2YFXA

Structure of l1196m mutant anaplastic lymphoma kinase in complex with crizotinib
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
308
structure length
292
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE RECEPTOR
publication title Design of Potent and Selective Inhibitors to Overcome Clinical Anaplastic Lymphoma Kinase Mutations Resistant to Crizotinib.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 292
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yfxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yfxA01
4F1TA 4QNYA 1APME 5BNJA 2CSNA 3LLTA 5DPVA 4FNWA 3DXNA 4I6HA 4U40A 2HELA 3F9NA 3GXLA 3H30A 3KL8A 4X2FA 2W5AA 3MJ1A 4ZSGA 4M12A 4R78A 3TIYA 3G5DA 4L67A 4H1JA 2VTQA 3LVPA 5IA5A 4TWPA 3VRZA 1GIJA 4FUYA 3HP2A 5AP7A 4FKIA 2VZ6A 3UBDA 3W2OA 5CU4A 2IN6A 1QPDA 4HCVA 3TJCA 4BCPA 2J0KA 4ASEA 3F5UA 3H3CA 3NIZA 4IB1A 3GOPA 5E1EA 3OBGA 5HLPA 1R1WA 2F49A 2GTMA 3G90X 5EI6A 2B54A 5M4UA 1JKSA 4HJOA 3DB6A 2JFLA 4ZOGA 5L6OA 3FEGA 4RX8A 3QCSA 4ANMA 2BZJA 5EM7A 5KZ0A 1PXIA 4XG7A 1TKIA 3GFWA 2OZAB 2PZ5A 3I6UA 3LPBA 3OD6X 4JDJA 2PK9A 1YQJA 5HG5A 4YO4A 3N51A 2OZOA 1QPJA 3CQEA 2GNGA 5F1ZA 2YM5A 4I92A 4WG5A 4V01A 4RGJA 2GU8A 4O0WA 2B9HA 4E4XA 4FKTA 2VN9A 4AFEA 4O0YA 4J98A 4C37A 4NJ3A 3MVJA 3QCYA 2VWVA 3Q4CA 2GNJA 4FYNA 5HBEA 3UVRA 3GCVA 3B8RA 5HLNA 3FZ1A 4FG9A 4BICA 3FMMA 3R9DA 3QX2A 4FTQA 3QWKA 4MHAA 1OB3A 4CG9A 4J71A 4CFUA 4BBFA 3M11A 4M3QA 1BI8A 4UB7A 1OIYA 4HVDA 1U5QA 3NSZA 4FSQA 3OOMA 3GU4A 3VS2A 3RM7A 5HNIX 2CKQA 1A48A 1YHVA 4PY1A 3FI3A 5HO8A 3TI1A 4X2JA 5KX8A 2VTJA 3HA6A 5HEZA 1GNGA 5JT2A 5HX6A 1SVGA 3DY7A 3OP5A 4AZTA 4C4HA 4TKSA 4GUBA 3M1SA 3BWFA 3OFMA 1PKDA 2YCSA 4BWKA 5E7RA 3WF9A 2XK3A 3R71A 2HENA 1P2AA 4CZYB 3HRCA 4QMPA 5EKNA 5J87A 3O7LB 2XJ1A 4P5ZA 2R9SA 1VYZA 2C1AA 3B8QA 3PVWA 2XJ0A 2X9FA 3REPA 3EQHA 2Q0BA 3LAUA 5EKOA 4PMPA 4CMOA 3W33A 2HY81 5FM2A 3F3UA 3KRJA 1PXLA 2JDOA 2BRHA 2W17A 3KXHA 3OC1A 3R2YA 5AUYA 3MESA 4RFYA 5LMAA 1W84A 3HA8A 3PP1A 5E8UA 2W1HA 4KA3A 4J52A 4YSMA 1ND4A 5C03A 3JS2A 4YGAA 4AGUA 4E5BA 4C61A 2R3MA 4RIWA 3PXFA 5M44A 5CSHA 4OTFA 4DH5A 5IH6A 3DKCA 4LYNA 1IA9A 5CEKA 4JIKA 4MYGA 3PXYA 3P0MA 3UMWA 4QMTA 5HOAA 4AZSA 4U9AA 4C4EA 1UV5A 2W0JA 3DFAA 4I5CA 1ZXEA 5EI8A 3S00A 2FA2A 2XIZA 4Y46A 4G34A 3GFEA 3GI3A 5FGKA 5LWMA 3ZRLA 4IVDA 2WU6A 4X6RA 1FQ1B 4FTMA 3C4XA 4RLLA 3TCPA 4FVPA 4WNPA 4O2PA 3Q9WA 5DWRA 4L46A 4O2ZA 3PIYA 1NT2A 3AGLA 3LFDA 4XG4A 5EYCA 5E8WA 1T45A 3R2BA 5HE3A 2PUPA 3FSKA 4I94A 5HCXA 4FNXA 5TR6A 4UWBA 4Q5HA 4YMJA 1V0OA 4I6BA 4LUEA 3ZLSA 2XEYA 4FSRA 4J1RA 3K5VA 2XK8A 3EOCA 3PA3A 1Q99A 3MJ2A 4PF4A 3HECA 5EDQA 2J4ZA 2GHMA 4HVGA 2CGVA 1REKA 2X7OA 2XJ2A 3PWDA 3R1NA 4WRSA 5C27A 4UYNA 3E8DA 5EW8A 5CU2A 1PHKA 4XRJA 5IISA 1XQZA 1ZY5A 1PMUA 2NRUA 4D2PA 2ZDUA 3CY3A 2V7OA 3I0OA 5DEYA 5FTOA 1L3RE 3EKKA 2YFXA 3OF0A 3ZTXA 4BDKA 3PVUA 4QP9A 1J3HA 2AC5A 3D14A 5I3OA 4U6RA 5AUWA 5IG1A 4C4FA 2FH9A 5K5NA 4KIQA 3T3UA 1TQPA 2WTKB 3E92A 3ORIA 2GHLA 4ERKA 4AZFA 3LQ8A 4TNDA 4XJ0A 4NH1A 3CTJA 3OTVA 4NFNA 3AD6A 3UOHA 1GJOA 5B2LA 3NYNA 4ACHA 1SNXA 3QU0A 1XWSA 4XP3A 3VW6A 5IQCA 3ZYAA 3MV5A 3ALOA 4C34A 1YXVA 3AG9A 4XP0A 2YM3A 4G3EA 4JDIA 4W9WA 4ZSLA 4LV5A 4C4IA 4QMYA 3CGOA 3H9OA 3MFUA 4GIHA 3ZDIA 5AUTA 3TT0A 4BYIA 4TY1A 4ZY6A 1CKJA 4KAOA 3LFBA 2R3QA 5C01A 3ZZEA 5IQFA 2DS1A 4MWIA 5KE0A 4TPTA 4RA4A 4ANSA 2FGIA 2YZLA 3F82A 4JBPA 4O0SA 2F2UA 5LQFA 3GQIA 4C57A 3AC1A 2WMWA 4HGSA 1Q3DA 4YJVA 4S34A 4HVHA 5E8VA 3FV8A 3L9NA 2NRYA 2WHBA 5AFVA 5DT0A 4EBWA 5J5TA 2VTNA 4ENXA 3HAVA 4LMUA 4N4SA 4RFMA 2ITNA 3TEIA 3TUCA 3W18A 5M07A 2PMNX 2UZLA 1IG1A 1NVRA 1AQ1A 1TVOA 4YNOA 3ZC6A 5I3RA 3QTQA 4CMUA 2PMIA 4F1OA 3IQ7A 4OTPA 4GU6A 2UW3A 3WE8A 3EN4A 5L8KA 3JVSA 3TNQB 4NFMA 4H1MA 2GDOA 3F2AA 5ANDA 4QP2A 4Y83A 3KXNA 2I1MA 5DN3A 2YISA 3KRXA 1JSTA 4CQGA 5J79A 3VUHA 4C3PA 4QT1A 3Q2MA 3ZUTA 1MP8A 2IZRA 3FWQA 4MBLA 4QMVA 3LJ1A 4TWCA 4QYEA 4XNEA 3OW3A 4MF0A 3DZOA 2R3HA 3HMPA 5DYJA 2OJFE 4C3FA 4U79A 4BCHA 3LFFA 4QNAA 5CXZA 2EUFB 3B2WA 4BDEA 2C6DA 5CEPA 4DF3A 2UV2A 2WELA 1OZ1A 5FEQA 3Q6UA 4JDKA 4IAFA 3OEZA 3V3VA 2QR8A 4YZNA 5AUZA 1YOLA 4RRVA 4BTKA 2OG8A 4JT3A 3P4KA 5JGBA 4F64A 3T9TA 3PRFA 4PL4A 4AS0A 3D4QA 5M08A 3OWLA 3PJ1A 3EN7A 2J2IB 4QTCA 3SOCA 2J0MB 3BGPA 3T8OA 4JG8A 2PZYA 3A61A 4Y73A 1YDRE 4AUAA 3LQ3A 4E93A 1BKXA 2VTOA 4AN3A 4J99A 5CALA 4O7VA 3CP9A 3KULA 1ZOHA 1PXOA 2REIA 5AIRA 2R3RA 3QRJA 4ZMEA 1PXNA 3HDMA 3RPVA 3QC4A 3P7AA 3HGKA 3U9CA 3AQVA 2ITQA 4K0YA 1YOJA 4R77A 1S9JA 4KIPA 4AA0A 5HU9A 4N6ZA 1ZOGA 5EH0A 3FQHA 4O0VA 1FVTA 2ZB1A 3UOKA 4YC8A 3GU6A 4Z7HA 1ZMVA 3ORTA 5ANIA 4ASDA 4BI0A 4I0RA 5EW3A 4FC0A 1DI8A 1RE8A 3SC1A 3U6IA 2J90A 3UO5A 2R3IA 1DM2A 1Z5MA 3C4CA 2G9XA 3FE3A 3W8LA 2XRWA 2YITA 5L8LA 5D12A 2JAMA 1OPLA 5CVFA 3F61A 4UALA 4IWQA 5HE1A 3KF4A 2XBJA 4R7BA 3IONA 4QYGA 4OBPA 2Q0NA 3IKAA 2HW6A 3R8UA 4MBJA 1BUHA 4IZ5A 3MY5A 3NYXA 4JIAA 4RIYA 1PYEA 4ZJVA 3L8SA 4RVMA 4EH4A 5EFQA 5LVPA 4NWMA 1U54B 3H0ZA 4PDOA 3DBDA 5AR7A 3PPZA 2OWBA 3EZVA 4JG7A 2J51A 4LV8A 4FI1A 4Q5EA 3T9IA 4S32A 1H08A 4U5JA 2QOIA 2I0EA 2JKMA 3PE1A 5I5ZA 5J1VA 2YIQA 4AT4A 4B6LA 4DT9A 2JFMA 2V55A 3DDQA 4NIFB 3RHXA 1H0VA 4G6LA 4QO9A 2WTIA 3CCNA 1ZZLA 2XNMA 4DLJA 2HWPA 5LARA 5M4FA 2WEVA 2XNEA 3QLFA 3LCSA 3QRUA 4R1YA 2QG7A 4KD1A 1CTPE 3KMMA 1HCLA 1VJYA 4NM3A 2WQOA 3BEAA 2JIVA 1OIUA 3EL8A 3OWJA 4EH2A 4GJ2A 2IG7A 3C4ZA 3PXKA 2UZEA 4AZVA 3UNJA 3VUIA 4FEXA 5E4HA 2OICA 2Y4PA 4XBRA 2BDWA 4H3BA 2GS6A 4AA5A 4P7EA 5HI2A 3DAEA 4WOVA 4A4XA 2E9NA 4IJPA 5JRQA 1AGWA 4MXYA 4XG6A 4UXQA 2R3JA 4C36A 4MNEB 2G15A 3TXOA 3G9LX 3EQDA 4FSMA 4LFIA 4WBBB 4Y8DA 2H6DA 3PG3A 2WB8A 4IFCA 4N57A 3QZFA 4RWKA 4U44A 3POZA 5CU0A 4ANLA 5JK3A 3Q4UA 4WG4A 4L9IA 3PLAE 4EK3A 5F94A 2J0LA 3GOKA 3UP7A 3VJNA 4EK5A 4RX5A 4BZOA 5BUEA 3BEGA 3FY0A 3TDVA 4NL0A 3IW6A 4TWNA 4YC3A 4JNWA 5CLPA 2EU9A 3GENA 2VNWA 2HXQA 1OL6A 4YLLA 3ZFXA 4EH7A 3COIA 3O7LD 4NKAA 4ACDA 4OTIA 5JEBA 3R7UA 4MEDA 1YHSA 4R1VA 2EXCX 3ZO1A 3ZOSA 2BAQA 5LCJA 2C5NA 2Y7JA 3R22A 3LE6A 4FKGA 3CJGA 3QQJA 4CZUA 2W4OA 4LGDA 3I81A 2ZV9A 4WNMA 5K4IA 4MBIA 4H3PA 3DB8A 4NT4A 3HV6A 2XKCA 4FTUA 3TKIA 5IMXA 2WMXA 2GSFA 4QYHA 2CCHA 4W4WA 3OMVA 4YC6A 4MCVA 5IA4A 2OJ9A 4FVQA 4GFGA 4DE4A 4ITJA 2OW3A 4RIXB 4QYYA 1DI9A 3D9VA 2QHNA 2UZVA 3HLLA 1PY5A 3V5LA 3GQLA 3TNPC 4DYMA 3OBJA 5K0KA 4ZK5A 5I9UA 4WHZA 3U51A 2VUWA 5AR8A 3HP5A 3PJ2A 3PY3A 1U46A 4IWDA 4W4YA 4F7LA 4L01A 1M2RA 4M8TA 3GBZA 3TZ8A 4QPMA 4M0ZA 3MH0A 4EK6A 4F9WA 3Q60A 4B8MA 3QL8A 3V5PA 1JNKA 3R00A 2HZIA 2UZTA 2R0UA 2VTAA 4JAJA 4KIKB 2RL5A 5E1SA 4ONAA 5EK7A 5FD2A 4CD0A 4F63A 3VC4A 5AADA 3ORMA 2AYPA 2XP2A 4JG6A 1GZ8A 4RX7A 3R1SA 3C9WA 1XO2B 1YI3A 2XM9A 4A7CA 3QD2B 3HMMA 4XV1A 3QWJA 5CEIA 1P5EA 2BTSA 4CFXA 4FEUA 3ATTA 4MD7E 5IA1A 5FBOA 5J1WA 1TQMA 3O8UA 3ZLYA 1J7LA 2YHVA 2X8IA 1WVWA 1XBCA 3DLSA 2YJSA 4FL1A 4WT6A 4BC6A 3U9NA 3ALNA 5I0BA 3GC0A 4FKQA 5DIAA 2JDVA 2PVLA 3OZ6A 3LCOA 2C6MA 4JX3A 4O91A 4FSWA 4AP7A 4CFWA 4F0FA 2WU7A 3Q6WA 4I1ZA 5EYDA 5HNGA 5G1XA 1OPKA 2Y4IC 3DT1A 2B55A 4X3FA 4KKGA 5CXHA 3FQEA 2ZOQA 4L8MA 3P86A 3RK9A 2B7AA 2B9FA 1LEWA 2EVAA 4F9CA 5JN2A 3KC3A 1VZOA 1V0PA 4QP4A 3NUAA 3LXLA 3PP0A 3MI9A 5B7VA 3KK8A 3VS4A 2GQSA 3EYHA 5CNNA 3KF7A 5HGIA 4PDYA 5KHXA 5E8SA 3GC8A 5GJFA 5A9UA 4O0RA 3FZSA 4X3JA 3LFCA 1Y6BA 2CGUA 1Q8ZA 4XV3A 2A1AB 5J8IA 3PE2A 3A8XA 4QMLA 2OI4X 3ATSA 5AX3A 4CT2A 3ZH8A 1OPJA 2WTCA 5TKDA 3VO3A 5BVDA 4QPAA 3UC3A 2IVTA 3AD4A 4R7HA 3VBVA 5LXMA 2XYNA 3SRVA 2J6MA 2PUIA 3PPKA 5HCZA 2UW9A 3GCPA 3PSCA 3HKOA 2CNUA 3AT3A 5A6NA 3PTGA 4BI1A 1GIHA 4BZDA 4G6OA 3QXPA 3EFLA 2O8YA 2PVMA 3OVVA 4D2WA 3CXWA 4KWPA 3KMUA 2JDRA 3S4QA 4FZ6A 3BHTA 5CVGA 4AF3A 2XK7A 4RJ7A 3RAKA 4GS6A 1YWVA 2C4GA 2JKQA 3PFQA 3VBTA 1PRYA 4LQMA 2VO0A 2C6EA 3IECA 4AXAA 4FV4A 4F9YA 3WZJA 3MFTA 4TN6A 4AACA 4P90A 2UZOA 3A7GA 1M7QA 3A4OX 5CENA 3CPCA 5TOZA 4X2KA 1W83A 3OROA 4QMOA 5I4NA 4BCGA 3KGAA 5DA3A 1UU9A 3RK7A 4PL5A 4NM5A 2Z7LA 2RGPA 3EIDA 1FMKA 1Y6AA 4E3CA 3FPMA 4Q9SA 3CTQA 3HV3A 3ELJA 4QPSA 2XH5A 4WUAA 4OLIA 4BN1A 5DR2A 3PVGA 4YHJA 2F7EE 2VO7A 3AMBA 4NK9A 5E91A 4G3CA 4RJ5A 3DJ5A 3ZXZA 5A4EA 5FEDA 3NVMB 1W82A 2IVUA 4EOKA 1PMNA 3QQLA 2B9JA 4XV9A 5C8MA 1WBOA 5HD4A 4CLIA 5J7BA 3PWYA 1Q62A 4ZLOA 2VTRA 3RTPA 3TV7A 3GCQA 4BIEA 4MXZA 4C62A 4APCA 2ERKA 3NR9A 4W8DA 4RQKA 3P1AA 3UVQA 4TYIA 3LXNA 4IB0A 4AGWA 3TG1A 3SGCA 4FTOA 4GK4A 1I44A 5EOBA 1A06A 3ZS5A 4ANOA 4IX5A 2PMOX 3IDCA 4ITHA 4OTWA 4ZSAA 5A3XA 2Y6MA 2B1PA 3QBNA 4DFXE 4XG3A 2CN5A 2YA9A 4YJTA 1FVVA 4O7WA 1REJA 3IOKA 3DDPA 4RJ8A 5EQEA 5HVYA 2BPMA 3OG7A 2WMUA 4I41A 3VRYA 3F2RA 5HZNA 4KBCA 4MVFA 3U54A 1DS5A 1A9UA 1XH9A 3BYOA 4O0XA 4TXCA 2YCFA 4EYJA 2BVAA 3ORZA 3ZU7A 3GU5A 2ZJWA 1ZY4A 2OSCA 3R21A 4EZ7A 1BMKA 4DEIA 3FKOA 3ORNA 2WIPA 3P7CA 3CY2A 4E6QA 3FMDA 5BYYA 3FBVA 4JBOA 2WTWA 3ORXA 4ZXTA 5FTQA 5K5XA 3FI2A 1OECA 2H9VA 3OCSA 3PXRA 4RWLA 4GH2A 4WKQA 5HKMA 4ANNA 4EOSA 3P23A 4GCJA 5IU2A 2PUNA 2PSQA 4JBQA 4D0WA 4R5YA 3U55A 2R7IA 3FL5A 3OCTA 2A2AA 3HYHA 3RKBA 5I9XA 4DBXA 2PVHA 3BBTB 3NYOA 3HV5A 3ORLA 4F7SA 4EZ3A 4KB8A 4PPBA 2C3IB 2OJJA 4D4VA 1ZYDA 3HL7A 3OOGA 2OXYA 4F99A 2J0IA 4AQCA 4FT3A 3RGFA 2VTTA 1OM1A 4RX9A 4PNKA 1KOAA 1R78A 5GZ9A 5FG8A 3KY2A 3TTJA 2QO9A 4TYJA 4ERWA 4ACMA 3IW5A 5D10A 4CCUA 3DKOA 3P9JA 2QO7A 4M69A 4BCJA 2CDZA 1WCCA 4FKWA 4FTLA 3NAYA 4LGGA 5CSVA 4DG0E 4DLIA 4UN0C 2UZUE 1OL7A 3TNIA 3F66A 3QKKA 3QUPA 3MFRA 4L00A 4TT7A 4D4RA 5BQ0A 5DLSA 1SVHA 5CU6A 3DS6A 4O7ZA 3I7BA 2GTNA 4XRLA 2G1TA 4ZLYA 5J7HA 5DR9A 4XG2A 2UUEA 3C13A 5JSMA 3CKWA 2V7AA 4PPAA 3NAXA 2W05A 4CMTA 2V22A 3ZO2A 5A4TA 1LEZA 3FDNA 4J7BA 2Z7RA 4FV8A 4QMZA 4EYMA 1RW8A 4K18A 4IVCA 4EH8A 5IQGA 4WSYA 1VEBA 3D5XA 4X7QA 4DAWA 4OBOA 2BROA 2VTSA 3BGZA 3UJGA 3DBCA 3MB7A 4O96A 3PSBA 4DEBA 3ZXTA 3HMOA 3L8PA 2PU8A 4FZAB 4EWQA 3DFCB 4M7IA 3DU8A 3OT3A 4TYHB 2XNBA 1JVPP 3QYZA 4ZTHA 3BQRA 3R9HA 1Z57A 1Q8UA 1RJBA 2C1BA 3CJFA 3FZPA 3MY0A 3DQXA 4FTAA 4ZTNA 3DCVA 3O8PA 4A06A 3HNGA 5AM7A 4F7JA 4FV5A 4PPCA 2V5QA 4G5JA 3G15A 3F5XA 2UZWE 4AU8A 5JFSA 4MXXA 4X0MA 1OMWA 4NUSA 4J95A 5IZFA 4CTCA 4U8ZA 3NW5A 3KXMA 1KE5A 4ACCA 3SG9A 3AC2A 1WMKA 3FLYA 1FVRA 4EKKA 4GT3A 5CANA 4YTCA 1XBAA 4C38A 4CNHA 2V62A 5J9YA 2PHKA 4FSZA 3WZKA 3OUKA 4FIJA 4BTMA 2GNHA 2YDKA 3F3VA 4KBAA 4GK2A 3VUDA 2Y8OA 4ZTMA 1BYGA 3FHRA 2C5OA 3F2NA 2ONLA 4X3FC 4N6YA 3QTXA 4ZTLA 4X6QC 5EW9A 2X2KA 2CLQA 1UKHA 4IC8A 4M97A 4TYGA 5CI7A 3LKMA 4RJ6A 1Z9XA 5I9WA 2W99B 3VWAA 2C5XA 4I0SA 4QQJA 2JIUA 5JQ8A 3ITZA 3RCJA 3PJ8A 5AUVA 2ZAZA 4RVLA 4XLVA 2QG5A 5F20A 1YI6A 1H1SA 1XBBA 3CR0A 3RK5A 2BAJA 4AWIA 2J9MA 4DGNA 2YABA 3TV6A 3LCDA 2PZIA 3F7WA 1H24A 4LI5A 3HRBA 3RAHA 4EOOA 4K9YA 5IQHA 2PULA 3V51A 4GFMA 3VAPA 1YI4A 2RKUA 4FK3A 3G51A 2WMAA 4ZEGA 3VNTA 3UE4A 2R7BA 2R3GA 3PJ3A 4HPUE 2O65A 2IW6A 5AWMA 4BGGA 2HW7A 5KMMA 3B2TA 2Y0AA 4HYIA 3DK6A 3K3JA 3O51A 4GU9A 3SW4A 4FSNA 4FV9A 5HCYA 2RFDA 5KKRB 2FSTX 2OIBA 4IM3A 2OIDA 2C6LA 2QI8A 3NX8A 5AAEA 4RJ3A 5EDRA 3TUBA 2I6LA 4II5A 3EQRA 4LUDA 2C30A 4TW9A 3L9PA 4UMPA 4QMMA 2PTKA 3BCEA 4O7YA 4YHFA 3FMLA 4G1WA 5DFPA 1DAYA 3U4UA 2A19B 3A7FA 3CQWA 2JITA 4IAZA 4DGLC 4DCEA 1Q5KA 3HMIA 4D55A 5FWKK 4RA5A 2C3KA 4B99A 5C8NA 5HTIA 3G6GA 4BBMA 5CAVA 1MQBA 2C5VA 1LR4A 1XH5A 1H07A 4PDSA 5J9ZA 2IPXA 5FRIA 4EK4A 1OBGA 3UPXA 3V6SA 1F3MC 2VWIA 5BYLA 2RF9A 4QMSA 2HOGA 3K2LA 3L8XA 2W4JA 5FUTA 2VTPA 4U43A 2CN8A 2H8HA 2KTYA 3NUYA 3ACJA 1O6KA 4LOOA 2R0IA 4D9TA 5I9YA 3LLAA 2GMXA 2Q83A 2DQ7X 4F1MA 3IK3A 5H8GA 1OL1A 2ZB0A 2CNQA 4RIOA 1FBNA 4JRNA 3DAKA 2WFYA 2G2FA 2XNGA 2WEIA 4I5HA 2VWXA 3GGFA 5AX9A 4WBOA 4EOQA 1BL7A 2XEZA 1FOTA 5IEVA 2X4ZA 4UY9A 5JGDA 4Y5HA 3R7IA 4CRSA 3FLQA 4NM7A 4IH8A 4GIIA 3DOGA 3VUKA 5TO8A 2ITYA 2JBPA 3ID6C 2CLXA 3PIZA 4W9XA 3RAIA 4A9UA 4C2WA 5JQ5A 5HG7A 3E8CA 3NS9A 4FX3A 5IQEA 3R8ZA 4EORA 2ZM1A 2WMTA 4C33A 3CC6A 3Q3BA 4FTTA 4J97A 1MUOA 3UYSA 3QTRA 3CD8A 5L8JA 4L45A 2C5YA 4K1BA 3BBWA 2W9ZB 5HNBA 3TACA 4EUUA 5JMSA 3S1HA 3ZO3A 1L8TA 1QL6A 4F6UA 3NNWA 2UW6A 2BIYA 2JD5A 1B38A 3NLBA 4GSBA 5M53A 4EHGA 1H8FA 2XK4A 5D9HA 4K6ZA 1JBPE 3F5PA 5DG5A 1J1BA 3OWPA 1U5RA 3R6XA 4IEBA 4EONA 2BDFA 2XNNA 3D15A 3R28A 4D9UA 3HEGA 3HUCA 4YBJA 5BUJA 4FV1A 4PTCA 5DRBA 3E64A 2I0YA 1ERKA 4W4XA 3W8QA 3G9NA 3EQGA 3OCGA 4FA2A 3TNWA 2R3NA 4I22A 1LUFA 3R1YA 2I7QA 2C3LA 3WF7A 4DG2E 5KHWA 3U6HA 4E1ZA 4F4PA 3H0YA 4EWHA 3R8LA 3CSVA 3R04A 4DA5A 3C51A 4CKRA 3GCSA 5CAUA 4IANA 5D7VA 3M2WA 3A8WA 1MRVA 5TE0A 4K33A 4B4LA 2QU6A 3DAJA 4M84A 3ZLXA 3DBEA 2PE1A 4G5PA 2R3LA 2WKMA 3KCKA 4IAIA 4RVKA 4B0GA 1FGIA 5K0XA 5A4CA 2XMYA 1PYXA 3WF6A 3QZHA 4GL9A 4XUFA 3OHTA 4WD5A 4KS8A 4EHVA 1J1CA 3RPOA 3CBLA 3A62A 3VUGA 3UQFA 5KMKA 1H25A 2P0CA 3H9RA 4FG8A 3ZSHA 5L2SA 4IX4A 3UC4A 5HG9A 3QHWA 3AGMA 4MXOA 2RFNA 4YJQA 3W2PA 3PLSA 3AC3A 2G2HA 4AW2A 1WBWA 4EKLA 4F70A 4IXPA 2P33A 5DR6A 3UIMA 4CXAA 3O8TA 3DPKA 3FMJA 3C4WA 4O6EA 5GZAA 3VS3A 2BILB 5M06A 2A4LA 3FZRA 3R1QA 3R7OA 3TKHA 3QUEA 1GAGA 3A60A 2BKZA 4GV1A 4RZVA 3W1FA 1OIQA 1UVRA 2QONA 3ZUVA 4BCFA 4HVSA 3EWHA 3Q4TA 1WFCA 2WQMA 5EYKA 4IWPA 4AOJA 4BTJA 5GIPE 3TV4A 1KWPA 2WD1A 4KBKA 3VBWA 3BGQA 3RCDA 4O0TA 3WZDA 1OBDA 1IA8A 4O86A 1OKZA 3RALA 2OKRA 2BALA 2Y4IB 3GUBA 5CSPA 1YDTE 4RC4A 5EQPA 3V6RA 3U87A 3TM0A 4USFA 1R0EA 2DWBA 1U54A 3A4PA 1X8BA 2GS7A 5CF5A 5DOSA 3C0GA 3TJDA 4BIBA 4V0GA 2O64A 4NSTA 4C3RA 3I1AA 5CAQA 1WVYA 5DRDA 2QVSE 4ENYA 3F69A 3RWPA 4EBVA 4JRVA 2ITOA 4QTAA 1Q61A 3GP0A 3UYTA 2W7XA 3BYMA 3Q32A 2XB7A 2Z7SA 2PVRA 3EFWA 3H4JA 3ZMMA 5A4LA 4NIFA 4O84A 3VW8A 3BI6A 2X6DA 2OXDA 2CKOA 3ZM4A 3IGGA 3L1SA 4FZFB 4IDVA 4KABA 3LFQA 1PMVA 2I0HA 2EXEA 1O9UA 3DV3A 5AR2A 2ONLC 4FV6A 3SXFA 3UVPA 4IX6A 3DZQA 3NPCA 4DTBA 4FZDB 4WNOA 4WNKA 1YKRA 3RINA 1KUTA 3LMHA 3CIKA 1S9IA 2OXXA 5AM6A 4NYEA 3OTUA 4U7ZA 4ZY4A 3FHIA 5ANJA 2C6KA 3F5GA 4JAIA 5DE2A 3AD5A 4BKYA 3KB7A 2VX3A 4DG3E 3R8VA 4MXAA 4XG9A 4F08A 2V0DA 4EOPA 3DK3A 1SNUA 3UPZA 4BRXA 2ZM3A 2VAGA 4GVJA 3P08A 2I0VA 4MNEA 4MQ2A 5HIEA 1IAHA 2FB8A 2VTLA 3NVKI 3KULB 3C5IA 2JKKA 2PWLA 2YZAA 3D94A 3GU8A 5IUHA 5C4LA 1STCE 4FKSA 3VBXA 4IIRA 2XS0A 3MVMA 4YTIA 2P4IA 4YZMA 5K4JA 4BHNA 3COHA 3ZEWA 3CS9A 4GK3A 1G5SA 4MKCA 2WNTA 3NGAA 3POOA 3ZRKA 3E87A 2C47A 4JL9A 3VULA 4C4JA 3WZUA 5CF4A 3IPHA 3O17A 5L6PA 2C6TA 1OUYA 2ITVA 4UV0A 3OWKA 5LVMA 3BIZA 4AOIA 2FO0A 3COMA 4NZWB 2PY3A 1ZOEA 2QC6A 4NTTA 2CGWA 3MBLA 3BELA 4NW5A 3F88A 5E8TA 3BPRA 4QP7A 4A9YA 2PVNA 4IBMA 4RIYB 4C58A 4GRBA 1M2QA 3C5UA 3H10A 3EN5A 2OF2A 3E3PA 4MAOA 3MFSA 3W2QA 1MRUA 4RIXA 3QX4A 4CVAA 3W16A 1H1WA 5TT7A 2WQEA 3ZHPC 5D1JA 2B9IA 4KIOA 2B4SB 3VS6A 4ZJJA 4O7RA 3VS5A 3LXKA 1OUKA 3WOWA 4B8LA 5HE2A 3EJ1A 4QMXA 2RFEA 3P5KA 2UW8A 4HCUA 5AMNA 3Q5ZA 2WAJA 3TIZA 4BZNA 4D2VA 4F9BA 4L3PA 4QTEA 3SQQA 3D2KA 3O0GA 2WOTA 4I3ZA 1OGUA 3DNEA 4E6AA 3FQSA 5J9LA 2YERA 1YVJA 3QKMA 3T3VA 5FLFA 3MIYA 3WARA 4DTAA 5HD7A 3NCZA 4CLJA 1XH7A 4JXFA 4L52A 2XK9A 3OUNB 4L44A 4D1SA 2ITXA 3HDNA 4KIKA 4UYAA 3IS5A 3MS9A 3FYKX 5DNRA 4DEEA 1ZYCA 3RI1A 5L2WA 4BR3A 4EL9A 2CJMA 3UIBA 5IDPA 4QTDA 3EB0A 1TQIA 4YU2A 1VYWA 2W1IA 4KRDA 2QODA 2X9EA 5HICA 5ETFA 4PQNA 4NJDA 2WMSA 5CSXA 4YPSA 5TF9A 1PXPA 3C0IA 2VRXA 2YACA 3FLWA 2C68A 4JLCA 3MDYA 4FKVA 3PY0A 1ZYLA 4TNBA 2OIQA 5M57A 4FL2A 3SV0A 5HIBA 4EH5A 4FV0A 5CSWA 3DK7A 4M66A 3RJCA 4EOMA 5IQIA 4H05A 3QQHA 2UZBA 3K54A 3KRWA 4U97A 3AT4A 3SX9A 3EMGA 2WMRA 4E26A 3BYVA 3FXXA 3PIXA 2UVXA 4PMTA 3VHEA 2GFSA 4YO6A 4CZTA 4DC2A 2XIYA 3DXPA 3IO7A 1XJDA 3JY9A 2QKWB 2VTIA 4MH7A 5KCVA 3BLQA 4N70A 4UMQA 4X2NA 5AP2A 2YM8A 5M09A 4DINA 2KULA 2WTDA 5BX0A 2QNJA 5IKWA 5CI6A 4ALUA 4GT4A 5A6OA 4YLJA 2VGOA 1LPUA 2PL0A 1JQHA 4WRGA 4LRMA 4BFMA 4EH9A 5D11A 4XG8A 1SM2A 4ZTRA 1WBPA 4FIIA 3R9NA 5L2TA 4PWNA 1IRKA 4PMMA 3A7HA 5HO6A 1JKKA 1JSUA 2QOHA 3BE9A 5CWZA 4BI2A 4EUTA 3QA0A 1P4OA 1U59A 4D2SA 3EQPA 3Q52A 3SHEA 5IPJA 4XBUA 2R2PA 3UNZA 4NKSA 3VIDA 4RZWA 3NDMA 3CGFA 4FL3A 5FDPA 3AOXA 3LCKA 3LFAA 4A9TA 3QFVA 2FYSA 2GHGA 2HYYA 2J50A 1XR1A 3QXOA 4EQMA 2X81A 1PXKA 4JQ8A 4R3CA 3EZRA 3EQIA 4UMRA 3QHRA 3E63A 2JKOA 2R3KA 4HYUA 3L9MA 3RP9A 4G9CA 3TN8A 3PXQA 3UG1A 3CQUA 5IMEA 3FZTA 2ETMA 4I5MA 1O6YA 4H36A 4MD9E 2QO2A 4GG7A 3BLRA 1H00A 4RC2A 3RHKA 3UZTA 1W98A 1G8SA 4GUEA 4B7TA 2WO6A 1YWNA 3KFAA 1M7NA 2C69A 4IDTA 4C2VA 5DI1A 5CQWA 5LJJA 3QYWA 3IOPA 4A9SA 1WVXA 2YM6A 3QRKA 1QPEA 4HZSA 4AW1A 2Y6OA 4FIGA 2WPAA 4HYHA 3KXXA 3RPRA 5IDNA 4OBQA 5DH3A 4G2FA 5EI2A 3LIJA 3OT8A 4IVBA 4CEGA 1ZAOA 4CTBA 3EN9A 2PVKA 2IWIA 1WBVA 4JR7A 4X3FB 3WYXA 4UMTA 3LZBA 5KBRA 2IZSA 4AGDA 5ITAA 4FEVA 4X21A 5AA9A 3ZFYA 4QQ5A 4YJPA 3ZONA 3SAYA 5GINE 3PA5A 1YXSA 2BFXA 3ZFMA 2WQNA 4BYJA 3KMWA 1IEPA 5CZIA 3RPSA 5A4QA 2GQRA 3F3ZA 3HMNA 3LFNA 1YXXA 4G3FA 4PMSA 3V5TA 4AN9A 4A9RA 5AV3A 3U6JA 3N4TA 2HCKA 4DH8A 3CLYA 4I24A 3MH1A 1JSVA 1ZZ2A 4AW5A 3D7TB 2VWWA 3S2PA 4DFNA 3BU6A 4ZZNA 5CF8A 3FXWA 3ZBFA 5H8BA 2W1CA 4BDIA 3WF8A 5CEQA 4S31A 3DA6A 3KRRA 4ZP5A 5BVFA 3N4VA 2QOCA 2ZM4A 3L8VA 4TL0A 2EXMA 1QMZA 3QTWA 1ZYSA 4F9AA 5DT3A 3SRVB 4KRCA 4YBKA 3ODYX 4LOQA 2WIHA 1R3CA 3QQUA 2IVVA 5ANEA 2PPQA 2C6OA 4G6NA 3VBQA 5IQBA 5A54A 3QGYA 3W2SA 4U0IA 3LOKA 3UTOA 3E5AA 4UX9A 4I0TA 5ANKA 3SD0A 3EFKA 3EHAA 4K8AA 3LCTA 5AP1A 4BBEA 5C9CA 3ENHA 4H39A 4OR5A 2O0UA 3PG1A 2XCKA 2EB2A 2XA4A 1RDQE 2ETKA 2ZMCA 3MH2A 4DTKA 2W5BA 2CGXA 4QYFA 4M14A 2VX0A 5D41A 5CU3A 1GZKA 2X6EA 2HIWA 2RSVA 3EFJA 3ORKA 2QOQA 4FGBA 3QD0A 4LG4A 4DFZE 5AA8A 5I9ZA 3P79A 3S0OA 5FXQA 3FPQA 4W4VA 3LFSA 5DHJA 3TL8A 4BCOA 5FEEA 3WILA 3N4UA 4JQ7A 2PE2A 3CE3A 4FSTA 4BDCA 3RVGA 4HNFA 4DEAA 1KE8A 4I20A 1W7HA 2YAKA 4MWHA 2OU7A 4HCTA 3SXRA 3TZ7A 1URCA 3MH3A 3ORPA 3VS7A 3SA0A 4O7SA 3IW4A 4LRKA 4XLIA 1PMEA 2B0QA 2YLFA 4GG5A 1IR3A 4MNFA 4O22A 3SDJA 5DGZA 4FKPA 3DBFA 4QMNA 2P2HA 3HZTA 3QQGA 1T46A 3PYYA 4O82A 2QOLA 3W2RA 2W06A 3AC4A 3GB2A 4M13A 3OXIA 5GHVA 1KV1A 4HVIA 4WSQA 4Z3VA 5G6VA 4NEUA 1XH8A 3NMUF 4AT5A 4ANBA 3OW4A 3QQKA 5AUXA 2ZVAA 4XP2A 2XRUA 3NNUA 3R01A 1PXMA 5CEOA 2ZMDA 3JR1A 4ASXA 4AAAA 4AX8A 1UWJA 2ZYBA 5ICPA 1GZOA 4D2TA 2GNLA 4BGQA 4R5SA 5HVJA 2PE0A 4IHPA 2JGZA 3BHVA 4G16A 4NM0A 4WO5A 5B2MA 4YZ9A 1IAJA 3F6XA 3TTIA 3G0FA 5IA3A 2YLEA 2E9OA 3FXZA 4FYOA 3ZLWA 3RPYA 4USEA 4RMZA 4EOJA 2RFSA 4P2KA 4QP3A 2BAKA 4F6WA 4AW0A 2I40A 1K9AA 3GC9A 4YZDA 4V04A 4A4LA 5CY3A 2W1GA 3BKBA 5EHOA 3UOJA 3DXQA 3Q04A 1PXJA 1BLXA 3GEQA 4MX9A 4MK0A 5FXSA 2BDJA 2WMQA 2C0TA 2OZAA 5FBNC 5B2KA 5CT0A 5IF1A 5HU3A 1JWHA 4Y72A 4ITIA 1LP4A 3EQBA 2BRGA 2HZ0A 3HRFA 3OXTA 5E92A 2ZV7A 1OKWA 5L3AA 2R4BA 2OK1A 4IZAA 3ZRMA 4ORKA 4QP6A 5IEYA 4RWJA 5CQUA 2YAAA 4E5AX 5K9IA 4ZS0A 5EHYA 2ETRA 4PP7A 1GIIA 3SXSA 4U81A 3Q53A 4D1ZA 1DAWA 4IADA 3ULZA 3PZEA 3P7BA 4MQ1A 4Q2AA 1HOWA 2CHLA 3UG2A 4XYFA 3V5JA 1H0WA 3LXPA 4GFOA 2JDSA 1BL6A 3A7IA 3NIEA 5IQAA 5FQDC 3R83A 4FOBA 4C35A 1KOBA 4FF8A 1BX6A 3QCXA 4FV7A 4F0IA 4FICA 4UWCA 2IZTA 1CDKA 2PMLX 4S30A 2BIKB 1CM8A 4M69B 4BGHA 1UNGA 5CVHA 2UZDA 3RBWA 4HPTE 4ZTQA 4AGCA 3KVWA 4UZHA 4M0YA 4YHTA 3R7YA 4P4CA 2WMBA 2BZIB 3DLZA 1M17A 4ZSEA 5AV1A 1ZYJA 3G2FA 2XIXA 3ANQA 4BCMA 5ACKA 3VN9A 4R8QA 2VWBA 4YURA 2GCDA 3GT8A 2FSMX 4L6QA 4ZS4A 2AUHA 4DEHA 4ASZA 2VX1A 3E8EA 4O81A 1IASA 3H9FA 3NUXA 1NY3A 5CTPA 2Y9QA 5JKGA 2QQ7A 1Y91A 2NP8A 2F57A 4DFYA 4JQEA 3LJ0A 2PZRA 4IB5A 4G3GA 3MPTA 3KCFA 4LGHA 4ANQA 4R7IA 3QZGA 3GVUA 4NCTA 3IW7A 4RSSA 2YM4A 4ZJIA 3ROYA 4BDBA 2ACXA 4E7WA 5JZJA 1KSWA 4ZTSA 1QCFA 4RWIA 1FMOE 3I6WA 3JUHA 3MA6A 2QOKA 1AD5A 3KN6A 3BX5A 4EH3A 4PDPA 5B0XA 4CFFA 3K3IA 5T3QA 3I79A 3FSFA 3W32A 3QAME 3ZDUA 4AA4A 3V5QA 4XCUA 1SYKA 2UZNA 4I5PA 3UOLA 5FTGA 4OTQA 4PL3A 5HX8A 2BTRA 3MY1A 4O7NA 3FI4A 4G3DA 2X1NA 2E9PA 3I7CA 4I93A 4KSPA 4QOXA 3O71A 4E4MA 4F7NA 4KNBA 2BHEA 3G0EA 4EHEA 2OJGA 4GW8A 4XH6A 4I21A 2PVFA 4Y95A 2ZDTA 4YJOA 5T6KA 3S95A 4H3QA 1M52A 5BMMA 2HY0A 3UZRA 2CCIA 3VVHA 4OTRA 3LJ2A 4J8NA 2YCRA 1EH4A 5CEMA 3V5WA 2CKEA 3MVLA 3Q9ZA 3IDPA 4YJUA 3VBYA 4Z55A 3ETAA 4AZEA 5FDXA 2X2LA 4FTNA 4XOYA 4YTFA 2W4KA 4FKOA 2BRMA 3I5NA 5GNKA 3R02A 4KS7A 5GJDA 4I4FA 3FMNA 2C0OA 3PJCA 4AOTA 4FSUA 4QMUA 5IQDA 4U42A 4Y85A 4MD8E 3WIKA 4GVAA 3E88A 5EHLA 3FC1X 2Z8CA 2AC3A 3R7VA 2BCJA 2O5KA 3LM5A 4XV2A 4OTDA 4CCBA 5DMZA 4LMNA 1ZMWA 3KRLA 4MXCA 3N9XA 4HYSA 1OKVA 4IWOA 4YJRA 3MW1A 4RVTA 5C26A 5F9EA 3VS0A 2XKFA 2O2UA 4GMYA 1PW2A 2PVJA 4ZLZA 5C1QB 2LGCA 4GYGA 2W1FA 2UW4A 2XIKA 5BUIA 2QOFA 3VHKA 5HBHA 3FZOA 2F2CB 3Q9YA 3TKUA 3TZMA 2XK6A 5AJQA 3BYUA 3RZFA 4AE6A 4AT3A 1Q8TA 5A46A 3PVBA 2FSLX 3BHUA 4RIWB 4CFVA 4R3RA 4D5KA 2JC6A 4U80A 5ANOA 3MTLA 3RAWA 1M2PA 4M15A 2HXLA 2WZJA 4Z7GA 3W55A 1H28A 2QKRA 5AIKA 3ZBXA 5AEPA 4FOCA 2QLUA 1XKKA 3KK9A 1R0PA 1JPAA 5M55A 4E4NA 3VS1A 5JFWA 4DH1A 4QRCA 4TZRA 2QLQA 3JYAA 3R7EA 4PX6A 5LMKA 2OH0E 3ULIA 2X2MA 4Y5QA 1NW1A 3E62A 2QOBA 5M4IA 2R3OA 2YIYA 3GCUA 3OS3A 2GFCA 4OAVB 3DTCA 5HESA 2FVDA 5HE0A 4YR8A 5EM6A 3G33A 4FNYA 4FKUA 1QPCA 4UBAA 1WBNA 5L2QA 2X7FA 3QLGA 1PJKA 1ZARA 3VF8A 4AZWA 2ITWA 3UZPA 4DBNA 4YUQA 4APPA 5CASA 3OY1A 4V05A 5BMSA 3KVXA 1MRYA 1V0BA 3BV3A 4YP8A 4FT7A 1URWA 3UIUA 4CQEA 3DTWA 3NNVA 1G3NA 3SOAA 4U3YA 4XHKB 2IO6A 4AE9A 4PP9A 4FIEA 2G2IA 5E8ZA 5BVNA 3BHYA 3LQ5A 5FP5A 2XF0A 2VNYA 5ANGA 3FL4A 4YNEA 2XVDA 1V1KA 1JLUE 5E9EA 4JBVA 4I23A 4KKHA 1F5QA 3FY2A 5GJGA 5KMJA 3R8PA 5DEWA 1O6LA 4Z9LA 1BI7A 2VWZA 1OKYA 3FMKA 5J95A 4GKIA 1B39A 4OT5A 3BYSA 4GKHA 3IW8A 3FMHA 5AP5A 1I09A 2WTJA 1P4FA 2WMVA 2OFVA 2VU3A 4IACA 5EYMA 4BCIA 3WYYA 3AXWA 3TNHA 4BDGA 2EB3A 4L7SA 2JDTA 4JX7A 4YSJA 3BU3A 2F4JA 3BWJA 4FT9A 1M14A 2QU5A 1FINA 2J7TA 4JJRA 4CKIA 3CD3A 5JFXA 3DKGA 3FAAA 4HOKA 2VGPA 2A0CX 4IZYA 5BYZA 4CV8A 4O21A 3QUDA 5EQYA 2FUMA 3D2IA 4DH7A 5KUPA 1H27A 3D5UA 2BUJA 3SLSA 1UKIA 2QOOA 4D1XA 4CRLA 4IM0A 3W2CA 5KNJA 2OH4A 3QCQA 1JAMA 4MTAA 5BPYA 2JLDA 5C4KA 3KXZA 4HGEA 4WG3A 3ANRA 5H9BA 1SVEA 3FLNC 4FKJA 4DFLA 4E20A 4K77A 2ITZA 2VWYA 2XNOA 3JVRA 3C4FA 1WZYA 4FG7A 1J7UA 3FLSA 2C3JA 4LL0A 1UU3A 4BDJA 5HHWA 4DGOA 4L43A 2F9GA 4OT6A 4K2RA 1G8AA 4RLKA 4X2GA 3KN5A 3MIAA 4PV0A 4D2RA 2R3PA 4E4LA 4HW7A 4WIHA 4ARKA 4FE2A 4BWXA 5AAFA 2EWAA 4CFMA 4AG8A 2ITTA 4FTKA 4FTRA 3O23A 3FKNA 2XKEA 2P3GX 2E9VA 2F7XE 2RIOA 3EN6A 2X8DA 3FC2A 2WGJA 2B53A 3F3TA 3QKLA 3ZC5A 4BL1A 4KKEA 3UNKA 2J5EA 2BRBA 2XM8A 3D83A 3IG7A 3ZZWA 2OFUA 4EJ7A 1H01A 4WA9A 4RG0A 2IJMA 4YZBA 3S3IA 3ZEPA 1Y8YA 4EOIA 3QTIA 1GOLA 3KU2A 4B9DA 4FGRA 1WBTA 2RG5A 1YWRA 5AV2A 5ETIA 4C0TA 3KREA 2CMWA 2WTVA 3QC9A 4IFGA 3CKXA 4TTHB 5E8XA 1UU8A 3V8TA 3PZHA 3L9LA 4BWPA 4AN2A 5E90A 3QRTA 2ITUA 4FEWA 1WBSA 3Q4ZA 4RFZA 3DQWA 3MTFA 2LAVA 3NW7A 2UVZA 2XZSA 2YIWA 4U45A 4E6CA 2XCHA 4L7FA 5KKRC 4BVUA 2QCSA 4EC8A 3NYVA 4USDA 3ZO4A 1E9HA 4NW6A 2O63A 4CFNA 3MPAA 3NUNA 4D0XA 3NUUA 3TUDA 2YN8A 2GNFA 4TYEA 1J7IA 2ESMA 2NPQA 3ENMA 2GPHA 4FIHA 4FR4A 5JZNA 3ET7A 3C50A 3UMXA 5LWNA 4NCTC 2VD5A 3EQCA 4QTBA 3PSDA 4EHZA 3NW6A 3NUSA 4LL5A 3WZEA 3PRIA 1YW2A 4EJNA 1GZNA 3W10A 5M56A 4PRJA 3AC8A 3F3WA 1OIRA 4UXLA 3RNYA 1Q97A 3IDBA 3R73A 1KE6A 1ZRZA 1Y8GA 3DJ7A 2WQBA 4FKLA 4V0GB 2P55A 5HO7A 1CSNA 4D4YA 3I4BA 4XX9A 2YIRA 3ERKA 4ID7A 1OL5A 1PKGA 4H58A 4L42A 1XH4A 3AMYA 3BZ3A 2OJIA 4RBLA 5CT7A 3ZUUA 5HLWA 4IB3A 4RPVA 3SKCA 1UA2A 5DVRA 3MYGA 5AV0A 5GZ8A 5ACBC 5H8EA 2HK5A 3HV4A 4R3PA 4YZCA 1E1VA 2VTHA 4W8EA 2Z60A 2HAKA 2BZKB 3R7GA 4BDAA 3BLHA 3AC5A 1H4LA 5IEXA 4JR3A 5CF6A 4EK8A 5AP0A 4E8AA 4F6SA 3VQUA 3ZSGA 3MN3A 4BY9E 1R39A 2YM7A 5AP6A 1JOWB 2Z7QA 3QA8A 3FKLA 5EDPA 2YIXA 3WF5A 5KMNA 3CTHA 2JBOA 4PTGA 1P14A 1HCKA 3EKNA 3GNIB 1H1RA 4YJSA 5ETAA 5DT4A 2WXVA 3TZ9A 1MQ4A 2YDIA 5LMBA 3JXWA 3UODA 4FNZA 5HIDA 5HTBA 5KMLA 2WTKC 3JPVA 5J5SA 4FVRA 5IH4A 4JI9A 4QP1A 4C59A 2GQGA 2UVYA 5BVEA 5JH6A 4O83A 5KO1A 1YDSE 5HG8A 5M4CA 1Y57A 4RT7A 4M67A 1H1PA 3A2CA 1VR2A 2G01A 3GU7A 5IUGA 4C4GA 3ZM9A 4ZZMA 3G6HA 5CAOA 5A14A 4IM2A 4J8MA 3RMFA 5AR4A 1NXKA 3DNDA 3E8NA 4D4SA 4FKRA 4ZZOA 4G17A 5L4QA 3OXZA 3IGOA 4O1PA 4S33A 4TRLA 3RZBA 5BVKA 4J96A 5KZIA 4IX3A 5AAGA 3LM0A 5CYIA 4CSVA 4AFJA 5LOHA 4ZIMA 2PUUA 2E2BA 1NVSA 5F4NA 4CGAA 1Q8WA 3R63A 4KUJA 3PXZA 2VV9A 2IZUA 2W1EA 2DUVA 3E7VA 3JY0A 4FV3A 4IVAA 3R9OA 1U4DA 3UO6A 5KMIA 2W5HA 3BRBA 4CYIA 3THBA 1PF8A 4MF1A 4FZ7A 3VUMA 3II5A 3CEKA 5FP6A 2DYLA 4DT8A 4Q9ZA 3E3BX 3O2MA 3O50A 4M68A 5BVOA 5LMKC 3HAMA 5DBXA 4FBXA 2F7ZE 1WAKA 3MPMA 5C8KA 2H34A 4N0SA 4OTHA 3E7OA 4F65A 4IAAA 5HBJA 2O3PA 5LVOA 1CMKE 2NO3A 4BHZA 2YEXA 2QR7A 4EOLA 4PTEA 4HGTA 3EQFA 4O1OA 5AP3A 4ZY5A 3QD4A 5LCKA 2OGVA 4BTFA 3LFEA 4U3ZA 3MGYA 1J91A 4CKJA 2P2IA 2OO8X 4IJ9A 4IZ7A 4UWYA 4S2ZA 4ZMFA 2VTMA 4I4EA 3SVVA 2HZNA 3I0QA 4DHFA 3KQ7A 2PVYA 3Q96A 2JEDA 3QRIA 3O96A 3HVCA 2ERZE 4QQTA 4O7TA 2J5FA 3HV7A 5AUUA 4C8BA 4CG8A 5AR5A 1Q24A 2C0IA 5KMOA 4JVGA 3EL7A 1RQQA 3NRMA 4FUXA 1KV2A 3BHHA 3OCBA 1ZLTA 2BMCA 3A7JA 1UWHA 2CNVA 2YCQA 5EOLA 1Q3WA 5CS6A 1W0XC 4EQUA 5AR3A 2XYUA 2ITPA 5KBQA 4FTCA 4DCAA 3Q5IA 4E73A 2PZPA 3NNXA 4BDFA 4OAUC 4F09A 1SZMA 3BU5A 3PPJA 4FT0A 4FT5A 4PUZA 3QZIA 4O7LA 4BIDA 4OUCA 4I6QA 4XOZA 4EZ5A 2A27A 2OF4A 3PA4A 2OLCA 3VQHA 3R9RA 3GC7A 1OITA 2J0JA 2ZV2A 2Z2WA 3DBQA 4C02A 4UMUA 3OEFX 3QF9A 3E93A 1YXUA 2UW0A 3WI6A 3D5VA 2X8EA 2XUUA 3FYJX 5EM8A 3D7TA 4F0GA 3AT2A 3K5UA 3V8WA 2BHHA 4I6FA 4YTHA 4D5HA 5D7AA 1F0QA 1H26A 2XKDA 3D0EA 3MSSA 4LOPA 4LRJA 5T68A 3RNIA 4E5WA 4P5QA 1UU7A 4OGRA 4K11A 4DFBA 1CKPA 3LMIA 2E9UA 3VUTA 1YRPA 4FODA 5AP4A 4BCQA 4BDDA 3R0TA 3DKFA 4L3JA 1W8CA 3CPBA 4PNIA 4GT5A 4YPDA 5GIOE 1Q8YA 4L68A 3TWJA 5CX9A 4BCNA 3FI8A 4J53A 4XMOA 5I9VA 2BRNA 4FTJA 3ZCLA 2XIRA 1GY3A 3PY1A 4JDHA 3UGCA 4BKZA 4QMQA 3QD3A 4XEYA 5H2UA 4A4OA 4DN5A 4XS2A 4YLKA 1YOMA 5IH5A 2UW5A 3SG8A 2XNPA 3NEWA 1UNLA 2Z02A 3D7ZA 3WBLA 5CAPA 1FPUA 4FEQA 4IE9A 1H1QA 2YJRA 2GNIA 3UP2A 2IW9A 4DGMA 4HZRA 3TDWA 5M51A 3MWUA 3NUPA 4GEOA 5LVNA 3R8MA 4DITA 4GYIA 3WE4A 3ROCA 2W9FB 3AMAA 3Q2JA 2QHMA 2XBAA 2GS2A 4BB4A 4DEDA 1OVEA 3UIXA 3PDTA 3UQGA 4HNIA 2H96A 3DJ6A 3FJQE 1NA7A 2QD9A 3P78A 5EM5A 4JS8A 5FM3A 4C7TA 1NVQA 3RWQA 3ODZX 2ZV8A 3ZSIA 4YJNA 5JGAA 1ATPE 1SMHA 3KEXA 2VO6A 2R64A 4EC9A 5HORA 4OW8A 4IW0A 4NTSA 4KINA 4IAKA 1YHWA 4O6LA 4UEUA 3LMGA 3F7ZA 4FSYA 4G9RA 5HTCA 2OBJA 5K3YA 5IA0A 2UW7A 1KE7A 3FMEA 2VO3A 2JAVA 4FMQA 2C6IA 3UO4A 4FK6A 3QGWA 4IMYA 5F95A 3U4WA 2QURA 3C1XA 4OTGA 1KE9A 2R3FA 3PUPA 4DEGA 1CKIA 1XH6A 1YXTA 2BKKA 4WUNA 2BFYA 4CT1A 5CNOA 2PYWA 2X4FA 1B6CB 2W1ZA 3DGKA 3V8SA 3D5WA 2HZ4A 4UZDA 5CZHA 4FTIA 4TWOA 2NNWB 1K2PA 2CKPA 5BVWA 4HGLA 4BCKA 4RC3A 3QTZA 3COKA 5HQ0A 1ZWSA 3R30A 3QQFA 4RQVA 3ACKA 4ALVA 4QP8A 3C0HA 4D28A 3KKVA 4EQCA 3Q9XA 3C4EA 4ALWA 4O38A 1UNHA 4R6VA 5HVKA 5E8YA 4IAYA 3HUBA 1K3AA 3C7QA 4RJ4A 4FIFA 4GJ3A 4IQ6A 4Z16A 2YWPA 3BV2A 4L3LA 1OL2A 3EYGA 5JRSA 3UDBA 2YWVA 4CV9A 3HX4A 2W1DA 4QMWA 4G31A 3KXGA 1XHAA 3V04A 3NCGA 3UQCA 1FGKA 3VF9A 3QALE 2FSOX 4U41A 3V01A 2WOUA 4QQCA 4E6DA 2X7GA 1JKTA 3OY3A 3LHJA 3QTSA 5L2IA 3SW7A 2B52A 3FUPA 4JOAA 2IW8A 5EG3A 4QD6A 5JFVA 5L6WL 3QTUA 4ACGA 3BQCA 1E1XA 4EI4A 4TYHA 3WIGA 4NU1A 4EEVA 3VJOA 2HWOA 5IUIA 3BE2A 2IVSA 4LM5A 3U8WA 2BR1A 3KA0A 2X39A 3MB6A 5AV4A 4O27B 3LW0A 4DFUA 4KSQA 4IC7A 4L53A 5FXRA 2CPKE 4CYJA 2BZHB 3NWWA 3EH9A 2X0GA 2R5TA 4D58A 4DGGA 1JKLA 3I5ZA 5ETCA 4ZAUA 1ZMUA 3M42A 4FV2A 3A99A 3RM6A 5H3QA 1Q4LA 2W96B 4ZSJA 4BF2A 4BKJA 4DH3A 5IA2A 4A07A 3FLZA 2VWUA 1OI9A 2YDJA 3I60A 5LVLA 3MA3A 3MVHA 4BDHA 4O0UA 2SRCA 4EH6A 2RG6A 3NZ0A 2JIIA 1Q41A
chains in the Genus database with same CATH superfamily
4F1TA 4QNYA 1APME 4FRFA 2CSNA 5BNJA 3LLTA 5DPVA 4FNWA 3DXNA 4I6HA 4U40A 2HELA 3F9NA 3GXLA 3H30A 3KL8A 4X2FA 2W5AA 3MJ1A 4ZSGA 4M12A 2XAOA 3TIYA 4R78A 3G5DA 4L67A 1XMLA 4H1JA 2VTQA 3LVPA 5IA5A 4TWPA 3VRZA 1GIJA 4FUYA 3HP2A 5AP7A 3W0NA 4FKIA 2VZ6A 3UBDA 3W2OA 5CU4A 2IN6A 1QPDA 4HCVA 4O4DA 3TJCA 4BCPA 2J0KA 4ASEA 3F5UA 3H3CA 3NIZA 4IB1A 3GOPA 5E1EA 3OBGA 5HLPA 1R1WA 2F49A 2GTMA 3G90X 5EI6A 2B54A 5M4UA 1JKSA 4HJOA 3DB6A 2JFLA 4ZOGA 5L6OA 3FEGA 4RX8A 3QCSA 4ANMA 2BZJA 5EM7A 5KZ0A 1PXIA 4XG7A 1TKIA 3GFWA 2OZAB 2PZ5A 3I6UA 3LPBA 3OD6X 4JDJA 2PK9A 1YQJA 5HG5A 4YO4A 3N51A 2OZOA 1QPJA 3CQEA 2GNGA 5F1ZA 2YM5A 4I92A 4WG5A 4V01A 4RGJA 2GU8A 4O0WA 2B9HA 4E4XA 4FKTA 2VN9A 4AFEA 4O0YA 4J98A 4C37A 4NJ3A 3MVJA 3QCYA 2VWVA 3Q4CA 2GNJA 4FYNA 5HBEA 3UVRA 3GCVA 3B8RA 5HLNA 3FZ1A 4FG9A 4BICA 3FMMA 3R9DA 3QX2A 4FTQA 3QWKA 4MHAA 1OB3A 4CG9A 4J71A 4CFUA 4BBFA 3M11A 4M3QA 1BI8A 4UB7A 1OIYA 4HVDA 1U5QA 3NSZA 4FSQA 3OOMA 3GU4A 3VS2A 3RM7A 5HNIX 2CKQA 1A48A 1YHVA 4PY1A 3FI3A 5HO8A 3TI1A 4X2JA 5KX8A 2VTJA 3HA6A 5HEZA 1GNGA 5JT2A 5HX6A 1SVGA 3DY7A 3OP5A 4AZTA 4C4HA 4TKSA 4GUBA 3M1SA 3BWFA 3OFMA 1PKDA 2YCSA 4BWKA 5E7RA 3WF9A 2XK3A 3R71A 2HENA 1P2AA 4CZYB 3HRCA 4QMPA 5EKNA 5J87A 3O7LB 2XJ1A 4P5ZA 2R9SA 1VYZA 2C1AA 3B8QA 3PVWA 2XJ0A 2X9FA 3REPA 3EQHA 2Q0BA 3LAUA 5EKOA 4PMPA 4CMOA 3W33A 2HY81 5FM2A 3F3UA 3KRJA 1PXLA 2JDOA 2BRHA 2W17A 3KXHA 3OC1A 3R2YA 5AUYA 3MESA 4RFYA 5LMAA 1W84A 3HA8A 3PP1A 5E8UA 2W1HA 4KA3A 4J52A 4YSMA 1ND4A 5C03A 3JS2A 1G8KA 4YGAA 4AGUA 4E5BA 4C61A 2R3MA 4RIWA 3PXFA 5M44A 5CSHA 4OTFA 4DH5A 5IH6A 3DKCA 4LYNA 1IA9A 5CEKA 4JIKA 4MYGA 3PXYA 3P0MA 3UMWA 4QMTA 5HOAA 4AZSA 4U9AA 4C4EA 1UV5A 2W0JA 3DFAA 4I5CA 1ZXEA 5EI8A 3S00A 2FA2A 2XIZA 4Y46A 4G34A 3GFEA 3GI3A 5FGKA 5LWMA 3ZRLA 4IVDA 2WU6A 4X6RA 1FQ1B 4FTMA 3C4XA 4RLLA 3TCPA 4FVPA 4WNPA 4O2PA 3Q9WA 5DWRA 4L46A 4O2ZA 3PIYA 1NT2A 3AGLA 3LFDA 4XG4A 5EYCA 5E8WA 1T45A 3R2BA 5HE3A 2PUPA 3FSKA 4I94A 5HCXA 4FNXA 5TR6A 4UWBA 4Q5HA 4YMJA 1V0OA 4I6BA 4LUEA 3ZLSA 2XEYA 4FSRA 4J1RA 3K5VA 2XK8A 3EOCA 3PA3A 1Q99A 3MJ2A 4PF4A 3HECA 5EDQA 2J4ZA 2GHMA 4HVGA 2CGVA 1REKA 2X7OA 2XJ2A 3PWDA 3R1NA 4WRSA 5C27A 4UYNA 3E8DA 5EW8A 5CU2A 1PHKA 4XRJA 5IISA 1XQZA 1ZY5A 1PMUA 2NRUA 4D2PA 2ZDUA 3CY3A 2V7OA 3I0OA 5DEYA 5FTOA 1L3RE 3EKKA 2YFXA 3OF0A 3ZTXA 4BDKA 3PVUA 4QP9A 1J3HA 2AC5A 3D14A 5I3OA 4U6RA 5AUWA 5IG1A 4C4FA 2FH9A 5K5NA 4KIQA 3T3UA 1TQPA 2WTKB 3E92A 3ORIA 2GHLA 4ERKA 4AZFA 3LQ8A 4TNDA 4XJ0A 4NH1A 3CTJA 3OTVA 4NFNA 3AD6A 3UOHA 1GJOA 5B2LA 3NYNA 4ACHA 1SNXA 3QU0A 1XWSA 4XP3A 3VW6A 5IQCA 3ZYAA 3MV5A 3ALOA 4C34A 1YXVA 3AG9A 4XP0A 2YM3A 4G3EA 4JDIA 4W9WA 4ZSLA 4LV5A 4C4IA 4QMYA 3CGOA 3H9OA 3MFUA 4GIHA 3ZDIA 5AUTA 3TT0A 4BYIA 4TY1A 4ZY6A 1CKJA 4KAOA 3LFBA 2R3QA 5C01A 3ZZEA 5IQFA 2DS1A 4MWIA 5KE0A 4TPTA 4RA4A 4ANSA 2FGIA 2YZLA 3F82A 4JBPA 4O0SA 2F2UA 5LQFA 3GQIA 4C57A 3AC1A 2WMWA 4HGSA 1Q3DA 4YJVA 4S34A 4HVHA 5E8VA 3FV8A 3TYKA 3L9NA 2NRYA 2WHBA 5AFVA 5DT0A 4EBWA 5J5TA 3BL7A 2VTNA 4ENXA 3HAVA 4LMUA 4N4SA 4RFMA 2ITNA 3TEIA 3TUCA 3W18A 5M07A 2PMNX 2UZLA 1IG1A 1NVRA 1AQ1A 1TVOA 4YNOA 3ZC6A 5I3RA 3QTQA 4CMUA 2PMIA 4F1OA 3IQ7A 4OTPA 4GU6A 2UW3A 3WE8A 3EN4A 5L8KA 3JVSA 3TNQB 4NFMA 4H1MA 2GDOA 3F2AA 5ANDA 4QP2A 4Y83A 3KXNA 2I1MA 5DN3A 2YISA 3KRXA 1JSTA 4CQGA 5J79A 3VUHA 4C3PA 4QT1A 3Q2MA 3ZUTA 1MP8A 2IZRA 3FWQA 4MBLA 4QMVA 3LJ1A 4TWCA 4QYEA 4XNEA 3OW3A 4MF0A 3DZOA 2R3HA 3HMPA 5DYJA 2OJFE 4C3FA 4U79A 4BCHA 3LFFA 4QNAA 5CXZA 2EUFB 3B2WA 4BDEA 2C6DA 5CEPA 4DF3A 2UV2A 2WELA 1OZ1A 5FEQA 3Q6UA 4JDKA 4IAFA 3OEZA 3V3VA 2QR8A 4YZNA 5AUZA 1YOLA 4RRVA 4BTKA 2OG8A 4JT3A 3P4KA 5JGBA 4F64A 3T9TA 3PRFA 4PL4A 4AS0A 3D4QA 5M08A 3OWLA 3PJ1A 3EN7A 2J2IB 4QTCA 3SOCA 2J0MB 3BGPA 3T8OA 4JG8A 2PZYA 3A61A 4Y73A 1YDRE 4AUAA 3LQ3A 4E93A 1BKXA 2VTOA 4AN3A 4J99A 5CALA 4O7VA 3CP9A 3KULA 1ZOHA 1PXOA 2REIA 5AIRA 2R3RA 3QRJA 4ZMEA 1PXNA 3HDMA 3RPVA 3QC4A 3P7AA 3HGKA 3U9CA 3AQVA 2ITQA 4K0YA 1YOJA 4R77A 1S9JA 4KIPA 4AA0A 5HU9A 4N6ZA 1ZOGA 5EH0A 3FQHA 4O0VA 1FVTA 2ZB1A 3UOKA 4YC8A 3GU6A 4Z7HA 1ZMVA 3ORTA 5ANIA 4ASDA 4BI0A 4I0RA 5EW3A 4FC0A 1DI8A 1RE8A 3SC1A 3U6IA 2J90A 3UO5A 2R3IA 1DM2A 1Z5MA 3C4CA 2G9XA 3FE3A 3W8LA 2XRWA 2YITA 5L8LA 5D12A 2JAMA 1OPLA 5CVFA 3F61A 4UALA 4IWQA 5HE1A 3KF4A 2XBJA 4R7BA 3IONA 4QYGA 4OBPA 2Q0NA 3IKAA 2HW6A 3R8UA 4MBJA 1BUHA 4IZ5A 3MY5A 3NYXA 4JIAA 4RIYA 1PYEA 4ZJVA 3L8SA 4RVMA 4EH4A 5EFQA 5LVPA 4NWMA 1U54B 3H0ZA 4PDOA 3DBDA 5AR7A 3PPZA 2OWBA 3EZVA 4JG7A 2J51A 4LV8A 4FI1A 4Q5EA 3T9IA 4S32A 1H08A 4U5JA 2QOIA 2I0EA 2JKMA 3PE1A 5I5ZA 5J1VA 2YIQA 4O4BB 4AT4A 4B6LA 4DT9A 2JFMA 2V55A 3DDQA 4NIFB 3RHXA 1H0VA 4G6LA 4QO9A 2WTIA 3W0MA 3CCNA 1ZZLA 2XNMA 4DLJA 2HWPA 5LARA 5M4FA 2WEVA 2XNEA 3QLFA 3LCSA 3QRUA 4R1YA 2QG7A 4KD1A 1CTPE 3KMMA 1HCLA 1VJYA 4NM3A 2WQOA 3BEAA 2JIVA 1OIUA 3EL8A 3OWJA 4EH2A 4GJ2A 2IG7A 3C4ZA 3PXKA 3ML1A 2UZEA 4AZVA 3UNJA 3VUIA 4FEXA 5E4HA 2OICA 2Y4PA 4XBRA 2BDWA 4H3BA 1G8JA 2GS6A 4AA5A 4P7EA 5HI2A 3DAEA 4WOVA 4A4XA 2E9NA 4IJPA 5JRQA 1AGWA 4MXYA 4XG6A 4UXQA 2R3JA 4C36A 4MNEB 2G15A 3TXOA 3G9LX 3EQDA 4FSMA 4LFIA 4WBBB 4Y8DA 2H6DA 3PG3A 2WB8A 4IFCA 4N57A 3QZFA 4RWKA 4U44A 3POZA 5CU0A 4ANLA 5JK3A 3Q4UA 4WG4A 4L9IA 3PLAE 4EK3A 5F94A 2J0LA 3GOKA 3UP7A 3VJNA 4EK5A 4RX5A 4BZOA 5BUEA 3BEGA 3FY0A 3TDVA 4NL0A 3IW6A 4TWNA 4YC3A 4JNWA 5CLPA 2EU9A 3GENA 2VNWA 2HXQA 1OL6A 4YLLA 3ZFXA 4EH7A 3COIA 3O7LD 4NKAA 4ACDA 4OTIA 5JEBA 3R7UA 4MEDA 1YHSA 4R1VA 2EXCX 3ZO1A 3ZOSA 2BAQA 5LCJA 2C5NA 2Y7JA 3R22A 3LE6A 4FKGA 3CJGA 3QQJA 4CZUA 2W4OA 4LGDA 3I81A 2ZV9A 4WNMA 5K4IA 4MBIA 4H3PA 3DB8A 4NT4A 3HV6A 2XKCA 4FTUA 3TKIA 5IMXA 2WMXA 2GSFA 4QYHA 2CCHA 4W4WA 3OMVA 4YC6A 4MCVA 5IA4A 2OJ9A 4FVQA 4GFGA 4DE4A 4ITJA 2OW3A 4RIXB 4QYYA 1DI9A 3D9VA 2QHNA 2UZVA 3HLLA 1PY5A 3V5LA 1TZDA 3GQLA 3TNPC 4DYMA 3OBJA 1XMMA 5K0KA 4ZK5A 5I9UA 4WHZA 3U51A 2VUWA 5AR8A 3HP5A 3PJ2A 3PY3A 1U46A 4IWDA 4W4YA 4F7LA 4L01A 1M2RA 4M8TA 3GBZA 3TZ8A 4QPMA 4M0ZA 3MH0A 4EK6A 4F9WA 3Q60A 1W2CA 4B8MA 3QL8A 3V5PA 1JNKA 3R00A 2HZIA 2UZTA 2R0UA 2VTAA 4JAJA 4KIKB 2RL5A 5E1SA 4ONAA 5EK7A 5FD2A 4CD0A 4F63A 3VC4A 5AADA 3AKKA 3ORMA 2AYPA 2XP2A 4JG6A 1GZ8A 4RX7A 3R1SA 3C9WA 1XO2B 1YI3A 2XM9A 4A7CA 3QD2B 3HMMA 4XV1A 3QWJA 5CEIA 1P5EA 2BTSA 4CFXA 4FEUA 3ATTA 4MD7E 5IA1A 5FBOA 5J1WA 1TQMA 3O8UA 3ZLYA 1J7LA 2YHVA 2X8IA 1WVWA 1XBCA 3DLSA 2YJSA 4FL1A 4WT6A 4BC6A 3U9NA 3ALNA 5I0BA 3GC0A 4FKQA 5DIAA 2JDVA 2PVLA 3OZ6A 3LCOA 2C6MA 4JX3A 4O91A 4FSWA 4AP7A 4CFWA 4F0FA 2WU7A 3Q6WA 4I1ZA 5EYDA 5HNGA 5G1XA 1OPKA 2Y4IC 3DT1A 2B55A 4X3FA 4KKGA 5CXHA 3FQEA 2ZOQA 4L8MA 3P86A 3RK9A 2B7AA 2B9FA 1LEWA 2EVAA 4F9CA 5JN2A 3KC3A 1VZOA 1V0PA 4QP4A 3NUAA 3LXLA 3PP0A 3MI9A 5B7VA 3KK8A 3VS4A 2GQSA 3EYHA 5CNNA 3KF7A 5HGIA 4PDYA 5KHXA 5E8SA 3GC8A 5GJFA 5A9UA 4O0RA 3FZSA 4X3JA 3LFCA 1Y6BA 2CGUA 1Q8ZA 4XV3A 2A1AB 5J8IA 3PE2A 3A8XA 4QMLA 2OI4X 3ATSA 5AX3A 4CT2A 3ZH8A 1OPJA 2WTCA 5TKDA 3VO3A 5BVDA 4QPAA 3UC3A 2IVTA 3AKJA 3AD4A 4R7HA 3VBVA 5LXMA 2XYNA 3SRVA 2J6MA 2PUIA 3PPKA 5HCZA 2UW9A 3GCPA 3PSCA 3HKOA 2CNUA 3AT3A 5A6NA 3PTGA 4BI1A 1GIHA 4BZDA 4G6OA 3QXPA 3EFLA 2O8YA 2PVMA 3OVVA 4D2WA 3CXWA 4KWPA 3KMUA 2JDRA 3S4QA 4FZ6A 3BHTA 5CVGA 4AF3A 2XK7A 4RJ7A 3RAKA 4GS6A 1YWVA 2C4GA 3NFGB 2JKQA 3PFQA 3VBTA 1PRYA 4LQMA 2VO0A 2C6EA 3IECA 4AXAA 4FV4A 4F9YA 3WZJA 3MFTA 4TN6A 4AACA 4P90A 2UZOA 3A7GA 1M7QA 3A4OX 5CENA 3CPCA 5TOZA 4X2KA 1W83A 3OROA 4QMOA 5I4NA 4BCGA 3KGAA 5DA3A 1UU9A 3RK7A 4PL5A 4AAYA 4NM5A 2Z7LA 2RGPA 3EIDA 1FMKA 1Y6AA 4E3CA 3FPMA 4Q9SA 3CTQA 3HV3A 3ELJA 4QPSA 2XH5A 4WUAA 4OLIA 4BN1A 5DR2A 4BJJB 3PVGA 4YHJA 2F7EE 2VO7A 3AMBA 4NK9A 5E91A 4G3CA 4RJ5A 3DJ5A 3ZXZA 5A4EA 5FEDA 3NVMB 1W82A 2IVUA 4EOKA 1PMNA 3QQLA 2B9JA 4XV9A 5C8MA 1WBOA 5HD4A 4CLIA 5J7BA 3PWYA 1Q62A 4ZLOA 2VTRA 3RTPA 3TV7A 3GCQA 4BIEA 4MXZA 4C62A 4APCA 2ERKA 3NR9A 4W8DA 4RQKA 3P1AA 3UVQA 4TYIA 3LXNA 4IB0A 4AGWA 3TG1A 3SGCA 4FTOA 4GK4A 1I44A 5EOBA 1A06A 3ZS5A 4ANOA 4IX5A 2PMOX 3IDCA 4ITHA 4OTWA 4ZSAA 5A3XA 2Y6MA 2B1PA 3QBNA 4DFXE 4XG3A 2CN5A 2YA9A 4YJTA 1FVVA 4O7WA 1REJA 3IOKA 3DDPA 4RJ8A 5EQEA 5HVYA 2BPMA 3OG7A 2WMUA 4I41A 3VRYA 3F2RA 5HZNA 4KBCA 4MVFA 3U54A 1DS5A 1A9UA 1XH9A 3BYOA 4O0XA 4TXCA 2YCFA 4EYJA 2BVAA 3ORZA 3ZU7A 3GU5A 2ZJWA 1ZY4A 2OSCA 3R21A 4EZ7A 1BMKA 4DEIA 3FKOA 3ORNA 2WIPA 3P7CA 3CY2A 4E6QA 3FMDA 5BYYA 3FBVA 4JBOA 2WTWA 3ORXA 4ZXTA 3UDZA 5FTQA 5K5XA 3FI2A 1OECA 2H9VA 3OCSA 3PXRA 4RWLA 4GH2A 4WKQA 5HKMA 4ANNA 4DHZA 4EOSA 3P23A 4GCJA 5IU2A 2PUNA 2PSQA 4JBQA 4D0WA 4R5YA 3U55A 2R7IA 3FL5A 3OCTA 2A2AA 3HYHA 3RKBA 5I9XA 4DBXA 2PVHA 3BBTB 3NYOA 3HV5A 3ORLA 4F7SA 4EZ3A 4KB8A 4PPBA 2C3IB 4QEBA 2OJJA 4D4VA 1ZYDA 3HL7A 3OOGA 2OXYA 4F99A 2J0IA 4AQCA 4FT3A 3RGFA 2VTTA 1OM1A 4RX9A 4PNKA 1KOAA 1R78A 5GZ9A 5FG8A 3KY2A 3TTJA 2QO9A 4TYJA 4ERWA 4ACMA 3IW5A 5D10A 4CCUA 3DKOA 3P9JA 2QO7A 4M69A 4BCJA 2CDZA 1WCCA 4FKWA 4FTLA 3NAYA 4LGGA 5CSVA 4DG0E 4DLIA 4UN0C 2UZUE 1OL7A 3TNIA 3F66A 3QKKA 3QUPA 3MFRA 4L00A 4TT7A 4D4RA 5BQ0A 5DLSA 1SVHA 5CU6A 3DS6A 4O7ZA 3I7BA 2GTNA 4XRLA 2G1TA 4ZLYA 5J7HA 5DR9A 4XG2A 2UUEA 3C13A 5JSMA 3CKWA 2V7AA 4PPAA 3NAXA 2W05A 4CMTA 2V22A 3ZO2A 5A4TA 1LEZA 3FDNA 4J7BA 2Z7RA 4FV8A 4QMZA 4EYMA 1RW8A 4K18A 4IVCA 4EH8A 5IQGA 4WSYA 1VEBA 3D5XA 4X7QA 4DAWA 4OBOA 2BROA 2VTSA 3BGZA 3UJGA 3DBCA 3MB7A 4O96A 3PSBA 4DEBA 3ZXTA 3HMOA 3L8PA 2PU8A 3TMOA 4FZAB 4EWQA 3DFCB 4M7IA 3DU8A 3OT3A 4TYHB 2XNBA 1JVPP 3QYZA 4ZTHA 3BQRA 3R9HA 1Z57A 1Q8UA 1RJBA 2C1BA 3CJFA 3FZPA 3MY0A 3DQXA 4FTAA 4ZTNA 3DCVA 3O8PA 4A06A 3HNGA 5AM7A 4F7JA 4FV5A 4PPCA 2V5QA 4G5JA 3G15A 3F5XA 2UZWE 4AU8A 5JFSA 4MXXA 4X0MA 1OMWA 4NUSA 4J95A 5IZFA 4CTCA 4U8ZA 3NW5A 3KXMA 1KE5A 4ACCA 3SG9A 3AC2A 1WMKA 3FLYA 1FVRA 2X0QA 4EKKA 4GT3A 5CANA 4YTCA 1XBAA 4C38A 4CNHA 2V62A 5J9YA 2PHKA 4FSZA 3WZKA 3OUKA 4FIJA 4BTMA 2GNHA 2YDKA 3F3VA 4KBAA 4GK2A 3VUDA 2Y8OA 4ZTMA 1BYGA 3FHRA 2C5OA 3F2NA 2ONLA 4X3FC 4N6YA 3QTXA 4ZTLA 4X6QC 5EW9A 2X2KA 2CLQA 1UKHA 4IC8A 4M97A 4TYGA 5CI7A 3LKMA 4RJ6A 1Z9XA 5I9WA 2W99B 3VWAA 2C5XA 4I0SA 4QQJA 2JIUA 5JQ8A 3ITZA 3RCJA 3PJ8A 5AUVA 2ZAZA 4RVLA 4XLVA 2QG5A 5F20A 1YI6A 1H1SA 1XBBA 3CR0A 3RK5A 2BAJA 4AWIA 2J9MA 4DGNA 2YABA 3TV6A 3LCDA 2PZIA 3F7WA 1H24A 4LI5A 3HRBA 3RAHA 4EOOA 4K9YA 5IQHA 2PULA 3V51A 4GFMA 3VAPA 1YI4A 2RKUA 4FK3A 3G51A 2WMAA 4ZEGA 3VNTA 3UE4A 2R7BA 2R3GA 3PJ3A 4HPUE 2O65A 2IW6A 5AWMA 4BGGA 2HW7A 5KMMA 3B2TA 2Y0AA 4HYIA 3DK6A 3K3JA 3O51A 4GU9A 3SW4A 4FSNA 4FV9A 5HCYA 2RFDA 5KKRB 2FSTX 2OIBA 4IM3A 2OIDA 2C6LA 2QI8A 3NX8A 5AAEA 4RJ3A 5EDRA 3TUBA 2I6LA 4II5A 3EQRA 4LUDA 2C30A 4TW9A 3L9PA 4UMPA 4I6LA 4QMMA 2PTKA 3BCEA 4O7YA 4YHFA 3FMLA 4G1WA 5DFPA 1DAYA 3U4UA 2A19B 3A7FA 2JITA 3CQWA 4IAZA 4DGLC 4DCEA 1Q5KA 3HMIA 4D55A 5FWKK 4RA5A 2C3KA 4B99A 5C8NA 5HTIA 3G6GA 4BBMA 5CAVA 1MQBA 2C5VA 1LR4A 1XH5A 1H07A 4PDSA 5J9ZA 2IPXA 5FRIA 4EK4A 1OBGA 3UPXA 3V6SA 1F3MC 2VWIA 1ST0A 5BYLA 2RF9A 4QMSA 2HOGA 3K2LA 3L8XA 2W4JA 5FUTA 2VTPA 4U43A 2CN8A 2H8HA 2KTYA 3NUYA 3ACJA 1O6KA 4LOOA 2R0IA 4D9TA 5I9YA 3LLAA 2GMXA 2Q83A 2DQ7X 4F1MA 3IK3A 5H8GA 1OL1A 2ZB0A 2CNQA 4RIOA 1FBNA 4JRNA 3DAKA 2WFYA 2G2FA 2XNGA 2WEIA 4I5HA 2VWXA 3GGFA 5AX9A 4WBOA 3W0PA 4EOQA 1BL7A 2XEZA 1FOTA 5IEVA 2X4ZA 4UY9A 5JGDA 4Y5HA 3R7IA 4CRSA 3FLQA 4NM7A 4IH8A 4GIIA 3DOGA 3VUKA 5TO8A 2ITYA 2JBPA 3ID6C 2CLXA 3PIZA 4W9XA 3RAIA 4A9UA 4C2WA 5JQ5A 5HG7A 3E8CA 3NS9A 4FX3A 5IQEA 3R8ZA 4EORA 2ZM1A 2WMTA 4C33A 3CC6A 3Q3BA 4FTTA 4J97A 1MUOA 3UYSA 3QTRA 4LV7A 3CD8A 5L8JA 4L45A 2C5YA 4K1BA 3BBWA 1W2FA 2W9ZB 5HNBA 3TACA 4EUUA 5JMSA 3S1HA 3ZO3A 1L8TA 1QL6A 4F6UA 3NNWA 2UW6A 2BIYA 2JD5A 1B38A 3NLBA 4GSBA 5M53A 4EHGA 1H8FA 2XK4A 5D9HA 4K6ZA 1JBPE 3F5PA 5DG5A 1J1BA 3OWPA 1U5RA 3R6XA 4IEBA 4EONA 2BDFA 2XNNA 3D15A 3R28A 4D9UA 3O5AA 3HEGA 3HUCA 4YBJA 5BUJA 4FV1A 4PTCA 5DRBA 3E64A 2I0YA 1ERKA 4W4XA 3W8QA 3G9NA 3EQGA 3OCGA 4FA2A 3TNWA 2R3NA 4I22A 1LUFA 3R1YA 2I7QA 2C3LA 3WF7A 4DG2E 5KHWA 3U6HA 4E1ZA 4F4PA 3H0YA 4EWHA 3R8LA 3CSVA 3R04A 4DA5A 3C51A 4CKRA 3GCSA 5CAUA 4IANA 5D7VA 3M2WA 3A8WA 1MRVA 5TE0A 4K33A 4B4LA 2QU6A 3DAJA 4M84A 3ZLXA 3DBEA 2PE1A 4G5PA 2R3LA 2WKMA 3KCKA 4IAIA 4RVKA 4B0GA 1FGIA 5K0XA 5A4CA 2XMYA 1PYXA 3WF6A 3QZHA 4GL9A 4XUFA 3OHTA 4WD5A 4KS8A 4EHVA 1J1CA 3RPOA 3CBLA 3A62A 3VUGA 3UQFA 5KMKA 1H25A 2P0CA 3H9RA 4FG8A 3ZSHA 5L2SA 4IX4A 3UC4A 5HG9A 3QHWA 3AGMA 4MXOA 2RFNA 4YJQA 3W2PA 4DDIA 3PLSA 3AC3A 2G2HA 4AW2A 1WBWA 4AXDA 4EKLA 4F70A 4IXPA 2P33A 5DR6A 3UIMA 4CXAA 3O8TA 3DPKA 3FMJA 3C4WA 4O6EA 5GZAA 3VS3A 2BILB 5M06A 2A4LA 3FZRA 3R1QA 3R7OA 3TKHA 3QUEA 1GAGA 3A60A 2BKZA 4GV1A 4RZVA 3W1FA 1OIQA 1UVRA 2QONA 3ZUVA 4BCFA 4HVSA 3EWHA 3Q4TA 1WFCA 2WQMA 5EYKA 4IWPA 4AOJA 4BTJA 5GIPE 3TV4A 1KWPA 2AQXA 2WD1A 4KBKA 3VBWA 2IF8A 3BGQA 4O0TA 3RCDA 3WZDA 1OBDA 1IA8A 4O86A 1OKZA 3RALA 3KIOC 2OKRA 2BALA 2Y4IB 3GUBA 5CSPA 1YDTE 4RC4A 5BV3A 5EQPA 3V6RA 3U87A 3TM0A 4USFA 1R0EA 2DWBA 1U54A 3A4PA 1X8BA 2GS7A 5CF5A 5DOSA 3C0GA 3TJDA 4BIBA 4V0GA 2O64A 4NSTA 4C3RA 3I1AA 5CAQA 1WVYA 5DRDA 2QVSE 4ENYA 3F69A 3RWPA 4EBVA 4JRVA 2ITOA 4QTAA 1Q61A 3GP0A 3UYTA 2W7XA 3BYMA 3BLAA 3Q32A 2XB7A 2Z7SA 2PVRA 3EFWA 3H4JA 3ZMMA 5A4LA 4NIFA 4O84A 3VW8A 3BI6A 2X6DA 2OXDA 2CKOA 3ZM4A 3IGGA 3L1SA 4FZFB 4IDVA 4KABA 3LFQA 1PMVA 2I0HA 2EXEA 1O9UA 3DV3A 5AR2A 2ONLC 4FV6A 3SXFA 3UVPA 4IX6A 3DZQA 3NPCA 4DTBA 4FZDB 4WNOA 4WNKA 1YKRA 3RINA 1KUTA 3LMHA 3CIKA 1S9IA 2OXXA 5AM6A 4NYEA 3OTUA 4U7ZA 4ZY4A 3FHIA 5ANJA 2C6KA 3F5GA 4JAIA 5DE2A 3AD5A 4BKYA 3KB7A 2VX3A 4DG3E 3R8VA 4MXAA 4XG9A 4F08A 2V0DA 4EOPA 3DK3A 1SNUA 3UPZA 4BRXA 2ZM3A 2VAGA 4GVJA 3P08A 2I0VA 4MNEA 4MQ2A 5HIEA 1IAHA 2FB8A 2VTLA 3NVKI 3KULB 3C5IA 2JKKA 2PWLA 2YZAA 3D94A 3GU8A 5IUHA 5C4LA 1STCE 4FKSA 4MUQA 3VBXA 4IIRA 2XS0A 3MVMA 4YTIA 2P4IA 4YZMA 5K4JA 4BHNA 3COHA 3ZEWA 3CS9A 4GK3A 1G5SA 4MKCA 2WNTA 3NGAA 3POOA 3ZRKA 3E87A 2C47A 4JL9A 3VULA 4C4JA 3WZUA 5CF4A 3IPHA 3O17A 5L6PA 2C6TA 1OUYA 2ITVA 4UV0A 3OWKA 5LVMA