3COKA

Crystal structure of plk4 kinase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
267
structure length
234
Chain Sequence
SLATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKESDVWSLGCMFYTLLIGRPPFDTDTVKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PLK4
publication title Crystal structure of PLK4 kinase.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 70
structure length 234
sequence length 267
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cokA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cokA01
1IA9A 1UV5A 1QMZA 2W1ZA 3PVWA 3WZUA 2JKOA 4BDKA 4WG3A 2UZBA 4J95A 3F7ZA 3HV7A 5AR4A 3NUNA 2CGVA 4BI1A 3RAHA 4IZAA 4BCMA 2DQ7X 4DG2E 3E3BX 3OY1A 5HIBA 3O17A 2W17A 5AR2A 5GIPE 4I6QA 5GJDA 1H0VA 2I6LA 3AOXA 3CGOA 3VS3A 3QCQA 4U8ZA 4BWKA 3LQ5A 4MHAA 2VTMA 2J50A 2YN8A 3DZOA 2NPQA 2VN9A 3ERKA 3F69A 3HDMA 4ALVA 3OW3A 4X3FA 2O2UA 3ORMA 3R0TA 5HLWA 4YSJA 2W4KA 3Q3BA 4QMQA 1KE6A 4O0VA 4OTDA 1W83A 2BFXA 3CP9A 3H3CA 3ZLYA 2XKEA 4U7ZA 3ZEWA 5FEQA 3NVKI 1DS5A 2GQGA 4JT3A 4UBAA 4JDHA 4YZNA 3EFJA 3EQGA 4FKOA 3FI3A 3FI8A 4P90A 5IQEA 3UYSA 3VAPA 2JEDA 1Z5MA 2NNWB 3QHRA 1GZKA 2CNUA 5LCKA 3R1SA 4CTCA 3IS5A 4JX3A 2R3LA 4O91A 2GS6A 3R1NA 3OOMA 4FZ6A 3ACKA 4QO9A 3ZRMA 3W33A 2YDJA 2ETRA 3V5LA 1U54A 5DYJA 2QD9A 2YJSA 2JDOA 4LRJA 3BV3A 3PPZA 5EOBA 4AA4A 4M13A 3OMVA 3UE4A 4NK9A 4O7VA 2WQOA 3VO3A 2DYLA 4FOBA 3W18A 2ZM4A 4L52A 4P5QA 3R8ZA 4PQNA 1QL6A 2X6EA 4KIOA 3SXRA 4BCJA 3UPXA 2QQ7A 2QOQA 4ZP5A 2FGIA 3QTXA 3S0OA 3VQUA 3VS7A 3P1AA 3UTOA 5LMAA 4FTMA 3GU6A 4I4FA 3NNUA 4IAFA 5I3OA 3R7OA 5CNNA 1GY3A 4LOQA 1QPEA 2PVFA 1PYEA 4YJSA 2XNPA 2B54A 1OIUA 4D2RA 3DKOA 2V55A 4UWCA 5A6NA 3SW7A 5H8GA 4RIWB 4YC3A 1OI9A 4X2NA 4ZSEA 5E9EA 4ANQA 4IB1A 2WQMA 4QP4A 2ZV2A 3I7CA 5CF6A 2VO3A 4V05A 4YLKA 3VW6A 2OZOA 3KFAA 2XNOA 5C9CA 4CMTA 1L8TA 4FTUA 3C50A 3ANQA 3PWDA 5IA3A 5HD7A 3ANRA 3EN5A 3PZHA 3DDQA 2GU8A 4DH5A 4Z55A 1XBBA 3DFCB 3BHHA 3WF8A 4D4SA 4FGRA 4PDYA 4X6RA 3NYVA 4FI1A 2A19B 3BLRA 3MVHA 4S31A 5DR6A 3POZA 3LM5A 4GT3A 4GJ2A 2C6MA 4D28A 4Q9SA 5C8NA 5M07A 1SM2A 4GL9A 3LFEA 4EK3A 1ZMWA 3GCQA 4HYHA 2GS7A 2QHMA 2VX3A 1J7IA 3S2PA 3FLQA 3RAKA 1JVPP 5CQWA 3CIKA 4ENYA 4FKGA 4HOKA 5DN3A 5AP7A 4RJ4A 4I5PA 3TG1A 4AX8A 3DNDA 3M42A 5HNGA 4CLJA 4FKPA 3VIDA 3LMHA 5A4QA 4L46A 3BBTB 3E8CA 3Q4ZA 4ACMA 3QQUA 4QMSA 3KB7A 5LMKC 4ITJA 3IGOA 3LQ8A 2R2PA 2O64A 1PKDA 3ZFMA 4AZTA 4F6SA 4Y5HA 5EYMA 5TR6A 5TT7A 4DEEA 3NX8A 4BBMA 3OZ6A 5DG5A 4WOVA 5BUJA 5JFWA 2WXVA 4PPAA 4XG7A 2B55A 2H8HA 1MRVA 2BFYA 2PSQA 1M2PA 3C5UA 1YVJA 4MXXA 5CAOA 3WIKA 5BX0A 5J87A 5CAQA 3ALNA 5E8VA 3Q4CA 4LRKA 4TYHB 4WNMA 2KULA 3QCXA 2YZAA 2UVXA 4YHFA 4PV0A 3IW6A 3R8LA 4NUSA 4G3CA 4KB8A 2CLXA 2XKFA 3C1XA 5K0KA 3D14A 3WF9A 4FV9A 2HYYA 4YZ9A 2Z7RA 3ZHPC 4FNWA 4UEUA 4DBNA 4O83A 4YHTA 3UO5A 4BKJA 2WU6A 3CD8A 3UIMA 3LJ0A 3F5UA 3OVVA 5DI1A 4DAWA 4AP7A 1MQBA 1P2AA 1J7UA 2CDZA 2W1FA 4BCNA 2WPAA 3E63A 1Q8YA 1MRUA 3I4BA 5C8KA 5KNJA 5G1XA 4XLIA 5F4NA 4R7BA 2V62A 3PZEA 1J3HA 3PJ2A 3RINA 4D58A 2H9VA 3GNIB 1OL1A 4EHEA 3FMHA 2C1BA 2VAGA 3GBZA 3ZXZA 4HCUA 3ORLA 3LFCA 1JAMA 4GUBA 5IEYA 2WIPA 4FE2A 2R7BA 3TL8A 3F6XA 4WIHA 3ZDIA 2BCJA 3AC2A 5IH6A 3VUKA 3VW8A 3AMBA 2PMOX 2XRWA 4GKHA 3QA8A 1PXMA 1UNGA 3E8DA 1VEBA 4ITHA 1PXIA 3AGLA 3MWUA 3A61A 4UWBA 3UC3A 5K4JA 4GW8A 1WFCA 5E8SA 5CASA 5CNOA 3HV4A 1FPUA 5AAGA 3LPBA 5KMNA 3GVUA 4V0GA 3BLQA 4BDHA 3KVWA 1H00A 1BMKA 2AC5A 5IISA 4MD7E 2NO3A 4OTQA 3HL7A 3N9XA 4D2TA 4QQTA 3EKNA 3QKMA 4FV5A 3NIZA 4RWKA 2YDKA 2VWBA 1Z9XA 4M69B 5AP3A 3D94A 1F3MC 2O63A 5CU2A 4LFIA 2P2HA 2VWZA 3L1SA 4ZS0A 2C6KA 3BE2A 3QTZA 3FZRA 3QUPA 4OBQA 2PVRA 4KD1A 4UMTA 2C6EA 2OWBA 2W1DA 3PWYA 4A9YA 1E1VA 4KIKA 3W10A 1JSVA 4QP2A 1YW2A 4R1VA 2XBAA 1PHKA 3NWWA 4OBOA 5KMMA 3KY2A 4AOIA 2WU7A 3GB2A 3TXOA 4WG5A 4I1ZA 4DYMA 3CJGA 2PVKA 2GCDA 4MQ2A 2C5NA 4OLIA 3O7LD 3D5VA 2XKDA 4QMUA 3HUBA 2UZUE 4CYJA 2F7EE 2PVHA 4QMMA 3ZFYA 3SOCA 4I6FA 1WBVA 5CSVA 4FG7A 2XK9A 3PIZA 4FTTA 5ANJA 2XIYA 3FSKA 3SRVB 2VNYA 1I44A 4G6NA 2ITNA 4AW5A 3V5TA 3D0EA 1BLXA 1U5RA 3KVXA 4FTNA 5DR9A 4AF3A 5TE0A 5E8ZA 4X3FC 2ZV9A 1BUHA 3FDNA 4G9CA 3JY0A 1OBGA 2W4OA 3RK5A 1JNKA 4A9RA 3THBA 4D9TA 4O0SA 5L4QA 3EFWA 4I20A 4NKAA 5DNRA 4GT5A 1Y8GA 3RPSA 4S33A 3C4ZA 2P2IA 5DHJA 1CMKE 3NNWA 4YTHA 4FEUA 5AA9A 1RDQE 3MH3A 1AQ1A 2WGJA 2UVYA 2JLDA 1UNLA 3UO4A 4KBAA 4PUZA 3OWPA 2FVDA 2GNJA 4I5HA 4U41A 3ZO2A 4FVRA 2QOKA 3LW0A 3PA4A 3C0GA 4EH9A 3NUYA 3VS4A 5CANA 3A7HA 2YM7A 3HZTA 2JKQA 3AT2A 4ZSLA 2WFYA 3HRBA 3L9MA 1PMNA 2XF0A 1YHSA 3IW7A 3NCZA 3ZLWA 4DTBA 3EKKA 2OI4X 2R3JA 1YXUA 5EFQA 5FBNC 5CZHA 4BWPA 3FHIA 3PSCA 3LMIA 2OO8X 3OWJA 4DT8A 1RE8A 2VWUA 2FO0A 4U43A 3TV4A 4C02A 5GINE 3CQEA 2VNWA 2VTJA 4NFMA 5LVLA 4ASEA 2UW4A 3MJ1A 3D9VA 5FM2A 5FTOA 4LMUA 4ZZNA 1CKPA 2CHLA 3HRFA 5HE3A 4FTQA 4LMNA 4KBCA 2E2BA 3R9NA 4BZDA 1H0WA 4M97A 1MQ4A 3IOKA 5CAPA 3P79A 4TRLA 5CU6A 1O6LA 4EQMA 3ZTXA 3AC1A 3LCOA 3QRUA 2EVAA 5L6OA 4RJ7A 4QMWA 3IKAA 1H1WA 3Q5IA 1IRKA 2GNFA 3QCSA 4Y72A 3ZC5A 4B0GA 3RPVA 3PXYA 3R73A 2O65A 1FVRA 1PW2A 3FJQE 4FUXA 4UWYA 4XNEA 4M12A 3U4WA 3LCDA 4ITIA 2ITOA 3REPA 3HMOA 5E7RA 2UW7A 4YR8A 3R02A 2JC6A 1R3CA 3FLSA 4WSQA 5HVJA 3GU8A 5HBHA 1UWJA 4FKUA 2OW3A 3OCSA 4I21A 5IUIA 3SVVA 2GTMA 1NVQA 2W9FB 4AZSA 4H3PA 4BTFA 4CGAA 1MUOA 3NGAA 4HGTA 4CT2A 4EOSA 4ERWA 3MVLA 3KULB 4NL0A 4ZEGA 4UMUA 4H3QA 3FC2A 2PE2A 3TKHA 3Q4TA 4EOLA 4E4MA 5E1SA 3KF7A 5IQBA 3IPHA 4J52A 4NJ3A 5DFPA 3UPZA 2BTSA 5BVDA 3QUDA 2UZLA 1Q61A 5CAVA 2X4ZA 3ELJA 4M68A 5JKGA 3QZGA 4IX5A 4RLLA 4I93A 4F0IA 5FM3A 3BE9A 5ETAA 2J51A 3QWJA 1Q8ZA 3ZO3A 4FV2A 3VS1A 4DE4A 3MBLA 3P7AA 3ZLSA 2W5BA 3VNTA 2LAVA 1UWHA 4RIWA 3II5A 1V1KA 3UYTA 5DLSA 4B8LA 4FL1A 2QOBA 5AUUA 4CYIA 2B1PA 4GU6A 5CVHA 2R3OA 4C7TA 3OD6X 5H8BA 2ERKA 2UZWE 4EOKA 2QKRA 4FIJA 4QMZA 2WEIA 4N57A 4I3ZA 5AIKA 2OIBA 5D12A 1U4DA 3EQDA 3NW5A 3P0MA 2IWIA 1WMKA 4OR5A 5I9UA 3IK3A 2OZAA 4RJ5A 3NW7A 3Q96A 3UMWA 3MTLA 3WF7A 4DGLC 5FQDC 2PHKA 2C4GA 2PZYA 4GSBA 5IQDA 5ANEA 2XNMA 2R64A 3FY0A 4D1SA 3H9OA 5IA2A 4UMQA 4O7ZA 2WELA 3MY0A 5CEPA 1UU9A 3UNJA 4MD8E 2I0HA 2W05A 2FA2A 5CS6A 5AAFA 4EHZA 2C68A 5B2LA 2UZOA 4IJ9A 1SVEA 2XMYA 5HE1A 3FPQA 5KKRC 3QTQA 5CU3A 4IB5A 4O86A 4NIFB 3C5IA 1LPUA 1XBCA 5CXHA 5F94A 2ITVA 5CX9A 5K4IA 4I5CA 5GIOE 1F0QA 3NAYA 3BEGA 4OUCA 1UKHA 4Y85A 4H36A 3FKLA 3SG9A 3ORTA 2IG7A 3E62A 4N6YA 4ANSA 4G5JA 4XP3A 4BB4A 1PF8A 4YJQA 4O7TA 3HA6A 4C2WA 1U54B 3KXXA 5EI6A 5DT0A 3P7BA 4YO4A 4YTCA 3ORZA 4BICA 2G2HA 5H8EA 5CENA 2C3IB 2XM9A 2BAJA 4GFGA 5BMMA 3TIYA 4YU2A 2W1CA 3OP5A 4UMRA 1OITA 4PF4A 4U3YA 3MH1A 3DBDA 3EL7A 4XJ0A 4UMPA 3LLAA 5B2KA 4QOXA 4AZFA 1SZMA 4FIHA 5M51A 3LXNA 5I9ZA 2F57A 4PMSA 4JQEA 2QG7A 4ID7A 5B0XA 3FSFA 5CAUA 3MB7A 4LGDA 5HTCA 5HCYA 1IASA 2C6LA 3P5KA 5AP0A 4ZSJA 4GFOA 4G2FA 5CF5A 3AD5A 5CI7A 2XNBA 2Z60A 1BI8A 3SXFA 5FXRA 2QOFA 4BGHA 5M44A 1NY3A 2JDRA 5HIDA 4BGGA 3C4WA 3DK6A 2BAQA 5CT7A 3C4XA 2CGUA 4FBXA 1K9AA 3I60A 3Q60A 4K6ZA 5L6WL 4EH5A 3BELA 5DH3A 1YRPA 5M08A 4DEAA 4HJOA 4HW7A 4PL5A 4RLKA 1UVRA 4W4YA 4CFNA 2BROA 2Y4IB 4LG4A 4FC0A 4C2VA 1OIYA 3O71A 5E91A 3RZFA 2WQNA 2OXYA 3UOHA 2OSCA 2PTKA 1QPCA 2QHNA 3MA6A 3SOAA 2UZEA 3P9JA 4AA0A 4ANLA 3GUBA 3K3JA 1OM1A 3OC1A 2C69A 4CNHA 4EKLA 3UOJA 5DIAA 5CEQA 4L67A 1KE7A 1OIQA 3E7OA 3ZM9A 5E90A 4A06A 2OJGA 2Z7QA 3A2CA 4L01A 4E5WA 1AGWA 3EQRA 2C0TA 2WHBA 2RFDA 4XG2A 4XLVA 3DU8A 3VJNA 4A4OA 2PZIA 2QLUA 3L9NA 5AFVA 3RVGA 2JBPA 4DF3A 5BVNA 2WIHA 2OH4A 3GC7A 3GGFA 5AADA 4LI5A 3UG1A 5IA1A 5C27A 5L2WA 1W0XC 2ZDTA 2FSMX 2HXLA 3ZSIA 2UW6A 4ASDA 4O84A 4M69A 5JZNA 1PY5A 5HG5A 4ZZOA 4NM5A 3CXWA 4ACDA 3KXNA 3SV0A 3L9PA 2H96A 3POOA 3CBLA 4PL4A 4EORA 5F20A 2ITWA 2C30A 2CN5A 4QRCA 3OEZA 3WI6A 3R7EA 2JFMA 2RKUA 3GXLA 1Q41A 2CCHA 4OTGA 3PLSA 1YXTA 2BKZA 2QLQA 4U42A 4ONAA 4RA5A 3QQJA 3V6RA 3N4TA 5EQYA 4DITA 1ZMUA 1A06A 2BRBA 2VTAA 3JYAA 4E5AX 3BHVA 3F9NA 5K9IA 4AN3A 4BTJA 4DFXE 4IVAA 4MNFA 1ZZLA 2IW8A 4KBKA 4XX9A 3UOLA 3C0HA 5BYZA 3VS0A 2O8YA 5HZNA 3ULIA 3G0EA 3MESA 5JH6A 1DI8A 4H1MA 2HAKA 2VO6A 3NDMA 2Y4PA 2YIQA 4F7NA 5JFXA 2V22A 4RQKA 3AMAA 4H3BA 4YJTA 3NNVA 4CFMA 4CFVA 1APME 4EOIA 2VU3A 4D4RA 3IDPA 3RGFA 5L2IA 3NS9A 2R3QA 1XKKA 5AUYA 2OXDA 4FSNA 3DGKA 4PPCA 3DCVA 4Y95A 5EHOA 5KKRB 4K0YA 4U79A 4AW0A 2QO2A 3VUIA 3MA3A 4I94A 3S00A 2R3NA 5HQ0A 5DRBA 4E6AA 1ND4A 3QZIA 2QI8A 4FT7A 4IVBA 4BZNA 5HNIX 2BRHA 1A48A 3I5ZA 2X0GA 4QNYA 4GVAA 4ANOA 5A54A 4YBKA 5FEDA 4O7YA 4MQ1A 4EOQA 4HGLA 4J71A 5LWMA 3TNWA 1ZRZA 4C36A 4EL9A 2QOHA 3PY1A 1H1RA 2GNLA 3BEAA 4JOAA 4G6LA 4RZWA 3ETAA 3FXXA 3R9HA 4JBQA 4RZVA 4XV1A 4QNAA 4DCAA 1XH5A 2LGCA 2BDWA 3ORNA 2W4JA 4EC8A 2C5XA 4NW6A 4IMYA 4EOOA 3HLLA 4KS7A 1FBNA 3COKA 3G6HA 5DVRA 4IIRA 4J98A 4K1BA 2HZ0A 4LUEA 3OBJA 2V7AA 4OW8A 4HYIA 2ZMDA 3COHA 4MKCA 3ZC6A 4KIKB 5AUWA 4WRGA 4I6HA 4IC8A 5L8KA 4XV2A 3F2AA 5ICPA 3UODA 5HTBA 1PXNA 5J5TA 4E5BA 3OXZA 2X1NA 2F4JA 3Q53A 2J7TA 3R8VA 4EI4A 1WBPA 5ANOA 3ULZA 5KCVA 5I9YA 4KWPA 3OWLA 4DFBA 3VN9A 4C57A 4IZ5A 4EWQA 2QONA 2CJMA 4S32A 2PY3A 2VTPA 4C8BA 1PXPA 2Z8CA 4YZBA 4EEVA 2REIA 5ANKA 3RNYA 3SAYA 3DK7A 3EN6A 4FSQA 4Z9LA 4FA2A 2F9GA 3KULA 4NU1A 3UO6A 4GK4A 2HELA 3LCTA 4UYAA 4GU9A 3G5DA 2XIXA 4CKIA 4RJ3A 1Y6AA 3DAKA 4AGUA 2R9SA 1RQQA 4WG4A 1G5SA 3TI1A 3QF9A 5HGIA 5EYCA 3C4EA 2Y6OA 3VUGA 4FL3A 3WF5A 4D4YA 1G8SA 3O50A 5AUVA 3E92A 3HP5A 4C3RA 2JIIA 2XS0A 3U9NA 2G15A 3NZ0A 4A9UA 3ZRLA 4JBVA 3NPCA 3DNEA 3MFSA 3E87A 4RBLA 3M11A 3F3ZA 2UV2A 3FWQA 3QTIA 4CXAA 4GK2A 5HE0A 1JSUA 2A27A 4IZYA 3QX2A 4W9WA 3GT8A 3PFQA 5CSPA 5I0BA 3F82A 4R78A 5JFVA 5KO1A 2R3RA 3QC4A 4PTCA 2XCHA 2VWIA 2Q0NA 4IX4A 4QQCA 4EYJA 3FEGA 4TPTA 4Q5HA 1OKZA 1W8CA 4FIGA 5BUIA 4FVQA 5GZ9A 4EK6A 4BY9E 5L2QA 4E1ZA 5FTQA 5A4EA 2OF4A 4BIBA 2JITA 2X2LA 3BHYA 3V5PA 5BVOA 4DH7A 1JKLA 3KRWA 4MBJA 3TN8A 4BL1A 4C4FA 3QD2B 4QT1A 3RMFA 1OPLA 2VD5A 3BU6A 4GUEA 4UALA 1XJDA 3KQ7A 3FKOA 4M0YA 4MWIA 4YO6A 3UVPA 3OXIA 3MI9A 1V0PA 5AX3A 3RM7A 3KRRA 3R2YA 4IM2A 3NW6A 4RPVA 2VTHA 3FBVA 4GVJA 4KABA 3UC4A 4O81A 4R77A 4BCHA 3KEXA 1FMKA 2RFSA 2EXEA 3R7VA 2RIOA 4F0FA 4ZTMA 3CTJA 2UW0A 4NIFA 1KV2A 2DUVA 2GHGA 2VO0A 3BQRA 4WT6A 3DV3A 5GJGA 3OF0A 4JXFA 5H3QA 4RRVA 2P3GX 3DY7A 2VTOA 3FLZA 3VUDA 4DEIA 2YZLA 4YSMA 4QMLA 2QNJA 1DAWA 4TNDA 4YNEA 4EWHA 5I9XA 1P5EA 1YI3A 1JWHA 2X7FA 3IQ7A 4EHGA 2PYWA 4YJRA 4FKLA 4PP9A 3W2SA 3COMA 4PMTA 2GFSA 4QMXA 4CMOA 5HLNA 4E6DA 2WMQA 2X8DA 1PXJA 3BU5A 4FSMA 4FV7A 3BBWA 2XIRA 2BKKA 4BDAA 5AR8A 4FZFB 5JK3A 2VX0A 2GMXA 5AV2A 2AUHA 4YBJA 4F9BA 1RJBA 4QP9A 2O5KA 4QMYA 4F7LA 2A1AB 4TYEA 4K11A 4G6OA 4M14A 3ZMMA 1REKA 4K18A 5HOAA 1SVHA 2QODA 4YNOA 1JKKA 3MW1A 2J5EA 5I9VA 3GCUA 4ASZA 3Q9WA 3SX9A 4QPSA 5LVMA 3R04A 4ZIMA 2HXQA 4NM7A 4BIEA 2Y9QA 1Q4LA 3R28A 4F1TA 5D10A 2RG5A 3GC0A 2BILB 1LEZA 3W32A 5IQIA 5LQFA 2WMSA 3LLTA 4M84A 1GOLA 3IO7A 1YXXA 3DTWA 3RWPA 4C58A 5M56A 5L3AA 5LMBA 3CY2A 4DC2A 3FZPA 3PY3A 4AZVA 4CTBA 5FUTA 3T9IA 3IECA 4AE6A 2GPHA 2YCFA 3QBNA 3VQHA 3HVCA 5AUZA 4TZRA 3CR0A 3QUEA 3W2RA 5I4NA 3LJ1A 3CPBA 4X0MA 2WNTA 5CZIA 5HBEA 5CF4A 3QYZA 4IWPA 3R7IA 3VHKA 5L8JA 3L8XA 4L3PA 2OZAB 4L9IA 5DEYA 3PPJA 3UQGA 4FT3A 1CDKA 4APCA 2ZM3A 4TT7A 2C6DA 3ZS5A 2X8IA 3V5WA 4EH3A 3TM0A 3BU3A 1CTPE 4GYGA 1NXKA 4DH8A 4D4VA 2BZIB 5HEZA 3U87A 4KKEA 3TZ9A 2OLCA 2OJJA 5M06A 3DT1A 3VRZA 5BMSA 2F2CB 3H0YA 4ZAUA 3GC9A 3Q9XA 2ZAZA 4BF2A 1K2PA 4ZTSA 3LM0A 1Y57A 4TN6A 3WILA 4R3CA 4QYFA 4CFUA 1AD5A 2VTTA 4C59A 4IFCA 4GK3A 4I23A 4JL9A 4O0YA 3BGPA 4EH6A 1PXLA 2I0YA 1MP8A 3BCEA 2CPKE 1XHAA 3EZVA 4XP0A 3A7GA 4RX5A 5JFSA 2YA9A 3G9NA 1U46A 2BRMA 2WMWA 3PJ8A 4AZWA 5LCJA 2BZKB 3W2QA 3RHKA 3OEFX 4YGAA 2F7ZE 2BIYA 4DGMA 3BWFA 1OPJA 5AR7A 4IAAA 4RMZA 5HO6A 1GIHA 1ATPE 4O2PA 4O38A 4FODA 4RJ6A 3WE8A 4B4LA 4P5ZA 4QMVA 1PMVA 2C0IA 3VBWA 4R8QA 3FMMA 4UN0C 5KMLA 2BHHA 3P4KA 4H39A 3QD3A 4UV0A 3LJ2A 1Q24A 4ZLYA 2ZB0A 3U6HA 2VZ6A 1FVTA 1Q8TA 3KCKA 4WO5A 4EK8A 2J4ZA 4QTDA 2PE0A 2PZ5A 4YLJA 4X7QA 3R9OA 2VV9A 4DEDA 4EONA 3LXKA 4FSUA 4TKSA 2C6OA 3V01A 1YOMA 3DBEA 3O0GA 2Q0BA 3O96A 3C4CA 4YMJA 1BL6A 3TZ8A 4FKSA 2VWXA 5FLFA 1OKWA 5KHWA 2YM8A 5IPJA 4FR4A 5CSWA 4TWCA 1KWPA 2PL0A 4BYJA 2G1TA 5AP4A 3MIAA 4FKVA 4JX7A 3RCJA 3AD6A 4ACCA 2Y8OA 1YWNA 4IB3A 4U5JA 4QP1A 4E4NA 3HMMA 2EB2A 3PE1A 3QXOA 2OU7A 4NWMA 4HNIA 4K33A 4RG0A 5EI8A 2DS1A 5E8TA 3IGGA 3PVGA 3NNXA 4CSVA 3VRYA 4P2KA 2XEYA 2XJ2A 5AMNA 3EWHA 5CYIA 3F5PA 4D2PA 3BI6A 2XK7A 3PP1A 3FXWA 1Y6BA 4K77A 2QVSE 2J5FA 2X2MA 3DKGA 1ZOEA 2XJ0A 4W4WA 4E8AA 3RM6A 4CLIA 2V5QA 2PWLA 5J9LA 2GHLA 4ZSGA 2W5AA 1VYWA 4BDBA 4L8MA 3QZHA 3OY3A 3LFSA 1BI7A 3AC3A 5TF9A 5A9UA 5M57A 4FVPA 4GMYA 4AZEA 1W7HA 4S2ZA 4A4LA 2PZPA 4R3RA 4UB7A 5CWZA 4CKJA 4XG9A 3EQPA 2BZJA 3ATSA 3FL5A 3DLZA 3SD0A 2VWVA 4MBLA 4KRDA 3PY0A 3FI4A 4IBMA 4XRJA 3TDVA 3R63A 3OXTA 4PRJA 3ZO4A 2QO7A 3OS3A 3UBDA 4PDPA 3VJOA 5DA3A 5IU2A 1B38A 4XOYA 2IZSA 4RIXA 3RPYA 1VR2A 5FD2A 4F7JA 5CSXA 2HWOA 4AS0A 2YIWA 4UZDA 3ZFXA 4DGOA 3SXSA 4O0TA 4YURA 3JUHA 3KRXA 4EC9A 5ANDA 2YWVA 3KL8A 3MPMA 5CVFA 2GHMA 2I0EA 4AE9A 5K3YA 3PXZA 4IWOA 5M4FA 2R3FA 3DBQA 4BBEA 3UJGA 2CCIA 4GYIA 3FQHA 2SRCA 5LJJA 1X8BA 4H58A 3FPMA 4M3QA 4XCUA 3E3PA 3QL8A 4BGQA 1M2QA 4P7EA 4ZMFA 1OUKA 1T46A 4BWXA 3OTUA 4F08A 4DH3A 3KN6A 1ZYDA 2GDOA 3VS6A 1SVGA 4TWOA 1PXKA 2WAJA 4KA3A 5EHYA 5IG1A 1WCCA 4LRMA 4H05A 2I0VA 3JPVA 3NR9A 3Q6WA 3TDWA 2UZTA 3TTJA 3PJCA 4RQVA 2C6TA 1UNHA 4FV0A 3LOKA 4FUYA 3FQEA 5BVKA 5BVEA 3W16A 3UP2A 3NUPA 5JRSA 4QTCA 3V3VA 2XRUA 4GS6A 3T3UA 3CTQA 3MDYA 3DKCA 3OT3A 4RX7A 1ZOGA 4L45A 4DTKA 3SC1A 3E8EA 3DQXA 2UZNA 4ZZMA 3H9FA 2OF2A 2JGZA 1BL7A 5CALA 4F99A 3OCTA 3IW8A 5BUEA 5LVOA 4FT5A 3KRLA 1VZOA 3D15A 3G6GA 4O0XA 3FC1X 3RBWA 4A9TA 4BCOA 5CT0A 4ALUA 4Y73A 4XG6A 4F1MA 5M53A 2FSLX 3EQFA 3QALE 3QHWA 1GZNA 2PE1A 4RFYA 4X2JA 5FTGA 3QTRA 4G3GA 4TL0A 2Q83A 3I7BA 3HECA 4O0WA 1OPKA 3AXWA 1TQIA 4EQUA 5HCZA 4Z7HA 3JR1A 1A9UA 2YISA 4FK6A 2QOCA 4O6LA 3DA6A 3HMNA 3QAME 4HVSA 4L43A 4AN9A 4FEWA 2W9ZB 1GAGA 4IDTA 5G6VA 3ZH8A 2VTNA 4MF1A 3VBYA 4E6QA 2W1EA 1WBWA 2Z7LA 4HYSA 4IW0A 4J1RA 1CKJA 4OT6A 5EG3A 1H1PA 1YKRA 4JRVA 2R4BA 5HESA 3QC9A 4BDGA 2Y4IC 4O21A 4ZMEA 1YDTE 2WTVA 3QQGA 4IZ7A 1M2RA 3AG9A 4KKHA 4G3EA 3GP0A 1XH4A 5KMIA 1GZ8A 1URCA 1EH4A 3AMYA 2HY81 2QOIA 4JNWA 4MNEB 3BWJA 2GFCA 2OICA 3JY9A 4UXLA 5ETCA 2FH9A 2JD5A 3EHAA 3TCPA 1R1WA 4JQ7A 1H07A 4IANA 4RVMA 3QRJA 3VVHA 3Q9ZA 2IJMA 3R2BA 4QMPA 5BVWA 4F0GA 4NW5A 3COIA 5KE0A 3HV3A 4B9DA 1STCE 1UU8A 4R5YA 2C5VA 2QO9A 2XJ1A 1Q62A 4XV9A 3OWKA 1H25A 1WVYA 2GNGA 3F3UA 3NYOA 3LIJA 3VULA 5FDXA 2HOGA 3D5WA 5DE2A 4FL2A 3DS6A 4FTIA 1B39A 3ZLXA 3IDBA 1CKIA 4I92A 3CJFA 3I5NA 4HGSA 2QR8A 3Q52A 1TQPA 4FNZA 4MXCA 4PMPA 4BTKA 4CEGA 3IDCA 5LWNA 2IO6A 5KMOA 4E20A 3G15A 4R1YA 4QP6A 2Y6MA 5DWRA 4JAIA 2QCSA 5AV3A 3Q04A 3WOWA 3QKKA 5AJQA 2CN8A 3ENHA 4FKQA 4D2SA 3HX4A 5I3RA 4LGGA 1TQMA 3N4UA 3A8WA 5IEXA 3ITZA 2ZMCA 5TKDA 4F65A 5A4LA 5C8MA 4BR3A 3C4FA 4USDA 4PPBA 4EJNA 4BZOA 3OHTA 4X2FA 5L2SA 2R0IA 4Q9ZA 5HU3A 4FV4A 2FB8A 4X2GA 1CSNA 2J6MA 3A99A 3K3IA 3PRFA 4U44A 3TKUA 5EM6A 2C0OA 3W55A 2GTNA 5IEVA 4QMOA 5BPYA 3PXKA 1OL7A 3H9RA 4FNYA 3TJCA 5IDNA 4IVCA 2VX1A 3ZYAA 1T45A 5FP5A 4D1XA 4UYNA 2XK6A 3F3TA 3LMGA 5ETIA 3A7JA 2P55A 3DXQA 4O7WA 4DEBA 1OMWA 5FWKK 4EH7A 4NKSA 3R9DA 4E93A 5IMXA 4DEHA 4AACA 3AC5A 3MSSA 5FEEA 5J9YA 4YJUA 4F63A 3W8QA 1F5QA 3ACJA 5EM5A 3R9RA 3FZSA 4TY1A 2QOOA 3TACA 3V5JA 3GEQA 2HK5A 3DJ5A 1H26A 3OBGA 2QR7A 4BYIA 4DH1A 2PULA 4CFFA 3NVMB 2YERA 3DTCA 3TUDA 2C3LA 3TT0A 4AT4A 3OCBA 2XB7A 4JR3A 3V5QA 3UMXA 4IH8A 2NRUA 4RA4A 2QU6A 3AT3A 3HMIA 1UU3A 2H6DA 3F3VA 3QFVA 2XYUA 5ACKA 3V6SA 2X2KA 5IA4A 4B8MA 2VGPA 1QCFA 5LARA 3MS9A 4XYFA 1WBTA 2JBOA 2BR1A 2W1GA 4HVHA 2BAKA 1JPAA 4O7NA 2J0KA 2PK9A 4EK5A 5B7VA 4MK0A 4EUTA 4OTIA 2E9NA 4O22A 4TXCA 2PPQA 3RK9A 1FMOE 1YHVA 3TIZA 1UA2A 2HZNA 4D0XA 4E4XA 4KNBA 3MTFA 1NVRA 1UKIA 2C1AA 2WQEA 3JVRA 1JKTA 2BPMA 3N51A 3MFTA 4FTOA 5AP6A 2R5TA 3VS2A 5L2TA 5M55A 2OKRA 4MBIA 3PSDA 3VBTA 3FMJA 4ZY6A 5H9BA 4C37A 3QLGA 3MFUA 3T8OA 1BYGA 3R21A 5JGBA 1OVEA 2UUEA 4JAJA 4ALWA 3QXPA 5AX9A 4MTAA 1J1CA 3VBVA 4J7BA 3AC4A 3FKNA 5L8LA 1Z57A 3PG1A 2YEXA 4N6ZA 2FUMA 4D2VA 4EQCA 2VGOA 1ZYSA 3UQFA 2BALA 5LVPA 5C26A 3BYUA 3UZTA 4W8EA 4X3JA 5KMKA 3TV6A 2JIVA 3JS2A 5AV0A 3QQHA 2XUUA 1H08A 4IX6A 1H28A 4O0UA 4Y8DA 5IDPA 1IR3A 2RG6A 3R01A 5K5NA 3VS5A 3FL4A 5L6PA 2B9IA 4YZCA 2IZUA 3VUTA 4LOPA 4FYOA 3A62A 4XH6A 3ET7A 4BKZA 4DG0E 1H27A 3DAEA 3LFBA 4JG7A 4FT9A 3LAUA 2C47A 5M4IA 3Q2JA 4U40A 4JIKA 4AA5A 4BC6A 4BHNA 4OTHA 1R39A 3HAVA 3DLSA 4O6EA 3E7VA 4E73A 1REJA 5AUTA 3PIXA 3NCGA 1B6CB 3GQLA 2OBJA 3P7CA 3RZBA 1M52A 5KX8A 3EQIA 4YHJA 4PDSA 4ORKA 4QYEA 4BI2A 3QQLA 4DLIA 2WQBA 3A7IA 3DK3A 2WD1A 1JQHA 3ID6C 4HVGA 1V0BA 4AGDA 4DA5A 4OGRA 5FG8A 5IA5A 2PVLA 4LM5A 1IG1A 5KZ0A 3CQWA 4GV1A 2X81A 4M8TA 2IZTA 2R3GA 4CV9A 3C0IA 4DFLA 4EKKA 4CVAA 2W06A 5M4UA 4NM3A 4NT4A 2W7XA 4NEUA 2QURA 3EB0A 4J99A 4M15A 4BCIA 4Y5QA 4X2KA 5AR5A 4GT4A 1P14A 4RFZA 1O6KA 4AUAA 4HPUE 2EWAA 3VF8A 2HZ4A 3PA3A 4I24A 4OT5A 4CFXA 2PVNA 2EB3A 3CTHA 2OGVA 4YC8A 4YJNA 5J1VA 4C61A 1ZY4A 2A4LA 4TYIA 4F4PA 2WOUA 4FIEA 4G31A 3S3IA 5JZJA 2XIKA 3D4QA 4HVDA 2PZRA 4BDEA 5EYDA 3O7LB 4JVGA 1Q3DA 3KXMA 3HYHA 4CCBA 5CI6A 1XH8A 1G8AA 2RF9A 5AWMA 5CLPA 3MPTA 5LVNA 3MV5A 3WZEA 1P4OA 4AN2A 2BDFA 2ONLC 1UU7A 1OUYA 3UNKA 5EKNA 4D9UA 2W1HA 5E8UA 4U3ZA 4DGGA 4M66A 5EHLA 5C01A 3TNPC 3G9LX 5K5XA 3OG7A 1NT2A 4FK3A 3BRBA 3KA0A 5FP6A 4BCQA 3ZBFA 4F9YA 4NYEA 4DCEA 3W8LA 2X7OA 4LV5A 5AA8A 1J1BA 3FV8A 5JQ8A 3MN3A 1U59A 4RIXB 2XK8A 1SNXA 3FY2A 2CNVA 1XWSA 4KS8A 3QU0A 3ODZX 4UXQA 4JRNA 2XNEA 4RIYB 2EXCX 2F49A 3LXLA 1Q99A 3ZBXA 4R7HA 2IW9A 5HD4A 3A4PA 5IQCA 2CKOA 3RI1A 2WKMA 3NUXA 3CQUA 4U80A 4NJDA 4XUFA 4D5HA 5HX8A 5LOHA 3HRCA 4MNEA 4FZ7A 1HCKA 3O8UA 4MEDA 2W1IA 5DOSA 3FE3A 2OJFE 1J91A 3GI3A 3HDNA 1ZOHA 4WKQA 5D7VA 2PVJA 2XP2A 3NLBA 4JDKA 5T68A 3E5AA 4BI0A 3CGFA 4KAOA 3RAWA 4BDIA 4BRXA 4CRSA 3UQCA 4ANNA 2BUJA 3P78A 5C03A 5EQPA 3TUBA 1XH7A 4QP8A 3UIXA 2B9JA 5E1EA 3SQQA 5AR3A 4F64A 3DBCA 4LL5A 2BHEA 1NA7A 3LFDA 2VTQA 4IQ6A 2YLEA 5HKMA 4ZTNA 4ANBA 2QU5A 2GSFA 4QMNA 4RWIA 2ZYBA 4EK4A 4RFMA 1O6YA 3F7WA 5AP2A 5KMJA 4FKIA 3VC4A 4I0TA 3RCDA 4H1JA 3P08A 4XBRA 4NCTA 3VUMA 4EZ7A 5EK7A 4IB0A 4KIPA 5J8IA 3OW4A 3ZEPA 3F2NA 4O0RA 4FSYA 1SYKA 1WVXA 4JDIA 1GIJA 3FLYA 4G5PA 2IN6A 3W1FA 4QTAA 5ACBC 2BTRA 1ERKA 2XH5A 4BKYA 1TVOA 1ZYLA 4I4EA 4JBPA 3BHTA 3I6UA 5F95A 2XBJA 4YUQA 3PJ3A 1GJOA 3RALA 4DEGA 5JEBA 4JS8A 3QTWA 5AM7A 1G3NA 3UVQA 5DMZA 4BFMA 2YM6A 4CKRA 3P23A 4ZY4A 4NZWB 3FLWA 2WMBA 1S9IA 2WMUA 4QP3A 3JXWA 2WZJA 2WMXA 3A4OX 3DFAA 4W8DA 3ZSHA 3WARA 5J9ZA 3PIYA 5HLPA 3PXQA 1JSTA 3GCPA 3KMWA 3I0OA 2A0CX 3GU4A 2WO6A 2XZSA 3DJ6A 5KUPA 3OUKA 4PWNA 5HORA 3SA0A 1DAYA 1LR4A 5CEOA 4L7FA 5IQFA 1ZYJA 3QWKA 4UX9A 1PMEA 3PTGA 3WIGA 1QPJA 4NH1A 4U45A 3VBQA 2AC3A 1YOLA 2IVTA 3L8SA 4K8AA 5FDPA 4C4IA 3MH2A 4EOJA 3UOKA 4K2RA 1OZ1A 2J9MA 4XRLA 4I0SA 4FICA 3QTSA 4F1OA 2GQSA 3QD4A 2Z7SA 3MY5A 4ZSAA 4AXAA 5JN2A 4GCJA 2YCRA 4C4EA 2P4IA 1URWA 3VF9A 5FRIA 1YQJA 4DFYA 4YPDA 2PMNX 4ANMA 3O2MA 2ETMA 3KRJA 3HEGA 4IAKA 5F9EA 4XEYA 5HO7A 2QG5A 4TYJA 4O7RA 5J5SA 4YTFA 4C33A 2YAAA 4MF0A 3S1HA 2ZOQA 4BDJA 2X6DA 5E8YA 3OT8A 2C3KA 4L68A 3D2KA 3C51A 3Q5ZA 3BHUA 4GJ3A 4EOMA 3V8WA 5HU9A 4BVUA 4ZJIA 2XEZA 3D7ZA 2UW8A 3LVPA 4AG8A 4BN1A 2RFEA 3KN5A 3ROCA 3SGCA 4M67A 5D9HA 1J7LA 4XG8A 4N0SA 1W98A 2ITZA 4WUNA 2H34A 3DB8A 3EIDA 2YACA 3PLAE 3HV6A 4A7CA 1ZARA 2JDVA 3AT4A 3O23A 4BDDA 4F7SA 5JGDA 2OG8A 4I0RA 3GU5A 5CEIA 3R8MA 4QD6A 2Z02A 5CY3A 4FIFA 1ZYCA 5A4TA 4DGNA 3H30A 4FEQA 3KU2A 4FF8A 2R7IA 3HAMA 4FTCA 1JBPE 1PKGA 3LE6A 1GNGA 4WA9A 2W0JA 4QYHA 3U51A 2ITYA 5HG9A 4YJPA 1W84A 4EYMA 4F6UA 3GFWA 5HE2A 1YWVA 5JMSA 4MXOA 4BDCA 4AFEA 1WBNA 2YWPA 4MXAA 1YHWA 2X9EA 3DZQA 1DM2A 3TNQB 2ZM1A 4RT7A 5IH5A 5KZIA 3PPKA 1VYZA 3UG2A 2E9PA 2HW6A 3L9LA 4L44A 5IA0A 3QX4A 2YABA 4G3DA 4RC2A 4ERKA 2ITXA 2IVVA 1IA8A 3RJCA 1KV1A 3U9CA 2B52A 2HIWA 3FMKA 4AFJA 1PYXA 1H1SA 3RNIA 4Z3VA 4L3JA 3FHRA 2FYSA 4PY1A 4BCGA 1FGIA 4J8MA 4K9YA 3BKBA 4KSPA 2R3PA 3VHEA 5FBOA 2BDJA 2XNGA 3MVMA 3ODYX 5D11A 3CPCA 3EFKA 4USEA 2G2FA 2R3HA 5C4KA 3F88A 2ZVAA 3ZUUA 3WYXA 4KRCA 4WD5A 5I5ZA 2ETKA 3A8XA 4AT3A 1H4LA 4YZMA 1LP4A 1WZYA 4MH7A 4D5KA 4HPTE 2PVYA 4II5A 2X39A 4FV6A 3V8TA 2R3IA 3MIYA 4PX6A 5JSMA 4ACGA 2YFXA 3QRTA 1GIIA 4FSRA 4ZLOA 3KREA 1PRYA 1S9JA 2VTLA 2HCKA 5DRDA 3VUHA 2HZIA 5EH0A 3K2LA 3W2OA 3F2RA 3KMUA 4FKWA 4QTEA 2B7AA 4PL3A 2ITQA 4V04A 5FGKA 2P0CA 2BMCA 3O51A 1H8FA 2JKKA 4XMOA 2Z2WA 3ZXTA 5AEPA 5IUGA 1NW1A 2J90A 3U4UA 3BQCA 3UZPA 4XHKB 2ITUA 4GFMA 3EH9A 4CCUA 3PG3A 4FV3A 4CV8A 1M7NA 2YIYA 3GFEA 4Y46A 3PA5A 4F9CA 1IAJA 4CT1A 4LGHA 2G01A 3KCFA 3O8TA 4CQGA 4JG8A 4IWQA 2CNQA 2CKEA 3TWJA 4C4HA 4F6WA 2ZB1A 3OOGA 3SDJA 2UZDA 4IADA 4M0ZA 5DPVA 4X6QC 5A14A 4WNKA 1YDSE 4OBPA 3UIUA 4EBWA 4MD9E 5CTPA 4FOCA 3C7QA 3PE2A 2IZRA 5GZAA 3D2IA 3G33A 1ZMVA 4AT5A 1W82A 4GIIA 4AGCA 4IC7A 3QKLA 4N70A 3U55A 4O27B 3R71A 4ZLZA 3UP7A 1OL5A 3QZFA 3FLNC 5DBXA 3M1SA 1WVWA 2IVSA 4B7TA 4DBXA 2WTWA 4XBUA 5J95A 4FYNA 1Q8WA 2J0MB 4IXPA 2RSVA 1MRYA 1R78A 3I79A 3EYGA 3R6XA 4NCTC 3QQKA 3SKCA 2F2UA 2WMTA 3CY3A 4W4VA 5GHVA 1CM8A 4MXZA 3VBXA 3HNGA 3ZOSA 4IWDA 4BBFA 2OXXA 3NIEA 4G34A 3E64A 4CZUA 4FSZA 4IVDA 3RP9A 4YC6A 5HO8A 4NFNA 2FSOX 4IHPA 3PRIA 2A2AA 3EQCA 3ZZWA 3B8QA 4RIYA 4KSQA 3BYVA 3FZTA 2W99B 4USFA 4FV8A 2VUWA 2QC6A 3EZRA 2C3JA 4J53A 3E8NA 1XH9A 4S34A 1Y8YA 3FYKX 3WZJA 5J7BA 2R3KA 3TTIA 3ZM4A 5GZ8A 2EUFB 2HENA 1RW8A 4GIHA 4BCKA 4PTEA 3ENMA 4RSSA 3Q6UA 4DG3E 1ZLTA 2CSNA 2BRGA 4QP7A 2BVAA 3AGMA 5EQEA 4PP7A 1O9UA 3TKIA 4Z7GA 1QPDA 3QD0A 3KXZA 1K3AA 4O7LA 3SG8A 4JIAA 1OIRA 5AIRA 3GOPA 4MAOA 1OKVA 1ZXEA 2WMVA 4PNIA 5ANGA 3D7TA 2YM3A 5DT3A 1PMUA 5IUHA 2WTCA 3E88A 2ZV7A 1FGKA 3ZONA 4ASXA 3CSVA 4FKTA 4XS2A 4CD0A 2I1MA 2RFNA 2ZV8A 4XG3A 2E9VA 3D5UA 4KIQA 2CKQA 3B2TA 2PUNA 2JIUA 2GQRA 2CGXA 1TKIA 1SMHA 2ITTA 4NM0A 4Q2AA 2CMWA 1Q3WA 3WZKA 3Q2MA 3ZRKA 5A6OA 5AAEA 2EXMA 3ZZEA 2YCSA 2B9FA 5AV1A 2PMIA 1YOJA 3I0QA 4ZTLA 4RJ8A 3SLSA 5BVFA 3KKVA 4RX9A 2J0LA 4RC3A 4OTPA 5EDRA 4FZAB 3MPAA 1OL2A 4ENXA 1SNUA 3EOCA 4CFWA 3HKOA 5HHWA 1YWRA 4YZDA 5CSHA 3RAIA 2X8EA 5A3XA 4FX3A 4MCVA 4F70A 4HGEA 1BKXA 3QGWA 4R5SA 2XK3A 3R7GA 4Z16A 2OJ9A 2P33A 2Y7JA 3NUSA 2ESMA 3OCGA 4HZSA 3WE4A 5KBRA 5KHXA 1KSWA 3F5XA 3NYNA 3P86A 1P4FA 2JDTA 5IQGA 3R1QA 3MFRA 4RC4A 4APPA 4HZRA 4EOPA 5CEMA 3RPOA 3E93A 3OUNB 4CRLA 2QOLA 3T3VA 3CC6A 4LV8A 5EW9A 2IVUA 3L8VA 2GNIA 2PMLX 2ITPA 3R30A 4FIIA 3RWQA 1OBDA 4G9RA 3BZ3A 3I1AA 3R7UA 2KTYA 3I81A 5GNKA 4C4JA 4JBOA 2XIZA 4W4XA 4ZXTA 2JKMA 5EOLA 3R1YA 4U9AA 4U97A 2DWBA 3PVBA 3BGZA 3IOPA 3TV7A 4E4LA 1ZZ2A 4IAZA 5HBJA 1OGUA 3GU7A 4YP8A 4I5MA 3U6JA 3NUUA 5JRQA 3CE3A 3NMUF 2C5YA 4WSYA 4L53A 4E7WA 2JAMA 3PUPA 3Q9YA 2XNNA 3SW4A 5HIEA 4PDOA 2G9XA 3ORIA 1HCLA 3LQ3A 2YM5A 3HP2A 5HVYA 3IONA 2OIQA 5ETFA 4AOJA 4EH8A 4C4GA 3Q4UA 3F61A 4C38A 3HV5A 1XBAA 2ONLA 3K54A 1KE5A 1BX6A 3C13A 2C5OA 2YIRA 3BYMA 3R83A 4F9AA 3NSZA 3PDTA 3JVSA 3UZRA 1E1XA 2XYNA 4M7IA 5HI2A 5AUXA 4HCVA 4C35A 2CKPA 4WNPA 3DXPA 3ZU7A 2HW7A 2XVDA 3S4QA 4IJPA 4FSTA 4DFNA 5E4HA 1M7QA 2Y0AA 3EYHA 4RVLA 4WUAA 2YLFA 3L8PA 3R8UA 5ANIA 5A46A 3FMNA 5E8WA 3HMPA 3PYYA 3GQIA 5T3QA 5CF8A 2PU8A 5D41A 2WTIA 3DKFA 2WMAA 5IMEA 2YDIA 1YXSA 2FSTX 3CCNA 3NRMA 2YJRA 4OTFA 5EW3A 2ZDUA 4LOOA 3G0FA 4F9WA 3PXFA 3MJ2A 2XA4A 3UGCA 2CLQA 4S30A 3TEIA 3ROYA 2YIXA 3ORKA 3RKBA 3DQWA 2OFVA 4ZTRA 4G17A 5HICA 3FQSA 3TNIA 3SHEA 1R0EA 2XK4A 3A60A 5LXMA 4AW2A 5BNJA 5CVGA 3K5UA 4CQEA 1E9HA 5CQUA 3KXGA 2JDSA 5EM7A 4D55A 3DB6A 2YHVA 3MVJA 3FZOA 3KF4A 2B0QA 2VTIA 3N4VA 4V01A 3BPRA 1Q8UA 3EL8A 1NVSA 3LFQA 1KOBA 4IE9A 4L42A 1YI4A 4QMTA 2OJIA 3WYYA 4ZJJA 2WTJA 2WEVA 4DFZE 5AP5A 5JGAA 4RWJA 3TNHA 3IG7A 5IQAA 3MH0A 4TTHB 2V0DA 3V8SA 4BCPA 4I6BA 3HUCA 4NTSA 4IDVA 5KBQA 2O3PA 4X3FB 3ALOA 4LYNA 5F1ZA 2R3MA 4YJVA 5DT4A 3EN4A 4TYGA 4E6CA 2X4FA 3LFAA 4MXYA 4LQMA 5TO8A 1LUFA 3PSBA 3DJ7A 3DXNA 4FTKA 4AOTA 3TUCA 2XCKA 4QYGA 5IQHA 4G1WA 4IFGA 4RGJA 4FMQA 3GCSA 1V0OA 4AU8A 4E3CA 4CZYB 1KUTA 3ZSGA 2B9HA 4GG7A 3UIBA 2YCQA 4BCFA 2VTSA 1FINA 5E8XA 1XR1A 4TW9A 5K0XA 4LUDA 1JOWB 3LXPA 3M2WA 2BRNA 4XG4A 3DAJA 4ZJVA 4HCTA 3OFMA 4EHVA 3QCYA 4GG5A 3C9WA 2EU9A 2I40A 3MY1A 4QQ5A 1GZOA 2X7GA 1WAKA 4UZHA 5EDQA 3G2FA 4WNOA 2IPXA 3U54A 4NSTA 4NTTA 4RIOA 4FKJA 4ACHA 3D5XA 1U5QA 4FT0A 2IW6A 5TOZA 3PXRA 4U81A 3T9TA 3LHJA 4YPSA 4EZ5A 4KUJA 3ZO1A 4DTAA 3DDPA 2ZJWA 2WB8A 3FYJX 4TYHA 3WZDA 1IAHA 3UNZA 2OIDA 2WTKC 3OTVA 3CEKA 3MGYA 5CU4A 5EDPA 5BQ0A 1JKSA 5EM8A 2J0JA 3U6IA 5H2UA 2UW5A 4JJRA 4DFUA 4FKRA 3ORPA 3ZCLA 2PUIA 2B4SB 1OB3A 3DOGA 3GC8A 3V51A 4XV3A 3EJ1A 5DR2A 4F09A 4J97A 4QPMA 3R7YA 3PJ1A 3PP0A 4TNBA 5EW8A 4DHFA 4U0IA 1JLUE 2NP8A 4DINA 4YTIA 4C34A 4ZK5A 4HVIA 4RWLA 2J2IB 5AV4A 5AP1A 2E9OA 4FEXA 3ZUVA 3I6WA 2PUUA 4MWHA 3FUPA 4P4CA 5HVKA 3LFFA 4OAVB 5B2MA 4HYUA 3FAAA 2YITA 5DGZA 2RGPA 3KK9A 4ZTQA 3NAXA 2XM8A 3TJDA 3UVRA 4IAIA 2UW9A 5I9WA 4G3FA 2OFUA 3TZ7A 3QGYA 4FG8A 4TWPA 2B53A 2W96B 4DLJA 1HOWA 2XKCA 1IEPA 4FTLA 5JQ5A 3KGAA 5J7HA 1M14A 4OAUC 3KC3A 2OH0E 3LCSA 4O1OA 4BHZA 4KKGA 4D0WA 3CKWA 5CU0A 5BYLA 3G90X 4DT9A 4JQ8A 5D1JA 3AD4A 4WBOA 4WHZA 3R00A 4CG9A 3BYOA 4A9SA 3R8PA 4ARKA 3VWAA 2UW3A 5JT2A 1M17A 5J79A 2VRXA 4XOZA 4FG9A 4IEBA 4EJ7A 4W9XA 2HWPA 4DN5A 3RHXA 3AC8A 3QQFA 5CXZA 4QYYA 2O0UA 4C0TA 1FOTA 4ZOGA 2WMRA 3HGKA 5EI2A 3OROA 1VJYA 1KE9A 4FTRA 3BIZA 5HTIA 5E92A 3KMMA 2GNHA 4PMMA 5AM6A 3F5GA 1LEWA 5GJFA 3SRVA 4BDFA 2WTDA 3LFNA 3RK7A 3MB6A 2F7XE 3BGQA 4QQJA 4MX9A 5FXSA 3LCKA 3QTUA 2E9UA 1FQ1B 3FMEA 4JDJA 4O96A 1YXVA 1PJKA 2JAVA 4XP2A 5EYKA 3RPRA 3K5VA 2G2IA 4LL0A 1R0PA 1OECA 3EQBA 5EKOA 1DI9A 4AGWA 5IF1A 4GKIA 5DEWA 3IW5A 3GENA 4Y83A 2OK1A 4AWIA 1H1QA 1KE8A 4IAYA 1I09A 2YAKA 4GH2A 4JR7A 4IACA 4L3LA 4YLLA 2AYPA 3AQVA 3MYGA 3DPKA 3WF6A 3ZDUA 4ZY5A 1YI6A 1XQZA 4JI9A 3FXZA 3S95A 4EBVA 4PNKA 4O82A 4RVKA 3CD3A 3F66A 2X9FA 1H01A 4O1PA 3LZBA 2R0UA 2GS2A 3IW4A 4HNFA 3CLYA 3EQHA 2PUPA 4G16A 1YDRE 4PTGA 4UY9A 4CG8A 4FV1A 5LMKA 5C4LA 3PVUA 4IM0A 3FMLA 4RX8A 4U6RA 3D83A 2ACXA 2NRYA 2W5HA 5HG7A 5T6KA 4R7IA 1Q97A 1WBSA 2ERZE 4V0GB 2VTRA 4FTAA 1XH6A 4CZTA 5J1WA 3DBFA 4O2ZA 2BIKB 4Q5EA 2WTKB 2PVMA 4GRBA 5FXQA 2RL5A 4MVFA 3V04A 3WBLA 4E26A 2VO7A 4C62A 3BLHA 4EH2A 4L7SA 2UVZA 5HNBA 1Y91A 4YJOA 4FTJA 2VWYA 4FGBA 4FEVA 4B6LA 2C6IA 4JG6A 4AW1A 5BYYA 5IKWA 5IZFA 5ITAA 4WRSA 3B8RA 1KOAA 4B99A 4FSWA 4C3FA 5HX6A 2WOTA 3W2PA 4MYGA 4O7SA 4CMUA 3BYSA 4QTBA 4EH4A 4R3PA 4BIDA 2YM4A 4FZDB 4I41A 2HY0A 5M09A 3EN7A 3QA0A 4D2WA 2J0IA 3TZMA 4BTMA 3NEWA 3B2WA 1ZWSA 4ZS4A 3H10A 3QRKA 4EZ3A 3O8PA 2I7QA 5IH4A 2QKWB 3D7TB 3FI2A 5M4CA 1FVVA 1H24A 3U8WA 1ZY5A 3KXHA 4GEOA 2VWWA 4IX3A 4D1ZA 5C1QB 3QYWA 1Q5KA 2UZVA 4L00A 3F3WA 4L6QA 5HG8A 4AQCA 3ORXA 4EUUA 1L3RE 3CKXA 3RTPA 2BZHB 4FNXA 3QRIA 4R6VA 5CEKA 4AAAA 3Q32A 1WBOA 3W2CA 3R22A 2CGWA 3ATTA 3EN9A 3FMDA 4TWNA 4C3PA 3A7FA 3BV2A 3CS9A 4I22A 4IM3A 4JLCA 4RVTA 3FZ1A 4X21A 3ZUTA 2JFLA 4KINA 4WBBB 3QLFA 4QPAA 1OL6A 4J96A 3EMGA 4J8NA 3UDBA 3LKMA 3BX5A 5D7AA 4A4XA 5A4CA 4ZTHA 4N4SA 5HCXA 1ZAOA 4OTRA 3G51A 1XO2B 1PXOA 4A07A 3NUAA 4OTWA 3KK8A 2V7OA 3GOKA 3H0ZA 1OKYA 3NYXA 3EFLA 3GCVA 3HA8A 3H4JA
chains in the Genus database with same CATH superfamily
1IA9A 1UV5A 1QMZA 2W1ZA 3PVWA 3WZUA 2JKOA 4BDKA 4WG3A 2UZBA 4J95A 3F7ZA 3HV7A 5AR4A 3NUNA 2CGVA 4BI1A 3RAHA 4IZAA 4BCMA 2DQ7X 4DG2E 3E3BX 3OY1A 5HIBA 3O17A 2W17A 5AR2A 5GIPE 4I6QA 5GJDA 1H0VA 2I6LA 3AOXA 3CGOA 3VS3A 3QCQA 4U8ZA 4BWKA 3LQ5A 4MHAA 2VTMA 2J50A 2YN8A 3DZOA 2NPQA 2VN9A 3ERKA 3F69A 3HDMA 4ALVA 3OW3A 4X3FA 2O2UA 3ORMA 3R0TA 5HLWA 4YSJA 2W4KA 3Q3BA 4QMQA 1KE6A 4O0VA 4OTDA 1W83A 2BFXA 3CP9A 3H3CA 3ZLYA 2XKEA 4U7ZA 3ZEWA 5FEQA 3NVKI 1DS5A 2GQGA 4JT3A 4UBAA 4JDHA 4YZNA 3EFJA 3EQGA 4FKOA 3FI3A 3FI8A 4P90A 5IQEA 3UYSA 3VAPA 2JEDA 1Z5MA 2NNWB 3QHRA 1GZKA 2CNUA 5LCKA 3R1SA 4CTCA 3IS5A 4JX3A 2R3LA 4O91A 2GS6A 3R1NA 3OOMA 4FZ6A 3ACKA 4QO9A 3ZRMA 3W33A 2YDJA 2ETRA 3V5LA 4QDVA 1U54A 5DYJA 2QD9A 2YJSA 2JDOA 4LRJA 3BV3A 3PPZA 5EOBA 4AA4A 4M13A 3OMVA 3UE4A 4NK9A 4O7VA 2WQOA 3VO3A 2DYLA 4FOBA 3W18A 2ZM4A 4L52A 4P5QA 3R8ZA 4PQNA 1QL6A 2X6EA 4KIOA 3SXRA 4BCJA 3UPXA 2QQ7A 2QOQA 4ZP5A 2FGIA 3QTXA 3S0OA 3VQUA 3VS7A 3P1AA 4O4EA 3UTOA 5LMAA 4FTMA 3GU6A 4I4FA 3NNUA 4IAFA 5I3OA 3R7OA 5CNNA 1GY3A 4LOQA 1QPEA 2PVFA 1PYEA 4YJSA 2XNPA 2B54A 1OIUA 4D2RA 3DKOA 2V55A 4UWCA 5A6NA 3SW7A 5H8GA 4RIWB 4YC3A 1OI9A 4X2NA 4ZSEA 5E9EA 4ANQA 4IB1A 2WQMA 4QP4A 2ZV2A 3I7CA 5CF6A 2VO3A 4V05A 4YLKA 3VW6A 2OZOA 3KFAA 2XNOA 5C9CA 4CMTA 1L8TA 4FTUA 3C50A 3ANQA 3PWDA 5IA3A 5HD7A 3ANRA 3EN5A 3PZHA 3DDQA 2GU8A 4DH5A 4Z55A 1XBBA 3DFCB 3BHHA 3WF8A 4D4SA 4FGRA 4PDYA 4X6RA 3NYVA 4FI1A 2A19B 3BLRA 3MVHA 4S31A 5DR6A 3POZA 3LM5A 4GT3A 4GJ2A 2C6MA 4D28A 4Q9SA 5C8NA 5M07A 1SM2A 4GL9A 3LFEA 4EK3A 1ZMWA 3GCQA 4HYHA 2GS7A 2QHMA 2VX3A 1J7IA 3S2PA 3FLQA 3RAKA 1JVPP 5CQWA 3CIKA 4ENYA 4FKGA 4HOKA 5DN3A 5AP7A 4RJ4A 4I5PA 3TG1A 4AX8A 4AXFA 3DNDA 3M42A 5HNGA 4CLJA 4FKPA 3VIDA 3LMHA 5A4QA 4L46A 3BBTB 3E8CA 3Q4ZA 4ACMA 3QQUA 4QMSA 3KB7A 5LMKC 4ITJA 3IGOA 3LQ8A 2R2PA 2O64A 1PKDA 3ZFMA 4AZTA 4F6SA 4Y5HA 5EYMA 5TR6A 5TT7A 4DEEA 3NX8A 4DDIA 4BBMA 3OZ6A 5DG5A 4WOVA 5BUJA 5JFWA 2WXVA 4PPAA 4XG7A 2NYAA 2B55A 2H8HA 1MRVA 2BFYA 2PSQA 1M2PA 3C5UA 1YVJA 4MXXA 5CAOA 3WIKA 5BX0A 5J87A 5CAQA 3ALNA 5E8VA 3Q4CA 4LRKA 4TYHB 4WNMA 2KULA 3QCXA 2YZAA 2UVXA 4YHFA 4PV0A 3IW6A 3R8LA 4NUSA 4G3CA 4KB8A 2CLXA 2XKFA 3C1XA 5K0KA 3D14A 3WF9A 4FV9A 2HYYA 4YZ9A 2Z7RA 3ZHPC 4FNWA 3W0PA 4UEUA 4DBNA 4O83A 4YHTA 3UO5A 4BKJA 2WU6A 3CD8A 3UIMA 3LJ0A 3F5UA 3OVVA 5DI1A 4DAWA 4AP7A 1MQBA 1P2AA 1J7UA 2CDZA 2W1FA 4BCNA 2WPAA 3E63A 1Q8YA 1MRUA 3I4BA 5C8KA 3PUFC 5KNJA 5G1XA 4XLIA 5F4NA 4R7BA 2V62A 3PZEA 1J3HA 3PJ2A 3RINA 4D58A 1XMMA 2H9VA 3GNIB 1OL1A 4EHEA 3FMHA 2C1BA 2VAGA 3GBZA 3ZXZA 4HCUA 3ORLA 3LFCA 1JAMA 4GUBA 5IEYA 2WIPA 4FE2A 2R7BA 3TL8A 3F6XA 4WIHA 3ZDIA 2BCJA 3AC2A 5IH6A 3VUKA 3VW8A 3AMBA 2PMOX 2XRWA 4GKHA 3QA8A 1PXMA 1UNGA 3E8DA 1VEBA 4ITHA 1PXIA 3AGLA 3MWUA 3A61A 4UWBA 3UC3A 5K4JA 4GW8A 1WFCA 5E8SA 5CASA 5CNOA 3HV4A 1FPUA 5AAGA 3LPBA 5KMNA 3GVUA 4V0GA 3BLQA 4BDHA 3KVWA 1H00A 1BMKA 2AC5A 5IISA 4MD7E 2NO3A 4OTQA 3HL7A 3N9XA 4D2TA 4QQTA 3EKNA 3QKMA 4FV5A 3NIZA 4RWKA 2YDKA 2VWBA 1Z9XA 4M69B 5AP3A 3D94A 1F3MC 2O63A 5CU2A 4LFIA 2P2HA 2VWZA 3L1SA 4ZS0A 2C6KA 3BE2A 3QTZA 3FZRA 3QUPA 4OBQA 2PVRA 4KD1A 4UMTA 2C6EA 2OWBA 2W1DA 3PWYA 4A9YA 1E1VA 4KIKA 3W10A 1JSVA 4QP2A 1YW2A 4R1VA 2XBAA 1PHKA 3NWWA 4OBOA 5KMMA 3KY2A 4AOIA 2WU7A 3GB2A 3TXOA 4WG5A 4I1ZA 4DYMA 3CJGA 2PVKA 2GCDA 4MQ2A 2C5NA 4OLIA 3O7LD 3D5VA 2XKDA 4QMUA 3HUBA 2UZUE 4CYJA 2F7EE 2PVHA 4QMMA 3ZFYA 3SOCA 4I6FA 1WBVA 5CSVA 4FG7A 2XK9A 3PIZA 4FTTA 5ANJA 2XIYA 3FSKA 3SRVB 2VNYA 1I44A 4G6NA 2ITNA 4AW5A 3V5TA 3D0EA 1BLXA 1U5RA 3KVXA 4FTNA 5DR9A 4AF3A 1G8KA 5TE0A 2XALA 5E8ZA 4X3FC 2ZV9A 1BUHA 3FDNA 4G9CA 3JY0A 1OBGA 2W4OA 3RK5A 1JNKA 4A9RA 3THBA 4D9TA 4O0SA 5L4QA 3EFWA 4I20A 4NKAA 5DNRA 4GT5A 1Y8GA 3RPSA 4S33A 3C4ZA 2P2IA 5DHJA 1CMKE 3NNWA 4YTHA 4FEUA 5AA9A 1RDQE 3MH3A 1AQ1A 2WGJA 2UVYA 2JLDA 1UNLA 3UO4A 4KBAA 4PUZA 3OWPA 2FVDA 2GNJA 4I5HA 4U41A 3ZO2A 4FVRA 2QOKA 3LW0A 3PA4A 3C0GA 4EH9A 3W0OA 3NUYA 3VS4A 5CANA 3A7HA 2YM7A 3HZTA 2JKQA 3AT2A 4ZSLA 2WFYA 3HRBA 3L9MA 1PMNA 2XF0A 1YHSA 3IW7A 3NCZA 3ZLWA 4DTBA 3EKKA 2OI4X 2R3JA 1YXUA 5EFQA 5FBNC 5CZHA 4BWPA 3FHIA 3PSCA 3LMIA 2OO8X 3OWJA 4DT8A 1RE8A 2VWUA 2FO0A 4U43A 3TV4A 4C02A 5GINE 3CQEA 2VNWA 2VTJA 4NFMA 5LVLA 4ASEA 2UW4A 3MJ1A 3D9VA 5FM2A 5FTOA 4LMUA 4ZZNA 1CKPA 2CHLA 3HRFA 5HE3A 4FTQA 4LMNA 4KBCA 2E2BA 3R9NA 4BZDA 1H0WA 4M97A 1MQ4A 3IOKA 5CAPA 3P79A 4TRLA 5CU6A 1O6LA 4EQMA 3ZTXA 3AC1A 3LCOA 3QRUA 2EVAA 5L6OA 4RJ7A 4QMWA 3IKAA 1H1WA 3Q5IA 1IRKA 2GNFA 3QCSA 4Y72A 3ZC5A 4B0GA 3RPVA 3PXYA 3R73A 2O65A 1FVRA 1PW2A 3FJQE 4FUXA 4UWYA 4XNEA 4M12A 3U4WA 3LCDA 4ITIA 2ITOA 3REPA 3HMOA 5E7RA 2UW7A 4YR8A 3R02A 2JC6A 1R3CA 3FLSA 4WSQA 5HVJA 3GU8A 5HBHA 1UWJA 4FKUA 2OW3A 3OCSA 4I21A 5IUIA 3SVVA 2GTMA 1NVQA 2W9FB 4AZSA 4H3PA 4BTFA 4CGAA 1MUOA 3NGAA 4HGTA 4CT2A 4EOSA 4ERWA 3MVLA 3KULB 4NL0A 4ZEGA 4UMUA 4H3QA 3FC2A 2PE2A 3TKHA 3KIOC 2ZFYA 3Q4TA 4EOLA 4E4MA 5E1SA 3KF7A 5IQBA 3IPHA 4J52A 4NJ3A 5DFPA 3UPZA 2BTSA 5BVDA 3QUDA 2UZLA 1Q61A 5CAVA 2X4ZA 3ELJA 4M68A 5JKGA 3QZGA 4IX5A 4RLLA 4I93A 4F0IA 5FM3A 3BE9A 5ETAA 2J51A 3QWJA 1Q8ZA 3ZO3A 4FV2A 3VS1A 4DE4A 3MBLA 3P7AA 4AAYA 3ZLSA 2W5BA 3VNTA 2LAVA 1UWHA 4RIWA 3II5A 1V1KA 3UYTA 5DLSA 4B8LA 4BJJB 4FL1A 2QOBA 5AUUA 4CYIA 2B1PA 4GU6A 5CVHA 2R3OA 4C7TA 3OD6X 5H8BA 2ERKA 2UZWE 4EOKA 2QKRA 4FIJA 4QMZA 2WEIA 4N57A 4I3ZA 5AIKA 2OIBA 5D12A 1U4DA 3EQDA 3NW5A 3P0MA 2IWIA 1WMKA 4OR5A 5I9UA 3IK3A 2OZAA 4RJ5A 3NW7A 3Q96A 3UMWA 3MTLA 3WF7A 4DGLC 1TFFA 5FQDC 2PHKA 2C4GA 2PZYA 4GSBA 5IQDA 5ANEA 2XNMA 1ST4A 2R64A 3FY0A 4D1SA 3H9OA 5IA2A 4UMQA 4O7ZA 2WELA 3MY0A 5CEPA 1UU9A 3UNJA 4MD8E 2I0HA 2W05A 2FA2A 5CS6A 5AAFA 4EHZA 2C68A 5B2LA 2UZOA 4IJ9A 1SVEA 2XMYA 5HE1A 3FPQA 5KKRC 3QTQA 5CU3A 4IB5A 4O86A 4NIFB 3C5IA 1LPUA 1XBCA 5CXHA 5F94A 2ITVA 5CX9A 5K4IA 4I5CA 5GIOE 1F0QA 3NAYA 3BEGA 4OUCA 1UKHA 4Y85A 4H36A 3FKLA 3SG9A 3ORTA 2IG7A 3E62A 4N6YA 4ANSA 4G5JA 4XP3A 4BB4A 1PF8A 4YJQA 4O7TA 3HA6A 4C2WA 1U54B 3KXXA 5EI6A 5DT0A 3P7BA 4YO4A 2X0OA 3ORZA 4BICA 4YTCA 2G2HA 5H8EA 5CENA 2C3IB 2XM9A 2BAJA 4GFGA 5BMMA 3TIYA 4YU2A 3VONA 2W1CA 3OP5A 4UMRA 1OITA 4PF4A 4U3YA 3MH1A 3DBDA 4FRFA 3EL7A 4XJ0A 4UMPA 3LLAA 5B2KA 4QOXA 4AZFA 1SZMA 4FIHA 5M51A 3LXNA 5I9ZA 2F57A 4PMSA 4JQEA 2QG7A 4ID7A 5B0XA 3FSFA 5CAUA 3MB7A 4LGDA 5HTCA 5HCYA 1IASA 2C6LA 3P5KA 5AP0A 4ZSJA 4GFOA 4G2FA 5CF5A 3AD5A 5CI7A 2XNBA 2Z60A 1BI8A 3SXFA 2IF8A 2QOFA 4BGHA 5FXRA 5M44A 1NY3A 2JDRA 5HIDA 4BGGA 3C4WA 3DK6A 2BAQA 5CT7A 3C4XA 2CGUA 4FBXA 1K9AA 3I60A 3Q60A 4K6ZA 5L6WL 4EH5A 3BELA 5DH3A 1YRPA 5M08A 4DEAA 4HJOA 4HW7A 4PL5A 4RLKA 1UVRA 4W4YA 4CFNA 2BROA 2Y4IB 4LG4A 4FC0A 4C2VA 1OIYA 3O71A 5E91A 3RZFA 2WQNA 2OXYA 3UOHA 2OSCA 2PTKA 1QPCA 2QHNA 3MA6A 3SOAA 2UZEA 3P9JA 4AA0A 4ANLA 3GUBA 3K3JA 1OM1A 3OC1A 2C69A 4CNHA 4EKLA 3UOJA 5DIAA 5CEQA 4L67A 1KE7A 1OIQA 3E7OA 3ZM9A 5E90A 4A06A 2OJGA 2Z7QA 3A2CA 4L01A 4E5WA 1AGWA 3EQRA 2C0TA 2WHBA 2RFDA 4XG2A 4XLVA 3DU8A 3VJNA 4A4OA 2PZIA 2QLUA 3L9NA 5AFVA 3RVGA 2JBPA 4DF3A 5BVNA 2WIHA 2OH4A 3GC7A 3GGFA 5AADA 4LI5A 3UG1A 5IA1A 5C27A 5L2WA 1W0XC 2ZDTA 2FSMX 2HXLA 3ZSIA 2UW6A 4ASDA 4O84A 4M69A 5JZNA 1PY5A 5HG5A 4ZZOA 4NM5A 3CXWA 4ACDA 3KXNA 3SV0A 3L9PA 2H96A 3POOA 3CBLA 4PL4A 4EORA 3BL9A 5F20A 2ITWA 2C30A 2CN5A 4QRCA 3OEZA 3WI6A 3R7EA 2JFMA 2RKUA 3GXLA 1Q41A 2CCHA 4OTGA 3PLSA 1YXTA 2BKZA 2QLQA 4U42A 4ONAA 4RA5A 3QQJA 3V6RA 3N4TA 5EQYA 4DITA 1ZMUA 1A06A 2BRBA 2VTAA 3JYAA 4E5AX 3BHVA 3F9NA 5K9IA 4AN3A 4BTJA 4DFXE 4IVAA 4MNFA 1ZZLA 2IW8A 4KBKA 4QDEA 4XX9A 3UOLA 3C0HA 5BYZA 3VS0A 2O8YA 5HZNA 3ULIA 3G0EA 3MESA 5JH6A 1DI8A 4H1MA 2HAKA 2VO6A 3NDMA 2Y4PA 2YIQA 4F7NA 5JFXA 2V22A 4RQKA 3AMAA 4H3BA 4YJTA 3NNVA 4CFMA 4CFVA 1APME 4EOIA 2VU3A 4D4RA 3IDPA 3RGFA 5L2IA 3NS9A 2R3QA 1XKKA 2AQXA 2OXDA 5AUYA 4FSNA 3DGKA 4PPCA 3DCVA 4Y95A 5EHOA 5KKRB 4K0YA 4U79A 4AW0A 2QO2A 3VUIA 3MA3A 4I94A 3S00A 2R3NA 5HQ0A 5DRBA 4E6AA 1ND4A 3QZIA 2QI8A 4FT7A 4IVBA 4BZNA 5HNIX 2BRHA 1A48A 3NFGB 3I5ZA 2X0GA 4QNYA 4GVAA 4ANOA 5A54A 4YBKA 5FEDA 4O7YA 4MQ1A 4EOQA 4HGLA 4J71A 5LWMA 3TNWA 1ZRZA 4C36A 4EL9A 2QOHA 3PY1A 1H1RA 2GNLA 3BEAA 4FJVA 4JOAA 4G6LA 4RZWA 3ETAA 3FXXA 3R9HA 4JBQA 4RZVA 4XV1A 4QNAA 4DCAA 1XH5A 2LGCA 2BDWA 3ORNA 2W4JA 4EC8A 2C5XA 4NW6A 4IMYA 4EOOA 3HLLA 4KS7A 1FBNA 3COKA 3G6HA 5DVRA 4IIRA 4J98A 4K1BA 2HZ0A 4LUEA 3OBJA 2V7AA 4OW8A 4HYIA 2ZMDA 3COHA 4MKCA 3ZC6A 4KIKB 5AUWA 4WRGA 4I6HA 4IC8A 5L8KA 4XV2A 3F2AA 5ICPA 3UODA 5HTBA 1PXNA 5J5TA 4E5BA 3OXZA 2X1NA 2F4JA 3Q53A 2J7TA 3R8VA 4EI4A 1WBPA 5ANOA 3ULZA 5KCVA 5I9YA 4KWPA 3OWLA 4DFBA 3VN9A 4C57A 4IZ5A 4EWQA 2QONA 2CJMA 4S32A 2PY3A 2VTPA 4C8BA 1PXPA 2Z8CA 4YZBA 4EEVA 2REIA 5ANKA 3RNYA 3SAYA 3DK7A 3EN6A 4FSQA 4Z9LA 4FA2A 2F9GA 3KULA 4NU1A 3UO6A 4GK4A 2HELA 3LCTA 4UYAA 4GU9A 3G5DA 2XIXA 4CKIA 4RJ3A 1Y6AA 3DAKA 4AGUA 2R9SA 1RQQA 4WG4A 1G5SA 3TI1A 3QF9A 5HGIA 5EYCA 3C4EA 2Y6OA 3VUGA 4FL3A 3WF5A 4D4YA 1G8SA 3O50A 5AUVA 3E92A 3HP5A 4C3RA 2JIIA 2XS0A 3U9NA 2G15A 3NZ0A 4A9UA 3ZRLA 4JBVA 4QEBA 3NPCA 4F78A 3DNEA 3MFSA 3E87A 4RBLA 3M11A 3F3ZA 2UV2A 3FWQA 3QTIA 4CXAA 4GK2A 5HE0A 1JSUA 2A27A 4IZYA 3QX2A 4W9WA 3GT8A 3PFQA 5CSPA 5I0BA 3F82A 4R78A 5JFVA 5KO1A 2R3RA 3QC4A 4PTCA 2XCHA 2VWIA 2Q0NA 4IX4A 4QQCA 4EYJA 3FEGA 4TPTA 4Q5HA 1OKZA 1W8CA 4FIGA 5BUIA 4FVQA 5GZ9A 4EK6A 3AKLA 4BY9E 5L2QA 4E1ZA 5FTQA 5A4EA 2OF4A 4BIBA 2JITA 2X2LA 3BHYA 3V5PA 5BVOA 4DH7A 1JKLA 3KRWA 4MBJA 3TN8A 4BL1A 4C4FA 3QD2B 4QT1A 3RMFA 1OPLA 2VD5A 3BU6A 4GUEA 4UALA 1XJDA 3KQ7A 3FKOA 4M0YA 4MWIA 4YO6A 3UVPA 1OGYA 3OXIA 3MI9A 1V0PA 5AX3A 3RM7A 3W0MA 3KRRA 3R2YA 4IM2A 3NW6A 4RPVA 2VTHA 3FBVA 4GVJA 4KABA 3UC4A 4O81A 4R77A 4BCHA 3KEXA 1FMKA 2RFSA 2EXEA 3R7VA 2RIOA 4F0FA 4ZTMA 2UW0A 3CTJA 4NIFA 1KV2A 2DUVA 2GHGA 2VO0A 3BQRA 4WT6A 3DV3A 5GJGA 3OF0A 4JXFA 5H3QA 4RRVA 2P3GX 3DY7A 2VTOA 3FLZA 3VUDA 4DEIA 2YZLA 4YSMA 4QMLA 2QNJA 1DAWA 4TNDA 4YNEA 4EWHA 5I9XA 1P5EA 1YI3A 1JWHA 2X7FA 3IQ7A 4EHGA 2PYWA 4YJRA 4FKLA 4PP9A 3W2SA 3COMA 4PMTA 2GFSA 4QMXA 4CMOA 5HLNA 4E6DA 2WMQA 2X8DA 1PXJA 3BU5A 4FSMA 4FV7A 3BBWA 2XIRA 2BKKA 4BDAA 5AR8A 4FZFB 5JK3A 2VX0A 2GMXA 5AV2A 2AUHA 4YBJA 4F9BA 1RJBA 4QP9A 2O5KA 4QMYA 4F7LA 2A1AB 4TYEA 4K11A 4G6OA 4M14A 3ZMMA 1REKA 4K18A 5HOAA 4AXCA 1SVHA 2QODA 4YNOA 1JKKA 3MW1A 2J5EA 5I9VA 3GCUA 4ASZA 3Q9WA 3SX9A 4QPSA 5LVMA 3R04A 4ZIMA 2HXQA 2XANA 4NM7A 4BIEA 2Y9QA 1Q4LA 3R28A 4F1TA 5D10A 2RG5A 3GC0A 2BILB 1LEZA 3W32A 5IQIA 5LQFA 2WMSA 3LLTA 4M84A 1GOLA 3IO7A 1YXXA 3DTWA 3RWPA 4C58A 5M56A 5L3AA 5LMBA 3CY2A 4DC2A 3FZPA 3PY3A 2IEWA 4AZVA 4CTBA 5FUTA 3T9IA 3IECA 4AE6A 2GPHA 2YCFA 3QBNA 3VQHA 3HVCA 5AUZA 4TZRA 3CR0A 3QUEA 3W2RA 5I4NA 3LJ1A 3CPBA 4X0MA 2WNTA 5CZIA 5HBEA 5CF4A 4O4CA 3QYZA 4IWPA 3R7IA 3VHKA 5L8JA 3L8XA 4L3PA 2OZAB 4L9IA 5DEYA 3NFFB 3PPJA 3UQGA 4FT3A 1CDKA 4APCA 2ZM3A 4TT7A 2C6DA 3ZS5A 2X8IA 3V5WA 4EH3A 3TM0A 3W0NA 3BU3A 1CTPE 4GYGA 1NXKA 4DH8A 4D4VA 2BZIB 5HEZA 3U87A 4KKEA 3TZ9A 2OLCA 2OJJA 5M06A 3DT1A 3VRZA 5BMSA 2F2CB 3H0YA 4ZAUA 3GC9A 3Q9XA 2ZAZA 4BF2A 3BL7A 1K2PA 4ZTSA 3LM0A 1Y57A 4TN6A 3WILA 4R3CA 4QYFA 4CFUA 1AD5A 2VTTA 4C59A 4IFCA 4GK3A 4I23A 4JL9A 4O0YA 3BGPA 4EH6A 1PXLA 2I0YA 1MP8A 3BCEA 2CPKE 1XHAA 3EZVA 4XP0A 3A7GA 4RX5A 5JFSA 2YA9A 3G9NA 1U46A 2BRMA 2WMWA 3PJ8A 4AZWA 5LCJA 2BZKB 3W2QA 3RHKA 3OEFX 4YGAA 2F7ZE 2BIYA 4DGMA 3BWFA 1OPJA 5AR7A 4IAAA 4RMZA 5HO6A 1GIHA 1ATPE 4O2PA 4O38A 4FODA 4RJ6A 3WE8A 4B4LA 4P5ZA 4QMVA 1PMVA 2C0IA 3VBWA 4R8QA 3FMMA 4UN0C 5KMLA 2BHHA 3P4KA 4H39A 3QD3A 4UV0A 3LJ2A 1Q24A 4ZLYA 2ZB0A 3U6HA 2VZ6A 1FVTA 1Q8TA 2X0QA 3KCKA 4WO5A 4EK8A 2J4ZA 4QTDA 2PE0A 2PZ5A 4YLJA 4X7QA 3R9OA 2VV9A 4DEDA 4EONA 3LXKA 4FSUA 4TKSA 2C6OA 3V01A 1YOMA 4AXDA 3DBEA 3O0GA 2Q0BA 3O96A 3C4CA 4YMJA 1BL6A 3TZ8A 4FKSA 2VWXA 5FLFA 1OKWA 5KHWA 2YM8A 5IPJA 4FR4A 5CSWA 4TWCA 1KWPA 2PL0A 4BYJA 2G1TA 5AP4A 3MIAA 4FKVA 4JX7A 3RCJA 3AD6A 4ACCA 2Y8OA 1YWNA 4IB3A 4U5JA 4QP1A 4E4NA 3HMMA 2EB2A 3PE1A 3QXOA 2OU7A 4NWMA 4HNIA 4K33A 4RG0A 5EI8A 2DS1A 5E8TA 3IGGA 3PVGA 3NNXA 4CSVA 3VRYA 4P2KA 2XEYA 2XJ2A 5AMNA 3EWHA 5CYIA 3F5PA 4D2PA 3BI6A 2XK7A 3PP1A 3FXWA 1Y6BA 4K77A 2QVSE 2J5FA 2X2MA 3DKGA 1ZOEA 2XJ0A 4W4WA 4E8AA 3RM6A 4CLIA 2V5QA 2A98A 2PWLA 5J9LA 2GHLA 4ZSGA 2W5AA 1VYWA 4BDBA 4L8MA 3QZHA 3OY3A 3LFSA 1BI7A 3AC3A 5TF9A 5A9UA 5M57A 4FVPA 4GMYA 4AZEA 1W7HA 4S2ZA 4A4LA 2PZPA 4R3RA 4UB7A 5CWZA 4CKJA 4XG9A 3EQPA 2BZJA 3ATSA 3FL5A 3DLZA 3SD0A 2VWVA 4MBLA 4KRDA 3PY0A 3FI4A 4IBMA 4XRJA 3TDVA 3R63A 3OXTA 4PRJA 3ZO4A 2QO7A 3OS3A 3UBDA 4PDPA 3VJOA 5DA3A 5IU2A 1B38A 4XOYA 2IZSA 4RIXA 3RPYA 1VR2A 5FD2A 4F7JA 5CSXA 2HWOA 4AS0A 2YIWA 4UZDA 3ZFXA 4DGOA 3SXSA 4O0TA 4YURA 3JUHA 3KRXA 4EC9A 5ANDA 2YWVA 3KL8A 3MPMA 5CVFA 2GHMA 2I0EA 4AE9A 5K3YA 3PXZA 4IWOA 5M4FA 2R3FA 3DBQA 4BBEA 3UJGA 2CCIA 4GYIA 3FQHA 2SRCA 5LJJA 1X8BA 4H58A 3FPMA 4M3QA 4XCUA 3E3PA 3QL8A 4BGQA 1M2QA 4P7EA 4ZMFA 1OUKA 1T46A 4BWXA 3OTUA 4F08A 4DH3A 3KN6A 1ZYDA 2GDOA 3VS6A 1SVGA 4TWOA 1PXKA 2WAJA 4KA3A 5EHYA 5IG1A 1WCCA 4LRMA 4H05A 2I0VA 3JPVA 3NR9A 3Q6WA 3TDWA 2UZTA 3TTJA 3PJCA 4RQVA 2C6TA 1UNHA 4FV0A 3LOKA 4FUYA 3FQEA 5BVKA 5BVEA 3W16A 3UP2A 3NUPA 5JRSA 4QTCA 3V3VA 2XRUA 4GS6A 3T3UA 3CTQA 3MDYA 3DKCA 3OT3A 4RX7A 1ZOGA 4L45A 4DTKA 3SC1A 3E8EA 3DQXA 2UZNA 4ZZMA 3H9FA 2OF2A 2JGZA 1BL7A 5CALA 4F99A 3OCTA 1VLRA 3IW8A 5BUEA 5LVOA 4FT5A 3KRLA 1VZOA 3D15A 3G6GA 4O0XA 3FC1X 3RBWA 4A9TA 4BCOA 5CT0A 4ALUA 4Y73A 4XG6A 4F1MA 5M53A 2FSLX 3EQFA 3QALE 3QHWA 4LV7A 1GZNA 2PE1A 4RFYA 4X2JA 5FTGA 3QTRA 4G3GA 4TL0A 2Q83A 3I7BA 3HECA 4O0WA 1OPKA 1W2CA 3AXWA 1TQIA 4EQUA 5HCZA 4Z7HA 3JR1A 1A9UA 2YISA 4FK6A 2QOCA 4O6LA 3DA6A 3HMNA 3QAME 4HVSA 4L43A 4AN9A 4FEWA 2W9ZB 1GAGA 4IDTA 5G6VA 3ZH8A 2VTNA 4MF1A 3VBYA 4E6QA 2W1EA 1WBWA 2Z7LA 4HYSA 4IW0A 4J1RA 1CKJA 4OT6A 5EG3A 1H1PA 1YKRA 4JRVA 2R4BA 5HESA 3QC9A 4BDGA 2Y4IC 4O21A 4ZMEA 1YDTE