3COKA

Crystal structure of plk4 kinase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
267
structure length
234
Chain Sequence
SLATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKESDVWSLGCMFYTLLIGRPPFDTDTVKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PLK4
publication title Crystal structure of PLK4 kinase.
rcsb
source organism Homo sapiens
total genus 70
structure length 234
sequence length 267
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cokA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cokA01
3FZSA 3COKA 4FSNA 4YTHA 3R7YA 3SQQA 1A48A 3TUDA 1EH4A 4DBNA 3VS0A 3R30A 5HESA 2WTKB 4HZSA 3KRLA 3ORLA 2QHMA 2PZPA 3C4EA 2PMOX 3ZDUA 4CRSA 3NUXA 2X8IA 4IAKA 2ZB0A 2H9VA 1Q4LA 4FEQA 4O0SA 3F2NA 4CFXA 3ENMA 3NUAA 3ZO1A 4ZJIA 1FPUA 4EYMA 5AR3A 3ZRMA 5CF6A 4GMYA 1Z9XA 3RBWA 4MD9E 4F9BA 3I0OA 5HHWA 2I6LA 3CJFA 3QHRA 2VTOA 3AOXA 4O2PA 5EI6A 3NWWA 1TKIA 2VWVA 2UZEA 3ORXA 4U81A 2R3NA 4P90A 3QHWA 1J1CA 1H00A 4R5YA 2VNWA 5ANIA 1PXPA 1UU3A 1DAYA 3T9IA 1KUTA 1F0QA 2VV9A 4QPAA 1U5RA 3IONA 2FO0A 4AS0A 1YHVA 4BZNA 1Q8ZA 3OOGA 4PMSA 4IJPA 5DRDA 2WQNA 1PHKA 3SW7A 3KVXA 1LPUA 4EQCA 5FBNC 2G15A 5IEYA 3R04A 1PW2A 4M66A 2JC6A 3RNIA 4K0YA 1CMKE 1YHWA 4R8QA 4U6RA 3SAYA 1BUHA 5CU0A 3NNXA 3POZA 1SNXA 1I44A 3HP5A 4J53A 4DTAA 1ZYJA 2E2BA 5GZAA 4H05A 1H27A 4JBQA 3BHTA 5HO8A 5LXMA 2B9IA 3LCKA 3VS6A 4JX7A 4BR3A 2I1MA 1S9IA 3MB7A 3ODYX 3NYOA 4G34A 3WZEA 5C01A 3ZU7A 4DH8A 3AD6A 1WBPA 4KABA 4ANLA 3PA3A 2C3KA 3QX4A 3DJ7A 2DYLA 4RJ5A 2B4SB 4IB3A 1YDTE 2XIZA 3UG1A 2GS7A 5E1SA 1XR1A 2BDJA 1BX6A 5T68A 1SNUA 4X2FA 4BFMA 2WTWA 4JLCA 2ITXA 2RL5A 2P33A 4L7SA 4KA3A 2XM9A 5IU2A 3S1HA 3EFJA 3RHKA 3D94A 3TNWA 1Q99A 3BHUA 2XB7A 5EM5A 4MBJA 3WE8A 3BU6A 3EFWA 1YOLA 5D1JA 3LFAA 2WU6A 3WARA 2GNLA 3AT2A 5K3YA 5IUHA 4LGGA 1T46A 2CKEA 3C1XA 3D2IA 4D2RA 3WOWA 5JZJA 3FMKA 1Q8UA 2F7ZE 4FTJA 3ROCA 5A4CA 3ZO3A 3D7TB 3R21A 2GNJA 2OIDA 3DTWA 4ITJA 3ZSIA 3EN4A 4E1ZA 3PA5A 1ZY4A 4IM3A 2X9FA 4QPMA 3CTJA 4DEHA 4U41A 4I1ZA 2V7OA 2ZV8A 2R3HA 2OJ9A 4QMQA 5B0XA 2OH4A 3DJ6A 2XA4A 2IZUA 4XBRA 1ZMWA 2C4GA 3DQWA 4UWBA 3IDBA 2PE2A 3ZUTA 3AC4A 5FDPA 1YVJA 4P5ZA 1Q3DA 2PVNA 3V04A 4AQCA 2NO3A 1H4LA 3FMJA 3ZLWA 3NLBA 4S30A 1WAKA 4Q9SA 2JKKA 4ZTSA 1SZMA 5M4UA 4FKPA 2I0HA 3QZIA 2QURA 3NVKI 2R0UA 1Y8GA 2V55A 1XQZA 3ACJA 4GJ2A 1NW1A 3HRBA 2YLFA 2WELA 3D14A 4GUBA 4AZSA 1Y8YA 4UMQA 2VGPA 3DKGA 3F2AA 5AP0A 1I09A 4FK3A 3F69A 3TNPC 4IBMA 3FAAA 3ZSHA 2W1IA 4MNFA 3S95A 4CV9A 2OLCA 1MQBA 5FTOA 5L4QA 3E8NA 1CM8A 4X2GA 2CGWA 4OTHA 3QQLA 4J71A 4XOZA 1ZYCA 1IAJA 4O21A 4O1OA 5KMNA 1J3HA 2XIRA 3EKNA 1OKVA 3VRYA 4APPA 3Q9ZA 2UW3A 4ANQA 3EIDA 4FNWA 2YCRA 4E73A 4EOJA 4CLIA 4XG8A 3LJ1A 5FRIA 2RFSA 4G5PA 3RAHA 4I6QA 4HVIA 5E91A 3WZKA 3DB8A 4CT2A 2X7GA 2GU8A 3UODA 4C38A 5E7RA 4KKEA 5EM6A 1H1PA 4EH5A 4MVFA 3PLSA 5IQBA 4DE4A 4RFYA 3LOKA 2C47A 3CTQA 4G3EA 2XF0A 4FTNA 3ZXZA 3R7VA 3LCTA 3PXZA 2H6DA 4RQKA 3VS4A 3I0QA 2XH5A 3EQBA 5KMJA 5EW3A 5ANDA 4ZTHA 1S9JA 2W9ZB 3ZFYA 2X4FA 4L6QA 1XJDA 3PG3A 5BPYA 1APME 5E1EA 2GHLA 4YZDA 2RFEA 4R78A 4BICA 1FMOE 4YSJA 5HBJA 5ITAA 3PVUA 5GIPE 3NAYA 2A0CX 2Z02A 3FMMA 4WNMA 2YM6A 3ZH8A 4WO5A 2QG7A 2QOFA 4PDOA 4B9DA 5F9EA 4U3YA 2EB2A 2Y6OA 3ROYA 4FT3A 4DF3A 2R3IA 4HNFA 4EH8A 3PDTA 4NK9A 4AUAA 2GPHA 3I79A 5A4QA 4W4WA 1U4DA 4M69B 3A7IA 1CTPE 4G6NA 4JX3A 2G1TA 2W4JA 4DEGA 1X8BA 4A4OA 2F4JA 2WB8A 3D2KA 3FKLA 3GQLA 5D12A 5CEIA 4DFNA 3LMGA 4CKJA 5I4NA 4N57A 1HCKA 2YEXA 3LJ2A 4F9CA 4O0UA 2H8HA 4YJOA 5KO1A 3COHA 3EB0A 4W4VA 3F5XA 3NR9A 1J7IA 4HGEA 3BIZA 4BIEA 2E9UA 4QPSA 5HCYA 4QP4A 2BRNA 5E92A 2PUNA 1OITA 2ZMCA 4I5PA 4JRVA 1JKTA 4L00A 3FYJX 4FT9A 1U54A 2XRUA 3T8OA 4QO9A 4YZ9A 5IA1A 5LVLA 2X6DA 3PRIA 3S00A 1OZ1A 2PVLA 3E8DA 2GHMA 3QC9A 4ITIA 4NL0A 5TT7A 4GKIA 3QKKA 3VVHA 3LCOA 1REKA 3OBJA 4FKVA 4IX4A 3UYTA 5HTCA 5CU6A 3JXWA 5C9CA 1ZOGA 4RFMA 3R22A 1OMWA 3P23A 3BWFA 4O2ZA 3W8QA 4BBFA 2W1CA 2NPQA 3H9OA 3HRFA 3MJ1A 4BIDA 3VC4A 4IB0A 1MP8A 5JGAA 4EZ7A 4JDHA 1M14A 1WBSA 2R3KA 4EH4A 1H1RA 3KXGA 4G9RA 3OC1A 4FT7A 4FKTA 4IAZA 5HBEA 5HNBA 3FV8A 4O7TA 3UPXA 3IO7A 4I0TA 5DVRA 4RIXA 2B9HA 5FWKK 4RLKA 1SVGA 5J1WA 4UYNA 3HAVA 1JWHA 4IW0A 3RCJA 4L52A 4NFNA 5B7VA 2EXEA 3O50A 4YJQA 3CQEA 2QI8A 4NEUA 2EU9A 3QRTA 3QU0A 2VWIA 2X0GA 3W1FA 2XNOA 1NY3A 3VW6A 2YWVA 2J5FA 3EQDA 3KRXA 2A2AA 2QVSE 2YISA 1DI8A 3GU8A 4AW1A 3OCTA 4OTPA 4EHVA 4K9YA 5E8YA 3CKXA 5JGDA 5BVOA 4RJ8A 5CZHA 2Q0NA 5AUWA 3RI1A 4CRLA 5HU9A 4NSTA 1PXIA 4EI4A 4JDJA 4Y73A 2WTCA 1PXJA 4AZEA 5CASA 3EYHA 3DXPA 5AADA 3UVRA 4JAIA 4EOLA 4FOBA 4NM5A 1JSUA 3C4FA 4IE9A 3FSFA 2BALA 5KZ0A 2A19B 2ITPA 5AR4A 3R0TA 1NVSA 4QP1A 5AMNA 2A1AB 3Q96A 4JR7A 4P7EA 4EOKA 5TE0A 5CSXA 2BKZA 5BVNA 3EKKA 4I92A 1OPKA 4KINA 3U54A 1KSWA 4G3DA 3VS5A 4BDKA 4JQEA 4XYFA 1F3MC 4QQCA 4RWKA 1KE7A 2OGVA 5D9HA 5L6WL 4ERKA 4IB5A 2HK5A 4MD7E 2IVUA 4H58A 4PWNA 4PNIA 3KXNA 3ZC5A 3QKMA 5KE0A 2F7XE 4JDKA 5T6KA 4H3PA 4KIPA 3OFMA 2X2LA 4MWIA 3Q2MA 1W7HA 2QO9A 3CS9A 2WOTA 3QZGA 3NUUA 3TZ7A 5AA9A 1GIHA 2W5AA 4C37A 4FV2A 2BZJA 3W2CA 4ZTRA 5B2KA 3MW1A 3DNDA 4CSVA 4KNBA 1L8TA 2HY81 3AMBA 3BGZA 3MDYA 3GNIB 5A3XA 1YRPA 5EH0A 4IZYA 5FBOA 2Y0AA 3MPMA 4GL9A 5L2QA 3TDWA 4FOCA 4I22A 3Q3BA 4A9RA 1PKGA 4FV6A 1WVXA 3C50A 2OSCA 3F3ZA 4G5JA 4D9TA 5EOLA 2O0UA 1OIRA 4ZTNA 5TKDA 3KULA 2OJIA 3R9NA 3IOPA 5DEYA 3TT0A 1E1VA 2JD5A 4FZ7A 3AGLA 3VS7A 3C0IA 3AXWA 3BU3A 1RQQA 2BILB 2OXDA 3CPCA 3QC4A 4WG3A 2VTQA 2OZAA 2AC3A 3FL5A 4E26A 4NM7A 1M7QA 2ZVAA 2E9NA 4IACA 3B2TA 4NTTA 5DWRA 4ANSA 4HVGA 3KY2A 5LJJA 5HD7A 5TR6A 3CIKA 4AN3A 3CJGA 4K11A 2YIXA 4JL9A 2WQEA 5FEDA 4E6QA 4RJ6A 5FG8A 3SOAA 5HCXA 3C51A 3LFDA 4EK8A 2C5OA 3Q4ZA 3QWKA 1UU7A 3FLWA 5CSVA 3PJCA 2C0OA 3I7BA 3W32A 2BKKA 4XMOA 4IM2A 3AMYA 4Z7HA 4XG2A 3DZQA 5LCJA 5G1XA 4BYJA 2ZDTA 4LQMA 5EQPA 3IW4A 4W4XA 3UP2A 1P4OA 1Q62A 3KF7A 3NRMA 4A7CA 2PSQA 3HA6A 3KN5A 4S2ZA 3WF5A 4M14A 4Y5QA 4D2PA 2RSVA 4K77A 4M0YA 3LLAA 4UALA 5DHJA 3T3UA 3W2PA 2BRBA 5BVWA 5HORA 3R1NA 4U97A 2OF2A 3R8MA 4LOOA 4HVSA 3FMHA 4FR4A 4YMJA 5ANGA 4IDVA 4PP9A 3FI8A 1GZKA 3ET7A 3SOCA 3BX5A 3ZFMA 1QCFA 4X3FB 5BUJA 1UA2A 2JEDA 4IVDA 5CNNA 3IW8A 3A99A 1OVEA 3QRUA 2BFYA 4YJVA 2XK8A 3TUBA 2WD1A 2Q83A 4QMNA 2XKCA 4LM5A 2RKUA 4I5MA 3W2SA 5IQAA 3PIXA 2V7AA 4D0WA 4UB7A 3LMHA 4UMPA 2BAQA 3LMIA 2YITA 3PFQA 4G3CA 1SMHA 4MTAA 3GFEA 5ANEA 3V5LA 3W8LA 3ZUUA 4D2VA 4DH5A 4FZDB 2B0QA 3MPAA 4N6YA 3BGPA 1JLUE 1PYEA 1GZOA 1A06A 4FNZA 5HI2A 2VTLA 2XIKA 4QNAA 5JFSA 3EN6A 2CGVA 1OL7A 3GU4A 3LM0A 3R2BA 4RVKA 1JNKA 3LFSA 4AF3A 1NVRA 5C8MA 1DS5A 3JS2A 3UTOA 3MB6A 3GC7A 2CGXA 4UZHA 4UY9A 5JT2A 4YLLA 2VZ6A 3F3VA 3FQEA 4U40A 4BCJA 4P4CA 2KULA 5EW9A 5JGBA 4A07A 3R7GA 5LMAA 4QMMA 1V0BA 4F7LA 5C8KA 2PZIA 3G9LX 4DH1A 4FTOA 3EQCA 3IK3A 2ETRA 3KA0A 4IC7A 5HGIA 3FLSA 3RHXA 1IAHA 2R3RA 1GY3A 1OIQA 2JIUA 3EN7A 4USDA 3R8PA 4FTQA 2Y7JA 3QCQA 4M3QA 4WSQA 1R0EA 4JS8A 4FKOA 1MUOA 1KE9A 2IJMA 3OHTA 3PSDA 3TV4A 4MEDA 3UIXA 4QYHA 1H25A 3E7OA 2OIBA 4N70A 4DGNA 4BDBA 5HD4A 2DWBA 4DHFA 3GC0A 1PXNA 1Y91A 3E8CA 3PUPA 4YLJA 4F9WA 1ZARA 3LKMA 1OIYA 2CGUA 3S2PA 4TNBA 2OJGA 5CYIA 5CSPA 4E4XA 3II5A 3NUPA 5A46A 4AT3A 3CQUA 3R8ZA 1YKRA 3FMLA 4C4EA 3A2CA 3UG2A 2NP8A 3HMMA 4OTQA 3WZJA 4HYHA 1K9AA 2RIOA 4CCUA 4TYGA 3QQGA 3TNQB 5CLPA 4CZUA 2YERA 2ZAZA 4S34A 4PTCA 4ZLZA 2YFXA 4KRDA 5AM6A 5HKMA 3QLGA 4IX3A 4YBJA 2VX1A 3R01A 4ZP5A 2X9EA 4CVAA 2UZUE 2JDSA 4ZZMA 2GNFA 3GQIA 4I21A 3WF8A 2WFYA 3H9RA 3QD3A 4J96A 2X39A 3Q04A 1H1SA 4FIJA 4MX9A 2JAMA 4EH7A 5I5ZA 3D9VA 5AP3A 3R71A 3R8LA 3R2YA 3ZDIA 4MBIA 4O7LA 4PPCA 4E5AX 1AGWA 1XBCA 5C8NA 3F5GA 3BHHA 4KSQA 4FODA 2HWPA 4IDTA 3WILA 1OKWA 1CSNA 2HZNA 3NS9A 3IKAA 3O8PA 4NH1A 4O0YA 2J7TA 4F63A 3DB6A 3BE2A 1L3RE 3B2WA 1LEZA 3R9RA 3O0GA 4UYAA 4I20A 3UNJA 4TT7A 5AP1A 2PE1A 3OUNB 3PXKA 3SXSA 5JSMA 3DLZA 4YHFA 4BI0A 3HL7A 3QQHA 3C0GA 4D28A 5I9VA 3MV5A 2EB3A 3D7TA 5AV3A 3FMDA 4HGLA 3U4WA 4QTEA 3DOGA 2BROA 4FV7A 5JZNA 2XM8A 2C5YA 4BBEA 4EJNA 2W96B 4QMPA 5ETFA 3DBCA 3NIEA 4ONAA 3VUIA 5M4CA 4IH8A 5HTBA 3FZTA 2ZV7A 2GSFA 4GU9A 2HIWA 3QL8A 3KMWA 2W5HA 3RAIA 4D1ZA 5KMMA 3CD8A 5EDQA 1VR2A 3MH0A 4GRBA 1Q41A 3VUMA 4F0IA 3SVVA 3JY9A 3C4ZA 3ZRLA 4QMWA 4QOXA 2PTKA 2XVDA 4XG9A 4YBKA 1ZRZA 5D41A 5BVKA 4FEUA 4KRCA 4G3FA 4TTHB 3HRCA 4KBKA 5IEVA 2R3LA 2WMTA 4RJ3A 2CDZA 2X8EA 2PZ5A 3SKCA 3LJ0A 4CTBA 2DQ7X 4IAAA 5DFPA 5CI7A 1ERKA 5HLPA 4M13A 3GCSA 3OXZA 3U9CA 3LVPA 2XMYA 2ZJWA 2CN5A 3NYNA 5KMKA 2FB8A 4CCBA 3BYSA 3G51A 4W8EA 5L8LA 1PRYA 3EYGA 2QOOA 2VTJA 3LFQA 3PSCA 3ZZWA 2X8DA 2WQBA 3FL4A 4H1MA 3O2MA 2WO6A 5CSWA 4BTFA 1H24A 4RVMA 1CKPA 5HZNA 4FMQA 5L2WA 2XJ1A 5I3RA 4DH3A 3TIYA 5A9UA 4Z9LA 4QTDA 4C02A 3RPOA 4L45A 4MXYA 4RZWA 4A9TA 3G15A 3MJ2A 4IM0A 4J99A 4AP7A 3POOA 4AA5A 4FV5A 2W1FA 4DAWA 1A9UA 2Z7RA 3UO6A 3UOJA 3DK3A 3H0ZA 5F94A 5IQFA 3SA0A 2WNTA 2J4ZA 2BRMA 2BZKB 3DFAA 4GFGA 4OBQA 4R7IA 4YJPA 5IQEA 4UXLA 2OK1A 3DJ5A 5AP4A 3KMMA 3TJDA 1BYGA 3FEGA 2JIIA 1YXSA 4G17A 2ITQA 2IW6A 5ETIA 4M68A 4XP0A 3T9TA 4BCFA 5HE3A 4DEDA 1LR4A 4F6SA 2QOIA 5IF1A 3P7BA 3HGKA 2R3GA 2X4ZA 3D4QA 1OL1A 3JY0A 2H96A 2KTYA 3N9XA 3OXTA 3ZM4A 4V0GB 2BVAA 2X6EA 4BCOA 4I94A 5B2LA 4EH9A 3GFWA 5JK3A 3LFBA 2YM3A 3P5KA 5DBXA 3I1AA 4G6LA 4PL4A 3E62A 4U0IA 3NVMB 3RK7A 3Q2JA 2YM8A 2LGCA 4I41A 4USFA 3BYMA 3OWLA 4BBMA 4MH7A 4ERWA 3UP7A 1NA7A 3P0MA 3P78A 2OJFE 2JKQA 2QU5A 4QP8A 4FV9A 3NW6A 1KV1A 4KWPA 2BUJA 3N4UA 4M69A 3BKBA 5EW8A 3KU2A 3PE2A 4NZWB 3QYWA 4FUXA 5AR8A 4YC6A 3QUDA 4ZMEA 5CU2A 4MQ2A 5EDRA 5F4NA 3O8UA 4ASEA 4F65A 3FJQE 4FK6A 5ICPA 4EJ7A 3OT3A 5BYLA 1FVRA 4IAFA 5FTGA 4DFBA 4PF4A 1J7UA 2ZV2A 3BELA 3ZC6A 5CAUA 1W98A 4WUAA 2W1HA 4TW9A 3TTIA 1NXKA 3EQRA 4A06A 4EOPA 3A62A 4U43A 3RZFA 4UMRA 4F1OA 3LW0A 1FOTA 4AOJA 2PMNX 4GK4A 3DAKA 4EYJA 4FUYA 5DR2A 4I6BA 4N0SA 4IVCA 4JG6A 2F57A 4DEBA 1QMZA 4YURA 4PTEA 2X2MA 5TO8A 4F70A 2VX0A 2CKPA 2B9FA 2GNIA 3F82A 3UIBA 3QTXA 3CLYA 3NSZA 4NTSA 4F4PA 1W8CA 5DI1A 4UXQA 4BKYA 3SGCA 2CNQA 2YN8A 5IA4A 3LQ5A 3RPSA 3U8WA 5M07A 5GZ8A 5KKRC 4BY9E 2PVYA 3C5IA 2QOHA 4G2FA 4GUEA 5BX0A 3P86A 3PPKA 3ORPA 3A7HA 2YWPA 4PX6A 4I6HA 2FA2A 4U9AA 4CQEA 4OAUC 4XNEA 5AAGA 3AQVA 3JPVA 4PDPA 3QUEA 3VBQA 1BL7A 1RE8A 1O9UA 2EUFB 4Z3VA 3K5UA 3C4CA 3HNGA 4HGSA 3DNEA 1UU9A 3PRFA 3I5ZA 1HOWA 4BI2A 3GVUA 3QBNA 4CD0A 4PNKA 3DPKA 4ZS0A 5DNRA 4AW2A 2WMSA 2XKFA 3ANQA 4OT5A 4CFFA 3F61A 4A4XA 3OW4A 4OAVB 3E88A 2ZOQA 3NDMA 2QOKA 4JAJA 2AUHA 4TYJA 1JQHA 2I40A 4FKLA 3RPYA 2PHKA 3F6XA 4FIFA 3FZ1A 5IH4A 4EORA 5ACKA 5EQYA 2YIYA 2P3GX 3RWQA 2XJ0A 2VWXA 5F1ZA 4O0TA 4LGHA 1FQ1B 2I0YA 4NIFB 4GVAA 2QOCA 2J0KA 4DG2E 3Q4UA 4OT6A 1B39A 1IA9A 3HP2A 3KEXA 4RX7A 4X6QC 4DGGA 4C2VA 4CQGA 4DGMA 2X1NA 4UBAA 5BVDA 1OKZA 4DEIA 1H28A 1URCA 3PA4A 3SG8A 5IQGA 1P2AA 4GU6A 4K18A 5C1QB 4Q5EA 2FVDA 5CF5A 5AUZA 2VTSA 2VX3A 3RWPA 2C0TA 2IWIA 2CN8A 3NCZA 3EQPA 2J9MA 2UZVA 4FL2A 4ALVA 3UYSA 5F20A 2BHHA 4X2KA 2C6IA 4BTJA 4C34A 3U6HA 4MKCA 1OM1A 4FSWA 5CQWA 3RPRA 4N4SA 5T3QA 3HA8A 3HV4A 3GOPA 2CCIA 3Q53A 3TUCA 1G8AA 1ZYSA 1PMVA 2G2FA 3L9NA 3KFAA 3MVMA 3OS3A 4EONA 4E7WA 2FSTX 3L9PA 3VBVA 4A9SA 1UV5A 3MH3A 2HAKA 4RBLA 5ETCA 4KKGA 4XG4A 4YZCA 5EKOA 2W06A 2YACA 5HVKA 2WIHA 4L01A 3UOLA 3C13A 3S4QA 4FSZA 4ZOGA 4ARKA 5BUIA 3VRZA 4FSYA 3MWUA 2QQ7A 1H1QA 4E20A 4MWHA 3TV7A 3VULA 4C36A 2PU8A 4QYYA 4F0GA 1PMNA 3TZMA 4IX6A 2Y4PA 2WQMA 3MSSA 4QQJA 5CENA 4UX9A 2HZIA 4V01A 3REPA 5AR2A 3R8VA 2HENA 2WXVA 3DS6A 5EYMA 4B6LA 5CALA 1YOJA 4PDSA 3E7VA 3QKLA 4W8DA 4O7YA 1IASA 3VUGA 1WMKA 3TM0A 3G2FA 4U44A 3EWHA 2O8YA 4HGTA 4NUSA 4AA4A 4I0RA 4TWNA 3FPMA 5HLNA 4H39A 4H3BA 4ZZOA 2BCJA 4QNYA 3I4BA 4GT5A 3VHEA 4AT5A 2YJSA 4QMSA 5K4IA 2GQGA 4JNWA 4NFMA 4O7SA 1BMKA 3DCVA 4YNEA 4EH2A 2C0IA 2ETKA 4LRKA 4RIWB 2X7OA 2J51A 4AU8A 4CMUA 5CF8A 1K3AA 3PVWA 3N4TA 4HYUA 5M4FA 5JQ8A 4AW5A 4XEYA 2W0JA 5L2SA 4GW8A 2ITZA 4I4FA 2EWAA 5I9UA 3ID6C 4AX8A 2P4IA 2ZM3A 5I9YA 5AV0A 3UC4A 4OTWA 3IECA 4O22A 3BPRA 3KC3A 4MXCA 4OBPA 3QTWA 3UIMA 4USEA 4O83A 1OIUA 1JVPP 4YPDA 3QTQA 4R3PA 3WE4A 2FSOX 5J95A 3A61A 3HMNA 3A8WA 2WTIA 2YCQA 3DDPA 1R78A 3UZPA 2W1ZA 3VWAA 5FP5A 3PIYA 5DT4A 4GSBA 3ZM9A 1UU8A 3OWPA 4R3CA 4X3FA 4ZY4A 3QA0A 5J5TA 2OFVA 2XEZA 3IOKA 5I0BA 5IQHA 4FNYA 4MHAA 5DH3A 4FT0A 5GJDA 3O7LB 2R5TA 2ETMA 4YTIA 2UUEA 2YCSA 4O0XA 3OG7A 4YSMA 4RT7A 5JFWA 3KXHA 4ANBA 2W4OA 3BEAA 3E93A 4EH6A 5FQDC 1WFCA 3GC9A 3UMXA 4B7TA 3A4OX 5IH6A 3O17A 3QRIA 4RA4A 2XS0A 3GU5A 4FSMA 1FGIA 3L1SA 3RNYA 3RPVA 4TL0A 2JITA 4PMTA 2GFSA 5B2MA 5CVFA 3UOKA 1Y57A 3GCUA 3QXOA 3V5PA 4ZY6A 3Q52A 2OZOA 3VW8A 4TZRA 3ODZX 4MNEB 3TEIA 3HMIA 3QQKA 4L68A 1HCLA 3QTZA 4FICA 4KS7A 4BDCA 2CSNA 5IH5A 1UNGA 3QQFA 4K6ZA 3LCDA 2IO6A 5HBHA 2Z7SA 4Q9ZA 5EDPA 3BYUA 3HECA 2J50A 4ACHA 2R3OA 4C61A 1YWRA 2Z8CA 4GIIA 4L3JA 5AM7A 3TKIA 5IMXA 2BAKA 5JQ5A 1UVRA 4GK3A 4DBXA 3ALOA 4IWQA 2OJJA 1K2PA 3F3TA 2X7FA 4U5JA 4O38A 2BHEA 5CTPA 3OEZA 4WIHA 5DLSA 1YDRE 2GS2A 4YGAA 4FVPA 4HCUA 3SX9A 2C6MA 3WF9A 4C58A 4HPUE 1LUFA 3D0EA 1R0PA 3MPTA 3Q32A 3TJCA 1OL5A 3OY1A 2PVKA 5GINE 3P7CA 4DFUA 3L9LA 4QQTA 3FY2A 4IEBA 5AR5A 3OWJA 3QCXA 3KXXA 1GJOA 3PVBA 2V22A 2F9GA 4QP3A 5CZIA 5ANJA 4AZWA 4ZSLA 2ITNA 3M42A 4JT3A 2AC5A 4O6EA 4OLIA 4IQ6A 3EH9A 5AWMA 4RVLA 4PMMA 4TY1A 4IADA 2C68A 4FSQA 4AFJA 1O6LA 3UQFA 4C4FA 4CZYB 1SYKA 3KXZA 2B53A 3R73A 3R9OA 3U6IA 2OWBA 5GIOE 3SC1A 5CAOA 3KK8A 2ITUA 2GHGA 5AIKA 2X2KA 2XJ2A 5FM2A 3Q5ZA 4ANOA 5HO6A 3BU5A 3QX2A 1JAMA 1MRVA 5CAQA 1YXXA 2ZM4A 2BIYA 4QMUA 4D0XA 5DEWA 5AX3A 2I0EA 4B0GA 5M53A 2OICA 3VS1A 4WNOA 2UW8A 3NUYA 4NW5A 4F6UA 5JH6A 1PY5A 4C35A 3BGQA 4F64A 3UQGA 5LVNA 2PULA 3FXXA 4NCTA 1GIIA 3EJ1A 3R7OA 4DFXE 4BCQA 1CDKA 5FDXA 2RF9A 4D4VA 4CFUA 4FA2A 3PZEA 3HUBA 2XEYA 1J1BA 5ANKA 2BZIB 2YABA 1PXLA 4TN6A 4EWQA 4AZVA 4ACMA 3V5TA 3HV6A 5BYYA 1MRUA 5HNGA 2EXMA 4E4MA 3D7ZA 4PL5A 4ZAUA 5IA3A 4F9YA 4M12A 3LHJA 3RM6A 2JLDA 2W1DA 3HZTA 3I6UA 3IW6A 2HY0A 4L9IA 2JFMA 1H01A 4S31A 4AFEA 5DN3A 3AMAA 5EHYA 4BN1A 3Q4CA 4FZAB 2J0LA 2WHBA 3DBFA 4FKIA 2OXYA 3TIZA 3ZONA 3DQXA 4BWKA 2BMCA 2YIQA 1H07A 4BZDA 4C57A 4AXAA 3H0YA 3NNWA 3P4KA 3I5NA 4EK6A 4L44A 3OOMA 4OUCA 4EL9A 4FG7A 4Q5HA 2UVYA 4JDIA 2P0CA 4BGGA 3IDPA 4FIHA 3VF9A 4HVHA 5JN2A 3KGAA 2R3FA 3RAWA 5FUTA 5GHVA 4B4LA 5LWMA 3VBYA 2XYUA 4PQNA 4C4IA 4C8BA 4D2TA 1Q3WA 1KE8A 3F5PA 5GZ9A 4O1PA 3TZ9A 5JRSA 4UV0A 3QALE 5AFVA 1B6CB 2OG8A 2CKOA 5DA3A 2JBPA 4YLKA 2C3JA 3TZ8A 5D11A 1ZAOA 5DR9A 4KB8A 2YM4A 3EFKA 1XH4A 4BI1A 4CZTA 4YTCA 3GGFA 3VO3A 1Z5MA 1Z57A 2G01A 2AYPA 4HZRA 2NRYA 5IG1A 4BHZA 3PJ1A 3V01A 3EOCA 4P5QA 2C6OA 4CKIA 4IMYA 4DG3E 4EQUA 2YA9A 2VTPA 5IZFA 5LMKA 1H8FA 2R3JA 4XP3A 4OTFA 5EM8A 4NWMA 2CJMA 5HX8A 1F5QA 2UVXA 2YDKA 4FGBA 4LUDA 3IGGA 2PMLX 3ZRKA 3ZS5A 4CLJA 3ALNA 5A54A 3QD2B 3ZBXA 3QRKA 3IG7A 1XH8A 5CSHA 3RJCA 1FMKA 3R6XA 4KIKB 5LQFA 3ORTA 4NKAA 4J97A 3F3UA 4Q2AA 4GFOA 4RIYB 4I5CA 5ANOA 4ANNA 3QWJA 4BVUA 5BNJA 4RVTA 4UZDA 2VTTA 3FC2A 5AP5A 3FE3A 5FP6A 1UWJA 4ZY5A 2CCHA 3QAME 1PMEA 5HG5A 5CU3A 2R4BA 4ENXA 3RMFA 4ACGA 1M52A 1XH6A 4KAOA 3TG1A 4F1TA 4CT1A 2BPMA 2J6MA 2P2HA 2PVMA 2Z60A 4FG9A 3ZZEA 5I9ZA 2XKEA 4ZJVA 3BWJA 1H0WA 4RX5A 3K54A 4IHPA 4E5BA 4V0GA 3F5UA 3U4UA 3VUDA 4XH6A 2F49A 3O71A 2C30A 4RWJA 4DLJA 3MESA 4QP9A 3R83A 4RA5A 4LOQA 4XOYA 2QKRA 4IJ9A 2RG5A 3MS9A 1H0VA 4LG4A 4U80A 4WUNA 1YOMA 5H3QA 5EM7A 3ZMMA 4IB1A 3NYVA 4AN9A 4D58A 3GOKA 5AJQA 3D5UA 1KV2A 4L46A 3DBDA 5CXHA 3CCNA 3BV2A 2UW6A 2WMBA 2ESMA 4FV8A 2PVFA 3E92A 4MQ1A 5I3OA 5J7BA 4O0WA 3RAKA 3Q4TA 3GEQA 3CR0A 3MN3A 4KIQA 2UZBA 4TWPA 5LVPA 4FC0A 4BCKA 3FWQA 5HE0A 2SRCA 2VWZA 4FBXA 4QP7A 4B8LA 4ENYA 3JVSA 4FGRA 4J8MA 2YM7A 5AA8A 3QD4A 3QQJA 2RFNA 3I60A 4WG5A 3DGKA 2QOLA 3EMGA 3NIZA 3WI6A 2VWWA 4NM3A 3BLQA 5LOHA 2OKRA 5M4IA 4TYHA 5ACBC 3AC5A 4D55A 4YUQA 2YIWA 5TF9A 1JBPE 4QYEA 3C7QA 5HX6A 3PP1A 3CEKA 5IMEA 2DS1A 5HEZA 4RC2A 2Z2WA 3DY7A 5EOBA 3PP0A 5AUXA 4KSPA 3EZVA 5IA5A 3VJNA 3HEGA 1E9HA 4QTCA 3U9NA 4GFMA 1SM2A 4ACDA 3OXIA 4F7JA 4IZAA 4X21A 4QT1A 2REIA 3VBTA 4F9AA 3MIAA 2VAGA 4FTIA 4U45A 3MFTA 4NJDA 4GS6A 4NYEA 4YC3A 3MH1A 2CKQA 3MTFA 5M57A 4V05A 2HYYA 2UW4A 3AT4A 4IIRA 3CTHA 4O6LA 3HV7A 5HIDA 5DOSA 1ZY5A 3LXNA 4L7FA 3TACA 2J0JA 4O96A 4D1XA 5AUTA 1WBTA 4WA9A 2YCFA 3V5WA 2RFDA 2VTNA 1KWPA 5DT3A 1P4FA 3UIUA 4WNKA 3DKFA 2IN6A 2OH0E 2CLQA 5M09A 2UZTA 2NNWB 3R1QA 4FTUA 5L2TA 3KVWA 5JMSA 2C6TA 4EK3A 4DC2A 5K0KA 5EHOA 4RMZA 3BYVA 4RWIA 4AT4A 3UBDA 1BLXA 4OR5A 2GCDA 3VBXA 1URWA 4M0ZA 4O0RA 3VUTA 4BKJA 2Y4IC 2VWBA 4WG4A 1REJA 3FQSA 3TCPA 1O6KA 4ZJJA 4FTTA 2O64A 4ITHA 4D4SA 4CNHA 5M06A 2OI4X 2UW5A 2HZ0A 4WD5A 3COMA 3RK9A 1QPCA 5IDNA 4I93A 1FVVA 2GTMA 3H10A 3CGOA 4RG0A 2XK4A 2XNGA 2PVJA 2R3MA 2GNGA 2R0IA 4FL3A 4MK0A 3TKHA 3VS3A 4DT8A 2A4LA 4AE6A 4KS8A 4LRMA 3R7EA 4ID7A 4NIFA 3KQ7A 4OGRA 2WPAA 3UVQA 2O3PA 2FGIA 3ZBFA 1U5QA 5HG8A 4PPBA 3MA3A 3SW4A 4FI1A 4OTRA 1W84A 5IA2A 4Y46A 4B99A 3ZOSA 4E6AA 2ACXA 2HW7A 4FTCA 4U7ZA 4O0VA 4WBBB 3PY3A 3NW5A 4QTBA 1P14A 1VYZA 1BKXA 2R7IA 4EOOA 3ZFXA 1OL6A 4R3RA 3M11A 4BDJA 2VGOA 3HKOA 2WTKC 3KRWA 4GCJA 1YWVA 1BI7A 4ZEGA 4NT4A 5HIEA 3D83A 5H8GA 4DEAA 3UQCA 4AGCA 4QMTA 3E87A 2PMIA 3OVVA 4E8AA 3BHVA 4HYSA 4O82A 2PZRA 4L53A 4Y83A 2I0VA 3VUKA 5E4HA 2QO7A 3W33A 4TYIA 2J2IB 1U46A 2VTRA 4CGAA 5CAPA 4AZTA 3OCSA 4C7TA 4ZXTA 4DN5A 1WBOA 3PVGA 3R28A 3DAJA 2PZYA 1BL6A 5D7AA 3GCQA 3UGCA 1R3CA 4Y5HA 4GG5A 2OF4A 2GFCA 3U87A 3WZDA 5JKGA 3TDVA 3DDQA 4FKGA 4QMYA 1ZZ2A 3NNVA 3PLAE 2I7QA 5LVMA 4LMNA 4LOPA 2WZJA 4ZZNA 4JRNA 1UNLA 2W1GA 1XH5A 3FI4A 3BBTB 4QP2A 4XV9A 4BTMA 3KN6A 2YM5A 3I7CA 3ERKA 2CMWA 3NMUF 4FE2A 2O63A 2WU7A 3TNHA 2HOGA 4KIOA 3SV0A 3VN9A 4U3ZA 3PPJA 4X0MA 3W10A 5LMBA 5IQIA 2QR7A 3BLRA 5CT7A 4XG6A 3D15A 3R8UA 1ZYLA 3VJOA 3FMNA 3KMUA 4YZNA 5IEXA 4W9WA 5C27A 5I9XA 2C5NA 4FX3A 5AUUA 3Q60A 4RLLA 2QNJA 1TQPA 4AOIA 1UKIA 2WMAA 4LI5A 3VQUA 4UWCA 2YIRA 2QOBA 1OL2A 4RIWA 3BLHA 5AP2A 4DA5A 5CNOA 3UZRA 5CQUA 4AOTA 4FG8A 1WVYA 4C62A 4B8MA 4O84A 2XIYA 4G31A 1RDQE 2XK7A 2JGZA 3IW5A 5A4LA 5E8XA 5J79A 5C03A 2J5EA 3C0HA 4RC4A 4WKQA 5AUYA 4S33A 3EQFA 4IWDA 3ZO2A 4O7RA 2VO7A 4JVGA 4PRJA 2W9FB 3NUNA 3VBWA 2QC6A 3KRJA 2JKMA 4IWPA 4L43A 4RQVA 3ZLSA 5JRQA 5HOAA 2HXQA 4EK4A 4EC8A 1PJKA 3O8TA 5FD2A 3EN5A 3LLTA 5FXQA 4PPAA 3DXQA 3C9WA 4NM0A 1PXOA 4D9UA 5M44A 4DFZE 4IVBA 3EL7A 3MYGA 1YI3A 3ZEWA 3FXWA 5GJFA 4GIHA 3TN8A 3E63A 3Q9YA 3Q5IA 4LMUA 4DGLC 4U8ZA 4RSSA 1FVTA 4QRCA 5AAEA 3HVCA 3EQGA 3ZUVA 3S0OA 4QTAA 2ZMDA 4EKKA 4GVJA 3QF9A 3ZEPA 4DCAA 2PVRA 3I6WA 2XK9A 4TPTA 4TYHB 5K9IA 4OTDA 4YZMA 3O51A 4PTGA 4A4LA 4JQ7A 3QTUA 4EZ5A 3ELJA 5IUIA 3ULZA 4E6DA 1SVEA 2BTSA 2W5BA 4BCMA 4FSTA 4CFMA 4FKSA 4GYGA 3GENA 4PV0A 1XO2B 1G8SA 4K2RA 4JI9A 3QTRA 3NCGA 3W16A 5CEMA 2B55A 4MNEA 3W55A 1H1WA 1Q5KA 3SXFA 5KMLA 5BQ0A 3CY2A 4LFIA 5KHWA 3PJ2A 1LP4A 3G0FA 2ITWA 2IVVA 4XJ0A 3WBLA 5E9EA 1G3NA 5AIRA 3DV3A 5FLFA 1NVQA 1ATPE 1WVWA 3OROA 3ATTA 3V51A 4YJSA 4DITA 2WIPA 5F95A 3ZHPC 4L3PA 2W05A 3IPHA 3V3VA 5CS6A 4BDDA 2QR8A 5CI6A 5K5XA 1OI9A 4CMTA 4ALUA 3PIZA 3LFFA 4TKSA 1IA8A 4FKUA 3NUSA 4AN2A 4BKZA 3FSKA 4J95A 2YZLA 1OPJA 4R7BA 3OZ6A 4X3JA 4BGQA 3LXPA 3ORZA 4YPSA 3ORMA 4UWYA 2C69A 4BGHA 4BCIA 3MFSA 3OW3A 4ZK5A 3G33A 2W4KA 3VHKA 5J1VA 2GQSA 1QL6A 2IG7A 3HV3A 4ZTMA 4C2WA 5IPJA 2JIVA 2BAJA 3QCYA 3F9NA 3HV5A 4GT4A 4YP8A 3MVJA 1M2PA 4BDFA 4C4HA 2VNYA 2HW6A 4FKQA 3SRVA 4EWHA 2IPXA 3LPBA 3QTSA 5HE1A 3GUBA 3FBVA 4I4EA 4MYGA 4DYMA 3ORNA 3R9HA 5K0XA 4JBVA 1Q24A 2JDRA 3JYAA 2R2PA 5AV4A 4CFVA 4DFLA 5M56A 4R77A 1JSTA 3LFNA 3F2RA 2YJRA 1JKKA 4W9XA 3CBLA 4XBUA 5TOZA 3C4WA 4ALWA 4C59A 4HVDA 3ZYAA 5CVGA 2XZSA 3P9JA 3UC3A 4YTFA 5KMIA 4IFGA 1PXMA 2ONLC 3OCGA 2YAAA 4IAYA 3VNTA 3WF6A 3A7JA 4BWXA 4FVRA 2G9XA 5HTIA 1Y6AA 4IZ5A 3V6RA 2FH9A 2W99B 1KE5A 3GU7A 3PSBA 3KXMA 1IG1A 3QFVA 4ZTLA 2WMRA 3QZFA 4DH7A 3GT8A 5IA0A 3E3PA 3LQ3A 3FQHA 3W2RA 4TWOA 2UZLA 3L9MA 3HX4A 1V1KA 4D1SA 4DLIA 3ORKA 5EI2A 5AAFA 1H08A 4D4YA 3HMPA 3FHIA 3PJ3A 3OCBA 2PPQA 3A4PA 4TYEA 3A7FA 3N4VA 5EK7A 2CNUA 3GBZA 4EHZA 4I24A 4EOSA 2CHLA 3CPBA 4Z16A 2VD5A 2J0MB 4O27B 1JKSA 2R64A 5H8EA 4O7VA 3EN9A 1DM2A 2Z7LA 3MY0A 4DTKA 4BRXA 4ACCA 1YHSA 3TNIA 1STCE 3V6SA 3FLQA 5HLWA 5CVHA 3ENHA 4FZFB 3ZXTA 2F7EE 4WOVA 3LXKA 3WYYA 2V62A 2XBAA 3L8XA 2GTNA 3OT8A 4YO4A 4FEXA 3P1AA 3QZHA 2VO0A 4H1JA 2QLQA 4J8NA 3DT1A 3NNUA 3ITZA 4QMXA 4FVQA 4F08A 4Z55A 3WIGA 3CQWA 4ASXA 4MCVA 2OU7A 4OTIA 4UMUA 4UEUA 3RKBA 5AR7A 2VU3A 2ZM1A 4K8AA 4XG3A 3PTGA 1TQMA 5DYJA 1M2RA 4E4LA 4R7HA 3RM7A 3HAMA 5J7HA 4FNXA 4BDHA 4E3CA 3BE9A 4G1WA 1Q8WA 4TRLA 4DG0E 5CEOA 2XCKA 2FSMX 5E8ZA 4F6WA 5A4TA 3M2WA 3F88A 4ZLYA 1U59A 3G6GA 5C26A 3KL8A 2O5KA 3A60A 5EYKA 1DI9A 2PUIA 4ZS4A 3UJGA 2QD9A 4F09A 3E5AA 2PUUA 1QPEA 1WBVA 4XV1A 3THBA 1YI6A 2GQRA 3RP9A 2XKDA 5IKWA 3LZBA 5AV1A 1RW8A 4J7BA 1ZMUA 4EEVA 5EYDA 3RGFA 3WIKA 5IUGA 3LAUA 5K5NA 5KUPA 3FKOA 5J9LA 2QG5A 4GG7A 4OBOA 4ASDA 3KF4A 3MVLA 4RIOA 3ZO4A 2UZNA 4S32A 4KD1A 4PY1A 3O23A 4APCA 2WQOA 2WMWA 4GEOA 4EOMA 3CY3A 1OB3A 3PPZA 4X7QA 2OO8X 1KOBA 4E93A 5KKRB 4ZMFA 3UO5A 3ZLYA 4Y8DA 4XS2A 2HELA 2VO3A 2OXXA 3R9DA 3EQHA 4QQ5A 3W2QA 4JR3A 2PUPA 4KIKA 1CKJA 4FV1A 2C1AA 4JBPA 4YJUA 2YZAA 4RIYA 3EL8A 3OP5A 4WNPA 5CU4A 5CEQA 3RZBA 3VS2A 5IQCA 3DBQA 4IANA 2XYNA 1ZLTA 3NGAA 2EXCX 2IZRA 2B52A 4FTKA 3AC2A 1JKLA 4FT5A 4DINA 3Q6WA 3P08A 4UN0C 1GZ8A 1V0PA 1OUYA 4K33A 5HVYA 4HPTE 2XNNA 1OGUA 1AQ1A 2BFXA 2OBJA 5L8JA 4U42A 4FZ6A 4HJOA 5HNIX 2PWLA 3COIA 4HCVA 3V8SA 2WMXA 5DPVA 4AG8A 4PMPA 4KUJA 4MXZA 5EFQA 5FXRA 3FMEA 3FC1X 3NEWA 1OECA 2C5VA 3I81A 3QUPA 4JIKA 3ZLXA 4EBWA 1T45A 3FI3A 5I9WA 1M7NA 3DTCA 1J91A 3DAEA 5KNJA 3QLFA 1VEBA 4XV2A 4XG7A 4O7WA 1AD5A 1DAWA 5BVEA 5CANA 2IVTA 5CEPA 4FTAA 2BDFA 2OFUA 4AA0A 2B7AA 2Z7QA 4YZBA 3U51A 1VJYA 3DU8A 3VIDA 3QTIA 3EQIA 4A9YA 4BCPA 2VTHA 1IRKA 3DXNA 3LM5A 4G3GA 4J52A 4QMLA 4R1YA 1B38A 1YW2A 3Q9WA 4AGDA 5L8KA 2Q0BA 3GU6A 3LCSA 3BV3A 2B1PA 1W83A 2C5XA 3PYYA 4JG7A 1FBNA 3EZRA 1W82A 1XH9A 2W7XA 1OPLA 4LL5A 4CFWA 4KBAA 3WF7A 1NT2A 3UE4A 4I23A 4EQMA 4O86A 3OEFX 4CTCA 5DRBA 3SLSA 3SXRA 3UOHA 5GJGA 5DE2A 4CEGA 3MBLA 2EVAA 2IW9A 4BYIA 3KK9A 5BMMA 4GYIA 5HU3A 3TXOA 2OIQA 3E8EA 5LCKA 3QGWA 4U79A 5KMOA 4DT9A 4CYJA 2YHVA 3OBGA 4ANMA 4CV8A 2OW3A 3SRVB 3Q9XA 4RJ7A 4YJTA 5AUVA 5K4JA 3BI6A 4FF8A 2VO6A 2IVSA 4IZ7A 4QD6A 1PKDA 3F66A 4XLIA 5HE2A 2FYSA 4FYNA 4BF2A 3K3JA 3PXYA 3AD4A 3N51A 1YQJA 5JFXA 2B9JA 2UVZA 4I0SA 5HO7A 4H36A 4LL0A 5E8WA 3V8WA 1ZXEA 2WOUA 3QGYA 2ZDUA 3GC8A 2GNHA 4MF1A 4IXPA 4Z7GA 2ZV9A 5FM3A 3B8RA 5L3AA 4FEVA 4C33A 5AX9A 4CKRA 1M2QA 5EKNA 3UZTA 3GCVA 2G2IA 4QYGA 4FSUA 2C3LA 2ITOA 3FY0A 4K1BA 5CT0A 2WMUA 3C4XA 1CKIA 2W17A 3BBWA 4ASZA 5DT0A 3B8QA 4DEEA 4EC9A 5FEQA 3RINA 4JG8A 2JFLA 1Q97A 3JVRA 2C6DA 1PF8A 4GH2A 5IQDA 4FKRA 5D10A 2UZWE 4IVAA 4X6RA 4GJ3A 4I3ZA 4JIAA 2ERZE 4X3FC 4GV1A 3RK5A 4CYIA 4WRSA 5EQEA 1QPDA 4WSYA 3LIJA 3UMWA 4HYIA 4CFNA 1OBDA 5CXZA 3ANRA 3ETAA 3QRJA 3JR1A 2YDIA 4M7IA 2DUVA 5J9ZA 3IDCA 4BTKA 1OKYA 1OUKA 3HUCA 4DCEA 5A4EA 2G2HA 4AAAA 4Y85A 4BCGA 2ITYA 5AEPA 3DZOA 5H9BA 4NJ3A 5AV2A 2CPKE 5KX8A 4HW7A 2FSLX 5C4LA 4IX5A 3VF8A 4A9UA 1XWSA 4AW0A 3IW7A 4YHTA 2WTJA 4M84A 5CX9A 5EHLA 1RJBA 3PXFA 4ZSGA 2WEIA 4FL1A 3A7GA 2VWYA 3TTJA 1MQ4A 4FIGA 4J98A 2HCKA 3GB2A 4MXXA 5DGZA 3PG1A 2PY3A 3BZ3A 2NRUA 2ZYBA 2BR1A 2CLXA 2E9PA 2GMXA 2VN9A 5FXSA 3QYZA 4C4GA 1OBGA 2IZTA 3FHRA 3IQ7A 3W2OA 3CE3A 4R5SA 4EHGA 2JDVA 2Y6MA 4HCTA 2J0IA 5CY3A 3O96A 4WBOA 3U55A 5E8VA 5LVOA 4RWLA 1W0XC 1YI4A 4QMOA 1YWNA 3PZHA 2F2CB 2FUMA 1ZMVA 1XKKA 1KE6A 3CP9A 3CD3A 2XCHA 3MI9A 3KCFA 3O7LD 3SDJA 2UZOA 1R1WA 3F3WA 1VYWA 2QCSA 2XIXA 3HDNA 1ZWSA 4GT3A 5CWZA 2PE0A 4AWIA 4WHZA 3TKUA 4PP7A 4BCHA 3CXWA 5AP7A 5CEKA 3C5UA 2WGJA 2WMVA 3DLSA 1IEPA 4FTLA 4PL3A 4YR8A 3FLZA 4YO6A 4DTBA 4QMVA 1YXVA 2JBOA 5DMZA 4O7ZA 4PDYA 4P2KA 2QONA 4CXAA 3MFRA 4UMTA 4D4RA 4BIBA 3HYHA 4E5WA 1H26A 3AC3A 2BIKB 2R3QA 3DFCB 3TL8A 2XNBA 3HDMA 2UW9A 1XBBA 2WKMA 4GK2A 3L8VA 4M15A 4MAOA 4MXOA 3TI1A 2X81A 5AP6A 3ORIA 4EH3A 4D2WA 3CC6A 3R7IA 5H8BA 2HWOA 4FTRA 1ND4A 4ZSEA 5H2UA 2PK9A 4FIEA 4RRVA 4BL1A 4CMOA 5A6OA 4G6OA 3DKOA 1UNHA 4NCTC 4MD8E 4GKHA 2XK3A 3WYXA 1Y6BA 3PE1A 3BCEA 2JDTA 4O81A 5J5SA 4RPVA 2E9OA 3OTVA 5CAVA 3QD0A 3KKVA 1GIJA 3VQHA 5C4KA 3T3VA 2ERKA 5KZIA 4EOQA 4XHKB 5LWNA 1YXUA 2VTMA 4JQ8A 3BRBA 3BQCA 4BWPA 2VWUA 2RGPA 3R1YA 4MF0A 4ZTQA 4RGJA 5HG7A 3FKNA 3L8PA 3LFCA 4YHJA 2PL0A 2A27A 3G0EA 2R9SA 5E8UA 4LUEA 3KRRA 3FDNA 3PXRA 4PUZA 2QOQA 4C3PA 1UWHA 2C1BA 4TWCA 3UDBA 3M1SA 4W4YA 5DIAA 4WT6A 5HQ0A 3D5WA 3AD5A 4J1RA 1PYXA 4MBLA 3SHEA 4XRJA 3BQRA 1ZZLA 4LYNA 3RTPA 3K2LA 2BTRA 4LV5A 3NW7A 2JKOA 1U54B 1WCCA 2BRGA 4IAIA 3FI2A 1YXTA 4L3LA 4LGDA 4M97A 3WZUA 5KBQA 3SG9A 4NU1A 2YAKA 3QA8A 2VTIA 3D5VA 3MGYA 2BDWA 4F0FA 2WTVA 5HICA 3DKCA 3EFLA 3PWDA 4TXCA 3IGOA 3MA6A 3R02A 4XP2A 5E8TA 4RC3A 4EK5A 3OY3A 4KKHA 3ATSA 4D2SA 4IC8A 3ZCLA 1GOLA 4FYOA 2UZDA 2Y8OA 4F99A 4BB4A 4ORKA 1WZYA 3V5JA 5EG3A 2GS6A 3PY0A 3KREA 4IFCA 5DR6A 3OWKA 3MTLA 4FV3A 5BVFA 4ZIMA 5J9YA 3AC8A 4C4JA 2C6EA 4JJRA 3R63A 5EYCA 5LMKC 5A6NA 2QU6A 3FYKX 4O7NA 4RIXB 4XX9A 4JXFA 4X2JA 1QPJA 3R1SA 4YNOA 5HG9A 4AACA 1KOAA 1R39A 3ACKA 4KBCA 4NKSA 5HCZA 3QCSA 5KHXA 3DBEA 2XK6A 3EHAA 2V5QA 4BDGA 4ZSAA 3AC1A 4II5A 4AGWA 1E1XA 3TV6A 5BUEA 2P55A 3MH2A 4HNIA 1M17A 4G16A 2WTDA 3UNZA 1GAGA 4FTMA 4FEWA 4RX8A 4BC6A 5E8SA 4TNDA 4BCNA 1ZYDA 3G5DA 1PMUA 2XNMA 3ULIA 3G9NA 1FINA 3AGMA 4OTGA 3KCKA 2V0DA 3FZOA 4F7NA 2XBJA 3H4JA 2UW7A 3R7UA 3FZPA 3U6JA 3FLNC 4ZSJA 2R3PA 2VTAA 2XP2A 3NPCA 4EUTA 1BI8A 1YDSE 1XHAA 2PYWA 3FXZA 5BYZA 3W18A 5FTQA 3MY5A 4IWOA 2ZB1A 2IW8A 4M67A 4BDIA 1UKHA 1JOWB 2C6LA 2B54A 5J87A 4O91A 2UW0A 3LFEA 2QHNA 3MIYA 2LAVA 3FUPA 4OW8A 3Q6UA 3PWYA 2HZ4A 4RX9A 4QP6A 2BRHA 4FIIA 5GNKA 1XBAA 4XRLA 4DGOA 4EHEA 3UVPA 2WAJA 2ITVA 4L67A 4R6VA 3H9FA 4EBVA 3ZSGA 3MFUA 5HIBA 2E9VA 4ZLOA 5JEBA 1PXKA 3LE6A 4EKLA 3FZRA 2H34A 4E6CA 5FEEA 5M51A 1IR3A 3BHYA 5M55A 2P2IA 3S3IA 3AG9A 3JUHA 3PY1A 4N6ZA 2GDOA 2QODA 4RZVA 5G6VA 5L2IA 3SD0A 1FGKA 4FSRA 3NYXA 2J90A 3RCDA 5CF4A 1TQIA 1VZOA 3FPQA 2C6KA 3F7ZA 2JDOA 4M8TA 3CSVA 3GXLA 3H30A 2VUWA 5M08A 4BDAA 2UV2A 1G5SA 4WRGA 1XH7A 3OF0A 1WBNA 3OMVA 1JSVA 3K3IA 3L8SA 3OD6X 5FGKA 4BDEA 3RALA 4RFZA 2QLUA 5ETAA 2ITTA 3G6HA 3OUKA 1TVOA 2RG6A 4I5HA 3E3BX 3KULB 3P7AA 2XNPA 4BHNA 3P79A 3QXPA 4EOIA 2QKWB 3CGFA 2OZAB 4YJRA 4XUFA 5EI8A 4AGUA 3GCPA 3OTUA 4FV0A 3E64A 4YJNA 3NX8A 1ZOHA 3ZTXA 3LQ8A 4QYFA 4C3RA 4G9CA 2C3IB 2WEVA 2VRXA 1JPAA 3LXLA 2CNVA 4E4NA 4L8MA 1J7LA 4L42A 4AZFA 3F7WA 3MVHA 5JFVA 1GNGA 3KB7A 2PVHA 4YU2A 5A14A 1SVHA 4QMZA 3CKWA 3H3CA 3RVGA 4C3FA 3MY1A 1GZNA 4I6FA 4FKWA 3DK7A 3PXQA 2F2UA 5IISA 3VAPA 3FLYA 1Q8YA 4R1VA 4BZOA 2YLEA 4LRJA 4F7SA 2R7BA 3DK6A 4YC8A 4DFYA 2WMQA 3HMOA 1LEWA 4NW6A 4RJ4A 5KCVA 2HXLA 3QQUA 4XCUA 3UO4A 3NZ0A 2XNEA 3V8TA 1WBWA 4MXAA 4XLVA 4LV8A 3R00A 4AE9A 4JBOA 4HOKA 2O2UA 2W1EA 3GI3A 2JAVA 3V5QA 3UPZA 5LARA 3UNKA 2XRWA 2Y9QA 1V0OA 2QO2A 2Y4IB 1Q8TA 3A8XA 4X2NA 1MRYA 4EUUA 5L6PA 2IZSA 3D5XA 4Y72A 4C0TA 5KBRA 3PJ8A 5L6OA 3HLLA 4D5HA 2XUUA 5DG5A 1Q61A 4H3QA 4CG8A 2YDJA 5BMSA 3DA6A 4CG9A 4F1MA 1O6YA 5D7VA 2ONLA 3BYOA 4Y95A 4D5KA 1P5EA 5E90A 3IS5A 4XV3A 1ZOEA 2BZHB 3BEGA 3NAXA 3K5VA 4JOAA 3G90X 4V04A 5HVJA 4EZ3A 5IDPA 3GP0A 2O65A 4FV4A 3AT3A 4FKJA 5J8IA 3VUHA 3TWJA
chains in the Genus database with same CATH superfamily
3FZSA 3COKA 4FSNA 4YTHA 3R7YA 3SQQA 1A48A 3TUDA 1EH4A 4DBNA 1VLRA 3VS0A 3R30A 5HESA 2WTKB 4HZSA 3KRLA 3ORLA 2QHMA 2PZPA 3C4EA 2PMOX 3ZDUA 4CRSA 3NUXA 2X8IA 4IAKA 2ZB0A 2H9VA 1Q4LA 4FEQA 4O0SA 3F2NA 4CFXA 3ENMA 3NUAA 3ZO1A 4ZJIA 1FPUA 4EYMA 5AR3A 3ZRMA 4QDVA 5CF6A 1W2CA 4GMYA 1Z9XA 3RBWA 4MD9E 4F9BA 3I0OA 5HHWA 2I6LA 3CJFA 3QHRA 2VTOA 3AOXA 4O2PA 5EI6A 3NWWA 1TKIA 2VWVA 2UZEA 3ORXA 4U81A 2R3NA 4P90A 3QHWA 1J1CA 1H00A 4R5YA 2VNWA 5ANIA 1PXPA 1UU3A 1DAYA 3T9IA 1KUTA 1F0QA 2VV9A 4QPAA 1U5RA 3IONA 2FO0A 4AS0A 1YHVA 4BZNA 1Q8ZA 3OOGA 4PMSA 4IJPA 5DRDA 2WQNA 1PHKA 3SW7A 3KVXA 1LPUA 4EQCA 5FBNC 2G15A 5IEYA 3R04A 1PW2A 4M66A 2JC6A 3RNIA 4K0YA 1CMKE 1YHWA 4R8QA 4U6RA 3SAYA 1BUHA 5CU0A 3NNXA 3POZA 1SNXA 1I44A 3HP5A 4J53A 4DTAA 1ZYJA 2E2BA 5GZAA 1TFFA 4H05A 1H27A 4JBQA 3BHTA 5HO8A 5LXMA 2B9IA 3LCKA 3VS6A 4JX7A 4BR3A 2I1MA 1S9IA 3MB7A 3ODYX 3NYOA 4G34A 3WZEA 5C01A 3ZU7A 4DH8A 3AD6A 1WBPA 4KABA 4ANLA 3PA3A 2C3KA 3QX4A 3DJ7A 2DYLA 4RJ5A 2B4SB 4IB3A 1YDTE 2XIZA 3UG1A 2GS7A 5E1SA 1XR1A 2BDJA 1BX6A 5T68A 1SNUA 4X2FA 4BFMA 2WTWA 4JLCA 2ITXA 2RL5A 2P33A 4L7SA 4KA3A 2XM9A 5IU2A 3S1HA 3EFJA 3RHKA 3D94A 3TNWA 1Q99A 3BHUA 2XB7A 5EM5A 4MBJA 3WE8A 3BU6A 3EFWA 1YOLA 5D1JA 3LFAA 3PFYA 2WU6A 3WARA 2GNLA 3AT2A 5K3YA 5IUHA 4LGGA 1T46A 2CKEA 3C1XA 3D2IA 4D2RA 3WOWA 5JZJA 3FMKA 1Q8UA 2F7ZE 4FTJA 3ROCA 5A4CA 3ZO3A 4O4DA 3D7TB 3R21A 2GNJA 2OIDA 3DTWA 4ITJA 3ZSIA 3EN4A 4E1ZA 3PA5A 1ZY4A 4IM3A 2X9FA 4QPMA 3CTJA 4DEHA 4U41A 4I1ZA 2V7OA 2ZV8A 2R3HA 2OJ9A 4QMQA 5B0XA 3ML1A 2OH4A 3DJ6A 2XA4A 2IZUA 4O4BB 4XBRA 1ZMWA 2C4GA 3DQWA 4UWBA 3IDBA 2PE2A 3ZUTA 3AC4A 5FDPA 1YVJA 4P5ZA 1Q3DA 2PVNA 3V04A 4AQCA 2NO3A 1H4LA 3FMJA 3ZLWA 3NLBA 4S30A 1WAKA 4Q9SA 2JKKA 4ZTSA 1SZMA 5M4UA 4FKPA 2I0HA 3QZIA 2QURA 3NVKI 2R0UA 1Y8GA 2V55A 1XQZA 3ACJA 4GJ2A 1NW1A 3HRBA 2YLFA 2WELA 3D14A 4GUBA 4AZSA 1Y8YA 4O4EA 2VGPA 3DKGA 3F2AA 4UMQA 1I09A 4FK3A 3F69A 5AP0A 4IBMA 3FAAA 3TNPC 3ZSHA 2W1IA 4MNFA 3S95A 4CV9A 2OLCA 1MQBA 5FTOA 5L4QA 3E8NA 1CM8A 4X2GA 2CGWA 4OTHA 3QQLA 4J71A 4XOZA 1ZYCA 1IAJA 4O21A 4O1OA 5KMNA 1J3HA 2XIRA 3EKNA 1OKVA 3VRYA 4APPA 3Q9ZA 4DHIB 2UW3A 4ANQA 3EIDA 4FNWA 2YCRA 4E73A 4EOJA 4CLIA 4XG8A 3LJ1A 5FRIA 2RFSA 4G5PA 3RAHA 4I6QA 4HVIA 5E91A 3WZKA 3DB8A 4CT2A 2X7GA 2GU8A 3O5AA 3UODA 4C38A 5E7RA 4KKEA 5EM6A 1H1PA 4EH5A 4MVFA 3PLSA 4JMQA 5IQBA 4DE4A 4RFYA 3LOKA 2C47A 3CTQA 4G3EA 2XF0A 4FTNA 3ZXZA 4F78A 3R7VA 3LCTA 3PXZA 2H6DA 4RQKA 3VS4A 3I0QA 2XH5A 3EQBA 5KMJA 5EW3A 5ANDA 4ZTHA 1S9JA 2W9ZB 3ZFYA 4AAYA 2X4FA 4L6QA 1XJDA 3PG3A 5BPYA 1APME 5E1EA 2GHLA 4YZDA 2RFEA 4R78A 4BICA 1FMOE 4YSJA 5HBJA 5ITAA 3PVUA 4BJJA 5GIPE 3NAYA 2A0CX 2Z02A 3FMMA 4WNMA 2YM6A 3ZH8A 4WO5A 2QG7A 2QOFA 4PDOA 4B9DA 5F9EA 4U3YA 2EB2A 2Y6OA 3ROYA 4FT3A 4DF3A 2R3IA 4HNFA 4EH8A 3PDTA 4NK9A 4AUAA 2GPHA 3I79A 5A4QA 4W4WA 1U4DA 4M69B 3A7IA 1CTPE 4G6NA 4JX3A 2G1TA 2W4JA 4DEGA 1X8BA 4A4OA 2F4JA 2WB8A 3D2KA 3FKLA 3GQLA 5D12A 5CEIA 4DFNA 3LMGA 4CKJA 5I4NA 4N57A 1HCKA 2YEXA 3LJ2A 4F9CA 4O0UA 2H8HA 4YJOA 5KO1A 3COHA 3EB0A 4W4VA 3F5XA 3NR9A 1J7IA 4HGEA 3BIZA 4BIEA 2E9UA 4QPSA 5HCYA 4QP4A 2BRNA 5E92A 2PUNA 1OITA 2ZMCA 4I5PA 4JRVA 1JKTA 4L00A 3FYJX 4FT9A 1U54A 2XRUA 3T8OA 4QO9A 4YZ9A 5IA1A 5LVLA 2X6DA 3PRIA 3S00A 1OZ1A 2PVLA 3E8DA 2GHMA 3QC9A 4ITIA 4NL0A 5TT7A 4GKIA 3QKKA 3VVHA 3LCOA 1REKA 3OBJA 4FKVA 4IX4A 3UYTA 5HTCA 5CU6A 3JXWA 5C9CA 1ZOGA 4RFMA 3R22A 1OMWA 3P23A 3BWFA 4O2ZA 3W8QA 4BBFA 2W1CA 2NPQA 3H9OA 3HRFA 3MJ1A 4BIDA 3VC4A 4IB0A 1MP8A 5JGAA 4EZ7A 4JDHA 1M14A 1WBSA 2R3KA 4EH4A 1H1RA 3KXGA 4G9RA 3OC1A 4FT7A 4FKTA 4IAZA 5HBEA 5HNBA 3FV8A 4O7TA 3UPXA 3IO7A 4I0TA 5DVRA 4RIXA 2B9HA 5FWKK 4RLKA 1SVGA 5J1WA 4UYNA 3HAVA 1JWHA 4IW0A 3RCJA 4L52A 4NFNA 5B7VA 2EXEA 3O50A 4YJQA 3CQEA 2QI8A 4NEUA 2EU9A 3QRTA 3QU0A 2VWIA 2X0GA 4QEBA 3W1FA 2XNOA 4AXCA 1NY3A 3VW6A 2YWVA 2J5FA 3EQDA 3KRXA 2A2AA 2QVSE 2YISA 1DI8A 4I6LA 3GU8A 4AW1A 3OCTA 4OTPA 4EHVA 4K9YA 5E8YA 3CKXA 5JGDA 5BVOA 4RJ8A 5CZHA 2Q0NA 5AUWA 3RI1A 4CRLA 5HU9A 4NSTA 1PXIA 4EI4A 4JDJA 4Y73A 2WTCA 1PXJA 4AZEA 5CASA 3EYHA 3DXPA 5AADA 3UVRA 4JAIA 3BL9A 4EOLA 4FOBA 4NM5A 1JSUA 3C4FA 4IE9A 3FSFA 2BALA 5KZ0A 2A19B 2ITPA 5AR4A 3R0TA 1NVSA 4QP1A 3W0OA 5AMNA 2A1AB 3Q96A 4JR7A 4P7EA 4EOKA 5TE0A 5CSXA 2BKZA 5BVNA 3EKKA 4I92A 1OPKA 4KINA 3U54A 1KSWA 4G3DA 3VS5A 4BDKA 4JQEA 4XYFA 1F3MC 4QQCA 4RWKA 1KE7A 2OGVA 5D9HA 5L6WL 4ERKA 4IB5A 2HK5A 4MD7E 2IVUA 4H58A 4PWNA 4PNIA 3KXNA 3ZC5A 3QKMA 5KE0A 2F7XE 4JDKA 5T6KA 4H3PA 4KIPA 3OFMA 2X2LA 4MWIA 3Q2MA 1W7HA 2QO9A 3CS9A 2WOTA 3QZGA 3NUUA 3KIOC 3TZ7A 5AA9A 1GIHA 2W5AA 4C37A 4FV2A 2BZJA 3W2CA 4ZTRA 5B2KA 3MW1A 3DNDA 4CSVA 4KNBA 1L8TA 2HY81 3AMBA 3BGZA 3MDYA 3GNIB 5A3XA 1YRPA 5EH0A 4IZYA 5FBOA 4AXDA 2Y0AA 3MPMA 4GL9A 5L2QA 3TDWA 5BV3A 4FOCA 4I22A 3Q3BA 4A9RA 1PKGA 4FV6A 1WVXA 3C50A 2OSCA 3F3ZA 4G5JA 4D9TA 5EOLA 2O0UA 1OIRA 4ZTNA 5TKDA 3KULA 2OJIA 3R9NA 3IOPA 5DEYA 3TT0A 1E1VA 2JD5A 4FZ7A 3AGLA 3VS7A 3C0IA 3AXWA 3BU3A 1RQQA 2BILB 2OXDA 3CPCA 3QC4A 4WG3A 2VTQA 2OZAA 2AC3A 3FL5A 4E26A 4NM7A 1M7QA 2ZVAA 2E9NA 4IACA 3B2TA 4NTTA 5DWRA 4ANSA 4HVGA 3KY2A 5LJJA 5HD7A 5TR6A 3CIKA 4AQKA 4AN3A 3CJGA 4K11A 2YIXA 3W0MA 4JL9A 2WQEA 5FEDA 4E6QA 4RJ6A 5FG8A 3SOAA 5HCXA 3C51A 3LFDA 4EK8A 2C5OA 3Q4ZA 3QWKA 1UU7A 3FLWA 5CSVA 3PJCA 2C0OA 3I7BA 3W32A 2BKKA 4XMOA 4IM2A 3AMYA 4Z7HA 4XG2A 3DZQA 5LCJA 2XALA 5G1XA 4BYJA 2ZDTA 4LQMA 5EQPA 3IW4A 4W4XA 3UP2A 1P4OA 1Q62A 3KF7A 3NRMA 4A7CA 2PSQA 3HA6A 3KN5A 4S2ZA 3WF5A 4M14A 4Y5QA 4D2PA 2RSVA 4K77A 4M0YA 3LLAA 4UALA 5DHJA 3T3UA 3W2PA 2BRBA 5BVWA 5HORA 3R1NA 4U97A 4DHZA 2OF2A 3R8MA 4LOOA 4HVSA 3FMHA 4FR4A 4YMJA 5ANGA 4IDVA 4PP9A 3FI8A 1GZKA 3ET7A 3SOCA 3BX5A 3ZFMA 1QCFA 4X3FB 5BUJA 1UA2A 2JEDA 4IVDA 5CNNA 3IW8A 3A99A 1OVEA 3QRUA 2BFYA 4YJVA 2XK8A 3TUBA 2WD1A 2Q83A 4QMNA 2XKCA 4LM5A 2RKUA 4I5MA 3W2SA 5IQAA 3PIXA 2V7AA 4D0WA 4UB7A 3LMHA 4UMPA 2BAQA 3LMIA 2YITA 3PFQA 4G3CA 1SMHA 4MTAA 3GFEA 5ANEA 3V5LA 3W8LA 3ZUUA 4D2VA 4DH5A 4FZDB 2B0QA 3MPAA 4N6YA 3BGPA 1JLUE 1PYEA 1GZOA 1A06A 4FNZA 5HI2A 2VTLA 2XIKA 4QNAA 5JFSA 3EN6A 2CGVA 1OL7A 3GU4A 3LM0A 3R2BA 4RVKA 1JNKA 3LFSA 4AF3A 1NVRA 5C8MA 1DS5A 3JS2A 3UTOA 3MB6A 3GC7A 2CGXA 4UZHA 4UY9A 5JT2A 4YLLA 2VZ6A 3F3VA 3FQEA 4U40A 4BCJA 4P4CA 2KULA 5EW9A 5JGBA 3NFGB 4A07A 3R7GA 5LMAA 4QMMA 1V0BA 4F7LA 5C8KA 2PZIA 3G9LX 4DH1A 4FTOA 3EQCA 4LDTA 3IK3A 2ETRA 3KA0A 4IC7A 5HGIA 3FLSA 3RHXA 1IAHA 2R3RA 1GY3A 1OIQA 2JIUA 3EN7A 4USDA 3R8PA 4FTQA 2Y7JA 3QCQA 4M3QA 4WSQA 1R0EA 4JS8A 4FKOA 1MUOA 1KE9A 2IJMA 3OHTA 3PSDA 3TV4A 4MEDA 3UIXA 4QYHA 1H25A 3E7OA 2OIBA 3BLAA 4N70A 4DGNA 4BDBA 5HD4A 2DWBA 4DHFA 1XMMA 3GC0A 1PXNA 1Y91A 3E8CA 3PUPA 4YLJA 4F9WA 1ZARA 3LKMA 1OIYA 2CGUA 3S2PA 4TNBA 2OJGA 5CYIA 5CSPA 4E4XA 3II5A 3NUPA 5A46A 4AT3A 3CQUA 3R8ZA 1YKRA 3FMLA 4C4EA 3A2CA 3UG2A 2NP8A 3HMMA 4OTQA 3WZJA 2ZFYA 4HYHA 1K9AA 2RIOA 4CCUA 4TYGA 3QQGA 3TNQB 5CLPA 4CZUA 2YERA 2ZAZA 4S34A 4PTCA 4ZLZA 2YFXA 4KRDA 5AM6A 5HKMA 3QLGA 4IX3A 4YBJA 2VX1A 3R01A 4ZP5A 2X9EA 4CVAA 2UZUE 2JDSA 4ZZMA 2GNFA 3GQIA 4I21A 3WF8A 2WFYA 3H9RA 3QD3A 4J96A 2X39A 3Q04A 1H1SA 4FIJA 4MX9A 2JAMA 4EH7A 5I5ZA 3D9VA 5AP3A 3R71A 3R8LA 3R2YA 3ZDIA 4MBIA 4O7LA 4PPCA 4E5AX 1AGWA 1XBCA 5C8NA 3F5GA 3BHHA 4KSQA 4FODA 2HWPA 4IDTA 3WILA 1OKWA 1CSNA 2HZNA 3NS9A 3IKAA 3O8PA 4NH1A 4O0YA 2J7TA 4F63A 3DB6A 3BE2A 1L3RE 3B2WA 1LEZA 3R9RA 3O0GA 4UYAA 4I20A 3UNJA 4TT7A 5AP1A 2PE1A 3OUNB 3PXKA 3SXSA 5JSMA 3DLZA 4YHFA 4BI0A 3HL7A 3QQHA 3C0GA 4D28A 5I9VA 3MV5A 2EB3A 3D7TA 5AV3A 3FMDA 4HGLA 3U4WA 4QTEA 3DOGA 2BROA 4FV7A 5JZNA 2XM8A 2C5YA 4BBEA 4EJNA 2W96B 4QMPA 5ETFA 3DBCA 3NIEA 4ONAA 3VUIA 5M4CA 4IH8A 5HTBA 3FZTA 2ZV7A 2GSFA 4GU9A 2HIWA 3QL8A 3KMWA 2W5HA 3RAIA 4D1ZA 5KMMA 3CD8A 5EDQA 1VR2A 3MH0A 4GRBA 1Q41A 3VUMA 4F0IA 3SVVA 3JY9A 3C4ZA 3ZRLA 4QMWA 4QOXA 2PTKA 2XVDA 4XG9A 4YBKA 1ZRZA 5D41A 5BVKA 4FEUA 4KRCA 4G3FA 4TTHB 3HRCA 4KBKA 5IEVA 2R3LA 2WMTA 4RJ3A 2CDZA 2X8EA 2PZ5A 3SKCA 3LJ0A 4CTBA 2DQ7X 4IAAA 5DFPA 5CI7A 1ERKA 5HLPA 4M13A 3GCSA 3OXZA 3U9CA 3LVPA 2XMYA 2ZJWA 2CN5A 3NYNA 5KMKA 2FB8A 4CCBA 3BYSA 3G51A 4W8EA 5L8LA 1PRYA 3EYGA 2QOOA 2VTJA 3LFQA 3PSCA 3ZZWA 2X8DA 2WQBA 3FL4A 4H1MA 3O2MA 2WO6A 5CSWA 4BTFA 1H24A 4RVMA 1CKPA 5HZNA 4FMQA 5L2WA 1G8JA 2XJ1A 5I3RA 4DH3A 3TIYA 5A9UA 4Z9LA 4QTDA 4C02A 3RPOA 4L45A 4MXYA 4RZWA 4A9TA 3G15A 3MJ2A 4IM0A 4J99A 4AP7A 3POOA 4AA5A 4FV5A 2W1FA 4DAWA 1A9UA 2Z7RA 3UO6A 3UOJA 3DK3A 3H0ZA 5F94A 5IQFA 3SA0A 2WNTA 2J4ZA 2BRMA 2BZKB 3DFAA 4GFGA 4OBQA 4R7IA 4YJPA 5IQEA 4UXLA 2OK1A 3DJ5A 5AP4A 3KMMA 3TJDA 1BYGA 3FEGA 2JIIA 1YXSA 4G17A 2ITQA 2IW6A 5ETIA 4M68A 4XP0A 3T9TA 4BCFA 5HE3A 4DEDA 1LR4A 4F6SA 2QOIA 5IF1A 3P7BA 3HGKA 2R3GA 2X4ZA 3D4QA 1OL1A 3JY0A 2H96A 2KTYA 3N9XA 3OXTA 3ZM4A 4V0GB 2BVAA 2X6EA 4BCOA 4I94A 5B2LA 4EH9A 3GFWA 5JK3A 3LFBA 2YM3A 3P5KA 5DBXA 3I1AA 4G6LA 4PL4A 3E62A 4U0IA 3NVMB 3RK7A 3Q2JA 2YM8A 2LGCA 4I41A 4USFA 3BYMA 3OWLA 4BBMA 4MH7A 4ERWA 3UP7A 1NA7A 3P0MA 3P78A 2OJFE 2JKQA 2QU5A 4QP8A 4FV9A 3NW6A 1KV1A 4KWPA 2BUJA 3N4UA 4M69A 3BKBA 5EW8A 3KU2A 3PE2A 4NZWB 3QYWA 4FUXA 5AR8A 4YC6A 3QUDA 3PUFC 5CU2A 4ZMEA 4MQ2A 5EDRA 5F4NA 3O8UA 4ASEA 4F65A 3FJQE 4FK6A 5ICPA 4EJ7A 3OT3A 5BYLA 1FVRA 4IAFA 5FTGA 4DFBA 4PF4A 1J7UA 2ZV2A 3BELA 3ZC6A 5CAUA 1W98A 4WUAA 4DDGA 2W1HA 4TW9A 3TTIA 1NXKA 3EQRA 4A06A 4EOPA 3A62A 4U43A 3RZFA 4UMRA 4F1OA 3LW0A 1FOTA 4AOJA 2PMNX 4GK4A 2XAMA 3DAKA 4EYJA 4FUYA 5DR2A 4I6BA 4N0SA 4IVCA 4JG6A 2F57A 4DEBA 1QMZA 4YURA 4PTEA 2X2MA 5TO8A 4F70A 2VX0A 2CKPA 2B9FA 2GNIA 3F82A 3UIBA 3QTXA 3CLYA 3NSZA 4NTSA 4F4PA 1W8CA 5DI1A 4UXQA 4BKYA 3SGCA 2CNQA 2YN8A 5IA4A 3LQ5A 3RPSA 3U8WA 5M07A 5GZ8A 5KKRC 4BY9E 2PVYA 3C5IA 2QOHA 4G2FA 4GUEA 5BX0A 3P86A 3PPKA 3ORPA 3A7HA 2YWPA 4PX6A 4I6HA 2FA2A 4U9AA 4CQEA 4OAUC 4XNEA 5AAGA 3AQVA 3JPVA 4PDPA 3QUEA 3VBQA 1BL7A 1RE8A 1O9UA 2EUFB 4Z3VA 3K5UA 3C4CA 3HNGA 4HGSA 3DNEA 1UU9A 3PRFA 3I5ZA 1HOWA 4BI2A 3GVUA 3QBNA 4CD0A 4PNKA 3DPKA 4ZS0A 5DNRA 4AW2A 2WMSA 2XKFA 3ANQA 4OT5A 4CFFA 3F61A 4A4XA 3OW4A 4OAVB 3E88A 2ZOQA 3NDMA 2QOKA 4JAJA 2AUHA 4TYJA 1JQHA 2I40A 4FKLA 3RPYA 2PHKA 3F6XA 4FIFA 3FZ1A 5IH4A 4EORA 5ACKA 5EQYA 2YIYA 2P3GX 3RWQA 2XJ0A 1TZDA 2VWXA 3P5JC 5F1ZA 4O0TA 4LGHA 1FQ1B 2I0YA 4NIFB 4GVAA 2NYAA 2QOCA 2J0KA 4DG2E 3Q4UA 4OT6A 1B39A 1IA9A 3HP2A 3KEXA 4RX7A 4X6QC 4DGGA 4C2VA 4CQGA 4DGMA 2X1NA 4UBAA 5BVDA 1OKZA 4DEIA 1H28A 1URCA 3PA4A 3SG8A 5IQGA 1P2AA 4GU6A 4K18A 5C1QB 4Q5EA 2FVDA 5CF5A 5AUZA 2VTSA 2VX3A 3RWPA 2C0TA 2IWIA 2CN8A 3NCZA 3EQPA 2J9MA 2UZVA 4FL2A 4ALVA 3UYSA 5F20A 2BHHA 4X2KA 2C6IA 4BTJA 4C34A 3U6HA 4MKCA 1OM1A 4FSWA 5CQWA 3RPRA 4N4SA 5T3QA 3HA8A 3HV4A 3GOPA 2CCIA 3Q53A 3TUCA 1G8AA 1ZYSA 1PMVA 2G2FA 3L9NA 3KFAA 3MVMA 3OS3A 4EONA 4E7WA 2FSTX 3L9PA 3VBVA 4A9SA 1UV5A 3MH3A 2HAKA 4RBLA 5ETCA 4KKGA 4XG4A 4YZCA 5EKOA 2W06A 2YACA 5HVKA 2WIHA 4L01A 3UOLA 3C13A 3S4QA 4FSZA 4ZOGA 4ARKA 5BUIA 3VRZA 4FSYA 3UDTA 3MWUA 2QQ7A 1H1QA 4E20A 4MWHA 3TV7A 3VULA 4C36A 2PU8A 4QYYA 4F0GA 1PMNA 3TZMA 4IX6A 2Y4PA 2WQMA 3MSSA 4QQJA 5CENA 4UX9A 2HZIA 4V01A 3REPA 5AR2A 3R8VA 2HENA 2WXVA 3DS6A 5EYMA 4B6LA 5CALA 1YOJA 4PDSA 3E7VA 3QKLA 4W8DA 4O7YA 1IASA 3VUGA 1WMKA 3TM0A 3G2FA 4U44A 3EWHA 2O8YA 4HGTA 4NUSA 4AA4A 4I0RA 4TWNA 3FPMA 3AKLA 5HLNA 4H39A 4H3BA 4ZZOA 2BCJA 4QNYA 3I4BA 4GT5A 3VHEA 4AT5A 2YJSA 4QMSA 5K4IA 2GQGA 4JNWA 4NFMA 4O7SA 1BMKA 3DCVA 4YNEA 3BL7A 4EH2A 2C0IA 2ETKA 4LRKA 4RIWB 2X7OA 2J51A 4AU8A 4CMUA 5CF8A 1K3AA 3PVWA 3N4TA 4HYUA 5M4FA 5JQ8A 4AW5A 4XEYA 2W0JA 5L2SA 4GW8A 2ITZA 4I4FA 2EWAA 5I9UA 3ID6C 4AX8A 2P4IA 2ZM3A 5I9YA 5AV0A 3UC4A 4OTWA 3IECA 4O22A 3BPRA 3KC3A 4MXCA 4OBPA 3QTWA 3UIMA 4USEA 4O83A 1OIUA 1JVPP 4YPDA 3QTQA 4R3PA 3WE4A 2FSOX 5J95A 3A61A 3HMNA 3A8WA 2WTIA 2YCQA 3DDPA 1R78A 3UZPA 2W1ZA 3VWAA 5FP5A 3PIYA 5DT4A 4GSBA 3ZM9A 1UU8A 3OWPA 4R3CA 4X3FA 4ZY4A 3QA0A 5J5TA 2OFVA 2XEZA 3IOKA 5I0BA 5IQHA 4FNYA 4MHAA 5DH3A 4FT0A 5GJDA 3O7LB 2R5TA 2ETMA 4YTIA 2UUEA 1OGYA 2YCSA 4O0XA 3OG7A 4YSMA 4RT7A 5JFWA 3KXHA 4ANBA 2W4OA 3BEAA 3E93A 4EH6A 5FQDC 1WFCA 3GC9A 3UMXA 4B7TA 3A4OX 5IH6A 3O17A 3QRIA 4RA4A 2XS0A 3GU5A 4FSMA 1FGIA 3L1SA 3RNYA 3RPVA 4TL0A 2JITA 4PMTA 2GFSA 5B2MA 5CVFA 3UOKA 1Y57A 3GCUA 3QXOA 3V5PA 4ZY6A 3Q52A 2OZOA 3VW8A 4TZRA 3ODZX 4MNEB 3TEIA 3HMIA 3QQKA 4L68A 1HCLA 3QTZA 4FICA 4KS7A 4BDCA 2CSNA 5IH5A 1UNGA 3QQFA 4K6ZA 3LCDA 2IO6A 5HBHA 2Z7SA 4Q9ZA 5EDPA 3BYUA 3HECA 2J50A 4ACHA 2R3OA 4C61A 1YWRA 2Z8CA 4GIIA 4L3JA 5AM7A 3TKIA 5IMXA 2BAKA 5JQ5A 1UVRA 4GK3A 4DBXA 3ALOA 4IWQA 2OJJA 1K2PA 3F3TA 2X7FA 4U5JA 4O38A 2BHEA 5CTPA 3OEZA 4WIHA 5DLSA 1YDRE 2GS2A 4YGAA 4FVPA 4HCUA 3SX9A 2C6MA 3WF9A 4C58A 4HPUE 1LUFA 3D0EA 1R0PA 3MPTA 3Q32A 3TJCA 1OL5A 3OY1A 2PVKA 5GINE 3P7CA 4DFUA 3L9LA 4QQTA 3FY2A 2X0OA 4IEBA 5AR5A 3OWJA 3QCXA 3KXXA 1GJOA 3PVBA 2V22A 2F9GA 4QP3A 5CZIA 5ANJA 4AZWA 4ZSLA 2ITNA 3M42A 4JT3A 2AC5A 4O6EA 4OLIA 4IQ6A 3EH9A 5AWMA 4RVLA 4PMMA 4TY1A 4IADA 2C68A 4FSQA 4AFJA 1O6LA 3UQFA 4C4FA 4CZYB 1SYKA 3KXZA 2B53A 3R73A 3R9OA 3U6IA 2OWBA 5GIOE 3SC1A 5CAOA 3KK8A 2ITUA 2GHGA 5AIKA 2X2KA 2XJ2A 5FM2A 3Q5ZA 4ANOA 5HO6A 3BU5A 3QX2A 2AQXA 1JAMA 1MRVA 5CAQA 1YXXA 2ZM4A 2BIYA 4QMUA 4D0XA 5DEWA 5AX3A 2I0EA 4B0GA 5M53A 2OICA 3VS1A 4WNOA 2UW8A 3NUYA 4NW5A 4F6UA 5JH6A 1PY5A 4C35A 3BGQA 4F64A 3UQGA 5LVNA 2PULA 3FXXA 4NCTA 3W0PA 1GIIA 3EJ1A 3R7OA 4DFXE 4BCQA 1CDKA 5FDXA 2RF9A 4D4VA 4CFUA 4FA2A 3PZEA 3HUBA 2XEYA 1J1BA 5ANKA 2BZIB 2YABA 1PXLA 4TN6A 4EWQA 4AZVA 4ACMA 3V5TA 3HV6A 5BYYA 1MRUA 5HNGA 2EXMA 4E4MA 3D7ZA 4PL5A 4ZAUA 5IA3A 4F9YA 4M12A 4LV7A 3LHJA 3RM6A 2JLDA 2W1DA 3HZTA 3I6UA 3IW6A 2HY0A 4L9IA 2JFMA 1H01A 4S31A 4AFEA 5DN3A 3AMAA 5EHYA 4BN1A 3Q4CA 4FZAB 2J0LA 2WHBA 3DBFA 4FKIA 2OXYA 3TIZA 3ZONA 3DQXA 4BWKA 2BMCA 2YIQA 1H07A 4BZDA 4C57A 4AXAA 3H0YA 3NNWA 3P4KA 3I5NA 4EK6A 4L44A 3OOMA 4OUCA 4EL9A 4FG7A