 2XK6A 3ZSIA 4AA0A 1U46A 4AZVA 5C1QB 5JEBA 4PUZA 4C58A 3A2CA 3CKXA 5EW8A 5M55A 3ZUTA 3Q9ZA 4DN5A 3CS9A 2CSNA 2C1AA 2EB2A 3A99A 3I6WA 3W8LA 4O82A 5BYLA 3AGLA 5FD2A 4HVSA 5CENA 4PX6A 4Z55A 5A3XA 3DY7A 2XRUA 4RWJA 5D11A 3MVMA 3TZ8A 3UVQA 5KO1A 3CIKA 4XBUA 1OIUA 2VNWA 5JZJA 4TWPA 2XALA 3FZPA 3TNWA 4J53A 5CEKA 3I7BA 3I7CA 4DF3A 4ZSJA 2ITUA 3MPMA 4BWXA 3QX2A 4S33A 1KSWA 2J4ZA 4GIIA 2VV9A 5JGAA 5CS6A 3GP0A 2QKRA 4ANQA 5HGIA 4O1PA 4GUEA 3QCXA 1PF8A 2B0QA 4FZFB 3TI1A 3PXRA 3HP5A 4A06A 2GS6A 5KMMA 4YP8A 3AKLA 3O7LD 3BHHA 5A6OA 2HWPA 3DJ5A 4H3PA 4RA4A 4BN1A 4U3ZA 3BKBA 4BCGA 1SM2A 4OBOA 4MBIA 5I9UA 3HV5A 2YA9A 1OKVA 3KMMA 5A6NA 5I9XA 3DAKA 2HWOA 3BGQA 4QO9A 3UDSA 2JDVA 3B8QA 3FKOA 3CTHA 5AAFA 5HOAA 2YIWA 1XH7A 3EB0A 4ZTQA 4BBEA 3GENA 4BDCA 4L46A 2UW3A 3EQPA 3BWFA 3C9WA 3WZUA 3LFCA 5DT0A 5AFVA 1OPKA 4GFGA 4CYIA 1U59A 1UKIA 4S2ZA 2YIYA 2WQBA 3RINA 4TWNA 4D1XA 3HRBA 1BUHA 3EKNA 2OZAA 4IX4A 4HVDA 3F2NA 1A48A 2ESMA 1WVYA 4D2WA 5IEYA 2JDOA 4DGNA 4O83A 5M09A 3COIA 3FC2A 2BHEA 2R0UA 3BWJA 3I5NA 4FT9A 4JQ8A 2OIQA 2R3OA 2VTJA 4NK9A 3PJ1A 4YLKA 4WO5A 4O0UA 5HG8A 2HCKA 1AGWA 4EZ7A 3EQGA 2HELA 2X8DA 2BIYA 1OIYA 2YWPA 3G6GA 3UZTA 5HCYA 3IGOA 1WBSA 4IWOA 4MEDA 4KBAA 5ETIA 4FTMA 2VTRA 5CWZA 4O7TA 4QPMA 5E90A 4LV5A 2PL0A 3OWKA 5CALA 3EQFA 4X2KA 1ZYSA 4L43A 4AE9A 5IMXA 1R78A 2C5XA 4YZMA 3ATTA 3FI8A 4R1VA 3ZXTA 4DCEA 5KCVA 4HPTE 3GC8A 4UX9A 3UG2A 3HL7A 4YZ9A 4U0IA 4YNEA 5BVWA 4UMUA 4L8MA 5HU3A 4OT5A 3FXZA 2PYWA 1IEPA 2B9HA 2FYSA 4C7TA 4W4XA 5AADA 2GMXA 4AXCA 3RK9A 2VO7A 2P2IA 2P4IA 2WIPA 2Z7SA 3AT3A 5CY3A 2P55A 5FLFA 3PRFA 3ZZEA 1VZOA 2WKMA 1OL5A 5EOBA 2GHLA 2CNQA 4PL3A 3Q53A 3GGFA 3O71A 5M08A 3C50A 2JFLA 1JKKA 2KTYA 3BGPA 4NTTA 3I81A 1OL7A 4QP9A 3ENMA 4OUCA 4ZSLA 1ZYJA 3F3VA 2BAQA 4GYIA 3TV4A 1Y6BA 4GVJA 3R8VA 4ALVA 4D4RA 4F70A 3U55A 2BMCA 4LM5A 4GU9A 3ID6C 3FMHA 2NO3A 2Z8CA 2VN9A 4QP3A 3MFUA 2QOFA 4B8LA 1TFFA 4GW8A 2OZAB 4FOCA 2YM7A 2I6LA 1HCKA 3R9HA 3AC1A 5IA4A 3LXPA 4UMRA 3FHRA 4RX5A 4L7SA 3UDTA 3NYXA 4IM3A 4C4EA 4FKSA 4O0VA 3FI3A 2PULA 3AD4A 4R5SA 4NZWB 4E4LA 2GQGA 4QTBA 4JDJA 3FZSA 4V05A 4QMZA 1FGIA 4QQCA 2SRCA 1W82A 1QCFA 4IAYA 2XP2A 2R3MA 3FHIA 3ET7A 4OBPA 5J87A 3UG1A 3HGKA 2JFMA 4RG0A 4DGOA 2P33A 5C8KA 1J1CA 4XV2A 3GU8A 4Z7GA 1XH5A 4YLJA 5AMNA 4XHKB 4DHFA 4RBLA 3BE2A 3WZJA 3ZC6A 5EHLA 3KC3A 4BDKA 3A60A 4APCA 4CFUA 1IAHA 4JVGA 4C8BA 2R5TA 2EUFB 2HAKA 2BALA 2WMBA 3IPHA 1YI6A 4OTGA 3TWJA 3ZM4A 3MY1A 2QR7A 3FQHA 3MWUA 1PMUA 4PMSA 5HO6A 3E8EA 4D9UA 4BZDA 3C7QA 3KGAA 3LJ0A 5DG5A 2VZ6A 2X9FA 4PY1A 1IR3A 4MF0A 4R3RA 4U41A 4UWCA 5T6KA 4PP7A 4HVGA 4FKPA 5DYJA 2A1AB 1J3HA 5I9YA 2PMNX 3V8TA 3E63A 4G5PA 2H6DA 4OTHA 1Z9XA 2G2HA 2YAAA 4D0XA 1M7QA 5CNOA 4BKJA 2DS1A 3NRMA 4OTRA 4XYFA 3HMNA 3ZRKA 4O7YA 5IF1A 3LMIA 4HGEA 4O0TA 2GNIA 3UO4A 5CU2A 5FP5A 3ALOA 3D0EA 2PZRA 1H4LA 2C5OA 5KE0A 4CD0A 3BL7A 4ZMFA 5IQCA 3RWPA 4M0YA 3DTWA 1REJA 2HXQA 4C38A 1P4FA 3HLLA 4GRBA 4LQMA 2WMUA 4RJ4A 5C03A 2B52A 2W0JA 3FLWA 5M57A 4GUBA 5HTCA 4F0GA 4WNMA 2GFSA 1OVEA 3NAXA 3TZMA 3QD4A 3G9NA 4WBOA 1XH4A 2NPQA 2R4BA 3HECA 3P7AA 3NW6A 4AN9A 3FLNC 4ITIA 5FUTA 3GXLA 4EH6A 1YXVA 4J1RA 3PDTA 2BROA 3PG1A 3E3PA 4RFMA 1H1QA 5EDRA 2IVVA 4ZS0A 3R9RA 3BLRA 2X6DA 4ZSGA 5K0XA 1PXLA 5IG1A 4D4SA 4LG4A 2WTCA 4JBOA 2W1EA 2XZSA 2XMYA 3E3BX 3NUNA 5HVKA 3MVHA 3IW6A 5L6PA 3ACKA 4CFNA 5KMNA 5D7VA 2PK9A 4AF3A 3BQRA 4F0FA 3LAUA 2OLCA 3D5XA 2ITOA 3QLFA 2W1IA 4D5HA 3R7VA 3LXLA 4ERWA 1E1XA 2YACA 4A4OA 4BCOA 4CCBA 5D9HA 4BDFA 3A4OX 4O7NA 3MH2A 4QPSA 3OW4A 4F63A 4DEGA 3C4EA 4I4FA 3NUAA 1BKXA 5ETFA 2FUMA 4K77A 3QL8A 2GNLA 5AUUA 3QZIA 4M15A 2O63A 4HVIA 4KKGA 3BYMA 2C1BA 2NRUA 4KABA 4MWHA 2ZV7A 5JKGA 4UXQA 1MP8A 4E4MA 1JOWB 4I6BA 5AV1A 4FV7A 5JFSA 3FLZA 3NNXA 1ZXEA 2BUJA 4FV1A 2XCHA 4FYOA 4FZDB 2I0EA 4MXZA 4W9XA 3ULZA 3ZLXA 1J7LA 4X3FA 5IQFA 2EXCX 1NW1A 5K3YA 3RVGA 5FDPA 2OI4X 4O7RA 2VTQA 4L3PA 2OF2A 3KXNA 3ZEPA 5A9UA 1H28A 2C6OA 4O6EA 3KIOC 3PP0A 4CQEA 4DFBA 2J6MA 3PA4A 4FKTA 2V62A 2R3FA 2WMXA 3QZFA 3QTUA 4YLLA 5EK7A 1JLUE 5KZ0A 2W1CA 3E62A 4AP7A 3QALE 4MKCA 2WB8A 5HESA 4U44A 5L6OA 1MQBA 2HZIA 1FVRA 1YXSA 2QKWB 1IA8A 3MYGA 1KE6A 4KA3A 3F9NA 4QTDA 5J9YA 5M4UA 2IWIA 2RGPA 1U5RA 4D0WA 2BRHA 4ACDA 4RLKA 1FGKA 4FICA 3FC1X 3PG3A 4IWQA 3DFAA 3NCZA 3MW1A 3QKMA 3I60A 4YZBA 5E8SA 3SOAA 4E93A 2R3KA 3GCQA 2BDJA 2RFNA 5DI1A 5G1XA 4RRVA 4FTTA 3KXHA 2OG8A 2ERZE 3TUCA 2YM8A 2BVAA 3KKVA 3OMVA 4S31A 4XV9A 3PXKA 4JQ7A 4BCKA 4UMPA 1PRYA 2PE2A 2PVYA 4CCUA 4NW6A 5CEIA 1WBWA 4WIHA 3G51A 1NXKA 3VRYA 5E9EA 4L3LA 2G01A 3TL8A 3NYNA 2BCJA 3OXZA 3DKCA 3U4UA 1UU3A 4AACA 2UW5A 3VBWA 3WILA 4FT7A 3E87A 4UZHA 3NYOA 4C4IA 4EK3A 3NIZA 3R1NA 2PVFA 4F1OA 2W9ZB 4OTIA 2WMWA 2AC3A 4YHFA 5CEOA 2GS7A 5AR5A 4ASDA 4BCMA 4L01A 4CZYB 2HOGA 4GKIA 3WBLA 1CM8A 4K9YA 4QMXA 4X3FB 3CD3A 3PY3A 1LR4A 3IG7A 3MV5A 4DH7A 4RT7A 3FY2A 1ST0A 3BZ3A 4XRJA 2OK1A 3PPKA 4ASXA 2I1MA 4IX5A 2VRXA 4YJSA 1YVJA 2PTKA 2WAJA 5HO7A 1JSVA 3TZ9A 5GIPE 3R6XA 4H36A 5BUIA 4JDKA 2HYYA 1Z5MA 3EYGA 3ZRLA 4HGSA 4XRLA 4FE2A 4FZAB 1UVRA 3OCBA 3QD3A 5EDPA 3TEIA 2PWLA 2REIA 3D5WA 4BB4A 2FO0A 2VTTA 4CTBA 1Z57A 2XEYA 3KB7A 3FLSA 4AZSA 2RSVA 3GC7A 4A9SA 4RVMA 2X0OA 5IU2A 4CFMA 3GU5A 5AP2A 1PKGA 1SVHA 3M11A 5JN2A 4BY9E 3ZXZA 4WKQA 4QP7A 1JPAA 2QR8A 1IRKA 3P0MA 5CT7A 3NVKI 4XNEA 3FY0A 5HNGA 3PUPA 2WIHA 3A7HA 4I4EA 3I5ZA 4IM0A 4KIPA 5HVYA 2OJIA 2F7XE 5CQWA 5KMOA 1DI9A 4I0SA 4TWCA 2A19B 2UVYA 3EQRA 4U3YA 4YC8A 4X7QA 5H2UA 4I3ZA 4DC2A 4DE4A 4DAWA 3HA8A 1ZLTA 5L3AA 2C3LA 5D41A 3O8UA 3OXIA 5IUGA 4DTBA 4EHGA 3EZVA 4BCFA 5I5ZA 3BHTA 3PYYA 4O0WA 2R3IA 3CTJA 2WMAA 1UU8A 3QC4A 3ORLA 4K8AA 4UEUA 5FWKK 3FPQA 2X7GA 5LVNA 1P5EA 4O86A 1Q8UA 4ONAA 1URCA 2UZLA 5L8LA 3QD0A 5HZNA 4A9TA 4BDGA 5JRQA 4BCPA 2RFSA 4G2FA 4O4FA 2J0JA 3LCKA 4YHJA 4M7IA 3VJOA 1Q61A 2ZYBA 5AP6A 3V5TA 4GJ2A 4J7BA 2FH9A 2O2UA 2PHKA 2OJJA 1FINA 2P2HA 2QO7A 3KK9A 5C4KA 1U54A 2OBJA 2VD5A 2ONLA 4FTUA 4L42A 4IMYA 4O6LA 4RFYA 3N9XA 5KBRA 3MH1A 4I41A 3UO5A 4BZOA 2WMVA 3P79A 3R21A 4IBMA 2GHGA 5BPYA 5J7HA 2W4KA 5A14A 3MJ2A 5HBJA 3QKLA 5J9LA 2BKKA 2XIXA 2XNOA 3GCUA 4HNFA 4AOTA 3HDMA 4RC4A 5M06A 3VNTA 3VUTA 4MBLA 1PMNA 2UW6A 2ZB0A 3R0TA 3R7OA 4AWIA 4N57A 2P0CA 4TW9A 5TF9A 2X1NA 1OPJA 3ALNA 3LXKA 5J1WA 2CGXA 2G2IA 2JIIA 2V0DA 4FKGA 4DEHA 3EN7A 4WSQA 5EYMA 3ML1A 4IFCA 2GQSA 1OPLA 2CJMA 4GK2A 3ZC5A 2IPXA 4FSWA 2R7BA 5F1ZA 4D5KA 3ZDUA 4X3JA 3UQCA 4R5YA 3HV6A 3QWJA 3T9TA 4ZY4A 5AP5A 4H3BA 4TZRA 3KFAA 2WFYA 4JXFA 4FKIA 5HE2A 4G1WA 4IAKA 5DVRA 4F9WA 5AP0A 5EW9A 2WMTA 3VBVA 5LQFA 4H1JA 4CKRA 1YXTA 5IEVA 4KNBA 3TUDA 1FMOE 2XARA 1XR1A 4U8ZA 3IW4A 1R1WA 4BWPA 3R8LA 4DGGA 4DT9A 3Q04A 4EH4A 5TT7A 5KMJA 1Y91A 3VONA 4MXXA 2W5BA 4M97A 4FI1A 2Z02A 1U54B 1W83A 3R8UA 3UDZA 4H3QA 5AUTA 2JDTA 2OU7A 4IB0A 4LOOA 4ANNA 4ANLA 3EQCA 3ZUUA 3E93A 2X9EA 3O5AA 3TXOA 2C6DA 4W4YA 1W98A 5A54A 4O84A 3AC4A 4J8NA 3NW7A 3TM0A 4AAYA 3QTZA 5BX0A 3RPRA 4R7BA 5EOLA 2VTIA 4ZTRA 3W10A 4YBJA 3JPVA 5CU4A 3ZHPC 2GPHA 3DCVA 2RG6A 4ALUA 5CT0A 4BDAA 3MB6A 1WBVA 2YDIA 4G3FA 4PTEA 4C02A 3RHKA 4GT4A 1XWSA 3C5UA 4C4HA 2PZYA 5BUJA 4DA5A 5EYKA 5DE2A 4WD5A 3MPTA 2WOTA 4ACGA 4JS8A 3SHEA 4CT1A 2ACXA 3P9JA 5IDPA 3CGFA 2QG5A 5AAEA 5K5NA 5LMAA 4TYEA 4YHTA 2G1TA 3LVPA 3BEAA 1SMHA 3CE3A 4A4LA 4TY1A 1W84A 5CAQA 3TUBA 4L3JA 5C8MA 3VVHA 1G8AA 5CTPA 1Q41A 4BDDA 3EIDA 3OUNB 2XIYA 1CMKE 1JNKA 4QYYA 5GJDA 4ARKA 4XG2A 2J0LA 4FSTA 4G3EA 3RAHA 4OTFA 3GBZA 4ACHA 1FPUA 1VEBA 3PWDA 2YISA 4CFXA 4AXDA 4TT7A 3HV4A 1ATPE 4WA9A 1ZMWA 1OECA 5CSHA 4BIEA 5AAGA 5HLPA 3V5WA 1AD5A 5LOHA 5L2WA 4I94A 2W7XA 1STCE 4BYIA 4CFFA 4GEOA 3LM5A 4FSNA 3V5QA 3F88A 4NW5A 4XP3A 3ZH8A 3SG8A 3EFLA 3O50A 1LUFA 4E4NA 4EYJA 1YHWA 2PSQA 4LUDA 3QBNA 2W1FA 4L68A 4FUXA 5GHVA 2J0KA 3VC4A 3LFBA 1MQ4A 2CKEA 5DR2A 1PYEA 4CFWA 3NNWA 2FGIA 2C0TA 4O0YA 3DK3A 3FL5A 3TTIA 3UTOA 3NFFB 2CN8A 5HU9A 3LKMA 3AXWA 4LDTA 1TQPA 3RZBA 4MVFA 4F6WA 5JMSA 3TYKA 2YLEA 4XP2A 4YO6A 3VULA 2YFXA 3P08A 4D4VA 3DBQA 2ITZA 5AIRA 4L7FA 3FQSA 1JKTA 3FZRA 3W2QA 3Q96A 5ANJA 5BMMA 3MJ1A 3OP5A 5AUVA 3IW8A 1YOLA 2WXVA 3R9NA 4APPA 4XUFA 3FDNA 4BCJA 2HZ4A 4YO4A 4N6ZA 4BIBA 4K33A 2PVKA 2QURA 2WMRA 2XYUA 3DNEA 4FK6A 4IQ6A 4P5ZA 5ACKA 4D2TA 3PZHA 2X7OA 5KMLA 4HYSA 3HV7A 5IQDA 2BDWA 3PVUA 4NSTA 3S2PA 4EOKA 4U5JA 2R0IA 3AD6A 4FNXA 2PZIA 3BLHA 3PUFC 4HZRA 4QMUA 4AZTA 3TZ7A 3FEGA 3OOGA 4CFVA 2YIQA 3FMMA 2QNJA 5CASA 3SW7A 4JNWA 5KHWA 3PP1A 1Q24A 3QGYA 2ZFYA 3AKJA 3NW5A 2IW8A 3OBJA 3F2RA 3ZZWA 3F3UA 3N4TA 2ZDTA 3VW8A 4ZTLA 3UODA 3LMGA 3P5KA 4J52A 4FODA 4KWPA 4NWMA 4J97A 5E91A 3KRJA 4ZTNA 5EQEA 2ITWA 3AMYA 3RAWA 2OKRA 4KAOA 5A4TA 5J9ZA 3EN9A 4IIRA 3O7LB 4C4GA 4EQMA 3POOA 3F5GA 4TYIA 2WTIA 4K2RA 5AV4A 2JAMA 3WYXA 3DU8A 3LM0A 3WF7A 1MRYA 4RZWA 2JBOA 4RFZA 3TT0A 4DTAA 5HLWA 4I92A 4RX8A 1KE8A 3FMDA 2BR1A 4QT1A 2PE0A 3VO3A 5M56A 4RJ5A 4MX9A 3R1QA 4ASZA 3L9LA 4BBMA 1O6LA 3KRWA 3WZKA 4IAIA 2B9JA 3OUKA 2W1ZA 3KCKA 2Y4IC 3RM6A 5JQ5A 1YDRE 4QRCA 4YPDA 3COMA 4GG7A 2R3GA 3AC3A 3FAAA 2PUNA 1VYZA 2XNGA 3GT8A 3MTFA 2BRBA 3AT2A 3GCVA 5AUWA 1F0QA 2FB8A 4I20A 3W55A 3SW4A 4QMNA 2CKPA 2CGWA 1YXUA 3MGYA 4GCJA 4Y73A 4C61A 4CLJA 4J96A 4BZNA 5CF4A 2YZLA 5IQHA 3R30A 4QMQA 3CY3A 2NRYA 3A7IA 4FTLA 4ZTSA 3P7BA 3UOKA 4TYGA 4AOIA 4FGRA 5DWRA 3SKCA 5EM7A 2E9PA 4M3QA 4FKOA 4D2PA 2XNBA 2OW3A 1UNHA 3EQHA 3DAJA 4AT5A 3LFFA 3VN9A 4ZIMA 3SOCA 1H24A 4JIKA 4N70A 4FTOA 1UWHA 4ITJA 3R9DA 4II5A 3ATSA 4GT5A 4X2GA 3LMHA 4I22A 4BCIA 3JR1A 2W4OA 5CEQA 4OAVB 2X8IA 3BYUA 4QTEA 5A4QA 3R1YA 2OJGA 3QAME 3MSSA 5EDQA 3PSCA 4JR3A 1O6YA 5AR3A 5IUIA 5IH4A 4QP4A 1OZ1A 3JVSA 4FX3A 5IH6A 2NNWB 1R0PA 3LFSA 4JBVA 5E92A 2QOOA 4O27B 3WIGA 4FMQA 4F9AA 5CAOA 3JY0A 5CVGA 2BZHB 3DGKA 2PUIA 4F4PA 5TO8A 3PA5A 4FZ7A 1YI3A 4PRJA 3VUHA 2YLFA 2VWXA 5LVPA 2PY3A 2XRWA 2OIDA 5E8ZA 4RIOA 2RIOA 3BYOA 4RSSA 3R8MA 3LQ8A 1KV1A 2XJ2A 3AT4A 1Q8YA 2RFDA 4FG7A 4I5MA 4EK4A 5AR7A 2GQRA 4IDVA 4UBAA 1KOBA 3LFNA 4A9UA 3VS7A 3U9NA 1YRPA 4A9YA 4IZ7A 1QPEA 5AX3A 4Q2AA 3H9FA 3DQXA 3HZTA 4UY9A 2GNFA 2W06A 1CKIA 3DA6A 3E5AA 3FSFA 3QCYA 3QX4A 5CNNA 2OXXA 5EM8A 3U4WA 4EQCA 4EWQA 1YHSA 5J79A 5B2KA 4G3GA 3I79A 3FV8A 3GC0A 3QGWA 4RIXA 3RNYA 3TNIA 4C2VA 3LCOA 2YCSA 1V1KA 3WZEA 4OTQA 4C3RA 4FIIA