5ETAA

Structure of mapk14 with bound the kim domain of the toxoplasma protein gra24
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
351
structure length
336
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Subversion of MAP Kinase Signaling by an Intrinsically Disordered Parasite Secreted Agonist.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 89
structure length 336
sequence length 351
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etaA01
4IAAA 4GFMA 4RWLA 2W0JA 1FBNA 4FKJA 1KUTA 5ANIA 3WILA 3AMBA 2HOGA 4O0RA 4R3CA 1WBSA 5HE0A 4Y73A 3RK5A 3KXNA 3I7CA 4O86A 2V55A 4FKPA 1ZAOA 2HZNA 2EB3A 2UW7A 5AV4A 3R73A 2WOUA 3KCKA 5K4JA 4RFZA 3D15A 4FF8A 4L01A 4RIOA 4OAUC 3R9RA 5EW9A 4FG9A 4FZFB 4YO4A 2B53A 3ODYX 3CKXA 4IFCA 3NR9A 5EM8A 3QQHA 3ZZWA 5IU2A 2WMBA 5LMBA 3HP5A 2VWIA 2W05A 3GT8A 1F5QA 2VTNA 4XV2A 1LPUA 3CC6A 4DN5A 4UX9A 4JOAA 5EYMA 4OLIA 2EXCX 3G2FA 4GG5A 4MXZA 5GJFA 2B9HA 3NPCA 5BUIA 5M4UA 4RFMA 2E9OA 3C4XA 2O63A 3IKAA 4OUCA 4AG8A 4BCOA 5CSXA 4XJ0A 3CTJA 3U55A 3HAVA 4I6HA 5AV2A 4MXOA 2W1IA 3EN5A 2OW3A 1UNLA 4KIKB 1R0EA 2F49A 2H34A 2VV9A 4YPSA 4RWJA 4D4VA 3ZXZA 3V5JA 5KHXA 4C37A 3ORIA 3GEQA 4DH1A 4ZLOA 4CKJA 3SKCA 1GZNA 3LLTA 3RZBA 2PTKA 4CQGA 4YP8A 4X2JA 3UO4A 4OBPA 4CFVA 3R1YA 4XNEA 4PPAA 4USFA 3PA4A 5B7VA 5CEIA 4PRJA 3RPRA 5JGBA 5HNGA 4YJUA 3CR0A 2C5XA 4JQ7A 4AOJA 4DEBA 4KSPA 4ZEGA 4MH7A 4PL3A 2RFNA 1A06A 1FINA 4QMWA 2E2BA 4PDYA 1UWJA 3HGKA 5HBEA 4DH3A 3UZRA 4CFUA 4DCAA 3DQXA 3E8NA 1I44A 3PDTA 2BCJA 4II5A 4BGHA 2W1GA 5CASA 3N4TA 2X9FA 2XK7A 3UOHA 5HE3A 1VR2A 1GIIA 4IE9A 2HZIA 4IAKA 3N9XA 2ITVA 3D0EA 4MXYA 3NIEA 4ZS0A 3W2OA 1LEWA 2PPQA 4EC8A 1L8TA 1OKZA 3HRCA 2HWPA 2YDIA 3HDNA 3DTCA 3VS7A 5IA2A 4ZTQA 2OJIA 3BWFA 4IACA 5CEPA 3QTXA 2XBJA 1SYKA 2BDJA 2ZMDA 2GNJA 4BBEA 1XH9A 2R64A 2GS6A 2OICA 3OXZA 3TNIA 3F3VA 5AP7A 5C01A 4O7LA 3DT1A 5IQBA 2GQSA 4G9RA 5LVMA 3WZEA 4D58A 1M2RA 2A27A 3EJ1A 4FTNA 4N70A 2LGCA 4BGQA 1G8SA 2FSLX 4C8BA 4QMVA 2F9GA 5L2QA 4AGCA 3RMFA 3W2QA 4EOQA 4OTIA 4JQ8A 4X7QA 5TR6A 3ZFYA 5E91A 2G2IA 2UZVA 2IZSA 5IA5A 4NW5A 2WB8A 3BX5A 4EZ3A 2XNGA 2VO7A 1WBNA 4DFYA 2EWAA 4HGTA 3GUBA 4FIIA 5BVEA 3DNEA 5BVWA 2J0JA 1L3RE 1QL6A 2XNOA 1YDTE 3ULZA 3JY9A 4F7LA 3I81A 3F69A 2J5EA 2YLEA 4R3RA 2GS7A 4D9UA 1IG1A 4YMJA 1YQJA 3M11A 3BRBA 1YXVA 4ANQA 3QD3A 3VBYA 4E5WA 2OFVA 5EKOA 4DF3A 2XIRA 4RX9A 1UV5A 4MWHA 4XCUA 3LOKA 2AYPA 3FC1X 4FTOA 4RIYB 1PYXA 4QTCA 3VW6A 4AA5A 4QYHA 2W7XA 4D5KA 4FSYA 2ZM1A 4QP9A 1H07A 3ORNA 3LCSA 4TYGA 4FNWA 5H2UA 2PZRA 4WKQA 5BX0A 4GV1A 4O27B 4DG3E 5AADA 2VN9A 3ZFXA 2ZV9A 1KE9A 3FMLA 2Q83A 4WD5A 3AD5A 4FV3A 1OL2A 4QP1A 4MEDA 1Q62A 3ACJA 2GQGA 3F3ZA 4RFYA 4PNIA 4JDKA 2UV2A 4NSTA 2C5NA 3IQ7A 4WBBB 1YHSA 3MTLA 4GW8A 5T6KA 3V5PA 2JD5A 3JXWA 4U97A 4WHZA 3DDQA 5D9HA 3MH2A 3QAME 4L8MA 4IC7A 4AFEA 5L8KA 2QG7A 2CKOA 4G16A 2RSVA 4TYJA 5CSVA 2HW6A 1DAYA 4G3GA 4KWPA 4NM7A 4EOIA 2XCHA 4OTPA 3BPRA 2C0IA 2FSMX 3DPKA 5HI2A 2R3IA 4CFXA 2R0UA 3LMIA 3GOPA 3P7BA 4NTSA 4JNWA 3VHKA 2PMOX 4D2SA 4R7IA 3UZTA 5HU3A 3MY1A 4FYNA 4FEUA 4MD7E 3UJGA 5EH0A 2CHLA 4NK9A 1W8CA 3KK8A 4DE4A 2HZ4A 2R3RA 4NM0A 4RQVA 1U5RA 5CTPA 1OL1A 5D11A 3VJNA 3JVSA 4U0IA 2C3JA 3EQCA 3LE6A 3OP5A 4S2ZA 3POOA 3VF8A 3T9TA 3PJ8A 3MPAA 3PFQA 3V04A 1W0XC 2WGJA 4FT5A 3SHEA 4IZ7A 2P0CA 5A54A 4R3PA 3VUIA 4FGBA 3ZMMA 5CF4A 4S34A 4YGAA 4ZY4A 4BZNA 3CQUA 2X8IA 3UC3A 2JGZA 1YDRE 3QD0A 3PSCA 4JS8A 4FT0A 4F9BA 4FTTA 4JR7A 2XEZA 4U44A 4AOIA 1AQ1A 4FKRA 1FMOE 1Q8UA 1QPDA 3FXXA 1LP4A 3MFTA 4E4XA 3KXXA 2GNIA 5C8NA 3FV8A 4PP9A 4QMTA 4M84A 3U9CA 2XH5A 3ZLWA 4K9YA 1JKTA 1Z9XA 4RPVA 4BHZA 4AN9A 4HVHA 4UV0A 1Q8TA 3IO7A 2BVAA 3O7LB 4LUEA 2XK4A 3CEKA 5DLSA 4B8LA 1BI7A 2Z7RA 4XEYA 4CRSA 5IMXA 5LQFA 5CF5A 5CAOA 5IZFA 4KIKA 4PMSA 4LRJA 4ZSAA 1H26A 4MHAA 4O0SA 3SRVB 4CQEA 5HVKA 2F4JA 5M44A 5C27A 4MXAA 2GTMA 5ETFA 2IWIA 2VTRA 3NUXA 3PXKA 3SD0A 2A2AA 3FZPA 2XYNA 1M7NA 3ZLXA 5HO7A 3IOPA 4YBKA 1JKLA 3BIZA 1WMKA 3LFNA 2JBOA 2R3LA 4R5SA 4N4SA 3K3IA 2YCRA 4NTTA 3S2PA 4BDKA 3TUCA 4LMUA 2HXLA 3CD8A 4JQEA 5A4TA 2XKDA 2X7FA 2FSTX 4FKIA 2C5VA 3QTQA 3OC1A 4CG8A 3LQ3A 4UN0C 1ZLTA 2C3KA 4RVMA 4DH8A 2OJJA 3ZONA 5AUTA 3D2KA 1FGKA 4RZWA 4FV2A 2UVZA 2PSQA 2VNWA 5C4LA 3U54A 4XUFA 4HNFA 1SVGA 3BLQA 4Q2AA 1RJBA 3VBTA 3ZM9A 5AJQA 2ZDUA 4ZXTA 3LCTA 1YHWA 4KS7A 3WZUA 2WQEA 2XJ2A 3Q60A 2RG5A 4ZMFA 1F0QA 1PKGA 4C34A 5CEMA 3IOKA 3M42A 4C36A 5KKRC 3HKOA 3HMMA 4M0YA 1O9UA 2ZB0A 3PIZA 3P7AA 2UZTA 2YLFA 2EXMA 2BIKB 3QD4A 2VTSA 3QC9A 4PTCA 4KIQA 3AC5A 1CKPA 2B1PA 4IXPA 5DT4A 3P1AA 4HZRA 1ERKA 5DT0A 2CCIA 4YJRA 3TCPA 3VNTA 3C5IA 4DTBA 3KMMA 4NU1A 3SX9A 1NW1A 2JBPA 2ZDTA 4C4FA 2RGPA 4KBAA 3UIUA 2W5BA 3W33A 1U54A 5I9ZA 3COHA 3TDVA 3LAUA 3BHUA 2F2CB 2OJ9A 4PTEA 4U6RA 1MRUA 3GNIB 4Z9LA 1WVWA 1Q3WA 4IIRA 4JG7A 4D2VA 2PUPA 3CY2A 3EFLA 4NYEA 4HCTA 2UUEA 3OOGA 4QRCA 3ZBFA 2WD1A 3VUTA 4BDFA 1OI9A 2BALA 3PWYA 5JK3A 4AOTA 1JSVA 3QUDA 3KREA 1KOAA 4FI1A 3A8XA 1G8AA 3GFEA 3E8CA 3T3UA 3RCDA 3WIGA 5LXMA 4FSNA 3DBDA 3QQGA 2XP2A 4G3CA 5L2SA 5C8MA 3S4QA 1OVEA 4AE9A 4ACHA 5KZIA 5G1XA 4RSSA 4W4XA 4YJPA 5D41A 4KKHA 5I9YA 2OG8A 4C33A 4C4GA 3C13A 3FQSA 3I6WA 3H0ZA 2AUHA 5FBNC 4D4RA 4PMMA 4UZHA 3QZIA 4FTMA 4MNEB 4TKSA 1AGWA 2PVYA 3R83A 4NKAA 4FTQA 4ZSGA 3RAKA 4GFOA 4O0XA 3C50A 5HG8A 5AV1A 2CKPA 4Z3VA 3G0EA 3D2IA 3DGKA 4FKOA 4G34A 5F20A 5HG5A 5EW3A 1J91A 2WMUA 2V5QA 5C4KA 3BHYA 3ROYA 4PQNA 2OXYA 2Y7JA 3W10A 4CYJA 4RC3A 5I5ZA 2JIUA 3ZEPA 4F6SA 5AA8A 3TDWA 4QP2A 3BEAA 4USEA 1XH4A 3S1HA 1PXLA 3UVPA 4L3LA 5K5NA 5J9YA 4FODA 5D7VA 3W2CA 5JGDA 2CDZA 3M1SA 2QQ7A 4FT7A 2A0CX 2UW9A 3QX4A 4LQMA 4PPCA 4WSYA 4XH6A 4O83A 3SG9A 4YO6A 3QRJA 5IQIA 3MTFA 4FSUA 2BROA 1NT2A 3C4ZA 3QLGA 4XHKB 5FGKA 1M14A 3FSFA 1ZYDA 3PXFA 1PMVA 2YCSA 4LMNA 2IVTA 1Y6BA 3FKOA 4EZ5A 3AC3A 4F9WA 4WO5A 4F9YA 3KRLA 3SAYA 3MH1A 1WZYA 3UQGA 5F9EA 1V0OA 3E8DA 3P5KA 4JL9A 4BZOA 5BMMA 3FLSA 2WTVA 2CGUA 2LAVA 3ORPA 5F4NA 1OL7A 1OUYA 4IAZA 5J9LA 4ACDA 2WEVA 3Q6WA 4K6ZA 1J1CA 2QKRA 5HG7A 4FTKA 3ENHA 5IQCA 3OCTA 3VBVA 1UU8A 5HBJA 3VW8A 4BY9E 5IEXA 2X4ZA 5BMSA 1OITA 2WTKB 3GU6A 2GFSA 4ZJIA 2VO3A 3K5VA 3B8QA 1ZXEA 3EFJA 3QCSA 3KF4A 4EH4A 5HIEA 4IB3A 4LGGA 4FKWA 4BCFA 4FV7A 3D7TB 3ZRMA 4IHPA 2B52A 2QOOA 4CTCA 2V7AA 3SVVA 1H08A 4HZSA 1MRVA 2FSOX 4L52A 4BCPA 1UKHA 2B55A 4BRXA 3FSKA 4J95A 3ZFMA 4C38A 2C1AA 3UMWA 4LRMA 3RAWA 2R0IA 1G3NA 3DXQA 4FNYA 3HRBA 3Q52A 4M14A 5EI8A 5F94A 3CS9A 5AM6A 3F2RA 1MP8A 3ZLYA 4FKLA 3W2SA 4BDBA 2OJFE 4UY9A 4IMYA 3OT3A 3HX4A 3L1SA 5HEZA 2B7AA 3FLWA 4FOBA 3ULIA 1H00A 2YEXA 4CZUA 3CCNA 3QQUA 4X3JA 4BIBA 4AT4A 2J7TA 4F9AA 2OXXA 4OAVB 3ZUTA 3HV5A 4GVAA 5FDPA 5LARA 2J2IB 2OJGA 2PK9A 2GNGA 4M0ZA 3ZSGA 3SOAA 4I6QA 3TJCA 2YM8A 3NCZA 5KHWA 2XM9A 3E92A 3D5WA 3VIDA 3C9WA 4CMUA 2R3HA 3ZC6A 4NJDA 4XBUA 2VX1A 5DEWA 5TKDA 4M67A 4HGSA 3E88A 2W1ZA 4UMUA 3NNXA 1VYZA 4J7BA 2X8EA 3FXZA 1GJOA 4EHGA 3GENA 4O2ZA 4PTGA 4A07A 2GS2A 3PG3A 3NNWA 2UVYA 4BBFA 2XZSA 5CU3A 4BDDA 1A9UA 3PZHA 3BYUA 2GU8A 3A7IA 3H4JA 3R28A 4GMYA 4XG4A 4JJRA 3L8PA 5IQHA 1BMKA 4BDJA 3QRKA 4BVUA 2XJ1A 4O91A 3Q9XA 2F2UA 3R00A 4KS8A 4Y85A 4GU6A 2P4IA 1KV1A 3JY0A 4M68A 2CGVA 4BI2A 1H1QA 2VGOA 2VWZA 3A7HA 3BQCA 1YOJA 4XP2A 3TWJA 4F99A 4YR8A 3RJCA 1Q99A 3BKBA 2VGPA 3RM7A 3FLQA 3RBWA 4JT3A 3VQHA 2XBAA 2QOIA 4EOMA 5I0BA 2WQMA 3FZOA 3V3VA 4DEHA 2XEYA 3P9JA 4JX3A 3EWHA 1W7HA 4V0GB 2VWUA 4EOKA 1DI8A 2BPMA 3IW8A 4PMPA 4RBLA 3CGOA 3R6XA 4U3YA 5DGZA 4I1ZA 1X8BA 3PZEA 4GK4A 3SW7A 5AP1A 3IW6A 2ZOQA 1UU7A 4I22A 4ZTLA 3RP9A 2OLCA 5IQGA 2QI8A 4RLKA 1J7UA 2EVAA 4FIFA 2XK3A 3MB7A 4PX6A 4EYMA 3R1SA 1MRYA 3QLFA 4MVFA 4FV5A 4Q5HA 4WT6A 4BYIA 5AP2A 4TXCA 2WZJA 2P55A 3O7LD 2XCKA 3HV3A 4ZY6A 4D4YA 5KMMA 3VS3A 2C3LA 5FXRA 3R30A 5HO6A 4H1JA 3DDPA 4AA4A 3DXPA 4R7HA 1GZOA 4W9XA 4J96A 3W18A 3W32A 3HVCA 2YWVA 1ZMUA 4MQ2A 4PUZA 3IDPA 2PVRA 1E1VA 3EQBA 2BKKA 3R01A 3BZ3A 4L00A 3QA8A 4C4EA 5B0XA 4QTBA 2H96A 4C2VA 4FV6A 4DHFA 5IA4A 3GQLA 5JFWA 4O2PA 3UQCA 4W9WA 3NYOA 4YLLA 5EHYA 5A4QA 4ZS4A 5IUHA 2C6MA 2UZLA 2XNPA 5CWZA 5LWNA 4WRSA 2YZLA 4LOPA 4BHNA 1TQIA 1YRPA 2A1AB 3PVGA 3HRFA 3VUHA 4RIXB 3HUCA 4IAYA 4E26A 1VEBA 4FZ6A 3F61A 2YJRA 3V8WA 4ANBA 4P5ZA 4FSWA 4FIGA 4MK0A 3W55A 5CVGA 1OL6A 4OBQA 3BV3A 3FQHA 4ZY5A 3BU5A 4D2RA 3TZMA 5EK7A 3UOKA 3IDCA 4D5HA 3DU8A 5EHLA 3F88A 3DKOA 4U7ZA 4CEGA 3KXHA 4GU9A 4Y5HA 4RIWA 2BKZA 3B8RA 4RGJA 1JKKA 3VS2A 3NZ0A 4UMRA 1ZZLA 2QKWB 2UW4A 5BUJA 3TV6A 4YBJA 3FMJA 2YIQA 4E73A 1TQPA 2F7ZE 3GC7A 3MV5A 4M66A 4FVPA 4RX7A 2JDTA 3ODZX 4I6BA 4IC8A 5BVOA 4BB4A 3TUBA 1KE5A 3PXRA 3KL8A 5HCXA 3VBWA 5AX9A 4XLVA 3ACKA 3ZO3A 1SMHA 3H10A 3LXKA 4E4NA 5LOHA 5HHWA 4DGGA 1CMKE 3Q9WA 4XG9A 3UO6A 1G5SA 2ITUA 3WI6A 3LCDA 4FKVA 2VO0A 2ZM4A 2C30A 4LV8A 4E6CA 5JRQA 4DITA 2X2LA 2CLXA 4WG5A 4EQCA 3SV0A 4LL5A 5CI7A 4IX4A 3VUMA 4ERWA 3ZU7A 1PXKA 4C4HA 4BGGA 5B2MA 3ZH8A 1YXTA 1MQ4A 4C7TA 3FXWA 5J87A 4XV1A 3RNYA 4L67A 2X39A 1H1SA 1U59A 5HIBA 3UVRA 1IA8A 3EZRA 3MH0A 3L9NA 4IM2A 5GIOE 5DT3A 2R3GA 4ZTMA 4G2FA 4RX8A 3Q9ZA 5JN2A 5LVNA 3R9NA 3SDJA 3A4OX 4ZZMA 1QCFA 5CX9A 4AW5A 4U45A 4F65A 3MIYA 3FHRA 3E7OA 2JAVA 5GJGA 4PWNA 4F64A 2I0EA 4QYEA 1V1KA 3NX8A 1PJKA 4TWCA 3G9NA 1Q5KA 2QHMA 5EM6A 4OTRA 4M97A 5TO8A 4QMMA 1FMKA 2OXDA 2YM7A 4QMSA 4DH7A 2B54A 4JDIA 4RA4A 3VRZA 4PV0A 4CV8A 2VO6A 5GZ8A 5L2IA 4HYIA 4F7NA 3AC2A 3OBJA 2C47A 3UBDA 4DBNA 1OB3A 1M17A 1XO2B 1WVYA 3EN4A 3THBA 3I5NA 3QL8A 3QYWA 4OTHA 4MCVA 5GHVA 4YZ9A 3A8WA 3FL4A 1JSUA 4U5JA 5JRSA 4EKLA 2PU8A 3GOKA 4FEWA 3OXIA 4Q5EA 2OH0E 3HV6A 3OUKA 4YHJA 5DN3A 4AQCA 4D4SA 5M53A 4OTFA 3QTSA 2UZUE 4XX9A 5JMSA 5KMLA 5KZ0A 5IQDA 1APME 2I0VA 4XBRA 4BTJA 5DIAA 4Z16A 3R22A 3C4FA 3VRYA 1B6CB 3NUAA 3DNDA 1Y8GA 4UXQA 3DLSA 3ETAA 4U8ZA 3REPA 3UYTA 2G1TA 1ZY4A 4F0IA 1Q41A 3PXQA 2C6KA 1O6LA 2HAKA 4W4YA 2GNLA 2W9FB 5IH5A 3NS9A 5HVYA 4DFLA 4BZDA 4MQ1A 3Q32A 2YAAA 5GJDA 3KY2A 3H9RA 3HZTA 5D1JA 1UKIA 3D4QA 4I92A 4CMOA 4C2WA 2J0MB 3ORKA 2OFUA 2QONA 2ITTA 5IPJA 3HLLA 4UYAA 3KMUA 4ZIMA 3W2RA 4O0WA 4YJSA 1GIJA 2QOCA 1R78A 4KIPA 3VUKA 4YZNA 2CKQA 1YDSE 3BBTB 3CPBA 3FQEA 1OM1A 4IWOA 4AW2A 4F6WA 3C1XA 2BRGA 4HNIA 3ZOSA 3FJQE 4EH3A 2WNTA 3F3WA 5B2KA 4K1BA 1IR3A 4DTKA 2VTLA 3FDNA 5AP4A 4H3QA 5DEYA 3CJGA 5K5XA 4D1ZA 4O7RA 4MF0A 2WTJA 2HZ0A 3UP2A 3TUDA 4F4PA 4IADA 5KKRB 2Z02A 3NUSA 1J3HA 4DFNA 4V05A 1FQ1B 1RQQA 4UBAA 5HCYA 4Z55A 2VWVA 2JAMA 3R21A 2IVUA 3MVLA 3NW6A 4AS0A 1PXPA 2UW0A 5AR8A 4CT1A 3AXWA 4KIOA 4EWQA 4TWOA 3QGYA 5CAUA 4NJ3A 2A19B 2QLQA 2YCQA 4FYOA 4QMNA 4IJ9A 2W5HA 2FGIA 3HMIA 3VUDA 4B99A 2H6DA 5CU0A 2R7IA 4ZJJA 5DRDA 2W4KA 3R8MA 4QMQA 5BNJA 2G2FA 3SA0A 3LLAA 3GP0A 4AT5A 4OBOA 5HCZA 4IX3A 4CD0A 2XKFA 3SGCA 5HVJA 4J99A 1XBAA 4F09A 2ITZA 3IGOA 3DAKA 4L46A 2QD9A 4F7JA 2ONLC 3MW1A 4FT9A 3P86A 4FL2A 1KE8A 2Y6MA 3P08A 4GCJA 2OF4A 5CT0A 4RMZA 4AW0A 1OPJA 5AR5A 2ZV8A 2G15A 4B0GA 4UALA 4IEBA 4ID7A 4I24A 4H3BA 5HLPA 3LJ1A 4DFZE 4Y8DA 4O7WA 1ZMVA 1FVVA 4W4VA 4K77A 3F5PA 4EYJA 3AQVA 3OWJA 4EQUA 4LG4A 3NDMA 3K5UA 1XH8A 3ZO1A 4R5YA 3D5XA 3UG2A 3UGCA 3UYSA 5J95A 4BF2A 4KUJA 3U8WA 1PHKA 3OWKA 3SXRA 3A2CA 3ORXA 2CMWA 4U41A 4ORKA 4GT3A 3LM0A 4K2RA 5HTBA 2PHKA 2ZV2A 1URCA 2EB2A 1U4DA 4FUYA 3BQRA 3RAHA 3MBLA 2PZPA 3QHRA 4FVQA 5I9WA 4R1VA 3QA0A 3WYXA 2O0UA 4I6FA 3H3CA 3L8VA 4KRDA 5K3YA 4LOQA 2YISA 2WTIA 3SQQA 2PMNX 4TT7A 4DFUA 1Y6AA 4EWHA 4RIWB 3NYNA 4O7TA 3QRTA 3ZRLA 5HG9A 5D10A 2BAJA 3PY1A 4GK2A 3WZKA 3UO5A 3Q5ZA 4FV8A 4QMUA 5E7RA 2JEDA 3CGFA 2R3JA 1KE7A 5CANA 2Y4IB 3BYVA 1BL7A 3F7ZA 3AC1A 3O51A 3F3UA 1B38A 4PMTA 5CU2A 2BZJA 3DAJA 4RIXA 2WTDA 2XMYA 5I3RA 4LL0A 3COMA 2VTMA 4K8AA 4YTFA 4X3FB 4ERKA 4D1XA 2PUNA 3R9HA 2QR8A 3LFBA 3DZOA 2I1MA 4DYMA 4EH9A 5CI6A 4D0XA 4IB5A 3I0OA 5FTGA 4GL9A 2JKKA 4J52A 3CQEA 5E4HA 4JIAA 4L53A 2C4GA 3GU7A 5FP6A 3W2PA 1YXXA 4PNKA 4KBCA 1JSTA 3QZHA 4AGUA 3OCSA 3WE8A 5A9UA 4Y72A 3Q04A 4LGHA 4E1ZA 3EN6A 3PP0A 3U6IA 3NMUF 4I5MA 3PVBA 3QXOA 1WBWA 4XRJA 5ETIA 3FL5A 5AV0A 5H8GA 4APPA 4M69A 4EL9A 1WCCA 2OZAB 3VBXA 2CN8A 3NAYA 3TNWA 3PG1A 2BAQA 3NW7A 5CU4A 3V5LA 4CKRA 4O21A 3FY0A 3O50A 2NPQA 3AC4A 3NVKI 4G31A 3FI8A 2YFXA 5F1ZA 2PE2A 2SRCA 3QUPA 3ZZEA 4HVDA 1BI8A 4G3DA 4GRBA 3Q3BA 5HICA 3UPXA 4FL3A 3OCGA 2C68A 1R1WA 4GYGA 5IEYA 3RAIA 1W83A 3QQJA 4FSMA 3N51A 5I9UA 4BCNA 3KN5A 4FR4A 1REJA 3OY3A 3AT3A 4O84A 2QOKA 5DHJA 1XH6A 3D7ZA 2R9SA 4O7VA 3PPJA 4A4XA 2PZ5A 3FYJX 2WMTA 3V51A 5AR3A 5JQ8A 3MJ2A 3QWKA 4FEQA 4AGWA 3E87A 4H39A 5K9IA 1UWHA 4L3PA 3BEGA 4N57A 1M52A 4ZK5A 5L6OA 1JOWB 4U79A 4C61A 2VX0A 3AD4A 4CXAA 2NNWB 3OUNB 3VS5A 4IZAA 5A46A 5CF6A 3LCOA 5TOZA 4TNDA 1B39A 4QP3A 2UZEA 3OG7A 2VU3A 2QODA 3G5DA 3E5AA 4L7SA 4K11A 4CFWA 2HCKA 2QO7A 5GNKA 2DWBA 2GTNA 3F5XA 5HTCA 3IPHA 4FTUA 4IB1A 4BCKA 3EOCA 1I09A 2WIHA 2X6DA 4DEIA 4XLIA 3UNJA 3DJ7A 1TVOA 2VTPA 3LFDA 1EH4A 4QMZA 2VTIA 4IJPA 3TNPC 4BYJA 3FZ1A 4YURA 2E9PA 3S00A 3R0TA 2W4JA 3Q4ZA 4RZVA 5J1VA 4DFXE 2GCDA 1UVRA 4MYGA 4LUDA 3QXPA 4TN6A 3LM5A 2HYYA 4G5JA 4L42A 4NW6A 5DFPA 1GZKA 1YXSA 3TN8A 3VUGA 5E90A 1WFCA 2WO6A 3BHHA 5KE0A 4X0MA 3BU3A 3NUPA 4GKIA 1OGUA 1ATPE 2QCSA 4FOCA 4RJ4A 4CT2A 3HV7A 4QP7A 2PL0A 4EH8A 4YZMA 1J7LA 2FUMA 3D14A 3BV2A 4G9CA 4QMXA 3RHXA 5CVHA 3PE2A 1Y91A 1H28A 4KKEA 4QYYA 2NRUA 4G17A 4D55A 2GSFA 5GIPE 3FLZA 4JBOA 2OSCA 2W1CA 3N4VA 2WXVA 4NFNA 2QC6A 5AFVA 1XBBA 2PY3A 4IWPA 5H8BA 4IB0A 3ZO2A 4EK8A 4HPTE 2DUVA 3AG9A 3DLZA 4E3CA 2ITNA 2W1EA 5AP3A 4D28A 1W84A 4ONAA 1VZOA 2H8HA 4I5HA 4E8AA 5JFVA 3P79A 4QTAA 3O0GA 2YDJA 3PWDA 3R7UA 3UODA 4IANA 4XG8A 4RVKA 5JT2A 3ID6C 3EYGA 3TL8A 4KB8A 5LVPA 3RK7A 3HMPA 4FV0A 4I5CA 5CZIA 1NXKA 3DBEA 3KQ7A 5CF8A 1Q8WA 5C03A 4WUAA 1HCLA 4BR3A 3QTRA 1ZOEA 2DS1A 2X9EA 3KRJA 3UTOA 3G0FA 2YABA 5EQPA 4CGAA 2Q0NA 2G01A 2ITXA 2R3FA 4HOKA 3ATSA 3G15A 4DT9A 3MA3A 3RVGA 2EXEA 2V7OA 2WMSA 4EJ7A 5EG3A 3WIKA 2WHBA 4DEGA 4Y5QA 1FPUA 5E92A 5FWKK 4AW1A 5CEKA 4ALWA 2FA2A 3HMNA 4L6QA 1QPCA 3DK7A 5AA9A 4O0VA 3MI9A 5IG1A 2R7BA 3TIYA 4IM3A 5EM5A 2JKQA 4RVTA 3RALA 3E8EA 4FKUA 5E8XA 2XM8A 1UNHA 4EH2A 1ZWSA 3EHAA 5HO8A 3FMHA 3LZBA 5JH6A 2X0GA 4JRVA 1YOLA 2VTQA 3IECA 4ANNA 4R8QA 4F1TA 2X8DA 2O2UA 1XKKA 2ESMA 5L8LA 5ACKA 3PJ3A 2C6LA 1IA9A 4YTIA 5DR6A 2W99B 1LUFA 3I7BA 4FIJA 3FWQA 2VWYA 3Q4UA 2HY81 5M4IA 3BHVA 2CLQA 2QU5A 2WQNA 5FQDC 5BVFA 3GCSA 5EDRA 3LQ8A 5HD4A 4OTGA 3SG8A 1BL6A 3ROCA 3QUEA 4EK3A 4IZYA 2WMWA 4FTRA 4AN2A 5FTOA 1Q4LA 3PPKA 4OT6A 3F66A 4FNZA 4TWNA 3DBFA 2WQOA 4WSQA 5DPVA 2JDRA 2VAGA 4XOYA 4ANMA 4A4LA 4BI1A 4F08A 4B7TA 3ZBXA 5IMEA 3TV4A 2XUUA 4MNEA 1LEZA 3WZJA 1BKXA 3R9OA 4EJNA 1O6YA 4I0TA 4NM5A 5EM7A 1YVJA 5IF1A 2R3KA 4HJOA 2ETMA 4F7SA 4GT4A 3QQFA 4H58A 1CTPE 4I21A 4OW8A 5FD2A 5J9ZA 5L8JA 3A60A 4TTHB 1OIUA 3FMMA 4MNFA 1PMUA 3RWPA 4EOOA 2FH9A 5JKGA 2OI4X 2VWWA 4DTAA 2W17A 3PJ2A 4CCUA 4NUSA 1OKWA 4NH1A 3WF9A 4FKQA 5EQEA 3TTJA 4QP4A 4K0YA 3T8OA 4IWQA 4USDA 4S33A 5CYIA 4F63A 3KRXA 4F0GA 3VO3A 1JKSA 2YDKA 3E63A 4YU2A 3DS6A 2VWXA 5JFXA 1U54B 3FMNA 4L43A 3ZRKA 2OU7A 2YAKA 1HCKA 3QX2A 1OPLA 3VULA 4RJ8A 5FEDA 3PXYA 5AUVA 3TT0A 1JLUE 3OZ6A 3TTIA 4DGOA 1W82A 3QF9A 5DWRA 2EUFB 2P2IA 3RTPA 4D2TA 3LMHA 5HLWA 2XNBA 2B9JA 4GYIA 4PL4A 2PE1A 3UOLA 5BYLA 4E6QA 2YN8A 5CNOA 3C7QA 4YZDA 4WNOA 4LV5A 2ONLA 3TJDA 4A9SA 4ZJVA 1R39A 2WU7A 4TYEA 1YI4A 1BUHA 4IVDA 3W8LA 3JR1A 4LOOA 4RWIA 4O7YA 3E7VA 3QWJA 1UNGA 3AOXA 1VYWA 3P7CA 5IA1A 2GFCA 4BCJA 3FHIA 3II5A 3BYSA 4ALVA 2QHNA 4A9YA 4NCTA 3I4BA 3LKMA 4I4EA 4JVGA 4O7ZA 4MTAA 1P14A 3RINA 5HE2A 4U80A 3EZVA 3F9NA 1PXMA 4UWCA 5L2WA 5HBHA 4IM0A 3JUHA 3LFAA 1FOTA 3R7OA 2JDVA 2RG6A 1HOWA 1LR4A 2I7QA 4G5PA 4MXXA 2ZJWA 1DM2A 5M55A 3R7EA 2UZNA 1K2PA 5JQ5A 2CSNA 4EKKA 5DYJA 1GOLA 2J4ZA 3ALOA 3BU6A 3PE1A 3LXLA 1Z5MA 2IW6A 2ITOA 3WYYA 4TY1A 1OUKA 2RFDA 4BCMA 4JIKA 3RK9A 2HIWA 3A7FA 5FEQA 3VS0A 3QBNA 3SRVA 3AD6A 4YPDA 4MD8E 5C8KA 4FTLA 2YM3A 1ZZ2A 3M2WA 3KF7A 4IDTA 4ZSEA 5K0XA 2XRWA 4RIYA 4GKHA 4CLJA 3MYGA 4XP0A 4X2GA 4R77A 2H9VA 3KMWA 1PXNA 1XJDA 3VS6A 5J1WA 5G6VA 4ZSJA 4AZVA 2GHLA 3U9NA 2XNEA 3CLYA 2W9ZB 4BTFA 4EHVA 4EK6A 5AMNA 4XS2A 3TM0A 3KC3A 4BTMA 3RWQA 4D9TA 3EKNA 4CNHA 5JZJA 4X2FA 1GY3A 3EQRA 2UZDA 2JFMA 4NT4A 2X4FA 4UMTA 1RW8A 1ZYSA 4ASEA 5DA3A 2QOQA 5CXHA 2BR1A 1IAJA 1YWRA 3FMDA 3GXLA 5E8TA 4EBWA 5KMJA 2ZM3A 3QQLA 3JPVA 4O38A 3VQUA 3ZCLA 2O5KA 4EOPA 2PZYA 5KNJA 5LVOA 4LRKA 2Y0AA 3OY1A 5FXQA 4KABA 4WA9A 4G1WA 5EFQA 2JITA 3NCGA 4JG6A 4GUEA 2YM6A 4YZBA 4OGRA 1P4FA 4KA3A 4L68A 4MWIA 4C4JA 1W98A 2ZVAA 3FY2A 1U46A 3ORMA 3OTVA 5BQ0A 5CALA 2VTHA 4OTQA 2OF2A 3A99A 3JYAA 3PIYA 4GH2A 4EC9A 3EMGA 2AC5A 3P4KA 2O64A 2CNVA 2BRNA 5DG5A 3GGFA 3OTUA 1PRYA 5E8YA 2QOHA 4Z7GA 5HLNA 4IAFA 4J53A 1YI6A 4J8NA 1NVRA 3N4UA 2C0OA 1A48A 2YIXA 2WMXA 2UZBA 4B9DA 5FP5A 5AEPA 5DI1A 3DFAA 4L7FA 5IISA 4ZSLA 3F2NA 1FVRA 3WF5A 2HELA 3ZYAA 3R63A 4IVCA 3D9VA 5FRIA 2CJMA 3R02A 4A4OA 3CXWA 1OBDA 2Z7QA 4EHEA 3KRRA 4C02A 3U4UA 3BHTA 4BDIA 2IN6A 5M07A 4L44A 4EOJA 4AZTA 1ZOGA 3BI6A 4UZDA 2BAKA 1CKJA 3L9PA 4I4FA 4FICA 5BYYA 4PDOA 5FM2A 5KX8A 4I93A 2ETKA 2XYUA 3RKBA 4YSJA 4IAIA 3BGZA 3WARA 1OKYA 3I6UA 1F3MC 3UG1A 1P4OA 3CQWA 4O81A 5BUEA 4HYSA 1S9IA 3MVHA 4YC6A 4EORA 4IQ6A 1ND4A 3O8PA 3TZ8A 2QO2A 1AD5A 2UW3A 4JDHA 4JAIA 3PA3A 4U42A 4ZTNA 3RCJA 1OKVA 3R2BA 5IQEA 1V0PA 5DVRA 3CBLA 3T9IA 4ALUA 1P2AA 4BC6A 1ZMWA 2O65A 3ZDUA 3A61A 5FDXA 2OBJA 3O71A 4U3ZA 3W8QA 2X2KA 5E9EA 3T3VA 2BDWA 4YJQA 2PVHA 5FTQA 5HIDA 3S95A 5LMKA 3FE3A 3R1QA 4FKGA 3MSSA 5ANJA 5IEVA 2BZKB 4FUXA 4GT5A 3BE9A 4ACGA 4FT3A 4GEOA 3KN6A 4NWMA 4Q9SA 3HL7A 3SC1A 2QOBA 2C5OA 2IW8A 3EL7A 2ITYA 3DCVA 4QPMA 4AZSA 3D5UA 1PY5A 3UMXA 3W16A 4QP6A 4BIEA 2R3MA 2WEIA 2WMVA 4BCHA 1YWVA 2XVDA 3C0IA 4YJNA 5AUWA 5L6PA 4N6YA 4ANSA 2AC3A 3HNGA 1YXUA 3Q96A 3NWWA 4YLKA 5AWMA 4KBKA 4YTCA 3QCYA 3OWPA 3LQ5A 4KINA 4R6VA 4IH8A 2FYSA 3QYZA 4MAOA 5DRBA 3OEFX 4BWPA 4GFGA 5JFSA 2BTRA 4R78A 3ZTXA 4NIFB 4KD1A 2BRMA 4XP3A 3F2AA 2ZYBA 3C0GA 3PJ1A 3OCBA 4MKCA 4EUTA 4FE2A 2REIA 2UW5A 5EI2A 4O7NA 4IFGA 2WMRA 3R7GA 3TG1A 4QT1A 2I0HA 1URWA 2IVSA 4UMPA 5ICPA 3BYOA 2CGXA 2F7EE 3VS4A 4E93A 5AAGA 5AUZA 3WE4A 4FV1A 3C4EA 1CM8A 3RNIA 3WBLA 4AUAA 1T46A 3ZEWA 3ORLA 3BCEA 4ARKA 5C26A 4A9TA 1H25A 2XK9A 4WG4A 4W8EA 3F6XA 4PP7A 1UU9A 3W1FA 5LWMA 5CSWA 4FTCA 1M2PA 2WTCA 4S32A 1BYGA 4FTAA 4L45A 3IGGA 4M13A 4RT7A 3ELJA 3U6JA 4QNYA 2DQ7X 1OECA 3UPZA 2C5YA 5ANEA 4YC8A 5H9BA 1Y8YA 3R2YA 4WNKA 4OR5A 3HP2A 5CAPA 4C58A 2PVMA 1YKRA 4YJOA 3H0YA 4DEEA 4EOLA 2J51A 3EQHA 4QQ5A 4EZ7A 2Y6OA 5CAVA 3HECA 3ANRA 4ZLZA 4EH7A 2XIXA 3DV3A 3O96A 1Q8ZA 2E9NA 3DTWA 3NIZA 4HGEA 4ZTRA 4BDGA 4DINA 4FG8A 4EUUA 4BCIA 2BFXA 3KXMA 2WMAA 4YC3A 2UZOA 2JC6A 2CNUA 2E9VA 2R3PA 4RJ6A 4QYFA 4QYGA 1RDQE 4DH5A 3ZLSA 1BX6A 2PYWA 3FMKA 2XNMA 3R8ZA 2XKEA 5CT7A 3RGFA 2C6IA 4ACCA 3D94A 3DB8A 3PIXA 2J0LA 3G9LX 1OIQA 3O8UA 4BDEA 5CEOA 2OO8X 1XQZA 3OEZA 2GNFA 4YLJA 4XG3A 2W1HA 3SLSA 5IDPA 2F7XE 4RJ3A 3TEIA 4QTEA 5M57A 4YUQA 4HCUA 4YNOA 4RG0A 1DI9A 4B6LA 5L4QA 3DK3A 3LFQA 4LGDA 2QVSE 5HORA 3FI2A 3O17A 5DOSA 4D2WA 4RLLA 1TKIA 5IDNA 4YZCA 5I4NA 3PRFA 3ALNA 4W4WA 1WBPA 4CV9A 5CXZA 3MY5A 4O22A 1YI3A 5LMAA 5KMOA 3R7VA 3RHKA 2J5FA 5AR7A 2R2PA 4C62A 3P78A 3ZM4A 1H8FA 2CPKE 4RJ5A 4DG2E 2PVLA 3UIMA 5I9VA 2P2HA 2JLDA 4ASXA 3MFRA 4WBOA 1CKIA 4G6NA 3TKHA 4AACA 2BRHA 5JZNA 3VAPA 3MJ1A 4ZP5A 4I3ZA 5DNRA 4O0YA 3BBWA 2RFSA 3AT4A 2C6DA 2HY0A 2V22A 3ORZA 3G6GA 4S30A 3R8PA 3MPTA 4LFIA 3C4CA 4I0RA 3IONA 3ZUUA 4FK6A 4BL1A 1O6KA 5FEEA 4Y46A 2WELA 5HNIX 3VWAA 5CQUA 5C1QB 5AUUA 5EQYA 1PXIA 2R3QA 3FPMA 3BYMA 4DAWA 4EEVA 2OH4A 4IVBA 3DOGA 4DLIA 2VWBA 1PF8A 4TPTA 3EN9A 1IASA 2P3GX 3ORTA 2IZRA 4JXFA 2BHHA 4XG7A 5EDQA 5FUTA 2XIYA 4P5QA 4QMLA 4HW7A 2OZAA 3OW4A 1CDKA 2NRYA 3CTHA 3COIA 4JLCA 4QPSA 4QOXA 4WUNA 4M7IA 1ZRZA 5HE1A 3BGQA 2C0TA 2YWPA 3HEGA 4XG6A 2QR7A 5H8EA 5A3XA 3C5UA 4BFMA 4RX5A 5LMKC 3OF0A 4GIHA 3LPBA 2ITPA 3OWLA 3ZC5A 3QU0A 2IW9A 2VZ6A 4EH5A 5GZ9A 2W1FA 3CSVA 4X2NA 3UIBA 3FUPA 3PPZA 5IA3A 2BMCA 2W1DA 3GU8A 3QQKA 5E8WA 3NUUA 4EH6A 3TNQB 4FNXA 4C4IA 5TT7A 5J5SA 4TL0A 3GU5A 1R0PA 2RFEA 2HK5A 3QTUA 1H0WA 1STCE 1SZMA 1XH7A 3NSZA 4XMOA 4I23A 4YNEA 3G33A 2I40A 5CVFA 5HNBA 4Y83A 3A7GA 5J8IA 5J5TA 3CE3A 4IW0A 4WG3A 4G6OA 4CLIA 3CIKA 4CFFA 3PY3A 3WF6A 2OIBA 2BZHB 1FGIA 2NO3A 3PTGA 3ZSHA 5HZNA 4QTDA 3R8VA 3NYVA 4QQTA 3F5UA 3LVPA 4ENXA 1WBVA 3DQWA 2IVVA 4BIDA 3MIAA 5DR9A 3MESA 3MS9A 3RPSA 3UZPA 3QRUA 1T45A 1GZ8A 3ET7A 4BKYA 4RC2A 4YJTA 3O8TA 1J7IA 4TRLA 2J50A 4HVSA 3PSDA 5L3AA 4FZDB 5ETAA 4BKJA 4YJVA 1ZYLA 2ZV7A 5ANKA 3KB7A 4DC2A 2QG5A 3VJOA 2YACA 3ZDIA 2W4OA 3HDMA 2J90A 3GVUA 4IZ5A 4IX5A 5DR2A 1U5QA 2QNJA 1ZYJA 3OFMA 3H30A 3TXOA 4AZEA 3Q9YA 3PUPA 3DBQA 3FLYA 4O82A 2C69A 4CMTA 2GHGA 3K54A 2Y9QA 4NKSA 2J6MA 4K18A 5AP0A 5E1EA 4FK3A 5FBOA 4FTJA 2YJSA 3F7WA 5CU6A 1QPEA 4NCTC 3EFKA 4MBLA 3EB0A 3IS5A 1NVSA 3KVXA 3PRIA 5LVLA 3UC4A 3F5GA 3NEWA 3C0HA 3HV4A 3E3BX 3MVMA 4PL5A 5AP5A 4JX7A 5ACBC 4EK5A 4LI5A 4ITHA 2PVKA 4NEUA 5ITAA 2ZMCA 4YHTA 5HOAA 3I5ZA 5IH6A 4M69B 3IW5A 1JAMA 4AZFA 3ZUVA 3P0MA 4QQJA 1H24A 4BCGA 4PY1A 1NY3A 1R3CA 2KULA 5EYDA 1E9HA 3RZFA 4BDHA 3Q4TA 4DFBA 5CLPA 4W8DA 5A4EA 1WBOA 3KRWA 4RWKA 4IWDA 3DFCB 3OHTA 1SM2A 1IRKA 5EDPA 4RQKA 3MH3A 4KAOA 4UYNA 2Z7SA 4DG0E 4GSBA 3QD2B 4DT8A 4QMYA 3OROA 1XH5A 4M15A 5ANGA 3OD6X 4ZTSA 1PMEA 3FKNA 4UXLA 3GU4A 2BHEA 2RKUA 3GB2A 3KULB 4V04A 3OS3A 5F95A 3U4WA 3LIJA 4X3FA 1ZYCA 2YA9A 4RC4A 4BKZA 2R3NA 4Q9ZA 3B2WA 1YHVA 4AFJA 2X81A 4D0WA 2ACXA 4ZZNA 5AR4A 5E8VA 3LFCA 2WFYA 3MWUA 3KXZA 4YHFA 3GC9A 3F82A 5T3QA 5E1SA 3V01A 5DH3A 3NAXA 3V8TA 2WTKC 4MBIA 1XWSA 2FVDA 4FZAB 3OT8A 5IUIA 1PXOA 3LXNA 3BWJA 4TZRA 4G3EA 2CKEA 3PLSA 3COKA 3OMVA 3PJCA 3NVMB 4QNAA 1H0VA 2ERKA 2X7GA 4FMQA 4UMQA 4X2KA 4BBMA 4DCEA 5IH4A 2I6LA 3V5WA 3L8SA 4FX3A 3LJ0A 1WAKA 4FGRA 2X7OA 5CNNA 4O6LA 5A4CA 2RF9A 3FZTA 3VVHA 3TACA 4ASZA 4B8MA 3VF9A 5AUYA 4ZTHA 4E4MA 4F70A 3NRMA 2OIDA 4TYIA 4ANLA 1OIYA 4GS6A 4ASDA 1SNUA 3FI3A 3QZGA 4AA0A 5HX6A 4EOSA 5KBQA 4U40A 4GJ3A 3GI3A 4O6EA 1BLXA 3BELA 3FPQA 5EKNA 1XBCA 3DJ6A 4FC0A 5FG8A 4HVIA 3FBVA 5M08A 2E9UA 4GUBA 4V01A 3GCUA 5IA0A 3EL8A 3TZ9A 2J9MA 1DS5A 3UIXA 3HMOA 4ANOA 2RL5A 3CP9A 3I79A 2JIIA 2W06A 5AP6A 5KBRA 3FI4A 2BZIB 4TW9A 3LHJA 3PY0A 1KE6A 1REKA 3FZSA 3L9LA 5AIKA 3D5VA 2QOFA 1JPAA 2ZB1A 2B0QA 4R7BA 5A6OA 2BDFA 4E5AX 4H05A 1FVTA 3R8LA 3GBZA 4X3FC 4E6DA 5JEBA 1PMNA 4EK4A 4FL1A 5H3QA 3E93A 3KXGA 2A4LA 4BTKA 3EIDA 3Q2MA 4AWIA 2QO9A 4EHZA 1MQBA 3MDYA 4NM3A 2Q0BA 3UE4A 2R5TA 2O3PA 2BIYA 2WKMA 3PP1A 4MBJA 5HGIA 4GJ2A 4RRVA 4AZWA 4KRCA 1IEPA 2OZOA 2YERA 3NYXA 3NNUA 5BPYA 5EYKA 5M4CA 4JBQA 3EYHA 3Q5IA 2C6OA 3KA0A 3KKVA 3MFSA 3OBGA 3RPOA 2B9FA 3BLHA 3CTQA 5EOBA 5A14A 2Y8OA 3V8SA 1XHAA 3AGLA 2YM5A 3DK6A 3G51A 5EW8A 2B9IA 5A6NA 1Z57A 2OIQA 5BVDA 4BWXA 5IQFA 5LJJA 4F9CA 4CRLA 4TYHA 3GC0A 3LCKA 3PVWA 3KGAA 5ETCA 4APCA 4C3PA 3GQIA 4OT5A 1H1PA 4P7EA 2J0KA 3R1NA 2EU9A 5FLFA 2UW6A 4M12A 2JDOA 2QURA 3GC8A 5KMIA 5M51A 4H36A 4FSTA 4AX8A 4LM5A 1KV2A 4CYIA 3E3PA 4E6AA 1JWHA 4JBVA 4AGDA 3FEGA 4XYFA 5CY3A 3FAAA 3GCVA 4YTHA 3OW3A 4CFNA 2OWBA 2XJ0A 4L9IA 4K33A 1KSWA 3UNZA 3QFVA 2IZUA 1KOBA 2FO0A 5KUPA 3VBQA 1P5EA 5FXSA 2PUIA 3UNKA 4XV3A 4J71A 3KFAA 5HKMA 2RIOA 3E62A 5L2TA 5DBXA 3PLAE 5IQAA 2VX3A 3DKFA 1PYEA 3EFWA 4GG7A 3SW4A 4DEDA 3GCPA 3DKCA 3A7JA 3HYHA 3RPVA 4AT3A 5L6WL 1OZ1A 3R71A 4DGMA 2GNHA 4BI0A 5CENA 5DMZA 3FYKX 3MPMA 3QZFA 4RA5A 2HW7A 3PSBA 5IUGA 3QKMA 4WNMA 2XK8A 3ZHPC 4DBXA 2R4BA 2PWLA 4N0SA 4TYHB 2NP8A 4G6LA 3LXPA 4N6ZA 4PDPA 5I9XA 5EOLA 4XV9A 4C3FA 3S0OA 3R8UA 1H4LA 4X21A 2UW8A 4J98A 3NW5A 4FEVA 4I94A 4PF4A 4BN1A 3DJ5A 4EONA 1OIRA 3C51A 3EQIA 5C9CA 4C3RA 5HD7A 5D12A 3MY0A 3O2MA 3DAEA 5LCKA 1Q3DA 3KULA 2BFYA 3ZS5A 4JBPA 3DY7A 4CVAA 4FG7A 5HTIA 1OL5A 2YHVA 5EHOA 4O7SA 4HCVA 3BGPA 3ITZA 3Q2JA 3MB6A 5J7BA 3MVJA 2QLUA 3ZXTA 2DYLA 2X6EA 3BLRA 4GVJA 3TNHA 2OKRA 4AU8A 4UB7A 4FSZA 3CY3A 4I41A 1YOMA 3HUBA 3MA6A 3OVVA 2HENA 2YIYA 4U43A 5FM3A 1TQMA 1JVPP 5AR2A 5LCJA 2Y4PA 4AN3A 1OMWA 3PYYA 4B4LA 2IPXA 4NL0A 3DBCA 5IKWA 3ZO4A 4F1OA 3PVUA 2ZAZA 1V0BA 5GZAA 2XKCA 4LYNA 3AC8A 4FEXA 4R1YA 5AV3A 5EI6A 4FKTA 4IBMA 2YZAA 2XA4A 1QMZA 2PUUA 4EQMA 2CN5A 2Z7LA 3DXNA 3QKLA 2GDOA 4EI4A 2PVFA 3AMYA 3TI1A 3PA5A 1ZARA 2WPAA 4EBVA 5M56A 3UVQA 5AAEA 3HA8A 4P2KA 1GNGA 5HESA 1Q24A 3MGYA 5AX3A 4BDCA 3EQGA 1Q97A 5D7AA 4MX9A 3CJFA 2WU6A 4DA5A 4QPAA 3G6HA 4O96A 3Q53A 4TNBA 4C35A 4QMOA 3UP7A 4D2PA 4HPUE 3K3JA 4NFMA 5AM7A 3JVRA 1NA7A 4I0SA 3FC2A 4CTBA 3AT2A 2J0IA 2QOLA 3UQFA 3QC4A 1E1XA 4FV4A 3FKLA 3MN3A 3Q6UA 3U6HA 4AAAA 4QO9A 5BVKA 3TKUA 4A06A 4ZAUA 3IG7A 4JI9A 3I60A 4XRLA 4A7CA 3I0QA 5CEQA 4ENYA 2B4SB 4E5BA 2W5AA 5TF9A 4KSQA 4RJ7A 3AMAA 2VD5A 4ITIA 4E4LA 1Q61A 4DGLC 4HVGA 3QTIA 5CAQA 1YWNA 1Q8YA 3NLBA 2QU6A 4J8MA 3NUYA 2V62A 5KO1A 4CG9A 3A62A 1SNXA 3F3TA 3FZRA 4FTIA 2XIKA 5CSHA 2WQBA 3U51A 3L8XA 2IJMA 5E8SA 3RM6A 4PDSA 4E20A 1H27A 3IDBA 1ZOHA 3A4PA 3H9OA 1JQHA 2R3OA 4QQCA 4IX6A 4X6QC 4F0FA 3P23A 5AAFA 1UA2A 2YCFA 4A9RA 4HGLA 2XK6A 4MXCA 2X1NA 4ZLYA 3D83A 2BRBA 4BICA 2ITWA 5K0KA 2O8YA 3LFFA 4JG8A 1NVQA 4KKGA 4C0TA 4ITJA 1SVEA 3C4WA 3V5TA 3QTZA 3V6SA 4E7WA 3SOCA 3DKGA 4WOVA 3RI1A 1OBGA 4WIHA 2Z2WA 4XG2A 3IW7A 4BDAA 4DEAA 4DLJA 5M09A 2HWOA 1J1BA 5HQ0A 3SXSA 5DE2A 5J79A 4QP8A 5AUXA 2VRXA 3KEXA 4I20A 5I3OA 4BCQA 2PE0A 2JKOA 3FLNC 3GCQA 2OGVA 4H3PA 2VTOA 4ZZOA 4ZOGA 3TV7A 2VNYA 5ANOA 2YIRA 4UEUA 4O0TA 2YITA 3TIZA 4ACMA 4Z7HA 1PXJA 3NNVA 5CQWA 2FB8A 4AF3A 2ETRA 2C6TA 3ANQA 2BTSA 2W96B 3IW4A 3PXZA 4M3QA 3R7YA 4BWKA 1SVHA 4CCBA 1UU3A 4FZ7A 5EYCA 4IVAA 2F57A 3UDBA 2CNQA 3QGWA 3DB6A 2BUJA 2G2HA 4FVRA 2Y4IC 2VTJA 4V0GA 5TE0A 4QD6A 4TWPA 3V5QA 3DA6A 3VHEA 2JFLA 1Y57A 3EQPA 3LFSA 3LFEA 4JDJA 4X6RA 4L3JA 4DGNA 1YW2A 3L9MA 4A9UA 3NGAA 4Y95A 4NZWB 4CZTA 4H1MA 3QKKA 5M06A 2PULA 5ANDA 3WF7A 2C1BA 3VC4A 4F1MA 4FSQA 4FKSA 3NUNA 1H01A 4MD9E 4P4CA 4O1PA 2VTAA 4AP7A 2XIZA 1K3AA 2I0YA 1ZY5A 3LMGA 5E8ZA 2XS0A 3OOMA 4CZYB 4FIEA 5A4LA 3CD3A 2Z60A 4CKIA 4GK3A 2C3IB 1MUOA 4WRGA 4QMPA 3EN7A 1PW2A 3KCFA 4HYUA 3JS2A 3QTWA 1S9JA 1DAWA 5HU9A 3EKKA 2WMQA 2IO6A 3G90X 2JIVA 3H9FA 2V0DA 3B2TA 3VS1A 1IAHA 5KMKA 4U9AA 2BILB 2C6EA 2IZTA 2OK1A 2GQRA 3ATTA 3Q4CA 5HX8A 3O23A 4YSMA 4C59A 4J1RA 3OXTA 3QHWA 4XOZA 3CPCA 3KK9A 4I5PA 3HA6A 3EQFA 1M7QA 5B2LA 4S31A 4PPBA 5M4FA 2PMIA 3R7IA 1M2QA 4JR3A 5E8UA 3GFWA 3RPYA 3K2LA 4FSRA 2XNNA 4FV9A 3WZDA 2CCHA 2P33A 2UVXA 3EH9A 5T68A 3TKIA 3ZSIA 2GMXA 2VUWA 4AE6A 5GINE 2GPHA 1RE8A 1WBTA 4P90A 3QCQA 3U87A 2WIPA 2YIWA 3LJ2A 5J7HA 5CSPA 3WF8A 2UZWE 1H1WA 4FBXA 5BVNA 5KCVA 5JGAA 3DZQA 4UWYA 2WAJA 2KTYA 4HYHA 3KVWA 5BYZA 2PMLX 3VN9A 4GIIA 4O0UA 1VJYA 1CSNA 2PZIA 3UOJA 3QRIA 4ZMEA 3WOWA 4MF1A 4WNPA 4J97A 1JNKA 3D7TA 3ERKA 4IDVA 2JKMA 4U81A 4D1SA 4FA2A 2G9XA 3KU2A 5JSMA 3HAMA 2Z8CA 4JRNA 4FIHA 3QCXA 3S3IA 2IG7A 4OTDA 1KWPA 1JBPE 2VTTA 1H1RA 5AIRA 2XRUA 2YM4A 1GIHA 2ERZE 2ITQA 2WOTA 3QALE 2HXQA 3MFUA 3AGMA 2PVJA 1QPJA 4AXAA 2GHMA 4F6UA 2JDSA 4C57A 3TZ7A 2WTWA 2PVNA 2XF0A 4KNBA 5KMNA 4O1OA 3CKWA 4G3FA 4CSVA 1K9AA 3E64A 2CGWA 4RVLA 3SXFA 1GAGA 3FMEA 3BE2A 4OTWA 3R04A 3EQDA 2X2MA 3IK3A 1XR1A 3POZA 4M8TA 3ENMA 4JAJA 4UWBA 1WVXA 2XB7A 5CS6A 3V6RA 1PKDA 5CZHA 4CFMA 1OPKA 3I1AA 3R9DA 3LW0A 4NIFA 5K4IA
chains in the Genus database with same CATH superfamily
4IAAA 4GFMA 4RWLA 2W0JA 1FBNA 4FKJA 1KUTA 5ANIA 3WILA 3AMBA 2HOGA 4O0RA 4R3CA 1WBSA 5HE0A 4Y73A 3RK5A 3KXNA 3I7CA 4O86A 2V55A 4FKPA 1ZAOA 2HZNA 2EB3A 2UW7A 5AV4A 3R73A 2WOUA 3KCKA 5K4JA 4RFZA 3D15A 4FF8A 4L01A 4RIOA 4OAUC 3R9RA 5EW9A 4FG9A 4FZFB 4YO4A 2B53A 3ODYX 3CKXA 4IFCA 3NR9A 5EM8A 3QQHA 3ZZWA 5IU2A 2WMBA 5LMBA 3HP5A 2VWIA 2W05A 3GT8A 1F5QA 2VTNA 4XV2A 1LPUA 3CC6A 4DN5A 4UX9A 4JOAA 5EYMA 4OLIA 2EXCX 3G2FA 4GG5A 4MXZA 5GJFA 2B9HA 3NPCA 5BUIA 5M4UA 4RFMA 2E9OA 3C4XA 2O63A 3IKAA 4OUCA 4AG8A 4BCOA 5CSXA 4XJ0A 3CTJA 3U55A 3HAVA 4I6HA 5AV2A 4MXOA 2W1IA 3EN5A 2OW3A 1UNLA 4KIKB 1R0EA 2F49A 2H34A 2VV9A 4YPSA 4RWJA 4D4VA 3ZXZA 3V5JA 5KHXA 4C37A 3ORIA 3GEQA 4DH1A 4ZLOA 4CKJA 3SKCA 1GZNA 3LLTA 3RZBA 2PTKA 4CQGA 4YP8A 4X2JA 3UO4A 4OBPA 4CFVA 3R1YA 4XNEA 4PPAA 4USFA 3PA4A 5B7VA 5CEIA 3W0MA 4PRJA 3RPRA 5JGBA 5HNGA 4YJUA 3CR0A 2C5XA 4JQ7A 4AOJA 4DEBA 4KSPA 4ZEGA 4MH7A 4PL3A 2RFNA 1A06A 1FINA 4QMWA 2E2BA 4PDYA 1UWJA 3HGKA 5HBEA 4DH3A 3UZRA 4CFUA 4DCAA 3DQXA 3E8NA 1I44A 3PDTA 2BCJA 4II5A 4BGHA 2W1GA 5CASA 3N4TA 2X9FA 2XK7A 3UOHA 5HE3A 4AQKA 1VR2A 1GIIA 4IE9A 2HZIA 4IAKA 3N9XA 2ITVA 3D0EA 4MXYA 3NIEA 4ZS0A 3W2OA 1LEWA 2PPQA 4EC8A 1L8TA 1OKZA 3HRCA 2HWPA 2YDIA 3HDNA 3DTCA 3VS7A 5IA2A 4ZTQA 2OJIA 3BWFA 4IACA 5CEPA 3QTXA 2XBJA 1SYKA 2BDJA 2ZMDA 2GNJA 4BBEA 1XH9A 2R64A 2GS6A 2OICA 3OXZA 3TNIA 3F3VA 5AP7A 5C01A 4O7LA 3DT1A 5IQBA 2GQSA 4G9RA 5LVMA 3WZEA 4D58A 1M2RA 2A27A 3EJ1A 4FTNA 4N70A 2LGCA 4BGQA 1G8SA 2FSLX 3BL7A 4C8BA 4QMVA 2F9GA 5L2QA 4AGCA 3RMFA 3W2QA 4EOQA 4OTIA 4JQ8A 4X7QA 5TR6A 3ZFYA 5E91A 2G2IA 2UZVA 2IZSA 5IA5A 4NW5A 2WB8A 3BX5A 4EZ3A 2XNGA 2VO7A 1WBNA 4DFYA 2EWAA 4HGTA 3GUBA 4FIIA 5BVEA 3DNEA 5BVWA 2J0JA 1L3RE 1QL6A 2XNOA 1YDTE 3ULZA 3JY9A 4F7LA 3I81A 2J5EA 2YLEA 3F69A 4R3RA 2GS7A 4D9UA 1IG1A 4YMJA 1YQJA 3M11A 3BRBA 1YXVA 4ANQA 3QD3A 3VBYA 4E5WA 2OFVA 5EKOA 4DF3A 2XIRA 4RX9A 1UV5A 4MWHA 4XCUA 3LOKA 2AYPA 3FC1X 4FTOA 4RIYB 1PYXA 4QTCA 3VW6A 4AA5A 4QYHA 2W7XA 4D5KA 4FSYA 2ZM1A 4QP9A 1H07A 3ORNA 3LCSA 4TYGA 4FNWA 5H2UA 2PZRA 4WKQA 5BX0A 4GV1A 4O27B 4DG3E 5AADA 2VN9A 3ZFXA 2ZV9A 1KE9A 3FMLA 2Q83A 4WD5A 3AD5A 3UDTA 4FV3A 1OL2A 4QP1A 4MEDA 1Q62A 3ACJA 2GQGA 3F3ZA 4RFYA 4PNIA 4JDKA 2UV2A 4NSTA 2C5NA 3IQ7A 4WBBB 1YHSA 3MTLA 4GW8A 5T6KA 3V5PA 2JD5A 3JXWA 4U97A 4WHZA 3DDQA 5D9HA 3MH2A 3QAME 4L8MA 4IC7A 4AFEA 5L8KA 2QG7A 2CKOA 4G16A 2RSVA 4TYJA 5CSVA 2HW6A 1DAYA 4G3GA 4KWPA 4NM7A 4EOIA 2XCHA 4OTPA 3BPRA 2C0IA 2FSMX 3DPKA 5HI2A 2R3IA 4CFXA 2R0UA 3LMIA 3GOPA 3P7BA 4NTSA 4JNWA 3VHKA 2PMOX 4D2SA 4R7IA 3UZTA 5HU3A 3MY1A 4FYNA 2XAMA 4FEUA 4MD7E 3UJGA 5EH0A 2CHLA 4NK9A 3W0OA 1W8CA 3KK8A 4DE4A 2HZ4A 2R3RA 4NM0A 4RQVA 1U5RA 5CTPA 1OL1A 5D11A 3VJNA 3JVSA 4U0IA 2C3JA 3EQCA 3LE6A 3OP5A 4S2ZA 3POOA 2X0PA 3VF8A 3T9TA 3PJ8A 4FJVA 3MPAA 3PFQA 3V04A 1W0XC 2WGJA 4FT5A 3SHEA 4IZ7A 2P0CA 5A54A 4R3PA 3VUIA 4FGBA 3ZMMA 5CF4A 4S34A 4YGAA 4ZY4A 4BZNA 3CQUA 2X8IA 3UC3A 2JGZA 1YDRE 3QD0A 3PSCA 4JS8A 4FT0A 4F9BA 4FTTA 4JR7A 2XEZA 4U44A 4AOIA 1AQ1A 4FKRA 1FMOE 1Q8UA 1QPDA 3FXXA 1LP4A 3MFTA 4E4XA 3KXXA 2AQXA 2GNIA 5C8NA 3FV8A 4PP9A 4QMTA 4M84A 3U9CA 2XH5A 3ZLWA 4K9YA 1JKTA 1Z9XA 4RPVA 4BHZA 4AN9A 4HVHA 4UV0A 1Q8TA 3IO7A 2BVAA 3O7LB 4LUEA 2XK4A 3CEKA 5DLSA 4B8LA 1BI7A 2Z7RA 4XEYA 4CRSA 5IMXA 5LQFA 5CF5A 5CAOA 5IZFA 4KIKA 4PMSA 4LRJA 4ZSAA 1H26A 4MHAA 4O0SA 3SRVB 4CQEA 5HVKA 2F4JA 5M44A 5C27A 3O5AA 4MXAA 2GTMA 5ETFA 2IWIA 2VTRA 3NUXA 3PXKA 3SD0A 2A2AA 3FZPA 2XYNA 1M7NA 3ZLXA 5HO7A 3IOPA 4YBKA 3UDSA 1JKLA 3BIZA 1WMKA 3LFNA 2JBOA 2R3LA 4R5SA 4N4SA 3K3IA 2YCRA 4NTTA 3S2PA 4BDKA 3TUCA 4LMUA 2HXLA 3CD8A 4JQEA 5A4TA 2XKDA 2X7FA 2FSTX 4FKIA 2C5VA 3QTQA 3OC1A 4CG8A 3LQ3A 3TMOA 4UN0C 1ZLTA 2C3KA 4RVMA 4DH8A 2OJJA 3ZONA 5AUTA 3D2KA 1FGKA 4RZWA 4FV2A 2UVZA 2PSQA 2VNWA 5C4LA 3U54A 4XUFA 4HNFA 1SVGA 3BLQA 4Q2AA 1RJBA 3VBTA 3ZM9A 5AJQA 2ZDUA 4ZXTA 3LCTA 1YHWA 4KS7A 3WZUA 2WQEA 2XJ2A 3Q60A 2RG5A 4ZMFA 1F0QA 1PKGA 4C34A 5CEMA 3IOKA 3M42A 4C36A 5KKRC 3HKOA 3HMMA 4M0YA 1O9UA 2ZB0A 3PIZA 3P7AA 2UZTA 1ST0A 2YLFA 2EXMA 2BIKB 3QD4A 2VTSA 3QC9A 4PTCA 4KIQA 3AC5A 1CKPA 2B1PA 4IXPA 5DT4A 3P1AA 4HZRA 1ERKA 5DT0A 2CCIA 4YJRA 3TCPA 3VNTA 3C5IA 4DTBA 3KMMA 4NU1A 3SX9A 1NW1A 2JBPA 2ZDTA 4C4FA 2RGPA 4KBAA 3UIUA 2W5BA 3W33A 1U54A 5I9ZA 3COHA 3TDVA 3LAUA 3BHUA 2F2CB 2OJ9A 4PTEA 4U6RA 1MRUA 3GNIB 4Z9LA 1WVWA 1Q3WA 4IIRA 4JG7A 4D2VA 2PUPA 3CY2A 3EFLA 4NYEA 4HCTA 2UUEA 3OOGA 4QRCA 3ZBFA 2WD1A 3VUTA 4BDFA 1OI9A 2BALA 3PWYA 5JK3A 4AOTA 1JSVA 3QUDA 3KREA 1KOAA 4FI1A 3A8XA 1G8AA 3GFEA 3E8CA 3T3UA 3RCDA 3WIGA 5LXMA 4FSNA 3DBDA 3QQGA 2XP2A 4G3CA 5L2SA 5C8MA 3S4QA 1OVEA 4AE9A 4ACHA 5KZIA 5G1XA 4RSSA 4W4XA 4YJPA 5D41A 4KKHA 5I9YA 2OG8A 4C33A 4C4GA 3C13A 3FQSA 3I6WA 3H0ZA 2AUHA 5FBNC 4D4RA 4PMMA 4UZHA 3QZIA 4FTMA 4MNEB 4TKSA 1AGWA 2PVYA 3R83A 4NKAA 4FTQA 4ZSGA 3RAKA 4GFOA 4O0XA 3C50A 5HG8A 5AV1A 2CKPA 4Z3VA 3G0EA 3D2IA 3DGKA 4FKOA 4G34A 5F20A 5HG5A 5EW3A 1J91A 2WMUA 2V5QA 5C4KA 3BHYA 3ROYA 4PQNA 2OXYA 2Y7JA 3W10A 4CYJA 4RC3A 5I5ZA 2JIUA 3ZEPA 4F6SA 5AA8A 3TDWA 4QP2A 3BEAA 4USEA 1XH4A 3S1HA 1PXLA 3UVPA 4L3LA 5K5NA 5J9YA 4FODA 5D7VA 3W2CA 5JGDA 2CDZA 3M1SA 2QQ7A 4FT7A 2A0CX 2UW9A 3QX4A 4LQMA 4PPCA 4WSYA 4XH6A 4O83A 3SG9A 4YO6A 3QRJA 5IQIA 3MTFA 4FSUA 2BROA 1NT2A 3C4ZA 3QLGA 4XHKB 5FGKA 1M14A 3FSFA 1ZYDA 3PXFA 1PMVA 2YCSA 4LMNA 2IVTA 1Y6BA 3FKOA 4EZ5A 3AC3A 4F9WA 4WO5A 4F9YA 3KRLA 3SAYA 3MH1A 3W0SA 1WZYA 3UQGA 5F9EA 1V0OA 3E8DA 3P5KA 4JL9A 4BZOA 5BMMA 3FLSA 2WTVA 2CGUA 2LAVA 3ORPA 5F4NA 1OL7A 1OUYA 4IAZA 5J9LA 4ACDA 2WEVA 3Q6WA 4K6ZA 1J1CA 2QKRA 5HG7A 4FTKA 3ENHA 5IQCA 3OCTA 3VBVA 1UU8A 5HBJA 3VW8A 4BY9E 5IEXA 2X4ZA 5BMSA 4LDTA 1OITA 2WTKB 3GU6A 2GFSA 4ZJIA 2VO3A 3K5VA 3B8QA 1ZXEA 3EFJA 3QCSA 3KF4A 4EH4A 5HIEA 4IB3A 4LGGA 4FKWA 4BCFA 4FV7A 3D7TB 3ZRMA 4IHPA 2B52A 2QOOA 4CTCA 2V7AA 3SVVA 1H08A 4HZSA 1MRVA 2FSOX 4L52A 4BCPA 1UKHA 2B55A 4BRXA 3FSKA 4J95A 3ZFMA 4C38A 2C1AA 3UMWA 4LRMA 3RAWA 2R0IA 1G3NA 3DXQA 4FNYA 3HRBA 3Q52A 4M14A 5EI8A 5F94A 3CS9A 5AM6A 3F2RA 1MP8A 3ZLYA 4FKLA 3W2SA 4BDBA 2OJFE 4UY9A 4IMYA 3OT3A 3HX4A 3L1SA 5HEZA 2B7AA 3FLWA 4FOBA 3ULIA 1H00A 2YEXA 4CZUA 3CCNA 3QQUA 4X3JA 4BIBA 4AT4A 2J7TA 4F9AA 2OXXA 4OAVB 3ZUTA 3HV5A 4GVAA 5FDPA 5LARA 2J2IB 2OJGA 2PK9A 2GNGA 4M0ZA 3ZSGA 3SOAA 4I6QA 3TJCA 2YM8A 3NCZA 5KHWA 2XM9A 3E92A 3D5WA 3VIDA 3C9WA 4CMUA 2R3HA 3ZC6A 4NJDA 4XBUA 2VX1A 5DEWA 5TKDA 4M67A 4HGSA 3E88A 2W1ZA 4UMUA 3NNXA 1VYZA 4J7BA 2X8EA 3FXZA 1GJOA 4EHGA 3GENA 4O2ZA 4PTGA 4A07A 2GS2A 3PG3A 3NNWA 2UVYA 4BBFA 2XZSA 5CU3A 4BDDA 1A9UA 3PZHA 3BYUA 2GU8A 3A7IA 3H4JA 3R28A 4GMYA 4XG4A 4JJRA 3L8PA 5IQHA 1BMKA 4BDJA 3QRKA 4BVUA 2XJ1A 4O91A 3Q9XA 2F2UA 3R00A 4KS8A 4Y85A 4GU6A 2P4IA 1KV1A 3JY0A 4M68A 2CGVA 4BI2A 1H1QA 2VGOA 2VWZA 3A7HA 3BQCA 1YOJA 4XP2A 3TWJA 4F99A 4YR8A 3RJCA 1Q99A 3BKBA 2VGPA 3RM7A 3FLQA 3RBWA 4JT3A 3VQHA 2XBAA 2QOIA 4EOMA 5I0BA 2WQMA 3FZOA 3V3VA 4DEHA 2XEYA 3P9JA 4JX3A 3EWHA 1W7HA 4V0GB 2VWUA 4EOKA 1DI8A 2BPMA 3IW8A 4PMPA 4RBLA 3CGOA 3R6XA 4U3YA 5DGZA 4I1ZA 1X8BA 3PZEA 4GK4A 3SW7A 5AP1A 3IW6A 2ZOQA 1UU7A 4I22A 4ZTLA 3RP9A 2OLCA 5IQGA 2QI8A 4RLKA 1J7UA 2EVAA 4FIFA 2XK3A 3MB7A 4PX6A 4EYMA 3R1SA 1MRYA 3QLFA 4MVFA 4FV5A 4Q5HA 4WT6A 4BYIA 5AP2A 4TXCA 2WZJA 2P55A 3O7LD 1W2FA 2XCKA 3HV3A 4ZY6A 4D4YA 5KMMA 3VS3A 2C3LA 5FXRA 3R30A 5HO6A 4H1JA 3DDPA 4AA4A 3DXPA 4R7HA 1GZOA 4W9XA 4J96A 3W18A 3W32A 3HVCA 2YWVA 3PUFC 1ZMUA 4MQ2A 4PUZA 3IDPA 2PVRA 1E1VA 3EQBA 2BKKA 3R01A 3BZ3A 4L00A 3QA8A 4C4EA 5B0XA 4QTBA 2H96A 4C2VA 4FV6A 4DHFA 5IA4A 3GQLA 5JFWA 4O2PA 3UQCA 4W9WA 3NYOA 4YLLA 5EHYA 5A4QA 4ZS4A 5IUHA 2C6MA 2UZLA 2XNPA 5CWZA 5LWNA 4WRSA 2YZLA 4LOPA 4BHNA 1TQIA 1YRPA 2A1AB 3PVGA 3HRFA 3VUHA 4RIXB 3HUCA 4IAYA 4E26A 1VEBA 4FZ6A 3F61A 2YJRA 3V8WA 4ANBA 4P5ZA 4FSWA 4FIGA 4MK0A 3W55A 5CVGA 1OL6A 4OBQA 3BV3A 3FQHA 4ZY5A 3BU5A 4D2RA 3TZMA 5EK7A 3UOKA 3IDCA 4D5HA 3DU8A 5EHLA 3F88A 3DKOA 4U7ZA 4CEGA 3KXHA 4GU9A 4Y5HA 4RIWA 2BKZA 3B8RA 4RGJA 1JKKA 3VS2A 3NZ0A 4UMRA 1ZZLA 2QKWB 2UW4A 5BUJA 3TV6A 4YBJA 3FMJA 2YIQA 4E73A 1TQPA 2F7ZE 3GC7A 3MV5A 4M66A 4FVPA 4RX7A 2JDTA 3ODZX 4I6BA 4IC8A 5BVOA 4BB4A 3TUBA 1KE5A 3PXRA 3KL8A 5HCXA 3VBWA 5AX9A 4XLVA 3ACKA 3ZO3A 1SMHA 3H10A 3LXKA 4E4NA 5LOHA 5HHWA 4DGGA 1CMKE 3Q9WA 4XG9A 3UO6A 1G5SA 2ITUA 3WI6A 3LCDA 4FKVA 2VO0A 2ZM4A 2C30A 4LV8A 4E6CA 5JRQA 4DITA 2X2LA 2CLXA 4WG5A 4EQCA 3SV0A 4LL5A 5CI7A 4IX4A 3VUMA 4ERWA 3ZU7A 1PXKA 4C4HA 4BGGA 3PFYA 5B2MA 3ZH8A 1YXTA 1MQ4A 4C7TA 3FXWA 5J87A 4XV1A 3RNYA 4L67A 2X39A 1H1SA 1U59A 5HIBA 3UVRA 1IA8A 3EZRA 3MH0A 3L9NA 4IM2A 5GIOE 5DT3A 2R3GA 4ZTMA 4G2FA 4RX8A 3Q9ZA 5JN2A 5LVNA 3R9NA 3SDJA 3A4OX 4BJJA 4ZZMA 1QCFA 5CX9A 4AW5A 4U45A 4F65A 3MIYA 3FHRA 3E7OA 2JAVA 5GJGA 4PWNA 4F64A 2I0EA 4QYEA 1V1KA 3NX8A 1PJKA 4TWCA 3G9NA 1Q5KA 2QHMA 5EM6A 4OTRA 4M97A 5TO8A 4QMMA 1FMKA 2OXDA 2YM7A 4QMSA 4DH7A 2B54A 4JDIA 4RA4A 3VRZA 4PV0A 4CV8A 2VO6A 5GZ8A 5L2IA 4HYIA 4F7NA 3AC2A 3OBJA 2C47A 3UBDA 4DBNA 1OB3A 1M17A 1XO2B 1WVYA 3EN4A 3THBA 3I5NA 3QL8A 3QYWA 4OTHA 4MCVA 5GHVA 4YZ9A 3A8WA 3FL4A 1JSUA 4U5JA 5JRSA 4EKLA 2PU8A 3GOKA 4FEWA 3OXIA 4Q5EA 2OH0E 3HV6A 3OUKA 4YHJA 5DN3A 4AQCA 4D4SA 5M53A 4OTFA 3QTSA 2UZUE 4XX9A 5JMSA 5KMLA 5KZ0A 5IQDA 1APME 2I0VA 4XBRA 4BTJA 5DIAA 4Z16A 3R22A 3C4FA 4AXEA 3VRYA 1B6CB 3NUAA 3DNDA 1Y8GA 4UXQA 3DLSA 3ETAA 4U8ZA 3REPA 3UYTA 2G1TA 1ZY4A 4F0IA 1Q41A 3PXQA 2C6KA 1O6LA 4MUQA 2HAKA 4W4YA 2GNLA 2W9FB 5IH5A 3NS9A 5HVYA 4DFLA 4BZDA 4MQ1A 3Q32A 2YAAA 5GJDA 3KY2A 3H9RA 3HZTA 5D1JA 1UKIA 3D4QA 4I92A 4CMOA 4C2WA 2J0MB 3ORKA 2OFUA 2QONA 2ITTA 5IPJA 3HLLA 4UYAA 3KMUA 4ZIMA 3W2RA 4O0WA 4YJSA 1GIJA 2QOCA 1R78A 4KIPA 3VUKA 4YZNA 2CKQA 1YDSE 3BBTB 3CPBA 3FQEA 1OM1A 4IWOA 4AW2A 4F6WA 3C1XA 2BRGA 4HNIA 3ZOSA 3FJQE 4EH3A 2WNTA 3F3WA 5B2KA 4K1BA 1IR3A 4DTKA 2VTLA 3FDNA 5AP4A 1ST4A 4H3QA 5DEYA 3CJGA 5K5XA 4D1ZA 4O7RA 4MF0A 2WTJA 2HZ0A 3UP2A 3TUDA 4F4PA 4IADA 5KKRB 2Z02A 3NUSA 1J3HA 4DFNA 4V05A 1FQ1B 1RQQA 4UBAA 5HCYA 4Z55A 2VWVA 2JAMA 3R21A 2IVUA 3MVLA 3NW6A 4AS0A 1PXPA 2UW0A 5AR8A 4CT1A 3AXWA 4KIOA 4EWQA 4TWOA 3QGYA 5CAUA 4NJ3A 2A19B 2QLQA 2YCQA 4FYOA 4QMNA 4IJ9A 2W5HA 2FGIA 3HMIA 3VUDA 4B99A 2H6DA 5CU0A 2R7IA 4ZJJA 5DRDA 2W4KA 3R8MA 4QMQA 5BNJA 1G8JA 2G2FA 3SA0A 3LLAA 3GP0A 4AT5A 4OBOA 5HCZA 4IX3A 4CD0A 2XKFA 3SGCA 5HVJA 4J99A 1XBAA 4F09A 2ITZA 3IGOA 3DAKA 4L46A 2QD9A 4F7JA 2ONLC 3MW1A 4FT9A 3P86A 4FL2A 1KE8A 2Y6MA 3P08A 4GCJA 2OF4A 5CT0A 4RMZA 4AW0A 1OPJA 5AR5A 2ZV8A 2G15A 4B0GA 4UALA 4IEBA 4ID7A 4I24A 4H3BA 5HLPA 3LJ1A 4DFZE 4Y8DA 4O7WA 1ZMVA 1FVVA 4W4VA 4K77A 3F5PA 4EYJA 3AQVA 3OWJA 4EQUA 4LG4A 3NDMA 3K5UA 1XH8A 3ZO1A 4R5YA 3D5XA 3UG2A 3UGCA 3UYSA 5J95A 4BF2A 4KUJA 3U8WA 1PHKA 3OWKA 4AAYA 3SXRA 3A2CA 3ORXA 2CMWA 4U41A 4ORKA 4GT3A 3LM0A 4K2RA 5HTBA 2PHKA 2ZV2A 1URCA 2EB2A 1U4DA 4FUYA 3BQRA 3RAHA 3MBLA 2PZPA 3QHRA 4FVQA 5I9WA 4R1VA 3QA0A 3WYXA 2O0UA 4I6FA 3H3CA 3L8VA 4KRDA 5K3YA 4LOQA 2YISA 2WTIA 3SQQA 2PMNX 4TT7A 4DFUA 1Y6AA 4EWHA 4RIWB 3NYNA 4O7TA 3QRTA 3ZRLA 5HG9A 5D10A 2BAJA 3PY1A 4GK2A 3WZKA 3UO5A 3Q5ZA 4FV8A 4QMUA 5E7RA 2JEDA 3CGFA 2R3JA 1KE7A 5CANA 2Y4IB 3BYVA 1BL7A 3F7ZA 3AC1A 2XARA 3O51A 3F3UA 1B38A 4PMTA 5CU2A 2BZJA 3DAJA 4RIXA 2WTDA 2XMYA 5I3RA 4LL0A 3COMA 2VTMA 4K8AA 4YTFA 4X3FB 4ERKA 4D1XA 2PUNA 3R9HA 2QR8A 3LFBA 3DZOA 2I1MA 4DYMA 4EH9A 5CI6A 4D0XA 4IB5A 3I0OA 5FTGA 4GL9A 2JKKA 4J52A 3CQEA 5E4HA 4JIAA 4L53A 2C4GA 3GU7A 5FP6A 3W2PA 1YXXA 4PNKA 4KBCA 1JSTA 3QZHA 4AGUA 3OCSA 3WE8A 5A9UA 4Y72A 3Q04A 4LGHA 4E1ZA 3EN6A 3PP0A 3U6IA 3NMUF 4I5MA 3PVBA 3QXOA 1WBWA 4XRJA 5ETIA 3FL5A 5AV0A 5H8GA 4APPA 4M69A 4EL9A 1WCCA 2OZAB 3VBXA 2CN8A 3NAYA 3TNWA 3PG1A 2BAQA 3NW7A 5CU4A 3V5LA 4CKRA 4O21A 3FY0A 3O50A 2NPQA 3AC4A 3NVKI 4G31A 3FI8A 2YFXA 5F1ZA 2PE2A 2SRCA 3QUPA 3ZZEA 4HVDA 1BI8A 4G3DA 4GRBA 3Q3BA 5HICA 3UPXA 4FL3A 3OCGA 2C68A 1R1WA 4GYGA 5IEYA 3RAIA 1W83A 3QQJA 4FSMA 3N51A 5I9UA 4BCNA 3KN5A 4FR4A 1REJA 3OY3A 3AT3A 4O84A 2QOKA 5DHJA 1XH6A 4O4EA 3D7ZA 2R9SA 4O7VA 3PPJA 4A4XA 2PZ5A 3FYJX 2WMTA 3V51A 5AR3A 5JQ8A 3MJ2A 3QWKA 4FEQA 4AGWA 3E87A 4H39A 5K9IA 1UWHA 4L3PA 3BEGA 1XMMA 1M52A 4ZK5A 5L6OA 4N57A 1JOWB 4U79A 4C61A 2VX0A 3AD4A 4CXAA 2NNWB 3OUNB 3VS5A 4IZAA 5A46A 5CF6A 3LCOA 5TOZA 4TNDA 1B39A 4QP3A 2UZEA 3OG7A 2VU3A 2QODA 3G5DA 3E5AA 4L7SA 4K11A 4CFWA 2HCKA 2QO7A 5GNKA 2DWBA 2GTNA 3F5XA 5HTCA 3IPHA 4FTUA 4IB1A 4BCKA 3EOCA 1I09A 2WIHA 2X6DA 4DEIA 4XLIA 3UNJA 3DJ7A 1TVOA 2VTPA 3LFDA 1EH4A 4QMZA 2VTIA 4IJPA 3TNPC 4BYJA 3FZ1A 4YURA 2E9PA 3S00A 3R0TA 2W4JA 3Q4ZA 4RZVA 5J1VA 4DFXE 2GCDA 1UVRA 4MYGA 4LUDA 3QXPA 4TN6A 3LM5A 2HYYA 4G5JA 4L42A 4NW6A 5DFPA 1GZKA 1YXSA 3TN8A 3VUGA 5E90A 1WFCA 2WO6A 3BHHA 5KE0A 4X0MA 3BU3A 3NUPA 4GKIA 1OGUA 1ATPE 2QCSA 4FOCA 4RJ4A 4CT2A 3HV7A 4QP7A 2PL0A 4EH8A 4YZMA 1J7LA 2FUMA 3D14A 3BV2A 4G9CA 4QMXA 3RHXA 5CVHA 3PE2A 1Y91A 1H28A 4KKEA 4QYYA 2NRUA 4G17A 4D55A 2GSFA 5GIPE 3FLZA 4JBOA 2OSCA 2W1CA 3N4VA 2WXVA 4NFNA 2QC6A 5AFVA 1XBBA 2PY3A 4IWPA 5H8BA 4IB0A 3ZO2A 4EK8A 4HPTE 2DUVA 3AG9A 3DLZA 4E3CA 2ITNA 2W1EA 5AP3A 4D28A 1W84A 4ONAA 1VZOA 2H8HA 4I5HA 4E8AA 5JFVA 3P79A 4QTAA 3O0GA 2YDJA 3PWDA 3R7UA 3UODA 4IANA 4XG8A 4RVKA 5JT2A 2XANA 3ID6C 3EYGA 3TL8A 4KB8A 5LVPA 3RK7A 3HMPA 4FV0A 4I5CA 5CZIA 1NXKA 3DBEA 3KQ7A 5CF8A 1Q8WA 5C03A 4WUAA 1XMLA 1HCLA 4BR3A 3QTRA 1ZOEA 2DS1A 2X9EA 3KRJA 3UTOA 3G0FA 2YABA 5EQPA 4CGAA 2Q0NA 2G01A 2ITXA 2R3FA 4HOKA 3ATSA 3G15A 4DT9A 3MA3A 3RVGA 2EXEA 2V7OA 2WMSA 4EJ7A 5EG3A 3WIKA 2WHBA 4DEGA 4Y5QA 1FPUA 5E92A 5FWKK 4AW1A 5CEKA 4ALWA 2FA2A 3HMNA 4L6QA 1QPCA 3DK7A 5AA9A 4O0VA 3MI9A 5IG1A 2R7BA 3TIYA 4IM3A 5EM5A 2JKQA 4RVTA 3RALA 3E8EA 4FKUA 5E8XA 3P5JC 2XM8A 1UNHA 4EH2A 1ZWSA 3EHAA 5HO8A 3FMHA 3LZBA 5JH6A 2X0GA 4JRVA 1YOLA 2VTQA 3IECA 4ANNA 4R8QA 4F1TA 2X8DA 2O2UA 1XKKA 2ESMA 5L8LA