3COKA

Crystal structure of plk4 kinase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
267
structure length
234
Chain Sequence
b'SLATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKESDVWSLGCMFYTLLIGRPPFDTDTVKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PLK4
publication title Crystal structure of PLK4 kinase.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 234
sequence length 267
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cokA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cokA01
3AXWA 2BHEA 1ZMWA 2F7EE 4O21A 4N70A 3NYNA 3QTXA 4XV2A 2PZRA 4FE2A 4FKPA 5KHXA 4F08A 2XK7A 5KX8A 3NSZA 4TKSA 1PXJA 3DGKA 4LMUA 4R1VA 5A6OA 5JT2A 3NNUA 3ZTXA 3U9CA 4R7IA 4CV9A 4ZY4A 2Z7QA 3LFDA 5BYZA 4GUBA 4S30A 2W06A 3DLSA 3WZDA 3VAPA 2XS0A 4DEHA 5AADA 1FVVA 5EHOA 1YOLA 3CPBA 5ITAA 1ND4A 3VNTA 4ITHA 4E6AA 5FG8A 4IM2A 5EM8A 4WNOA 5IDPA 2QOBA 4DTBA 2HAKA 3LLAA 3OCSA 4U80A 3WIKA 3R7VA 4FV2A 2RG5A 1CSNA 4FSRA 4BHZA 1OKWA 4C35A 3Q2JA 3LM0A 4DCAA 4AZVA 1LUFA 2OF4A 4IVCA 2O63A 5DRDA 5IEVA 4L00A 3RAIA 3VS2A 4Q9ZA 3DCVA 3U4UA 4XBUA 3A62A 4HYHA 4HVIA 3F88A 3SKCA 1Y8YA 3ZDIA 2BFXA 5IEXA 4AU8A 4H3PA 3ZS5A 2FYSA 3K54A 3SHEA 5M55A 4MX9A 3FSKA 2HENA 3D5VA 2CGVA 3AC1A 2A4LA 3UP7A 3V8WA 3FY0A 1Y8GA 3KU2A 4G3CA 4JNWA 5CT7A 4A9YA 4B4LA 3IOKA 3ZDUA 3BRBA 5EG3A 3NNWA 3QCXA 4PRJA 2DYLA 1MUOA 4IANA 3MPAA 3TV7A 3UJGA 5IH4A 3KREA 3E3PA 4YU2A 4XHKB 5EYDA 3LE6A 3CTQA 3R21A 2CHLA 2QLUA 3IDCA 4IAKA 4X2GA 5IZFA 1UWHA 4GL9A 4F0IA 4RLLA 3LJ1A 2CPKE 2YM3A 2YIQA 4FGBA 3UO6A 5K9IA 3F82A 4FTMA 3TI1A 4BDIA 1YOJA 3L8PA 4D0XA 3C4FA 4EONA 5EKOA 4FT7A 4AX8A 5I3OA 2JAMA 3QTRA 4PUZA 4UALA 4F70A 3JXWA 5HLNA 3UPZA 5BQ0A 2BZIB 5TF9A 5LMBA 2OJJA 3PJ3A 3NYVA 2HCKA 1ZY5A 4C34A 4TY1A 1CDKA 1H1SA 4X2NA 3ID6C 1L8TA 4MBIA 3T8OA 4WBOA 5E8TA 3RK5A 3VW6A 4DGLC 4CYIA 1ZLTA 4ACDA 3Q60A 2QCSA 3IOPA 3OS3A 3MPMA 5K3YA 4AS0A 1MQ4A 3LFEA 2JD5A 2WQBA 5BYYA 5DHJA 3R2BA 5EKNA 2KULA 5AAGA 2ESMA 3L9MA 2JFMA 2JITA 3G2FA 4F7JA 4MNEA 4FEVA 4U45A 3KRWA 3JVRA 5TO8A 5JFWA 3TM0A 5HLPA 4C4IA 3Q5ZA 4FIIA 4EKKA 5J5SA 4RIOA 5A4QA 4FIFA 5HI2A 1UWJA 1WVXA 2VTRA 3GT8A 4G3DA 4PPCA 4U40A 5EI8A 3C51A 4FKOA 4S2ZA 2YM4A 3LXPA 2VX1A 3FZ1A 4EH5A 1DI9A 4NM3A 3R8LA 3R8UA 2P2HA 1LR4A 3C4WA 3MIYA 4FBXA 4IBMA 3TJCA 4E4NA 2ETMA 5HU9A 5I9XA 1PXNA 4AN3A 2JGZA 3R0TA 3DJ5A 3V04A 4YLKA 4L52A 1R0EA 2XKDA 4MBLA 3Q53A 2EB3A 5CSVA 4Y73A 4GT3A 5KBQA 1J7LA 4KS8A 4S33A 3E8EA 1APME 4AXAA 4RBLA 4IWPA 4D28A 3R8ZA 4ENXA 5IH6A 3QQLA 4N0SA 3EFLA 3LZBA 3UODA 3W8QA 5HZNA 3QL8A 3OG7A 3P23A 5IQCA 3UIBA 4HZSA 2W1EA 4QYFA 2RKUA 2XRWA 3L9NA 1MRYA 4GH2A 3UZTA 4FEWA 3SA0A 4FIHA 1PMVA 3QHWA 3R8PA 3MVMA 4RIWA 3FI3A 2Z7LA 4OAUC 2VTNA 2ITYA 4YLJA 5HLWA 5EDRA 2C30A 3UTOA 2PVNA 3D5UA 4XJ0A 4FKIA 5CU0A 5KO1A 3ROCA 5DGZA 4XG8A 3GEQA 2X7GA 2XIYA 3KCKA 4BTJA 4JX7A 1ZYJA 3E87A 3UG1A 4IB0A 3O8TA 3D4QA 4FV3A 5E8VA 1CKPA 4HOKA 5LVLA 4FVQA 1OL2A 2WMXA 5EM6A 2PK9A 4JRNA 4L6QA 1IASA 4GFGA 3AQVA 1UNLA 4FT0A 2HW7A 1NVRA 2VWZA 3OT8A 2WD1A 3G5DA 1KSWA 3KXZA 1H26A 3HYHA 5L6WL 1YXVA 3SXRA 3P08A 4BRXA 4RLKA 2CLQA 3CLYA 3UMXA 5B7VA 2ITXA 4R7HA 5KCVA 3U51A 3ULZA 4LFIA 5BUIA 5L6OA 1BI7A 1CMKE 3EL8A 1HOWA 4DBNA 4Y72A 4O6EA 4Y5HA 4FF8A 5TR6A 3TEIA 3C4CA 4L9IA 4QMPA 3JR1A 4GKHA 3ORNA 3WF6A 2AUHA 5K4JA 3KXNA 4YJRA 5KMMA 3C4XA 4W8EA 1JSTA 5LJJA 1SVHA 4A9RA 4HW7A 3CQUA 2CJMA 2CLXA 1OL7A 4TWNA 2J50A 1XH8A 3RWQA 3HMMA 5ETAA 3T3UA 4PF4A 4L43A 1K3AA 3NS9A 4QYYA 2B9FA 1ZYSA 1R3CA 1ZMVA 4FNXA 4M84A 2X1NA 4E20A 2PUNA 1U46A 2BMCA 2QO9A 5KMNA 3N4VA 3LQ5A 4DFZE 4IVAA 1GIHA 3PFQA 1OKYA 2UZVA 4M69A 4CZTA 3F61A 3MS9A 4UXQA 5ANJA 2WQOA 2X8DA 4GV1A 4KKGA 5D7AA 4X3FB 4IZYA 2WQMA 2GNJA 5FBNC 3UZRA 2WMSA 4NZWB 3WYYA 3EH9A 4BYJA 5IG1A 4LUEA 5BX0A 2R3HA 2BDFA 3DXNA 2PVKA 3I7BA 3KL8A 3G9NA 3W16A 3Q4ZA 3CP9A 1XKKA 4CQEA 3F3VA 4HVDA 5M53A 3IW6A 2ETRA 2J0JA 4OLIA 3TUBA 3RKBA 4YPDA 4D2WA 4FTIA 3EKKA 3HAMA 2CGUA 5EYKA 3QRTA 1JVPP 2YWPA 1W7HA 3QQGA 4BGGA 4CLJA 3DFCB 5AIKA 4XNEA 3NRMA 3K3IA 4QPAA 3QQFA 3K2LA 4YC6A 4TXCA 5FRIA 3AC8A 4MD7E 1XH7A 3SAYA 5CAVA 4J98A 3R8VA 5BVFA 3CBLA 2GNFA 3FI2A 4LOQA 5LVOA 3RHKA 5HBHA 4P90A 1CKJA 1SVGA 1EH4A 4ZP5A 2WMQA 4R1YA 5HE0A 4DINA 2VO0A 3MVHA 2WIPA 4RVKA 3DKFA 5M4IA 4IHPA 3NZ0A 5TE0A 3M11A 1XH4A 5IQBA 4K18A 2XBAA 3R7YA 3GCPA 4BHNA 4C3FA 3QWKA 5K0KA 4MCVA 5KKRC 5DEWA 3NGAA 3ODYX 1WBSA 1Q24A 1JKSA 3MB6A 4O22A 3W2SA 5HIBA 1UKIA 5HCYA 4CG9A 4F9WA 3OW4A 3ZM4A 4I0SA 1O6YA 2BROA 3MJ1A 2UZEA 2GMXA 3ZXZA 2UW6A 4XYFA 2XKCA 4Z3VA 4J7BA 3BE9A 1OIRA 3MYGA 4QTCA 4CZUA 3VRZA 4XRLA 2QD9A 2DUVA 4K11A 4DT8A 4WG3A 3VQHA 2FH9A 1Q8UA 2C6KA 3HV6A 4ZJVA 4UX9A 4JI9A 3GCVA 4TN6A 3VUGA 4QQTA 4BDGA 5A46A 3UC4A 5DR2A 3PVBA 4KA3A 4M7IA 3LHJA 2CNVA 3UOJA 5BVDA 1WBNA 4OAVB 4FTQA 1M2RA 2XMYA 1A9UA 1YHSA 5I3RA 4LL0A 4C4JA 2WNTA 5LWNA 4OTWA 4WOVA 3RK9A 4LRJA 2R3PA 4D2RA 4NU1A 1FVTA 3C5IA 4QP8A 2PE0A 3EQDA 1SMHA 2BIYA 4JBPA 4EOIA 4GFOA 4J71A 4J97A 3O23A 4GJ3A 4K1BA 4GSBA 3L9LA 3CKXA 3S95A 4D4RA 3LFAA 5CAPA 2YCSA 4RG0A 3PIZA 3MJ2A 3QD2B 4CFVA 4ZY5A 2VTAA 3CY3A 3HECA 4CYJA 3U87A 1AD5A 4I94A 2XEZA 4UWBA 3PRIA 4LGHA 3RK7A 4CCUA 2HWPA 5CYIA 4H36A 4PMMA 2YN8A 4NIFB 4WO5A 5AMNA 5A14A 2C1AA 4I5HA 1ZZLA 2HY0A 4L46A 4NUSA 3V8TA 2IJMA 1H00A 1BKXA 2QU6A 2JDOA 2W1HA 3DTWA 1R78A 2HELA 3F66A 3HV5A 3PXRA 1IRKA 2J4ZA 2VTPA 4IVBA 3TZ8A 2C0IA 3RP9A 4CFUA 4EYMA 4NWMA 4C02A 2GTMA 5HNIX 3DK6A 5AAEA 3EFKA 2Z02A 5JFVA 3OD6X 4AG8A 1JKTA 4S34A 4ERKA 5GIOE 3PXKA 4OTPA 1GY3A 1O6LA 2B9HA 3PE2A 4IACA 3V6SA 3HZTA 4A07A 4B8LA 4YSJA 3IDBA 4I92A 5HQ0A 3HAVA 3PLAE 3ANRA 1GZ8A 2XUUA 1ZRZA 3DDQA 3GQIA 3OBJA 3CEKA 3JS2A 3OEZA 2BVAA 2EXMA 4FSTA 5DT3A 1A48A 2QONA 2AC3A 2J2IB 1P4FA 3QGYA 2JBPA 3R22A 3KULA 5AUYA 1MRUA 3M42A 2YISA 3ENMA 2IWIA 3QTSA 1R0PA 2GQGA 4HYSA 2P4IA 1M2PA 2X8IA 3H9RA 4KUJA 4FSUA 3E64A 3EN7A 4H1MA 2EU9A 3HRBA 5CENA 2YIRA 3O8PA 4G9CA 3C4ZA 4FEQA 5AWMA 4FTOA 4M0ZA 5T6KA 5K5NA 1XBCA 2WB8A 3DXPA 3A99A 4QP7A 5C8KA 3LKMA 2WMAA 3GU7A 5A9UA 3MTLA 1IAHA 1OPLA 2C6EA 3BHHA 1REJA 5LCJA 1Y6AA 1OIQA 4A9UA 2EXEA 3TV4A 3OWLA 5J8IA 5ACKA 3PYYA 1J1CA 4R3CA 4XG4A 4RIXA 5ETCA 3IS5A 2YERA 4KIQA 2C0OA 3PY1A 1R1WA 2LGCA 2CNUA 4O0WA 4PDSA 2O8YA 4M3QA 3QLFA 5FM3A 4HNFA 4FKUA 3AMBA 1FGKA 3LVPA 3R1NA 3CE3A 3NCGA 3MFRA 4AZWA 3G51A 4F6UA 5IUGA 5M4UA 5KMKA 4QTBA 3PJCA 5HTCA 4RFZA 3BHTA 4FGRA 4I1ZA 3KMMA 5AM7A 2C3JA 1GNGA 1QPJA 3BWJA 3EQIA 2YAAA 4L8MA 4V01A 5JQ5A 3OUNB 2HXLA 3COMA 4UV0A 4AW2A 4KIKB 4FR4A 4E3CA 4BDEA 3ZEWA 4O83A 4KS7A 3DDPA 4IM0A 5DH3A 4C0TA 4OR5A 5M4FA 3ZM9A 3ZLSA 4L3LA 3EOCA 2G9XA 3HRCA 4RX7A 5D1JA 2ETKA 1W83A 3DJ6A 2ITWA 3IW7A 4XUFA 5DG5A 1NW1A 2NNWB 4IXPA 5I4NA 4L42A 4TYHA 2XIKA 5CEMA 3VF9A 4F63A 4YTFA 5IA1A 2C4GA 1B6CB 1XH5A 2O64A 2RG6A 4XS2A 5DWRA 2X6EA 4EYJA 4ZEGA 4DGMA 2XB7A 4TWCA 5ETIA 4J99A 3VS7A 4F7NA 3ZO4A 1ZYDA 2CDZA 4O2PA 4Y8DA 4DEIA 5GZ9A 3C5UA 2XKFA 3S2PA 4G6LA 3JPVA 4ZTSA 5EHLA 2F7ZE 5J1WA 1Y6BA 5C27A 3GOKA 3EN9A 2Z8CA 1OMWA 4AGCA 2B55A 2J5EA 2YITA 4FV0A 2YHVA 1FINA 1UNGA 2BDWA 3LQ3A 4RC3A 4CCBA 4EH3A 3FLZA 5AV0A 3NYOA 5IU2A 3NW5A 5IA4A 3BQRA 4N6YA 1M7QA 1JOWB 1FQ1B 3N4UA 3FYKX 5DEYA 3SG8A 5IUHA 2XK4A 2OU7A 4MD9E 4EK5A 4BCGA 3I0OA 4ZLYA 2ERKA 4BWPA 2QODA 3VS0A 4HVSA 2DWBA 5DR9A 4UMRA 2C1BA 3BV3A 5CVGA 3E8CA 2QO7A 4X2FA 2X9EA 3VBXA 3ZEPA 2W0JA 1ZAOA 3CQEA 4XMOA 4JBQA 4JQ7A 4CFNA 3VS1A 3P86A 4O1OA 5DNRA 4I5MA 3D9VA 3MVJA 3MFUA 4OTFA 2HK5A 4MNEB 4NM0A 4ANMA 2X9FA 1G3NA 2C69A 4MQ2A 3AMAA 4EH8A 2FSOX 2VTMA 4QMSA 4QYHA 4EI4A 4H05A 4FT3A 2X7FA 5C01A 4BTMA 2UZWE 1ZMUA 4HGEA 3KC3A 5AP0A 5HX6A 2FSMX 2Y9QA 3G15A 4XEYA 1XH9A 3UNJA 4CKJA 4O82A 3NMUF 4II5A 4YHJA 4XOZA 3SVVA 4XX9A 4BDJA 3OXIA 4F6WA 3LM5A 1KUTA 3DBDA 2ZV8A 4A4XA 2QR7A 4BZNA 2YDKA 3FUPA 5L2IA 3VF8A 1WBPA 4HPUE 3MB7A 5I0BA 1H0WA 3VO3A 3OHTA 5EW8A 3HP2A 4GK4A 5TKDA 4DTAA 3C0IA 4WUNA 3WE8A 1G8AA 1PRYA 2GHLA 3R1QA 3PXZA 5KZIA 4G16A 1RQQA 1W8CA 2W4KA 4JG6A 4EBVA 1E1VA 4O7NA 4C7TA 3KVXA 1SNXA 3I81A 4EOPA 3NW6A 3F2AA 4I3ZA 4M12A 5FUTA 2R64A 3R2YA 3ZFYA 3GUBA 5EM5A 4NTSA 4JXFA 5CSXA 1H01A 5H2UA 2BIKB 4ZTQA 5F4NA 1LP4A 1YXUA 2WTKB 3CC6A 1T46A 1W84A 4BWKA 3U6HA 5JRSA 4KIOA 3HA8A 3U6IA 4RVLA 4FG8A 4EUUA 3W55A 5JEBA 1Y57A 4YJOA 4FZ6A 5T3QA 4KBCA 4KKEA 5AV4A 1ZOGA 4DLIA 3ZMMA 3QRIA 4NJ3A 1CKIA 1PF8A 2WTVA 3BKBA 4EH7A 3DNEA 3RZFA 2OH0E 2X2LA 2SRCA 4QMQA 3IW5A 2Y7JA 3ZYAA 3RM6A 5J1VA 3BEGA 2Y4IC 1NT2A 3QCYA 5JGDA 1PY5A 3FE3A 1BLXA 3MH2A 4KNBA 4U81A 4E8AA 3AD4A 4CXAA 1BL7A 3F5XA 5LMAA 5C26A 4C62A 3R9NA 4RT7A 2WHBA 4NCTC 4C37A 4LRMA 5ETFA 3D7TB 4EOQA 1QMZA 4O0VA 2O0UA 4M67A 3BPRA 2OXYA 4A9TA 4APPA 5G6VA 3L8XA 2C6IA 2IO6A 3FI8A 4W4WA 2W9FB 2WIHA 3HUCA 3BIZA 2YIYA 5I9VA 3WZEA 2UW8A 4W9WA 1DAWA 1V0PA 3NUSA 3L1SA 5AR8A 3WF9A 1NVQA 1UU8A 4QMYA 4EZ5A 2HWOA 4ZS0A 5CU3A 4PMSA 2GCDA 4DAWA 4RJ3A 2H6DA 3H9OA 3RMFA 2J0KA 4AE6A 3PTGA 3NIEA 3Q9YA 2RL5A 4Y85A 2QOHA 3FQSA 3FLQA 2Y4PA 4TNDA 4QO9A 3TKUA 5DBXA 1UU3A 2XNBA 3QTZA 3R1SA 4M69B 2PMNX 2BFYA 4MXOA 4CRSA 1H25A 3DXQA 3E7VA 3D0EA 3AC3A 1TKIA 4GW8A 4RWIA 4XBRA 2YZAA 2W7XA 2OO8X 3TZMA 1OIYA 4I22A 3VHEA 4WT6A 4M8TA 3BV2A 4E93A 2ZM1A 5HESA 1OL1A 3EN5A 5HO6A 4ENYA 3O17A 4J95A 2F7XE 2VWUA 1QL6A 4YGAA 3BZ3A 3EQBA 4WKQA 4GFMA 4FG9A 1Q5KA 2G15A 3EMGA 4RC4A 2CN5A 1GZKA 2EVAA 3C1XA 3ET7A 5E7RA 3FKNA 1Q62A 1H1WA 3FYJX 2WTCA 3JY9A 4E5WA 3TDWA 5JH6A 3QWJA 3DS6A 3LXKA 4E73A 3R73A 3IECA 4OBOA 2RF9A 3DKGA 4ASXA 4R8QA 1U5QA 3H9FA 4UB7A 4F65A 4O7TA 4QRCA 5AV1A 4BIBA 4C4GA 3OOGA 3VUMA 4ZSJA 5EM7A 3MDYA 4LOOA 3I4BA 1OITA 3IGGA 4MQ1A 5AP7A 2IW8A 3LXLA 3OWPA 4AOIA 4P4CA 4EOOA 2P55A 2YDJA 5AR3A 5HTIA 5ANDA 3I79A 5AV2A 3BWFA 4IEBA 1OVEA 4KINA 4UYAA 2QU5A 5FQDC 1Z5MA 3FC2A 4HGLA 2CKQA 1M2QA 5IF1A 5CT0A 4AAAA 4IDVA 3OF0A 4HCVA 4OTRA 2OFVA 5F20A 3TACA 4IX3A 2GSFA 3ORPA 4IAFA 2REIA 3QX2A 5E92A 4FKQA 4OT5A 4R77A 1WFCA 4XLVA 1MRVA 4PPBA 5E8SA 5CANA 2XJ2A 3TNQB 4EZ7A 3UC3A 2GTNA 3DQWA 4FT5A 3HL7A 2P0CA 3CJGA 3PP0A 5DT0A 4YNEA 4FTTA 2ZB0A 2JIIA 3QXPA 4BCMA 3QA0A 3II5A 4C58A 4E4MA 2UZOA 3TKIA 3F5UA 4ZIMA 2PE1A 3AMYA 2WQEA 5JN2A 1WBVA 3EZVA 4DFXE 3F3TA 2OKRA 4YHTA 4YP8A 4PMPA 2UW4A 2V22A 4BCOA 3ORZA 3RINA 5KMLA 4WSQA 5DMZA 2XK8A 3BE2A 3MH1A 5FDXA 3NIZA 4JIAA 2Z7RA 2GQSA 2J6MA 3AT3A 3U54A 2UZDA 2UV2A 3BU6A 2ITQA 1JBPE 2C6TA 4I24A 3R9DA 4P7EA 3MH0A 5HU3A 2H8HA 4FKJA 4EC8A 4MWIA 4HCTA 5GHVA 3Q9ZA 4YJNA 4FTJA 5AP2A 3BYVA 4MF1A 3UVPA 4D1ZA 2PZYA 5GJDA 1BX6A 4AGUA 4CFFA 4DFUA 4ANOA 2YAKA 2QR8A 4UMUA 5CY3A 5E8YA 4J53A 3HRFA 4IB3A 1KOBA 4FV7A 5LVPA 2PMOX 1ZOEA 2BKZA 2FGIA 4YC3A 4GVJA 1OPKA 5HORA 4JQ8A 4KBAA 2JEDA 3RNYA 3FMEA 3VUHA 1YRPA 2UVYA 2QOLA 4RSSA 4CEGA 4RWKA 3VBYA 3D5XA 4QPMA 3BYMA 4OT6A 3ORLA 2VRXA 2Y6OA 2BR1A 3GXLA 1GIIA 2Q0NA 2UW0A 2RGPA 2X39A 3MPTA 4RZWA 3V01A 5CEKA 5I9UA 3OVVA 4BGHA 4OTQA 2VZ6A 4DT9A 4IDTA 4A4OA 4D2SA 4H1JA 4C3RA 4IVDA 3FXWA 4OBQA 4DEBA 4QMXA 3CY2A 5DOSA 1OECA 2R3OA 3F9NA 4O27B 4BB4A 2XYNA 1IA9A 5IA5A 4M15A 4O0XA 4JR3A 4CTCA 3FEGA 2BUJA 4NKAA 2J90A 4FV6A 5E8XA 4CT1A 2AC5A 2YM8A 5AX9A 4BYIA 3LPBA 4O81A 3ZO3A 4WD5A 4BIDA 2OICA 2R3GA 4ORKA 3FC1X 4U42A 5IA0A 1LEWA 3ACKA 3VBVA 3NUAA 3HLLA 2C6OA 3R1YA 2Q0BA 5HE1A 5HG5A 5CF5A 3KFAA 4BZDA 3Q4CA 3UVQA 4FSZA 2R0UA 3QX4A 4L67A 4JS8A 1ATPE 5CTPA 3HVCA 3MA3A 3R6XA 3TZ9A 4R7BA 4ERWA 2JKKA 3DKOA 4W9XA 3PPKA 1KV2A 2WOTA 5KMJA 2ITTA 1AGWA 4F1OA 5BVOA 2G1TA 5CU4A 3S4QA 4PP9A 4FV8A 1IR3A 3WZJA 4RQVA 3UIUA 4AZFA 5JK3A 4EZ3A 4IX5A 1J91A 2R5TA 2C68A 4YMJA 1JKKA 2XH5A 2YIWA 3FL5A 3LCDA 2ITPA 1KE7A 3PXYA 4RIXB 4TZRA 3R7EA 4E6CA 3F2RA 4HZRA 3W1FA 1XR1A 2V55A 3P7AA 1Q4LA 4E26A 1XBBA 4ANNA 3GVUA 1URWA 4QNYA 4I6HA 2BTRA 3MV5A 4RX8A 5AR2A 3KN5A 4BR3A 1XH6A 1YKRA 4FZ7A 1V0OA 3IO7A 2W1FA 3PVWA 3OROA 4S32A 3FLWA 2WEVA 4BL1A 2X8EA 5HO8A 3UNZA 2WU7A 1FPUA 4O0YA 2XNPA 3DAJA 2ONLC 3MWUA 2JKQA 3VWAA 4G3EA 2J0IA 4YBKA 3G0EA 4F1MA 1PW2A 3SD0A 3WARA 3DK7A 1FBNA 2YZLA 3HX4A 3DY7A 3V5LA 3B2WA 5E8UA 5AP1A 4IAIA 2I0VA 5L2WA 2KTYA 4BBFA 2XKEA 2JDSA 4DGNA 3FZSA 3OCBA 3FZOA 3UYTA 3M2WA 3DKCA 3ENHA 1WBWA 4IJPA 3F2NA 5DPVA 4BBEA 1J7UA 1FMKA 1OPJA 3A4PA 3H10A 4E4LA 2QG7A 4KSQA 4YZBA 5GZ8A 3PXFA 1YW2A 4CKRA 4FA2A 3EB0A 2W1CA 4G3GA 3SQQA 2XBJA 3QAME 3VQUA 2X2MA 3PSDA 5EYCA 5FBOA 2O65A 3NAXA 3P7CA 5A54A 1KE8A 1JSUA 4I4EA 3R9OA 3V6RA 3ZONA 4OTDA 2B1PA 5CEQA 3E92A 5LOHA 2C5VA 3I5ZA 5DN3A 4TL0A 2E9VA 5DVRA 3KMUA 2Z60A 4EQUA 1YWNA 5F9EA 5JFXA 2ZMDA 4RVTA 2OZAA 3P78A 3CD3A 1A06A 4HYIA 5HNGA 4CVAA 2R3IA 3WBLA 2PMLX 4G6OA 5HIEA 4FZAB 4B7TA 3ERKA 4IMYA 3K3JA 2B7AA 1YDRE 4ALVA 2PY3A 2RIOA 4H39A 3KK8A 4Y5QA 2JKOA 1Q8WA 2R3NA 2W96B 4FTKA 4GT4A 3AG9A 4GEOA 3PIXA 4BVUA 2BRMA 4EUTA 4FICA 1J1BA 4CMTA 4XG2A 2XZSA 4IADA 3D2IA 5L8LA 3TXOA 3CGFA 3EL7A 4BCNA 2UZUE 4JDJA 4G34A 3RPSA 5FEQA 2F57A 5AFVA 3R30A 3F69A 3PY0A 4GVAA 3R7OA 4IC8A 1W0XC 4TW9A 3H0ZA 4XP0A 3LJ2A 4RX9A 5DA3A 5IQHA 5GJFA 2WMVA 1PYXA 4DHFA 2GS7A 3FMKA 3ANQA 5I9ZA 5JRQA 3GCQA 4AZTA 4FVPA 4JDIA 4F6SA 3QHRA 4FT9A 3TT0A 4H3BA 3H4JA 4N4SA 3ZCLA 2H34A 2UW3A 3DA6A 3R7IA 1WMKA 4C4EA 4D2PA 3Q6UA 3UOKA 5FDPA 3GC8A 4FKVA 4I5CA 4AT3A 4LI5A 3A7FA 4FOCA 4TWPA 3ZRKA 4E6QA 4FX3A 4Z55A 3PVGA 5HVJA 1ERKA 3WE4A 3UQCA 2WTJA 3FLSA 2YEXA 5M08A 5CSPA 2VTHA 4IWOA 4QTEA 4HVHA 3BU5A 2X6DA 4WG4A 3EYHA 4C2VA 5AJQA 4ASEA 3TIYA 3TN8A 3ORXA 1Q8YA 3PSBA 4FK6A 4RJ6A 4U43A 4YZDA 3DAKA 3NNXA 4Q5HA 5C8NA 4JX3A 2I40A 2XNMA 2C3IB 4IWQA 4F9YA 4YBJA 5IA2A 1TVOA 1T45A 4JDHA 4M14A 1OUYA 5E90A 3ALOA 2BALA 3QTWA 3R9HA 5B2LA 2YDIA 1RDQE 1JQHA 5C4KA 1X8BA 3MFTA 4F9BA 2Q83A 4O7ZA 3VS4A 3P1AA 4CTBA 1Y91A 4K8AA 5ANKA 4FMQA 3FZPA 4IB5A 3W2PA 4FC0A 3UQFA 3TCPA 3DB8A 4G6NA 4I4FA 1XWSA 4O1PA 1VZOA 2YABA 4GS6A 2OWBA 4QTAA 3RCDA 4B99A 4DFNA 4C59A 1OM1A 4BDAA 3W2OA 4USFA 2IPXA 2XF0A 1H1RA 4NCTA 4CMOA 2R2PA 3F3ZA 3ZO1A 1UU9A 4E1ZA 3SW4A 3FPMA 5C9CA 4DCEA 2B0QA 4GK3A 3LAUA 4AW1A 3A8WA 4BDFA 3PIYA 4ZS4A 2ITVA 2XNEA 3MA6A 4D2TA 3NLBA 4XCUA 3LQ8A 5CI6A 2QNJA 4J1RA 3QKMA 5HX8A 3O0GA 4OUCA 4FKSA 4AW5A 2XVDA 2ITUA 2YLFA 4Q9SA 3I60A 2E2BA 4BDBA 3U8WA 4FSWA 3NVMB 4UWYA 3VVHA 4FKWA 4ZLZA 4G5JA 2FUMA 2W5HA 3W32A 4BWXA 4BKZA 3W18A 5HICA 5CQWA 1B38A 3FY2A 4O86A 4QTDA 3KA0A 3A4OX 3OXZA 3RPRA 4JQEA 1YXSA 2C5NA 3H0YA 3AD5A 3QCSA 5D7VA 4NYEA 3GENA 3NX8A 5IEYA 4U6RA 2QLQA 2XM9A 4NM7A 5LVMA 3QA8A 3TZ7A 2W99B 1KWPA 4V0GA 4YJTA 5GNKA 5HG8A 2C47A 5E8ZA 3LFCA 4L3PA 5AX3A 4FVRA 5LARA 1OKZA 5IQIA 4EK8A 3SOAA 5H8BA 5HBEA 5KZ0A 4J52A 5FTQA 2B9IA 4MAOA 4X21A 4BGQA 4ZZNA 4R78A 1TQIA 2ZJWA 5B0XA 5B2MA 4USEA 4AQCA 3MSSA 3EFJA 4Y83A 5HG7A 2LAVA 4GJ2A 4ANBA 3QC4A 3QD4A 3FAAA 4I6FA 4RC2A 5JGBA 1L3RE 4ZK5A 4BY9E 4YO6A 3DQXA 4ZJIA 1KE5A 3K5UA 4YO4A 4EORA 4O2ZA 4FNWA 3FHIA 3PXQA 5GINE 3PPJA 5CZHA 2YCFA 4D1SA 1PXMA 4IQ6A 4TWOA 2IZSA 5IKWA 4FNZA 4F64A 1V0BA 2HXQA 4CMUA 5CAUA 2QQ7A 4XOYA 4AACA 2ZV9A 4RJ7A 5J79A 2GU8A 4GYIA 4QNAA 4X2KA 1WBTA 4EHGA 3R00A 4FV4A 3O7LB 1U54A 4G31A 2FSTX 4DEGA 5KKRB 3SGCA 5B2KA 4AW0A 3EQPA 1Q8ZA 2W1ZA 4KSPA 2EXCX 3UO4A 5KBRA 4MVFA 2JBOA 2W5BA 3NEWA 5DLSA 4JT3A 4BTFA 4NW6A 2ACXA 3BQCA 3R8MA 4NJDA 3OFMA 2HIWA 4QQCA 3RI1A 4DF3A 3BI6A 4KABA 1FOTA 4G5PA 5L3AA 4C38A 3A7HA 4EL9A 5EQPA 5M4CA 2G01A 2IVSA 3ZSGA 4UBAA 4PMTA 5CAQA 4BCJA 3WF5A 4J8MA 3D14A 5ANGA 5AP6A 2R3RA 4BTKA 1VJYA 2I6LA 3KEXA 4CT2A 3R71A 1I09A 3E8DA 1PYEA 3I7CA 3MVLA 4WRGA 4X0MA 5EDQA 4FTNA 4GRBA 3ZZWA 5EQEA 2VO3A 4IZ5A 2W4OA 3B8RA 4YURA 4W4XA 3ZH8A 3PLSA 1OIUA 3Q6WA 2ZOQA 4FYOA 3W2QA 3N9XA 3BHYA 3JUHA 3HMIA 4K9YA 4PTEA 3IPHA 5C1QB 3Q9XA 3KXHA 2F2UA 2XCKA 5L4QA 1GOLA 3DTCA 3VS6A 2JIVA 3CXWA 5CF4A 3KVWA 2VTLA 5CI7A 5HG9A 4EH2A 4DEEA 3ATSA 3ZUUA 3P7BA 5KHWA 4C4HA 4DFYA 3T9IA 3EFWA 3OBGA 4WNPA 5FXRA 1UVRA 4G2FA 5E8WA 4QMNA 2A2AA 4L7SA 4AFEA 3PRFA 2I0EA 4YZMA 4DITA 5IMEA 3O50A 4RJ8A 4ZZMA 3TTIA 2YJRA 4FKTA 3VS3A 4RPVA 5EHYA 3WF7A 2ZVAA 2ZDUA 4UMPA 4I23A 4MEDA 4FV9A 2NO3A 2PE2A 3QQKA 5IQDA 5H8GA 3WOWA 1U4DA 4I5PA 3RWPA 4EHZA 4IJ9A 1M17A 4AZSA 4PDPA 2CGWA 3ZBXA 4M97A 5FXQA 3UGCA 3O7LD 4G3FA 4JAIA 4BKYA 5K0XA 1J7IA 3R04A 2IW6A 3EN6A 3A61A 3FJQE 4FG7A 1PXOA 4LMNA 5HCXA 4ZSGA 4YZ9A 4UWCA 3CR0A 2XIRA 4PPAA 3QRJA 2I0HA 4XH6A 5I5ZA 1BYGA 4E5BA 5CQUA 2W5AA 3MBLA 3ZUTA 4EH4A 3ATTA 4X3FA 4BFMA 3SW7A 3Q32A 4IM3A 2JDVA 3JY0A 3V3VA 3ZFXA 5L2TA 4CD0A 3OCGA 3ZO2A 5BVEA 4CQGA 1XQZA 2WKMA 1J3HA 3GC7A 3QUPA 4MD8E 4O96A 2GNHA 5EW3A 2B54A 1O9UA 4BDHA 2QOFA 5TT7A 4Q2AA 2BRNA 2F4JA 5CNNA 1OBGA 3OTUA 2R7IA 3MY1A 5HO7A 1SZMA 2C6DA 4O0UA 3S00A 4AUAA 1PHKA 3D94A 1Q3DA 3A8XA 4JAJA 3SXFA 4IFCA 1IA8A 4PNKA 2BHHA 2VAGA 5ANOA 1ZOHA 1DI8A 3KF4A 2FB8A 3DZOA 1Q8TA 4EJ7A 3PA5A 2YCQA 5CZIA 2HZIA 2VTTA 5FD2A 4PNIA 4CFXA 4NH1A 5D41A 5AR5A 5BUEA 4XP3A 4KB8A 4FOBA 4NM5A 2UZTA 5AUZA 4MBJA 4EQMA 3C0GA 4WRSA 5J95A 1B39A 4WHZA 3W8LA 5BMMA 4CGAA 4LQMA 2V5QA 5BVKA 2B9JA 2P3GX 3BYSA 4JL9A 2XNNA 4AOTA 4F09A 5HTBA 3DAEA 3FDNA 1H24A 4OTGA 3P79A 4ALWA 2IVVA 3RM7A 4FSQA 4FYNA 3GP0A 4OTHA 4RIWB 4DFLA 5KNJA 4LM5A 4FEUA 4DBXA 2OI4X 4PTCA 4CV8A 2ONLA 3TWJA 3TUCA 2OFUA 4DH8A 4NKSA 4HJOA 3S0OA 3BGZA 2DQ7X 2H9VA 2NPQA 3LMGA 3D2KA 4DGOA 3EZRA 2R3MA 5EQYA 5FTGA 4E4XA 2CKEA 3KGAA 4FODA 3PJ1A 1H1PA 5AM6A 2HY81 3DBFA 3E93A 4RIYA 4YJVA 4ASDA 4EWHA 5AR7A 4I41A 4D9UA 2W1IA 2OIDA 4QMOA 2PHKA 3DU8A 2VU3A 3ZRMA 4B6LA 4EHEA 5JZJA 5A3XA 5IQFA 2X4ZA 4PX6A 5IISA 4K33A 3D5WA 2CCIA 2C5OA 4AA5A 2XK9A 3W2RA 3ACJA 2RFEA 3CCNA 4EK6A 2OG8A 4XG7A 3ZLYA 3D15A 4FTLA 3FLNC 2A19B 4U5JA 2ITNA 3S3IA 4IFGA 2GNLA 3Q4UA 2UVZA 4EQCA 2UZLA 5CNOA 3OXTA 2VWIA 3HP5A 2E9UA 3ZUVA 1YWRA 2ZB1A 4RRVA 4QP6A 2WMWA 3VBTA 1TQPA 5LVNA 3KRJA 1QCFA 3E63A 2OH4A 4ANSA 3LFNA 2YA9A 5EFQA 1WVYA 4QP1A 3NUPA 4TYEA 3UMWA 5J9LA 2EUFB 5E4HA 4U7ZA 3QQUA 4AA4A 5TOZA 2JAVA 2IZTA 2PSQA 2V0DA 2YACA 2R9SA 3VIDA 3Q5IA 2XJ0A 4NSTA 3KRRA 3MY5A 4ACGA 3VRYA 4O7WA 3OMVA 4JLCA 4F99A 2PVYA 3MGYA 2VV9A 4ONAA 1P4OA 5EOBA 2C5XA 4ZY6A 1SVEA 1E1XA 2BZJA 2OZAB 3ZFMA 4NIFA 3TUDA 1OGUA 4IZAA 4O38A 4TTHB 4WA9A 1O6KA 1K2PA 2WTWA 2UVXA 2UW7A 5D11A 3O71A 2XCHA 3V5QA 2I1MA 3KXXA 4XP2A 4GUEA 4MWHA 3ETAA 4DE4A 2OIBA 4MXZA 3HV4A 3NCZA 3RPOA 4C4FA 2Z2WA 1OUKA 3FMLA 4E7WA 5KE0A 3AOXA 4EK4A 3C9WA 4X6QC 3OEFX 5A4LA 2YIXA 4S31A 4ANQA 4O7SA 4M13A 3I6WA 5M06A 1JWHA 3SRVA 5JGAA 2OXXA 4ZSAA 2B4SB 4I6QA 3BGPA 4RA4A 4MXCA 2VTIA 3FZTA 1ZXEA 4BCIA 1UV5A 1F0QA 4R5YA 4AP7A 3LJ0A 4XV9A 4HCUA 1E9HA 4FUXA 3BYUA 4YTIA 2V7AA 3RPYA 1HCLA 3ZBFA 3PWYA 3DBQA 4GCJA 3DFAA 4L45A 3EIDA 1R39A 2W9ZB 4RJ4A 1YOMA 4PL5A 2JIUA 2WZJA 2W05A 3MTFA 5AA8A 3HGKA 3LFFA 2JFLA 4F9AA 5CF8A 2G2FA 5ANEA 4G9RA 3VBQA 3QLGA 3FXXA 4FIJA 3O2MA 4P5QA 2OBJA 3CTJA 4GIIA 3DZQA 3CTHA 3NWWA 4ZTNA 4HGTA 1LEZA 4BBMA 3GI3A 3IONA 5DYJA 2OSCA 4RGJA 5KMOA 3EQFA 2VWXA 1JAMA 2BRBA 3RPVA 1JPAA 5FLFA 2J0MB 4D4VA 4EWQA 2YCRA 4XLIA 2B53A 1Q3WA 4TPTA 5AR4A 5F1ZA 3KRLA 3PDTA 5E9EA 3ZSIA 3ORIA 3LW0A 2WGJA 4G1WA 3GBZA 3TDVA 4FTUA 1H1QA 4ZTLA 1V1KA 2YM7A 3NW7A 3W10A 3OUKA 3V5JA 2JDTA 3PZEA 3UP2A 2Y4IB 4FV5A 4ID7A 4H58A 2YLEA 4IC7A 3LCTA 1G8SA 3OOMA 4KIPA 5IQGA 1LPUA 4NK9A 3UIMA 4B8MA 3LFQA 3AGLA 4YC8A 5J5TA 5EI2A 3BHUA 2OGVA 1XJDA 4KIKA 5FWKK 2E9NA 4PDYA 2P33A 2BTSA 4U3YA 2WMUA 3EJ1A 2PUUA 4I93A 4QP9A 3FMDA 5LMKC 3E7OA 3LOKA 5BVWA 4RWJA 4O7LA 4CKIA 3E88A 3BU3A 3NUNA 4IX4A 4MYGA 4Y95A 3CKWA 3KXMA 3L8SA 2ZV2A 4QT1A 2PVLA 2OF2A 5ANIA 4FIGA 3GCUA 5E91A 5AUUA 2HYYA 5HE3A 4DC2A 4LGGA 2OK1A 2PZIA 2V7OA 4RFYA 3U6JA 5EYMA 3Q9WA 4UYNA 3FXZA 4O0TA 2XA4A 1BI8A 1K9AA 3QU0A 5EH0A 3MESA 3AGMA 1YI6A 2A0CX 5CU2A 5AAFA 2JC6A 1PMEA 4X6RA 1Q41A 4G17A 5L8JA 3BGQA 4NFMA 3QCQA 4GK2A 3BCEA 4CRLA 2RFNA 1Z57A 2VN9A 4C8BA 4AOJA 2VGOA 4A7CA 4DH1A 4CNHA 4V0GB 5DI1A 3REPA 3FMHA 4PL4A 5FXSA 5LCKA 5HOAA 3LCOA 4MF0A 3ODZX 4YJUA 3PE1A 3U9NA 3SDJA 3WIGA 3E3BX 1P14A 4C33A 4FL3A 4K77A 2IZUA 1XBAA 1F5QA 1W98A 2PL0A 2PVMA 2QOQA 3OY1A 4BF2A 3E5AA 3GGFA 1NXKA 1VEBA 2ZV7A 3F3WA 4IH8A 3VW8A 4CLIA 2BZHB 3BELA 3UNKA 3IK3A 2BAKA 3A7IA 3BEAA 3KULB 4HNIA 4R3RA 4X3FC 2WMBA 3SX9A 2QURA 3QQJA 4KWPA 1KV1A 3QALE 2I7QA 5M07A 1U59A 3SXSA 5JKGA 3ZHPC 3EQCA 4XV3A 4WNMA 2GHMA 2ERZE 1GAGA 4BCFA 2QOOA 2GPHA 3R7UA 4AN2A 3VJNA 4FTAA 4LOPA 2GFCA 4YJSA 1XO2B 3O51A 5FEEA 3FLYA 3UQGA 5CLPA 3QZIA 4ZTRA 4YSMA 5AUTA 1JNKA 3RJCA 5GIPE 3R02A 4WUAA 3RAHA 2OLCA 1TQMA 3B8QA 5CVFA 4C36A 2CNQA 2OJGA 5HE2A 4BDDA 4JR7A 1U54B 4IB1A 5BVNA 1MQBA 5FP6A 4FKLA 3PG3A 4I0TA 3RTPA 3EWHA 2YM5A 4FEXA 1H28A 2VNWA 3HUBA 5G1XA 3EQGA 4UXLA 3G90X 2WTDA 4FI1A 3V5TA 1VR2A 3QBNA 4ACCA 2RSVA 2CMWA 1SNUA 3FWQA 5CSHA 4CZYB 1Q99A 2A27A 4ASZA 4BIEA 3QRKA 4QMWA 1FGIA 3NPCA 5DRBA 3VS5A 4AE9A 5M57A 4X7QA 5HVYA 2R3JA 4O7YA 4ZSEA 2E9OA 3MW1A 3FZRA 2CSNA 3QQHA 4R5SA 2OZOA 1QPEA 3L9PA 3VBWA 1PMUA 4DG3E 2CN8A 4U9AA 3R7GA 4I0RA 3HEGA 3RALA 2QC6A 4GMYA 3EN4A 5DIAA 3IW4A 4M0YA 3BBTB 2Y8OA 5EK7A 4D1XA 5M51A 2VX3A 1P5EA 4DH3A 1FVRA 2BPMA 4YR8A 2XNOA 3UVRA 2C0TA 5D12A 4DH7A 3R28A 3I5NA 5DT4A 5FEDA 1H27A 5IDNA 3H30A 2OIQA 4AFJA 1S9JA 3EKNA 5CALA 5HBJA 3EQHA 4L53A 4ZOGA 3LFBA 4BI1A 2X7OA 4WG5A 3QC9A 3DBEA 4WIHA 4GG5A 3TNHA 4ZXTA 1H8FA 4TYHB 2FO0A 4UMTA 3FKLA 5AUVA 3Q4TA 4YHFA 4O0RA 3P0MA 2R3QA 4F4PA 2WMRA 4QMUA 5GJGA 3OC1A 5AP4A 4F0FA 2WFYA 3PWDA 5LXMA 3VN9A 3TNWA 3ZU7A 4MK0A 1PXLA 3D7TA 2CKPA 3NUUA 1VYZA 4OTIA 2GQRA 2PU8A 5IMXA 4IIRA 2W1DA 3PUPA 2OJFE 2QOIA 3I1AA 4YPSA 3A2CA 4HVGA 4KRCA 4CFMA 4AGDA 2J7TA 3NNVA 3ZC6A 1W82A 2XK6A 4QQJA 2O5KA 3AC2A 4YUQA 1NA7A 3RCJA 3MFSA 3LCSA 4XRJA 1CTPE 2BILB 2W17A 2WMTA 5AV3A 4YTHA 3KK9A 2WO6A 3SV0A 5AUXA 3TKHA 2VWWA 4L7FA 2C3LA 4IW0A 4DLJA 4EOSA 2VTJA 3WZUA 3FQHA 4RJ5A 4D4YA 2ZMCA 3DV3A 3OY3A 1XHAA 4EHVA 4EH6A 2R7BA 4QOXA 1Q97A 2IVTA 5IQAA 3E62A 1BUHA 4FZDB 2PZPA 4IZ7A 5FGKA 5IA3A 4GKIA 3VUTA 5F95A 3FKOA 5KMIA 3GU6A 4DEDA 4PDOA 4TYIA 4TYJA 2WAJA 4TNBA 1H07A 3HKOA 3QGWA 4FNYA 3UOLA 4EOLA 5I9YA 3Q2MA 2VO6A 1I44A 2J5FA 4LG4A 1KE9A 2J9MA 3EYGA 4YJPA 2VO7A 4NW5A 4EBWA 5CXHA 1OZ1A 1OL6A 4L68A 3C0HA 3TTJA 2R3FA 2ITOA 3F3UA 1WZYA 4MKCA 4ITJA 4LGDA 5L8KA 2HZ4A 5T68A 3GNIB 3NYXA 2IW9A 2PMIA 2PPQA 2XRUA 3CJFA 5CASA 4L01A 4J96A 1WBOA 4FL1A 5EW9A 2VWVA 2W1GA 3D7ZA 3A7JA 4BDCA 2C5YA 2XJ1A 1KE6A 3THBA 2CKOA 2Y0AA 3CSVA 3M1SA 4PV0A 3PY3A 3F5PA 4HYUA 3Q3BA 5CF6A 4B0GA 4BCKA 5JSMA 2R3LA 4DN5A 4K6ZA 5JMSA 4CG8A 2H96A 4F1TA 4D2VA 4Z7HA 4BCPA 3Q04A 4XG9A 1ZARA 4Z9LA 4C3PA 4PQNA 4AZEA 1JSVA 1SM2A 3HMOA 4U97A 2GDOA 3LFSA 3QZGA 3WZKA 2P2IA 2X0GA 4ITIA 4D5HA 5K5XA 3OTVA 3C50A 3R01A 2RFSA 3UG2A 4D0WA 5C8MA 4BKJA 4NT4A 2JKMA 2AYPA 2O2UA 2I0YA 4X2JA 1YDSE 3ORTA 4LUDA 1Q61A 3GB2A 2R0IA 3COKA 1REKA 3IKAA 4AN9A 1OKVA 4EOMA 5IUIA 4Y46A 4AF3A 3RVGA 4UY9A 2OJIA 3VUKA 3HV3A 1URCA 2QHNA 4BI2A 5A4TA 2BRGA 4RIYB 2RFDA 4R6VA 4U0IA 4EOKA 3KRXA 3AT4A 4I21A 3W2CA 4J8NA 3EQRA 4O0SA 5L2QA 5LWMA 4O7VA 3CD8A 4FTRA 1F3MC 1P2AA 3HNGA 3QD3A 2XEYA 4QMZA 5H8EA 4ZTMA 4ACMA 4LL5A 3TNPC 4IAAA 2IZRA 3NR9A 4RQKA 4RFMA 4F9CA 1WCCA 2WXVA 3L8VA 2XYUA 3K5VA 4QQ5A 3V5WA 4CFWA 3UZPA 4AT5A 1PJKA 2F2CB 2WQNA 3SOCA 5JFSA 4Z16A 3GU5A 1WAKA 3LIJA 4DGGA 3QTIA 2ZM3A 2WEIA 2NRYA 3AT2A 5HHWA 2QVSE 3RAKA 3V5PA 4JVGA 4ZMFA 1OL5A 3HMPA 4DFBA 2X81A 3KB7A 4LYNA 1IAJA 1OB3A 3G9LX 4U3ZA 2GFSA 4FTCA 3KQ7A 4F7SA 3OW3A 3VUDA 4YTCA 2IVUA 3W33A 2WTIA 2XIXA 4BICA 3FHRA 2F49A 1ZY4A 4U8ZA 4UZDA 4RVMA 2DS1A 3CS9A 4ZZOA 1AQ1A 4D58A 4IAZA 4D55A 2O3PA 3TNIA 1YHVA 3ORMA 4L3JA 3RAWA 2OW3A 3V8SA 2PUIA 1OBDA 4QP3A 4X3JA 5EI6A 3O96A 3BLQA 2ITZA 3H3CA 4MNFA 1YWVA 5HNBA 4XV1A 1H08A 2VGPA 3QRUA 3TL8A 3GU4A 4KAOA 5L2SA 1H4LA 4QPSA 1BMKA 3F6XA 4BCQA 2EWAA 4A06A 3C13A 3ORKA 2A1AB 4O84A 4O7RA 3F5GA 3OP5A 3Q52A 4WSYA 5IQEA 4EKLA 3RZBA 3QUEA 3SRVB 2ZM4A 3GCSA 4UN0C 4PL3A 5CU6A 3UO5A 2C6MA 3DB6A 3QD0A 3TIZA 5BYLA 3F7ZA 2WU6A 5E1EA 3GC9A 3OZ6A 4ZSLA 2FVDA 2BAQA 3WYXA 4ZLOA 2VUWA 1YDTE 3FMMA 2QKWB 4RMZA 1S9IA 3E8NA 1FMOE 3ITZA 4UEUA 4FSMA 4H3QA 4AWIA 4C2WA 2PZ5A 2VNYA 3SLSA 4FIEA 3GOPA 2QOKA 3FPQA 2CCHA 5M56A 5K4IA 5HCZA 2ZAZA 4KD1A 4FK3A 2QO2A 3C7QA 2VTQA 3NUYA 4RX5A 2IG7A 3N4TA 5F94A 3ULIA 2PWLA 3UIXA 2BCJA 4FL2A 2JDRA 2YM6A 4FKRA 3I0QA 4LRKA 2XIZA 2UUEA 4ARKA 1M52A 4IAYA 5CS6A 3POOA 4QYGA 5M44A 5FP5A 4QMMA 3COIA 4MXAA 1NVSA 2WOUA 1QPDA 4XG6A 3ZC5A 4TT7A 5C4LA 4KKHA 3SC1A 3ALNA 1U5RA 5DFPA 4RWLA 5HKMA 4GYGA 4ACHA 2PULA 4PP7A 2VTOA 1BL6A 2OXDA 3WF8A 2XK3A 4O6LA 4JDKA 4Q5EA 1PKDA 2BKKA 5LMKA 1GZNA 5HIDA 2R4BA 5FM2A 5CX9A 3MIAA 4EC9A 2WELA 3NDMA 4MTAA 3RHXA 4GT5A 3PG1A 3QYWA 4BDKA 2GNGA 2WTKC 4JOAA 4U79A 4R3PA 3BHVA 4AGWA 3I6UA 3FV8A 2UZBA 4UZHA 4WNKA 2IN6A 3U4WA 5A6NA 3ZXTA 2F9GA 5AUWA 2QI8A 5ICPA 3RGFA 4GU9A 3VC4A 5HD4A 3A60A 2PVFA 3UOHA 2QG5A 4FSNA 4YNOA 2E9PA 5AA9A 4QP4A 3FL4A 3U55A 3UPXA 3JVSA 3AC5A 1YI4A 4IWDA 2GS6A 2YJSA 4C61A 4MXYA 4A4LA 2HOGA 2C6LA 3G6HA 3OWJA 3PZHA 3FI4A 3PP1A 1PXPA 2Y6MA 4ZTHA 4NFNA 4E5AX 4YZNA 5A4CA 4YZCA 3P9JA 4Z7GA 3C4EA 3QF9A 5JZNA 1JLUE 3G33A 3P4KA 5C03A 3KKVA 2W4JA 5H3QA 3FBVA 2G2IA 4APCA 1ZYCA 3QUDA 4UMQA 4I6BA 5AEPA 3LCKA 3ZOSA 3DOGA 3BYOA 5BUJA 5ACBC 1PXIA 3ZZEA 3AC4A 1GIJA 4AA0A 4BN1A 1VYWA 2QOCA 1M7NA 5HVKA 2EB2A 2VTSA 3JYAA 5CXZA 3KN6A 3KMWA 3RBWA 3WILA 3D83A 4N57A 2PVHA 4JJRA 4EJNA 1H0VA 2PYWA 2CGXA 4I20A 4L44A 2BAJA 1ZWSA 3QZHA 4FV1A 3GU8A 3TG1A 3QKKA 5CSWA 4EK3A 3S1HA 2OJ9A 4IE9A 3PSCA 3DBCA 1RW8A 1M14A 1STCE 3DLZA 2V62A 3KF7A 1IEPA 2QKRA 4PY1A 3DJ7A 4K2RA 3R83A 4DH5A 4JRVA 3QFVA 2FSLX 2NP8A 4HGSA 4RZVA 1Z9XA 4NL0A 2J0LA 4JG7A 1YI3A 4D4SA 1HCKA 2WPAA 3CQWA 5A4EA 2VWYA 4NTTA 5HEZA 2PUPA 2PVRA 5J9YA 5AP3A 2Z7SA 4WBBB 2GHGA 5CWZA 5L6PA 4DG0E 3FMNA 4ZMEA 4DYMA 1UKHA 4U41A 3GFEA 4W4YA 4QP2A 2NRUA 4HPTE 4FZFB 4P2KA 4OBPA 3GFWA 3PA4A 5J87A 4QYEA 1UU7A 5CVHA 1QPCA 5D9HA 1JKLA 1RJBA 2FA2A 5BMSA 4XG3A 1G5SA 1ZYLA 3CGOA 4MXXA 5BNJA 3A7GA 3O8UA 3Q96A 5D10A 4MHAA 3IQ7A 2BZKB 3QXOA 2YFXA 3RNIA 2HZ0A 3BBWA 2QHMA 4ANLA 3EHAA 3HDMA 4KBKA 5HD7A 3UBDA 4MH7A 1DAYA 5E1SA 2X2KA 4OW8A 5J7BA 5JQ8A 3B2TA 3PA3A 4BI0A 3OCTA 1PKGA 4W4VA 4JBOA 4C57A 3ELJA 5J7HA 3COHA 3HV7A 4V04A 4U44A 4FKGA 5FTOA 1NY3A 3T9TA 2PTKA 4FUYA 4TYGA 3NAYA 2B52A 5DE2A 5CEIA 1PXKA 1SYKA 4A9SA 4E6DA 4K0YA 3BLRA 4M68A 1YHWA 4BZOA 2UW9A 3IGOA 1ZZ2A 3OWKA 3VHKA 3MY0A 3VULA 3PPZA 3ZRLA 4JG8A 4YLLA 5EOLA 5AIRA 1GJOA 4GU6A 3ZLXA 3QKLA 2BRHA 3CIKA 1PMNA 5I9WA 1CM8A 2ZDTA 3BLHA 5DR6A 3N51A 4IX6A 4JBVA 3V51A 3SG9A 4EH9A 4V05A 3UE4A 1GZOA 2XM8A 5AP5A 3TJDA 4LV5A 3PJ8A 2GNIA 2X4FA 3FQEA 2HZNA 3ZSHA 3G6GA 4LV8A 4BC6A 4DTKA 3DPKA 3R63A 2C3KA 3GQLA 3FSFA 4OGRA 5M09A 3PVUA 1KOAA 3PJ2A 3P5KA 1DM2A 4P5ZA 4YJQA 3KCFA 4ZJJA 3BX5A 4USDA 5IPJA 3WI6A 5J9ZA 4DA5A 2J51A 3DK3A 1YXXA 1IG1A 4PTGA 1YVJA 2PVJA 4JIKA 1UNHA 3VJOA 4EOJA 5HGIA 3LMHA 4NEUA 3QTUA 3QYZA 4TRLA 1OI9A 5BPYA 3F7WA 4DG2E 3LXNA 2GS2A 1DS5A 2VX0A 3T3VA 3FMJA 3OT3A 2BDJA 4QMTA 2YWVA 3QZFA 1RE8A 3IDPA 1WVWA 2XNGA 3KXGA 4RA5A 4W8DA 3MI9A 4BCHA 3R9RA 3KY2A 4O91A 3UYSA 3HMNA 5GZAA 4M66A 4GIHA 4KRDA 3ROYA 2UZNA 2G2HA 3DNDA 4QMLA 3UDBA 5IH5A 3POZA 2JLDA 4CSVA 2R3KA 4D9TA 4GG7A 2UW5A 4FSYA 4N6ZA 4QD6A 3VUIA 4B9DA 4F7LA 4PWNA 5CEPA 3MH3A 3AD6A 1UA2A 3IW8A 1YQJA 3NUXA 4ZAUA 2ZYBA 1YXTA 4AT4A 5CEOA 3LMIA 5CAOA 4ALUA 3IG7A 3G0FA 3LLTA 3DT1A 5H9BA 4EEVA 4F0GA 5LQFA 3QTQA 3CPCA 4QMVA 3HA6A 3HDNA 5EDPA 2HW6A 3MN3A 2VD5A 2XP2A 3NVKI 4DEAA 3TV6A 3ZLWA 1MP8A 3GC0A 5KUPA 4D5KA 2VWBA
chains in the Genus database with same CATH superfamily
3AXWA 2BHEA 1ZMWA 2F7EE 4O21A 4N70A 3NYNA 3QTXA 4XV2A 2PZRA 4FE2A 4FKPA 5KHXA 4F08A 2XK7A 5KX8A 3NSZA 4TKSA 1PXJA 3DGKA 4LMUA 4R1VA 5A6OA 5JT2A 3NNUA 3ZTXA 2AEGA 3U9CA 4R7IA 4CV9A 4ZY4A 2Z7QA 3LFDA 5BYZA 4GUBA 4S30A 2W06A 3DLSA 3WZDA 3VAPA 2XS0A 4DEHA 1W2DA 1FVVA 5EHOA 1YOLA 3CPBA 5AADA 5ITAA 1ND4A 3VNTA 4ITHA 4E6AA 5FG8A 4IM2A 5EM8A 4WNOA 5IDPA 2QOBA 4DTBA 2HAKA 3LLAA 3OCSA 4U80A 3WIKA 3R7VA 4FV2A 2RG5A 1CSNA 4FSRA 4BHZA 1OKWA 4C35A 3Q2JA 3LM0A 4DCAA 4AZVA 1LUFA 2OF4A 4IVCA 4DHZA 2O63A 5DRDA 5IEVA 4L00A 3RAIA 3VS2A 4Q9ZA 3DCVA 3U4UA 4XBUA 3A62A 4HYHA 4HVIA 3F88A 3SKCA 1Y8YA 3ZDIA 2BFXA 5IEXA 4AU8A 4H3PA 3ZS5A 2FYSA 3K54A 3SHEA 5M55A 4MX9A 3FSKA 2HENA 3D5VA 2CGVA 3AC1A 2A4LA 3UP7A 3W0QA 3V8WA 3FY0A 1Y8GA 3KU2A 4G3CA 4JNWA 5CT7A 4A9YA 4B4LA 3IOKA 3ZDUA 3BRBA 5EG3A 3NNWA 3QCXA 4PRJA 2DYLA 1MUOA 4IANA 3MPAA 3TV7A 3UJGA 5IH4A 3KREA 3E3PA 4YU2A 4XHKB 5EYDA 3LE6A 3CTQA 3R21A 2CHLA 2QLUA 3IDCA 4IAKA 4X2GA 5IZFA 1UWHA 4GL9A 4F0IA 4RLLA 3LJ1A 2CPKE 2YM3A 2YIQA 4FGBA 3UO6A 5K9IA 3F82A 4FTMA 3TI1A 4BDIA 1YOJA 3L8PA 4D0XA 3C4FA 4EONA 5EKOA 4FT7A 4AX8A 4DHJA 5I3OA 2JAMA 3QTRA 4PUZA 4UALA 4QDVA 4F70A 3JXWA 5HLNA 3UPZA 5BQ0A 2BZIB 5TF9A 5LMBA 2OJJA 3PJ3A 3NYVA 2HCKA 1ZY5A 4C34A 4TY1A 1CDKA 1H1SA 4X2NA 3ID6C 1L8TA 4MBIA 3T8OA 4WBOA 5E8TA 3RK5A 3VW6A 4DGLC 4CYIA 2XAOA 1ZLTA 4ACDA 3Q60A 2QCSA 3IOPA 3OS3A 3MPMA 5K3YA 4AS0A 1MQ4A 3LFEA 3KIOC 2JD5A 2WQBA 5BYYA 5DHJA 3R2BA 5EKNA 2KULA 5AAGA 2ESMA 3L9MA 2JFMA 2JITA 3G2FA 4F7JA 4MNEA 4FEVA 4U45A 3KRWA 3JVRA 5TO8A 5JFWA 3TM0A 5HLPA 4C4IA 3Q5ZA 4FIIA 4EKKA 5J5SA 4RIOA 5A4QA 4FIFA 5HI2A 1UWJA 1WVXA 2VTRA 3GT8A 4G3DA 4PPCA 4U40A 5EI8A 3C51A 4FKOA 4S2ZA 2YM4A 3LXPA 2VX1A 3FZ1A 4EH5A 1DI9A 4NM3A 3R8LA 3R8UA 2P2HA 1LR4A 3C4WA 3MIYA 4FBXA 4IBMA 3TJCA 4E4NA 2ETMA 5HU9A 5I9XA 1PXNA 4AN3A 2JGZA 4AXFA 3R0TA 3DJ5A 3V04A 4YLKA 4L52A 1R0EA 2XKDA 4MBLA 3Q53A 2EB3A 5CSVA 4Y73A 4GT3A 3BLAA 5KBQA 1J7LA 4KS8A 4S33A 3E8EA 1APME 4AXAA 4RBLA 4MUQA 4IWPA 4D28A 3R8ZA 4ENXA 5IH6A 3QQLA 4N0SA 3EFLA 3LZBA 3UODA 3W8QA 5HZNA 1ST0A 3QL8A 3OG7A 3P23A 5IQCA 3UIBA 4HZSA 2W1EA 4QYFA 2RKUA 2XRWA 3L9NA 1MRYA 4GH2A 3UZTA 4FEWA 3SA0A 4FIHA 1PMVA 3QHWA 3R8PA 3MVMA 1ST4A 4RIWA 3FI3A 2Z7LA 4OAUC 2VTNA 2ITYA 4YLJA 5HLWA 5EDRA 2C30A 3UTOA 2PVNA 3D5UA 4XJ0A 4FKIA 5CU0A 5KO1A 3ROCA 5DGZA 4XG8A 3GEQA 2X7GA 2XIYA 3KCKA 4BTJA 4JX7A 1ZYJA 3E87A 3UG1A 1OGYA 4IB0A 3O8TA 3D4QA 4FV3A 5E8VA 1CKPA 4HOKA 5LVLA 4FVQA 1OL2A 2WMXA 5EM6A 2PK9A 4JRNA 4L6QA 1IASA 4GFGA 3AQVA 1UNLA 4FT0A 2HW7A 1NVRA 2VWZA 3OT8A 2WD1A 3G5DA 1KSWA 3KXZA 1H26A 3HYHA 5L6WL 1YXVA 3SXRA 3P08A 4BRXA 4RLKA 2CLQA 3CLYA 3UMXA 5B7VA 2ITXA 4R7HA 5KCVA 3U51A 3ULZA 4LFIA 5BUIA 5L6OA 1BI7A 1CMKE 3EL8A 1HOWA 4DBNA 4Y72A 4O6EA 4Y5HA 4FF8A 5TR6A 3TEIA 3C4CA 4L9IA 4QMPA 3JR1A 4GKHA 3ORNA 3WF6A 2AUHA 5K4JA 3KXNA 4YJRA 5KMMA 3C4XA 4W8EA 1JSTA 5LJJA 1SVHA 4A9RA 4HW7A 3CQUA 2CJMA 2CLXA 1OL7A 4TWNA 2J50A 1XH8A 3RWQA 3HMMA 5ETAA 3T3UA 4PF4A 4L43A 1K3AA 3NS9A 4QYYA 2B9FA 1ZYSA 1R3CA 1ZMVA 4FNXA 4M84A 2X1NA 4E20A 2PUNA 1U46A 2BMCA 2QO9A 5KMNA 3N4VA 3LQ5A 4DFZE 4IVAA 1GIHA 3PFQA 1OKYA 2UZVA 4M69A 4CZTA 3F61A 3MS9A 4UXQA 5ANJA 2WQOA 2X8DA 4GV1A 4KKGA 5D7AA 4X3FB 4IZYA 2WQMA 2GNJA 5FBNC 3UZRA 2WMSA 4NZWB 3WYYA 3EH9A 4BYJA 5IG1A 4AQKA 4LUEA 5BX0A 2R3HA 2BDFA 3DXNA 2PVKA 3I7BA 3KL8A 3G9NA 3W16A 3Q4ZA 3CP9A 1XKKA 4CQEA 3F3VA 4HVDA 5M53A 3IW6A 2ETRA 2J0JA 4OLIA 3TUBA 3RKBA 4YPDA 4D2WA 4FTIA 3EKKA 3HAMA 2CGUA 5EYKA 3QRTA 4FJVA 1JVPP 2YWPA 1W7HA 3QQGA 4BGGA 4CLJA 3DFCB 5AIKA 4XNEA 4BJJB 3NRMA 3K3IA 4QPAA 3QQFA 3K2LA 4YC6A 4TXCA 5FRIA 3AC8A 4MD7E 1XH7A 3SAYA 5CAVA 4J98A 3R8VA 5BVFA 3CBLA 2GNFA 3FI2A 4LOQA 5LVOA 3RHKA 5HBHA 4P90A 1CKJA 1SVGA 1EH4A 4ZP5A 2WMQA 4R1YA 5HE0A 4DINA 2VO0A 3MVHA 2WIPA 4RVKA 3DKFA 5M4IA 4IHPA 3NZ0A 5TE0A 3M11A 1XH4A 5IQBA 4K18A 2XBAA 3R7YA 3GCPA 4BHNA 4C3FA 3QWKA 5K0KA 4MCVA 5KKRC 5DEWA 3NGAA 3ODYX 1WBSA 1Q24A 1JKSA 3MB6A 4O22A 3W2SA 5HIBA 1UKIA 5HCYA 4CG9A 4F9WA 3OW4A 3ZM4A 4I0SA 1O6YA 2BROA 3MJ1A 2UZEA 2GMXA 3ZXZA 2UW6A 4XYFA 2XKCA 4Z3VA 4J7BA 3BE9A 1OIRA 3MYGA 4QTCA 4CZUA 3VRZA 4XRLA 2QD9A 4O4FA 2DUVA 4K11A 4DT8A 4WG3A 3VQHA 2FH9A 1Q8UA 2C6KA 3HV6A 4ZJVA 4UX9A 4JI9A 3GCVA 4TN6A 3VUGA 4QQTA 4BDGA 5A46A 3UC4A 5DR2A 3PVBA 4KA3A 4M7IA 3LHJA 2CNVA 3UOJA 5BVDA 1WBNA 4OAVB 4FTQA 1M2RA 2XMYA 1A9UA 1YHSA 5I3RA 4LL0A 4C4JA 2WNTA 5LWNA 4OTWA 4WOVA 3RK9A 4LRJA 2R3PA 4D2RA 3UDTA 4NU1A 1FVTA 3C5IA 4QP8A 2PE0A 3EQDA 1SMHA 2BIYA 4JBPA 4EOIA 4GFOA 4J71A 4J97A 3O23A 4GJ3A 4K1BA 4GSBA 3L9LA 3CKXA 3S95A 4D4RA 3LFAA 5CAPA 2YCSA 4RG0A 3PIZA 3MJ2A 3QD2B 4CFVA 4ZY5A 2VTAA 3CY3A 3HECA 4CYJA 3U87A 1AD5A 4I94A 2XEZA 4UWBA 3PRIA 4LGHA 3RK7A 4CCUA 2HWPA 5CYIA 4H36A 4PMMA 2YN8A 4NIFB 4WO5A 5AMNA 5A14A 2C1AA 4I5HA 1ZZLA 2HY0A 4L46A 4NUSA 3V8TA 2IJMA 1H00A 1BKXA 2QU6A 2JDOA 2W1HA 3DTWA 1R78A 2HELA 3F66A 3HV5A 3PXRA 1IRKA 2J4ZA 2VTPA 4IVBA 3TZ8A 2C0IA 3RP9A 4CFUA 4EYMA 4NWMA 4C02A 2GTMA 5HNIX 3DK6A 5AAEA 3EFKA 2Z02A 5JFVA 3OD6X 4AG8A 1JKTA 4S34A 4ERKA 5GIOE 3PXKA 4OTPA 1GY3A 1O6LA 2B9HA 3PE2A 4IACA 3V6SA 3HZTA 4A07A 4B8LA 4YSJA 3IDBA 4I92A 5HQ0A 3HAVA 3PLAE 3ANRA 1GZ8A 2XUUA 1ZRZA 3DDQA 3GQIA 3OBJA 3CEKA 3JS2A 3OEZA 2BVAA 2EXMA 4FSTA 5DT3A 1A48A 2QONA 2AC3A 2J2IB 1P4FA 3QGYA 2JBPA 3R22A 3KULA 5AUYA 1MRUA 3M42A 2YISA 3ENMA 2IWIA 3QTSA 1R0PA 2GQGA 4HYSA 2P4IA 1M2PA 2X8IA 3H9RA 4KUJA 4FSUA 3E64A 3EN7A 4H1MA 2EU9A 3HRBA 5CENA 2YIRA 3O8PA 4G9CA 3C4ZA 4FEQA 5AWMA 4FTOA 4M0ZA 5T6KA 5K5NA 1XBCA 2WB8A 3DXPA 3A99A 4QP7A 5C8KA 3LKMA 2WMAA 3GU7A 5A9UA 3MTLA 1IAHA 1OPLA 2C6EA 3BHHA 1REJA 5LCJA 1Y6AA 1OIQA 4A9UA 2EXEA 2XAMA 3TV4A 3OWLA 5J8IA 5ACKA 3PYYA 1J1CA 4R3CA 4XG4A 4RIXA 5ETCA 3IS5A 2YERA 4KIQA 2C0OA 3PY1A 1R1WA 2LGCA 2CNUA 4O0WA 4PDSA 2O8YA 4M3QA 3QLFA 5FM3A 4HNFA 4FKUA 3AMBA 1FGKA 3LVPA 3R1NA 3CE3A 3NCGA 3MFRA 4AZWA 3G51A 4F6UA 5IUGA 5M4UA 5KMKA 4QTBA 3PJCA 5HTCA 4RFZA 3BHTA 4FGRA 4I1ZA 3KMMA 5AM7A 4F78A 2C3JA 1GNGA 1QPJA 3BWJA 3EQIA 2YAAA 4L8MA 4V01A 5JQ5A 3OUNB 2HXLA 3COMA 4UV0A 4AW2A 4KIKB 4FR4A 4E3CA 4BDEA 3ZEWA 4O83A 4KS7A 3DDPA 4IM0A 5DH3A 4C0TA 4OR5A 5M4FA 3ZM9A 3ZLSA 4L3LA 3EOCA 2G9XA 3HRCA 4RX7A 5D1JA 2ETKA 1W83A 3DJ6A 2ITWA 3IW7A 4XUFA 5DG5A 1NW1A 2NNWB 4IXPA 5I4NA 4L42A 4TYHA 2XIKA 5CEMA 3VF9A 4F63A 4YTFA 5IA1A 2C4GA 1B6CB 1XH5A 2O64A 2RG6A 4O4EA 4XS2A 5DWRA 2X6EA 4EYJA 4ZEGA 4DGMA 2XB7A 4TWCA 5ETIA 4J99A 3VS7A 4F7NA 3ZO4A 1ZYDA 2CDZA 4O2PA 4Y8DA 4DEIA 5GZ9A 3C5UA 2XKFA 3S2PA 4G6LA 3JPVA 4ZTSA 5EHLA 4DHIB 2F7ZE 5J1WA 1Y6BA 5C27A 3GOKA 3EN9A 2Z8CA 1OMWA 4AGCA 2B55A 2J5EA 2YITA 4FV0A 3W0RA 2YHVA 1FINA 1UNGA 2BDWA 3LQ3A 4RC3A 4CCBA 4EH3A 3FLZA 5AV0A 3NYOA 5IU2A 3NW5A 5IA4A 3BQRA 4N6YA 1M7QA 1JOWB 1FQ1B 3N4UA 3FYKX 5DEYA 3SG8A 5IUHA 2XK4A 2OU7A 4MD9E 4EK5A 4BCGA 3I0OA 4ZLYA 2ERKA 4BWPA 2QODA 3VS0A 4HVSA 2DWBA 5DR9A 4UMRA 2C1BA 3BV3A 5CVGA 3E8CA 2QO7A 4X2FA 2X9EA 3VBXA 3ZEPA 2W0JA 1ZAOA 3CQEA 4XMOA 4JBQA 4JQ7A 4CFNA 3VS1A 3P86A 4O1OA 5DNRA 4I5MA 3D9VA 3MVJA 3MFUA 4OTFA 2HK5A 4MNEB 4NM0A 4ANMA 2X9FA 1G3NA 2C69A 4MQ2A 3AMAA 4EH8A 2FSOX 2VTMA 4QMSA 4QYHA 4EI4A 4N57A 3VONA 4H05A 4FT3A 2X7FA 5C01A 4BTMA 2UZWE 1ZMUA 4HGEA 3KC3A 5AP0A 5HX6A 2FSMX 2Y9QA 3G15A 4XEYA 1XH9A 3UNJA 4CKJA 4O82A 3NMUF 4II5A 4YHJA 4XOZA 3SVVA 4XX9A 4BDJA 3OXIA 4F6WA 3LM5A 1KUTA 3DBDA 2ZV8A 4A4XA 2QR7A 4BZNA 2YDKA 3FUPA 5L2IA 3VF8A 1WBPA 4HPUE 3MB7A 5I0BA 1H0WA 3VO3A 3OHTA 5EW8A 3HP2A 4GK4A 5TKDA 4DTAA 3C0IA 4WUNA 3WE8A 1G8AA 1PRYA 2GHLA 3R1QA 3PXZA 5KZIA 4G16A 1RQQA 1W8CA 2W4KA 4JG6A 4EBVA 1E1VA 4O7NA 4C7TA 3KVXA 1SNXA 3I81A 4EOPA 3NW6A 3F2AA 4I3ZA 4M12A 5FUTA 2R64A 3R2YA 3ZFYA 3GUBA 5EM5A 4NTSA 4JXFA 5CSXA 1H01A 5H2UA 2BIKB 4ZTQA 5F4NA 1LP4A 1YXUA 2WTKB 3CC6A 1T46A 1W84A 4BWKA 3U6HA 5JRSA 4KIOA 3HA8A 3U6IA 4RVLA 4FG8A 4EUUA 3W55A 5JEBA 1Y57A 4YJOA 4FZ6A 5T3QA 4KBCA 4KKEA 5AV4A 1ZOGA 4DLIA 3ZMMA 3QRIA 4NJ3A 1CKIA 1PF8A 2WTVA 3BKBA 4EH7A 3DNEA 3RZFA 2OH0E 2X2LA 2SRCA 4QMQA 3IW5A 2Y7JA 3ZYAA 3RM6A 5J1VA 3BEGA 2Y4IC 1NT2A 3QCYA 5JGDA 1PY5A 3FE3A 1BLXA 3MH2A 4KNBA 4U81A 4E8AA 3AD4A 4CXAA 1BL7A 3F5XA 5LMAA 5C26A 4C62A 3R9NA 4RT7A 2WHBA 4NCTC 4C37A 4LRMA 5ETFA 3D7TB 4EOQA 1QMZA 4O0VA 2O0UA 4M67A 3AKKA 3BPRA 2OXYA 4A9TA 4APPA 5G6VA 3L8XA 2C6IA 2IO6A 3FI8A 4W4WA 2W9FB 2WIHA 3HUCA 3BIZA 2YIYA 5I9VA 3WZEA 2UW8A 4W9WA 1DAWA 1V0PA 1TZDA 3L1SA 3NUSA 5AR8A 1NVQA 1UU8A 3WF9A 4QMYA 4EZ5A 2HWOA 4ZS0A 5CU3A 4PMSA 2GCDA 4DAWA 4RJ3A 2H6DA 3H9OA 3RMFA 2J0KA 4AE6A 3PTGA 3NIEA 3Q9YA 4DDGA 2RL5A 4Y85A 2QOHA 3FQSA 3FLQA 2Y4PA 4TNDA 4QO9A 3TKUA 3AKJA 5DBXA 1UU3A 2XNBA 3QTZA 3R1SA 4M69B 2PMNX 2BFYA 4MXOA 4CRSA 1H25A 3DXQA 3E7VA 3D0EA 3AC3A 1TKIA 4GW8A 4RWIA 4XBRA 2YZAA 2W7XA 2OO8X 3TZMA 1OIYA 4I22A 3VHEA 4WT6A 4M8TA 3BV2A 4E93A 2ZM1A 5HESA 1OL1A 3EN5A 5HO6A 4ENYA 3O17A 4J95A 2F7XE 2VWUA 1QL6A 4YGAA 3BZ3A 3EQBA 4WKQA 4GFMA 4FG9A 1Q5KA 2G15A 3EMGA 4RC4A 2CN5A 1GZKA 2EVAA 3C1XA 3ET7A 5E7RA 3FKNA 1Q62A 1H1WA 3FYJX 2IF8A 2WTCA 3JY9A 4E5WA 3TDWA 5JH6A 3QWJA 3DS6A 3LXKA 4E73A 2AQXA 3R73A 3IECA 4OBOA 2RF9A 3DKGA 4ASXA 4R8QA 1U5QA 3H9FA 4UB7A 4F65A 4O7TA 4QRCA 5AV1A 4BIBA 4C4GA 3OOGA 3VUMA 4ZSJA 5EM7A 3MDYA 4LOOA 3I4BA 1OITA 3IGGA 4MQ1A 5AP7A 2IW8A 3LXLA 3OWPA 4AOIA 4P4CA 4EOOA 2P55A 2YDJA 5AR3A 5HTIA 5ANDA 3I79A 5AV2A 3BWFA 4IEBA 1OVEA 4KINA 4UYAA 2QU5A 5FQDC 1Z5MA 3FC2A 4HGLA 2CKQA 1M2QA 5IF1A 5CT0A 4AAAA 4IDVA 3OF0A 4HCVA 4OTRA 2OFVA 5F20A 3TACA 4IX3A 2GSFA 3ORPA 4IAFA 2REIA 3QX2A 5E92A 4FKQA 4OT5A 4R77A 1WFCA 4XLVA 1MRVA 4PPBA 5E8SA 5CANA 2XJ2A 3TNQB 4EZ7A 3UC3A 2GTNA 3DQWA 4FT5A 3HL7A 2P0CA 3CJGA 3PP0A 5DT0A 4YNEA 4FTTA 2ZB0A 2JIIA 3QXPA 4BCMA 3QA0A 3II5A 4C58A 4E4MA 2UZOA 3TKIA 3F5UA 4ZIMA 2PE1A 3AMYA 2X0OA 2WQEA 5JN2A 1WBVA 3EZVA 4DFXE 3F3TA 2OKRA 4YHTA 4YP8A 4PMPA 2UW4A 2V22A 4BCOA 3ORZA 3RINA 5KMLA 4WSQA 5DMZA 2XK8A 3BE2A 3MH1A 5FDXA 3NIZA 4JIAA 2Z7RA 2GQSA 2J6MA 3AT3A 3U54A 2UZDA 2UV2A 3BU6A 2ITQA 1JBPE 2C6TA 4I24A 4O4BB 4P7EA 3MH0A 3R9DA 5HU3A 2H8HA 4FKJA 4EC8A 4MWIA 4HCTA 5GHVA 3Q9ZA 4YJNA 4FTJA 5AP2A 3BYVA 4MF1A 3UVPA 4D1ZA 5BV3A 2PZYA 5GJDA 1BX6A 4AGUA 4CFFA 4DFUA 4ANOA 2YAKA 2QR8A 4UMUA 5CY3A 5E8YA 4J53A 3HRFA 4IB3A 1KOBA 4FV7A 5LVPA 2PMOX 1ZOEA 2BKZA 2FGIA 4YC3A 4GVJA 1OPKA 5HORA 4JQ8A 4KBAA 2JEDA 3RNYA 3FMEA 3VUHA 1YRPA 2UVYA 2QOLA 4RSSA 4CEGA 4RWKA 3VBYA 4QEBA 3D5XA 4QPMA 3BYMA 4OT6A 3ORLA 2VRXA 2Y6OA 2BR1A 3GXLA 1GIIA 2Q0NA 2UW0A 2RGPA 2X39A 3MPTA 4RZWA 3V01A 5CEKA 5I9UA 3OVVA 4BGHA 4OTQA 3W0MA 2VZ6A 4DT9A 4IDTA 4A4OA 4D2SA 4H1JA 4C3RA 4IVDA 3FXWA 4OBQA 4DEBA 4QMXA 3CY2A 5DOSA 1OECA 2R3OA 3F9NA 4O27B 4BB4A 2XYNA 1IA9A 5IA5A 4M15A 4O0XA 4JR3A 4CTCA 3FEGA 2BUJA 4NKAA 2J90A 4FV6A 5E8XA 4CT1A 2AC5A 2YM8A 5AX9A 4BYIA 3LPBA 4O81A 4O4CA 4WD5A 3ZO3A 4BIDA 2OICA 2R3GA 4ORKA 3FC1X 4U42A 5IA0A 1LEWA 3ACKA 3VBVA 3NUAA 3HLLA 2C6OA 3R1YA 2Q0BA 5HE1A 5HG5A 5CF5A 3KFAA 4BZDA 3Q4CA 3UVQA 4FSZA 2R0UA 3QX4A 4L67A 4JS8A 1ATPE 5CTPA 3HVCA 3MA3A 3R6XA 3TZ9A 4R7BA 4ERWA 2JKKA 3DKOA 4W9XA 3PPKA 1KV2A 2WOTA 5KMJA 2ITTA 1AGWA 4F1OA 5BVOA 4AAYA 2G1TA 5CU4A 3S4QA 4PP9A 4FV8A 1IR3A 3WZJA 4RQVA 3UIUA 4AZFA 5JK3A 4EZ3A 4IX5A 1J91A 2R5TA 2C68A 4YMJA 1JKKA 2XH5A 2YIWA 3FL5A 3LCDA 2ITPA 1KE7A 3PXYA 4RIXB 4TZRA 3R7EA 4E6CA 3F2RA 4HZRA 3W1FA 1XR1A 2V55A 3P7AA 1Q4LA 4E26A 1XBBA 3O5AA 4ANNA 3GVUA 1URWA 4QNYA 4I6HA 2BTRA 3MV5A 4RX8A 5AR2A 3KN5A 4BR3A 1XH6A 1YKRA 4FZ7A 1V0OA 3IO7A 2W1FA 3PVWA 3OROA 4S32A 3FLWA 2WEVA 4BL1A 2X8EA 5HO8A 3UNZA 2WU7A 1FPUA 4O0YA 2XNPA 3DAJA 2ONLC 3MWUA 2JKQA 3VWAA 4G3EA 2J0IA 4YBKA 3G0EA 4F1MA 1PW2A 3SD0A 3WARA 3DK7A 1FBNA 2YZLA 3HX4A 3DY7A 3V5LA 3B2WA 5E8UA 5AP1A 4IAIA 2I0VA 5L2WA 2KTYA 4BBFA 2XKEA 2JDSA 4DGNA 3FZSA 3OCBA 3FZOA 3UYTA 3M2WA 3DKCA 3ENHA 1WBWA 4IJPA 3F2NA 5DPVA 4BBEA 1J7UA 1FMKA 1OPJA 3A4PA 3H10A 4E4LA 2QG7A 4KSQA 4YZBA 5GZ8A 3PXFA 1YW2A 4CKRA 4FA2A 3EB0A 2W1CA 4G3GA 3SQQA 2XBJA 3QAME 3VQUA 2X2MA 3PSDA 5EYCA 5FBOA 2O65A 3NAXA 3P7CA 5A54A 1KE8A 1JSUA 4I4EA 3R9OA 3V6RA 3ZONA 4OTDA 2B1PA 5CEQA 3E92A 5LOHA 2C5VA 3I5ZA 5DN3A 4TL0A 2E9VA 5DVRA 3KMUA 2Z60A 4EQUA 1YWNA 5F9EA 5JFXA 2ZMDA 4RVTA 2OZAA 3P78A 3CD3A 1A06A 4HYIA 5HNGA 4CVAA 2R3IA 3WBLA 2PMLX 4G6OA 5HIEA 4FZAB 4B7TA 3ERKA 4IMYA 3K3JA 2B7AA 1YDRE 4ALVA 2PY3A 2RIOA 4H39A 3KK8A 4Y5QA 2JKOA 1Q8WA 2R3NA 2W96B 4FTKA 4GT4A 3AG9A 4GEOA 3PIXA 4BVUA 2BRMA 4EUTA 4FICA 1J1BA 4CMTA 4XG2A 2XZSA 4IADA 3D2IA 5L8LA 3TXOA 3BL7A 3CGFA 3EL7A 4BCNA 2UZUE 4JDJA 4G34A 3RPSA 5FEQA 2F57A 5AFVA 3R30A 3F69A 3PY0A 4GVAA 3R7OA 4IC8A 1W0XC 4TW9A 3H0ZA 4XP0A 3LJ2A 4RX9A 5DA3A 5IQHA 5GJFA 2WMVA 1PYXA 4DHFA 2GS7A 3FMKA 3ANQA 5I9ZA 5JRQA 3GCQA 4AZTA 1G8KA 4FVPA 4JDIA 4F6SA 3QHRA 4FT9A 3TT0A 4H3BA 3H4JA 4N4SA 3ZCLA 2H34A 2UW3A 3DA6A 3R7IA 1WMKA 4C4EA 4D2PA 3Q6UA 3UOKA 5FDPA 3GC8A 4FKVA 4I5CA 4AT3A 4LI5A 3A7FA 4FOCA 4TWPA 3ZRKA 4E6QA 4FX3A 4Z55A 3PVGA 5HVJA 1ERKA 3WE4A 3UQCA 2WTJA 3FLSA 2YEXA 5M08A 5CSPA 2VTHA 4IWOA 4QTEA 4HVHA 3BU5A 2X6DA 4WG4A 3EYHA 4C2VA 5AJQA 4ASEA 3TIYA 3TN8A 3ORXA 1Q8YA 3PSBA 4FK6A 4RJ6A 4U43A 4YZDA 3DAKA 3NNXA 4Q5HA 5C8NA 4JX3A 2I40A 2XNMA 2C3IB 4IWQA 4F9YA 4YBJA 5IA2A 1TVOA 1T45A 4JDHA 4M14A 1OUYA 5E90A 3ALOA 2BALA 3QTWA 3R9HA 5B2LA 2YDIA 1RDQE 1JQHA 5C4KA 1X8BA 3MFTA 4F9BA 2Q83A 4O7ZA 3VS4A 3P1AA 4CTBA 1Y91A 4K8AA 5ANKA 4FMQA 3FZPA 4IB5A 3W2PA 4FC0A 3UQFA 3TCPA 3DB8A 4G6NA 4I4FA 1XWSA 4O1PA 1VZOA 2YABA 4GS6A 2OWBA 4QTAA 3RCDA 4B99A 4DFNA 4C59A 1OM1A 4BDAA 3W2OA 4USFA 2IPXA 2XF0A 1H1RA 4NCTA 4CMOA 2R2PA 3F3ZA 3ZO1A 1UU9A 4E1ZA 3SW4A 3FPMA 5C9CA 4DCEA 2B0QA 4GK3A 3LAUA 4AW1A 3A8WA 4BDFA 3PIYA 4ZS4A 2ITVA 2XNEA 3MA6A 4D2TA 3NLBA 4XCUA 3LQ8A 5CI6A 2QNJA 4J1RA 3QKMA 5HX8A 3O0GA 4OUCA 4FKSA 4AW5A 2XVDA 2ITUA 2YLFA 4Q9SA 3I60A 2E2BA 4BDBA 3U8WA 4FSWA 3NVMB 4UWYA 3VVHA 4FKWA 4ZLZA 4G5JA 2FUMA 2W5HA 3W32A 4BWXA 4BKZA