2YFXA

Structure of l1196m mutant anaplastic lymphoma kinase in complex with crizotinib
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
308
structure length
292
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of Potent and Selective Inhibitors to Overcome Clinical Anaplastic Lymphoma Kinase Mutations Resistant to Crizotinib.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE RECEPTOR
total genus 97
structure length 292
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yfxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yfxA01
3PUPA 1OL6A 3OCBA 4MBLA 2KULA 3NAYA 3BHVA 4YMJA 2BTSA 4AGUA 4HYUA 5FTGA 3MVLA 3QCQA 4YC8A 3VNTA 4FODA 4FVQA 4BWXA 4DAWA 4FR4A 4GSBA 4AT5A 4CQEA 2PMIA 2YM7A 1URCA 2WQBA 1JKKA 4JAJA 1NA7A 4QPMA 2WEVA 4EZ7A 4ZSAA 3AC1A 5IEVA 3G6GA 3NS9A 5ACBC 5B7VA 5HX6A 3E8NA 2JIIA 2JKKA 3SD0A 4WO5A 1Q97A 4G3DA 1B6CB 1CSNA 2BPMA 2E9UA 2W9ZB 3JVRA 3FHRA 2UZVA 2ZV2A 3GFWA 2IW8A 3ZLSA 5FBNC 2IVTA 3TNHA 2PPQA 2OZAA 3GBZA 3RM7A 4EBVA 3TIYA 5FP6A 3TTIA 2X1NA 5J1WA 3UIXA 4S31A 5L6OA 5DH3A 2R3LA 3QQKA 3BLQA 1JSTA 4EQUA 3AT3A 4IXPA 3GOPA 4FT5A 3R1NA 4M68A 5FDXA 4CFVA 3PG3A 3EQFA 5EDPA 4IZAA 4WBOA 1NXKA 3F5PA 4RJ4A 3A61A 3AT4A 2XBAA 3BGZA 2WELA 2Y6MA 4GRBA 2C4GA 3LFAA 4GJ3A 5D7VA 2C6LA 4AZWA 3A7GA 5AUXA 5IDPA 3KXMA 2R64A 3MPTA 3ZFYA 5E8XA 2BAKA 1G3NA 4F1TA 2SRCA 3PSBA 3QU0A 3UMXA 5HG8A 4U44A 4OAUC 2XRWA 3MFTA 4FKSA 4FNZA 4UWBA 3A7JA 2BFXA 2BIYA 4QNYA 4PDSA 5EHLA 3DJ7A 3HP5A 4KABA 3A99A 3WIGA 4BGGA 3NIEA 5I9WA 3UNJA 3FZTA 5LCJA 4DHFA 2RG6A 1V0PA 4V05A 3ZS5A 3F82A 4DGOA 2J6MA 4IX5A 4C33A 4DH7A 4EQCA 5JH6A 2VUWA 2RL5A 4F99A 4YJPA 4HNIA 3A2CA 3FPMA 3K54A 3QWKA 1BI8A 2HELA 4FKLA 5EM5A 3EQGA 3NLBA 4LFIA 3DDQA 2JD5A 4NH1A 5CNOA 5CVGA 4AA5A 2NRYA 2XK7A 4TTHB 5A9UA 1QL6A 4M12A 4GU9A 5HTIA 5ETAA 5HE1A 3V5QA 3I7BA 5FWKK 2CKEA 5EG3A 3T9TA 4Y5HA 5IDNA 2G2IA 3QFVA 4EYJA 1JKLA 3V6SA 3B2TA 4FMQA 2UUEA 2XNMA 5LMKA 4ASEA 4EOMA 3IKAA 5AUYA 5H2UA 2GTNA 2HZ0A 5K0XA 2Y9QA 5EOLA 3C9WA 2CN8A 2OWBA 3AMAA 4JLCA 2X8IA 3EQPA 1M2RA 3PTGA 4FKRA 4IAZA 4L6QA 3HNGA 4NKAA 2R0UA 4PDOA 4CKRA 4EH6A 3TNPC 4KUJA 1X8BA 3M2WA 4RJ6A 1G5SA 4I23A 2QVSE 4C3RA 2I0HA 2YAAA 2C0OA 4ZTLA 3AD6A 3QD2B 4CZYB 1PKDA 4WG3A 1KUTA 4JRVA 3GU6A 4GIHA 4N6YA 4FOBA 5BMMA 2OKRA 4M97A 3ZO4A 2JDSA 4OTWA 3D14A 5J79A 3UZTA 4IDTA 4UEUA 3LFNA 4I22A 3BU6A 4QTCA 2IZRA 5AUZA 3TKUA 3WI6A 3H0ZA 3ANRA 3QX2A 5IUHA 5IH4A 3MJ2A 3EWHA 4UZDA 3E3PA 4FTIA 4BTMA 3MFSA 2W4OA 2CNVA 1RQQA 5HG9A 3WZKA 2PHKA 3U4UA 1RDQE 3E3BX 5EOBA 3KXXA 1O6KA 3EYHA 4RC3A 4XCUA 4NM7A 4XUFA 1OMWA 4EK4A 4QMQA 2EXMA 2C5VA 3BHTA 3KFAA 4ORKA 1M14A 2GU8A 2WTIA 3H30A 5M56A 4G3GA 3V5TA 4Y72A 2Q83A 3OWKA 4MQ2A 2OJFE 4ZY5A 4XBUA 1ATPE 2GHGA 3DQWA 4TWOA 5E7RA 4F0FA 2C5XA 5LVOA 3DFAA 4E5AX 5E4HA 3TDVA 3DBCA 5AR7A 3UQFA 4TL0A 1UU3A 4NTTA 2VU3A 3LXLA 4JX7A 4USDA 2ZM4A 4QTEA 2Z02A 2RG5A 4FL1A 2GNJA 3RJCA 3NX8A 2GSFA 3RPSA 4FKTA 5F95A 4XS2A 3ZLXA 3CIKA 3NNXA 2WMTA 2VWUA 3LFBA 2VTMA 4HCTA 4AN2A 5JFXA 4P5QA 1UNLA 4U81A 3HECA 5EKNA 5GIPE 1XH8A 2A27A 2FB8A 2XK3A 2UZBA 1BYGA 2QU6A 5BVOA 4KSPA 1CTPE 5TE0A 4CTBA 5IA4A 4BZNA 3HUBA 2G15A 5LVNA 3CQWA 2ZM3A 2GNLA 2B4SB 1ZYCA 3BZ3A 4H3PA 3AXWA 4QYEA 3BBWA 4EBWA 4IVBA 1OPKA 3QTRA 5IMEA 4F1MA 5AAEA 3QALE 3GC9A 4J8NA 3KN5A 4J52A 4OTGA 3W16A 1XH9A 3PRFA 4D2PA 4O21A 4IWOA 3QHRA 4JIAA 2Y7JA 3M11A 2ZDTA 5CU6A 1RJBA 4I21A 3LLAA 3FLYA 5FQDC 2CLXA 4EH2A 5CAOA 5E9EA 4PTGA 1H08A 1H28A 4M84A 3R21A 2O63A 1OPJA 2QQ7A 3EZRA 3LZBA 1I09A 4UV0A 3CR0A 2X6EA 2ITYA 2C47A 4JDKA 3LFFA 2C6EA 4IX3A 4UZHA 4UWCA 2W5HA 3KL8A 4CNHA 4FV8A 4GG5A 4MXCA 3MJ1A 3RHXA 2CNQA 1YI6A 4FV9A 4M13A 4S30A 2ZYBA 1MQ4A 4RSSA 4F6SA 3R1SA 3VVHA 2BRGA 3K3JA 3TZMA 1J3HA 2E9NA 2XBJA 4F6WA 2DS1A 3N4VA 1M17A 2O0UA 2JDVA 2PTKA 4BB4A 3PPJA 5GIOE 4KD1A 3WE8A 3S00A 4BDHA 5ANOA 3PVGA 3FEGA 4FT3A 3R9NA 3QKKA 4YO4A 1HCKA 3FZRA 4FEQA 1H0VA 4BGHA 3TWJA 4FX3A 3E92A 4JDHA 5JK3A 5CVHA 3IG7A 2OG8A 3F3WA 3ZONA 2DWBA 4BBEA 4O7WA 3SQQA 4TNBA 1Y8YA 2R5TA 3M42A 3R8PA 3TV4A 2GTMA 2R3KA 5CU2A 5ACKA 4EOQA 4ZMFA 3W2OA 5DBXA 4G3EA 4O0VA 2YCFA 4X6RA 5FD2A 3I1AA 2WTDA 2V62A 1L8TA 3HMMA 4GKHA 3D7TA 2ZB1A 3LIJA 2XNOA 1KOBA 4FA2A 4BKJA 1FGKA 1P5EA 4KRDA 3AGLA 4I94A 3PY0A 3PRIA 5IQCA 2PZYA 3LAUA 4I93A 2PY3A 5L3AA 4DTAA 2IZUA 3L1SA 4O0TA 2B9HA 4CQGA 4QP7A 4U43A 1WVXA 2C6KA 2OBJA 3UIMA 3ZC5A 3JUHA 2QOLA 3GUBA 3LOKA 4QOXA 2WMBA 3I4BA 1A9UA 2XK9A 3MH2A 2I1MA 4MYGA 4RVTA 3RK5A 3U9NA 2J4ZA 3Q9WA 3P78A 1PHKA 4WUAA 3ZLYA 3SC1A 5CF8A 4ZTNA 2PL0A 4GT5A 2XJ0A 5A6OA 2WTKC 1W8CA 2ITTA 3EQCA 3R7VA 4YC3A 3H9OA 3HL7A 4WSYA 4XYFA 4YHTA 4EONA 5HO6A 3RAHA 5LMBA 4KIKB 4EI4A 2G01A 2VAGA 2XM9A 4FSRA 4I4EA 3LPBA 2V22A 3JYAA 3VBYA 3I0QA 1AD5A 1H1QA 1I44A 5EDRA 1OIQA 3Q4TA 3VF8A 3R71A 4M67A 3OXZA 1PYXA 2FYSA 2VX0A 4FK6A 4C4JA 1W7HA 4WG5A 5HX8A 3DDPA 3NYXA 1GAGA 4XP0A 4RJ8A 3T9IA 5AEPA 3TI1A 4ANQA 1YHWA 2JBPA 3QD4A 4BIDA 2VWZA 2YABA 4OTRA 4H05A 3UC4A 3DY7A 4J71A 4DFYA 4KKGA 5CS6A 1KE6A 1TQPA 2W5BA 3Q32A 3RPVA 4FC0A 4IMYA 4AFJA 1WMKA 3GENA 3UGCA 3QRUA 5J9LA 2GNHA 3G90X 2QO9A 3Q3BA 5H8EA 2B0QA 3LCDA 3OCSA 4IZ7A 4IAFA 4X0MA 2IN6A 2R3QA 3R22A 3GC7A 2YIWA 3BWJA 1YWNA 4U40A 2VX3A 4YJOA 4I0RA 5CT7A 2DUVA 4GU6A 4PMPA 2PVNA 3D2KA 4RX7A 4YURA 4M7IA 2E9VA 4YUQA 3KXHA 5IZFA 5LOHA 5FGKA 4BVUA 3ROCA 5AP1A 4YJTA 4KBCA 4CFXA 4GV1A 2OSCA 2Z2WA 4D0WA 4GFOA 2PULA 5AADA 2BCJA 1OIYA 2O2UA 3I6UA 4RRVA 2HK5A 4YLLA 3QAME 2RIOA 5I5ZA 1OZ1A 3A7HA 2WOTA 4R5YA 3FL5A 3CKWA 3KVXA 4FTQA 1YWVA 1NVQA 4BDBA 4DFXE 2UVXA 2WAJA 1GJOA 4FT7A 3K5VA 4GK3A 4PF4A 5EW8A 3QBNA 2HXQA 4JAIA 1E9HA 4XNEA 1WBNA 3QC4A 3OHTA 3FJQE 3EQDA 4M66A 3QLFA 4OTIA 2J90A 2BZIB 1ZY5A 4RX9A 3VUKA 4A7CA 5JN2A 4F9WA 4NFMA 1H26A 2W1EA 3DAEA 3RGFA 1SMHA 4W9WA 4XP3A 2X6DA 4MWHA 5F20A 5DMZA 2VO7A 4C3PA 4M0YA 1BL6A 1DM2A 3COKA 4C59A 1Q99A 3ATTA 4FI1A 4D5HA 2WMXA 2H9VA 4FNYA 4DFZE 1FMOE 2CN5A 3DJ5A 5CSVA 4DGLC 3ACJA 4FK3A 4XV3A 5H9BA 4PPBA 5LWNA 1LEWA 5D10A 5C9CA 5K5NA 3A8XA 4FKJA 4S33A 4OBOA 4QTDA 3TL8A 5HHWA 1PRYA 3ZOSA 3D5WA 4O0XA 5DPVA 3HZTA 4CFNA 5BVKA 1Q8TA 2ZV7A 3C4CA 4EZ5A 2H96A 1XH6A 1Q3DA 2UZOA 3DAJA 3FYJX 2QO7A 3ZRLA 3VQUA 3R8UA 3DXNA 2W0JA 1YXVA 3MW1A 4AT4A 3TCPA 3R7IA 5HGIA 4R7BA 2WHBA 4R1YA 2YWPA 2P2IA 1IASA 4U8ZA 2OZAB 4G3CA 3R9OA 4ZTMA 4DT8A 1Q8ZA 3MFRA 3QXOA 5E8ZA 4DH3A 4ASXA 2VTQA 5L8KA 3FBVA 4PX6A 4RFYA 4LMNA 3PXYA 4U79A 4X3FA 5AP4A 5AP5A 2PYWA 3CD8A 2OU7A 4BCNA 3I81A 2OGVA 4TYHB 2Y4IB 4CFMA 3RMFA 3NUNA 4GG7A 1NY3A 4O81A 3C1XA 2EWAA 3DS6A 3OXIA 4N57A 2O5KA 2VX1A 3DBDA 1SM2A 3L8XA 4TKSA 4ASZA 3VS0A 3G33A 4ZSJA 3FV8A 5KE0A 3D2IA 2F2UA 2F7EE 4D9UA 3KB7A 5AMNA 2OIBA 4P2KA 2VNWA 4XG7A 5AUTA 3R0TA 5J9ZA 3LXNA 2BR1A 2EB3A 1ZXEA 2CSNA 5CANA 4IVAA 2QR8A 3ORKA 3PVBA 2BIKB 2ZM1A 2HWPA 3MPAA 4E6QA 3BGPA 3ORLA 4FIIA 4GK2A 4HZRA 3JPVA 3ODZX 4R5SA 5HCXA 4O84A 3B8QA 3UO6A 3MB6A 3R9DA 3FMLA 1JLUE 3QD3A 3CTJA 3R2YA 5A6NA 4D1ZA 1G8SA 3QCXA 2HAKA 4WRSA 4CLIA 3UOJA 4RC4A 2C5YA 2WU6A 4G6OA 2J0MB 2WD1A 1Z57A 5E1EA 3UIUA 5L8LA 3SW7A 4EJ7A 4DBNA 4QQ5A 4FIFA 4CFFA 2WTJA 3FMMA 5H8GA 4AAAA 3GU7A 4IAYA 4HGEA 4A9YA 1V1KA 1REJA 3QRTA 1WAKA 1SNXA 5JGDA 4NKSA 4P5ZA 2ETKA 5M44A 3UP2A 4OBPA 2VGPA 2ITZA 4RVKA 5ANEA 3UG1A 5LARA 2W4KA 4R3RA 4O7LA 3THBA 3V8TA 3NW6A 2UW9A 2VTRA 5L2TA 4K77A 5HNBA 3Q6WA 2HY81 3E62A 1J7IA 2GQSA 2R3HA 4C8BA 4I6QA 5IISA 4BY9E 5AR4A 4YPSA 5BYZA 4D55A 4RIXA 5J5TA 4PP7A 4F7LA 3POOA 4TPTA 4K18A 2QODA 5CU3A 3MIYA 4MX9A 4DH8A 3VQHA 3O8TA 1PMVA 2UZNA 5KCVA 3KC3A 3TJDA 3GU4A 4NU1A 5HD4A 4V04A 3FY0A 3PLSA 4Z7HA 2R4BA 3F69A 3FLNC 1UA2A 1KV1A 4FIHA 1PYEA 2DQ7X 3F3VA 3FQSA 4IQ6A 4ACGA 2WQEA 1B39A 3F3TA 4MF0A 3FKNA 3MPMA 2UZEA 2QI8A 3VW8A 1H1RA 4EUUA 3HAVA 2HZIA 5HBEA 3V3VA 3DPKA 3BHHA 4WOVA 3D9VA 4YHJA 5IQHA 2QHMA 2NP8A 2IZSA 3ZXTA 3RPRA 4BDIA 3DBQA 3O8PA 4WNKA 1JOWB 4R6VA 4YSMA 5LMAA 3PXFA 4QMNA 3FXWA 4BCQA 4KIOA 5BVWA 4CSVA 3AC2A 2PZ5A 3BCEA 3BEGA 1VZOA 1R0EA 4IHPA 2PE2A 2QO2A 3QC9A 4RIWA 4NM5A 2NRUA 3PPKA 3C4WA 5EKOA 5IU2A 3D83A 3FWQA 2W99B 3TUBA 1WBSA 4C3FA 1ZYDA 3C4XA 5ICPA 2X2MA 1IA9A 2J0JA 3PYYA 3W8LA 5JGBA 4QTBA 2WNTA 5EQEA 2WQNA 3KQ7A 2C1BA 3NIZA 5BMSA 3SA0A 3EH9A 3O71A 4X3FB 4Y83A 1OKWA 4HYSA 2XJ2A 4D2SA 3BQRA 2JIUA 2UW0A 3OROA 2OLCA 1WVWA 3AC5A 4L3LA 4H1MA 5FEEA 5HE0A 4CCBA 5GHVA 2Y6OA 3DXPA 5KBRA 4I41A 4DTBA 3KRRA 2PUUA 3O8UA 4X7QA 2C69A 4BL1A 2UVZA 4I5MA 4I6FA 1OKVA 4EHZA 3KA0A 3OXTA 2C6IA 5HIBA 3PXKA 4Y95A 1Y6BA 2WO6A 2B7AA 4JDJA 4G1WA 5EW3A 3HV4A 2WMQA 3PVWA 2O8YA 3UMWA 1UKHA 4O6LA 3RVGA 2VTSA 4QP4A 5BUEA 3W2SA 4ANNA 2YAKA 1WZYA 3WZUA 1XBAA 2XNEA 3IK3A 4C61A 2VWIA 3C13A 4D4SA 4EQMA 3CS9A 4GFGA 4W4WA 4UN0C 3V5LA 4EH9A 3V8WA 4DEDA 3EZVA 5IQFA 4EHVA 1XR1A 5HO8A 2PU8A 3EJ1A 4BWPA 3PY1A 5C4KA 3LXPA 3AOXA 3H9FA 5BVEA 4RJ7A 1P14A 4F70A 4YTFA 5A4EA 5AFVA 4HPTE 4I3ZA 4Q5HA 5DR6A 4O7ZA 5BYYA 3EKKA 4O38A 1YOJA 4ZSEA 4ZXTA 5L8JA 5I9XA 5EFQA 3NNUA 3MIAA 4NFNA 2OH0E 4IX4A 4F7NA 3E8DA 4ZIMA 4O0UA 5I9YA 4QMLA 3O2MA 3PIYA 4FG8A 5A4LA 2YLFA 2J9MA 2HENA 4OTDA 4QMPA 2UVYA 3KRXA 2YACA 2J5FA 5B2KA 3OT3A 4P90A 2A19B 2J0LA 4F65A 3ORZA 3F2AA 2C5NA 3QZHA 4YR8A 3O0GA 4KSQA 2KTYA 5FUTA 3PA5A 4BCMA 1DI9A 2X7FA 3O23A 4L3PA 2WZJA 3O51A 3PIXA 3IDPA 3D7TB 4NIFB 3S3IA 3BRBA 5BVFA 5L6PA 4MBIA 1MRVA 3KK8A 1U59A 1ZYLA 3QYWA 4M0ZA 4BN1A 1J7UA 4AWIA 4U6RA 4B7TA 4PRJA 3ZEPA 5FXQA 1DI8A 3BX5A 4FKVA 3G6HA 4G9RA 3WZDA 5AA9A 3LJ2A 3ZEWA 3HV7A 4TYEA 3I6WA 3TN8A 2F2CB 5KX8A 3C5IA 5EYMA 3Q96A 1WBWA 2R3NA 5JFWA 3SLSA 1YVJA 5EYKA 4IB5A 5F94A 5BPYA 5JKGA 5KMNA 3OG7A 4EOLA 4EORA 4QP6A 3FSKA 4IDVA 3VHEA 3U6HA 3NUAA 2RFNA 4LUDA 3E5AA 3TTJA 2OXXA 5KUPA 4IWQA 4NM3A 2BRBA 2PZIA 1NW1A 2UZLA 3A4PA 4YZCA 4E73A 4Y46A 4XV2A 4ZTQA 1PW2A 4OTPA 3VW6A 3DA6A 4GT3A 5DOSA 1Q8WA 1LR4A 4DN5A 2NPQA 3KKVA 4FZ7A 5LCKA 3PE2A 5K4IA 4AZEA 2X0GA 3PA4A 4IFGA 1HOWA 4LRJA 4RIYA 3QX4A 3RNIA 3QD0A 5J7BA 4ZS4A 3L9PA 4IH8A 2C3LA 4TYHA 3MVHA 4LOPA 3HYHA 3R04A 4RZVA 4AF3A 5JT2A 1FOTA 4MXXA 3VBWA 3R02A 2PVFA 3AG9A 3DB8A 2ZV9A 2OIDA 2BTRA 3RP9A 4EEVA 4QYGA 1SVEA 3ETAA 5DT0A 3KK9A 3UNZA 4BDCA 1LPUA 4BYIA 4ZTSA 1P4FA 5CAUA 2HW6A 3E63A 3KF4A 4LRKA 2ITXA 4X3FC 5AAGA 1FMKA 2XP2A 2Y8OA 4L67A 1PJKA 4G6LA 3VS4A 4Y85A 1W98A 3BBTB 2ZAZA 3MV5A 4A9TA 4ACMA 4FTKA 4HNFA 4I0SA 2V7OA 3IGOA 4PNIA 2Z7LA 5TOZA 3IDBA 2YM6A 1WCCA 4C57A 3EL7A 4XHKB 4FKUA 4O0SA 4CT2A 5HI2A 3CGOA 3U55A 3C4EA 3MBLA 5T68A 2ITUA 3HV6A 3HRBA 1Q62A 3TJCA 5HNGA 2QONA 5CZHA 4ANSA 2VN9A 3CGFA 5G6VA 4Q5EA 4E4XA 3UYSA 3ZXZA 4MHAA 4I5HA 5TR6A 3D5UA 1QPCA 3TZ8A 3BYVA 2F9GA 2PK9A 3E64A 4FICA 3NVKI 4NK9A 5LVPA 4X2FA 2FUMA 4KIKA 3ENMA 3FMNA 1R1WA 2JKQA 4JQEA 2CKPA 3FZPA 3VS3A 1EH4A 3WF8A 4UMTA 4ITJA 4BCGA 4BTJA 3PXZA 1JWHA 4QP1A 4RFMA 4WBBB 3VAPA 2Y4PA 4EC9A 5A4QA 3ORPA 2JLDA 4HGSA 5HZNA 5CQWA 2B9JA 3OVVA 4BI1A 4C58A 5C27A 2Q0NA 4C0TA 4D4VA 1XHAA 5IH6A 4XV9A 4IEBA 2DYLA 3UBDA 4E5BA 3P4KA 3W18A 4CMTA 2JITA 4JBOA 3UQCA 4LG4A 5M4FA 3TEIA 2JC6A 2PUNA 3CE3A 5A14A 5F9EA 3GCVA 1U5QA 3RI1A 4FEUA 3W1FA 3G9LX 4FTLA 3RZFA 3NYOA 3R7OA 3HEGA 1M7NA 4Q9SA 3OS3A 5E1SA 5AV3A 3VBTA 3OW3A 5KKRC 4U42A 4TYIA 1QCFA 2J51A 4DGGA 4B8LA 3B8RA 3QZIA 3KXZA 2E9PA 3MSSA 3D7ZA 4ZSLA 4FKPA 4NL0A 3UZRA 3TNIA 3CKXA 3VUTA 3GU8A 4AS0A 5AUUA 3MVJA 3P7BA 3VUDA 1J7LA 1CDKA 4L8MA 3ORNA 2WU7A 3QZGA 4BZDA 3NR9A 4GS6A 4ACHA 3KN6A 3FMEA 5JEBA 4JX3A 1Q5KA 2YIQA 3QQFA 3FMKA 4H3BA 4RWKA 3M1SA 5KMMA 4QMWA 5KMJA 3OWJA 3VUGA 4FSQA 2VTLA 4D2TA 4HVHA 1RE8A 5IUGA 4CG8A 3KY2A 4K2RA 2P3GX 3DFCB 4APCA 3COHA 3P1AA 5AX3A 3NCZA 5LMKC 4QPSA 2R3MA 1A06A 2CHLA 3FDNA 4BC6A 4G3FA 1GNGA 2V5QA 2R2PA 3UOKA 3O17A 4PMSA 3W2RA 4QO9A 4HGTA 3LJ1A 3WARA 5CNNA 3GB2A 1J1CA 4GYGA 1JKSA 2RSVA 2GNIA 4PMMA 4QNAA 2J0KA 4GUBA 3TACA 2O3PA 2I6LA 2PMNX 3E8CA 1QMZA 3TV6A 4PPCA 1PXPA 4DG3E 1MUOA 4MVFA 4E4MA 4IADA 4EOSA 4F63A 3T3UA 3V04A 3ULZA 3UNKA 2ZMCA 3LMGA 1OIUA 4S32A 3OC1A 5AR8A 2J5EA 3S0OA 2CGVA 2QC6A 5EM6A 3LFEA 5M06A 4A07A 4TY1A 4KINA 3BU5A 2C0IA 1KWPA 3I79A 3LFQA 3MVMA 1Z5MA 4IAKA 3DK6A 1AQ1A 1ZYSA 2X8DA 3QYZA 4KRCA 3LXKA 2ACXA 5JRQA 5K5XA 3UO5A 2CJMA 4I0TA 4TYGA 2XS0A 5JFVA 4A9UA 5IH5A 4R78A 5AP6A 3CP9A 4JI9A 4DH5A 4N6ZA 4JDIA 3P23A 5CXHA 4RT7A 1UNGA 4IX6A 4U41A 5AP3A 1OL2A 4B8MA 1YW2A 3FLSA 4JBVA 3BEAA 3QQLA 4BTKA 5CENA 2PE0A 4S34A 3UYTA 3VULA 4MTAA 3AT2A 4QYFA 4FTOA 5KMIA 4FKIA 4MD9E 4UXQA 4O6EA 5AAFA 3SGCA 1ZOHA 4D2RA 3PDTA 1V0BA 1M7QA 3VS1A 3TUCA 3LCTA 4QYYA 5FDPA 4EK3A 1DAYA 2CKOA 5EK7A 3QUEA 4QPAA 2AC3A 3W10A 3COIA 4L46A 3CTHA 3N4UA 3LQ3A 3H3CA 4YBKA 3GXLA 5HLNA 4HVSA 5EYCA 4EOIA 2FGIA 5HEZA 3IGGA 4ZY6A 4ZAUA 2BHHA 3TT0A 5IQGA 1BMKA 2JFMA 4FKQA 3OTVA 4M69A 1GIIA 4H39A 3HRFA 4LI5A 2YITA 4DE4A 5LVMA 4LOOA 4ARKA 4LGGA 1VR2A 3GT8A 3U54A 3GI3A 4FV3A 4GEOA 4JQ7A 4LV8A 5DFPA 3JY0A 5CASA 2X7GA 2JKOA 3EFJA 3G0FA 4USEA 2VTIA 4V0GB 1FGIA 2BUJA 5HTCA 3CD3A 1L3RE 4J95A 3ZM4A 2B55A 4I6HA 4CV8A 3OZ6A 5EM8A 1YXXA 3QXPA 4XOZA 2YIYA 4FKWA 5DRDA 1Q8UA 2XVDA 3TM0A 5GJFA 2OFUA 5FTQA 3WF7A 2W7XA 4EYMA 4F9YA 4XV1A 4AZFA 3SV0A 1GY3A 1WBPA 3VRZA 4O7YA 4ID7A 2J2IB 2C3IB 3R63A 2QOFA 4YZBA 4WNMA 3UPXA 2YFXA 4BIBA 3OBGA 1YKRA 4AQCA 4UMUA 3HMIA 3JS2A 4QMTA 3EIDA 3OW4A 3TKIA 3POZA 3N9XA 3RWQA 2IW9A 4GMYA 3FZSA 4FV6A 3HAMA 2Y0AA 3DNEA 1H07A 1CKPA 3AMYA 4PP9A 2CCHA 3NPCA 3P0MA 3IECA 2F4JA 4JG7A 4CKJA 4FF8A 2BDFA 4CRLA 4K6ZA 3ZRKA 3R7YA 5KHXA 5AV1A 5HCZA 2QLUA 4JG8A 2X2LA 4JR3A 3LCKA 3NCGA 2PMLX 5CYIA 3BIZA 4ZLYA 2XF0A 4OTFA 3ZO1A 4E4NA 4ZMEA 4IVDA 3DLSA 2HZNA 4XG9A 2ITQA 3KVWA 2C6DA 3AD4A 5CEIA 3K2LA 3NZ0A 3FI8A 3Q9ZA 5DE2A 2G9XA 4J53A 3ZMMA 5BVNA 1OGUA 3KEXA 5A4TA 2X7OA 2YISA 4W8EA 3UQGA 4YO6A 2QG5A 5BUIA 2YJRA 3D4QA 2J50A 2YCRA 3HMOA 4WG4A 4RFZA 4AFEA 3ZYAA 4ASDA 4EWQA 4RX5A 4DGNA 2EB2A 3R6XA 4OTHA 3ELJA 2IW6A 4O83A 4U5JA 5M53A 1H0WA 3BE2A 4FOCA 3G15A 3NGAA 4FG9A 3RALA 1O6LA 4AA4A 3DT1A 3D5VA 4TT7A 4F4PA 1WVYA 2H8HA 4IB1A 3BHYA 4O7VA 2JGZA 3OCGA 3EQBA 1XBCA 5T6KA 3NMUF 3VC4A 4G31A 5IG1A 5M09A 4RC2A 3QA8A 4F09A 2GFCA 2P55A 1PXMA 3VF9A 5L6WL 5CEPA 3MFUA 1REKA 5E91A 4YGAA 3IW4A 4I20A 1ZZ2A 2RKUA 3GCPA 3HV5A 4II5A 3KXNA 3RPYA 4BCIA 2QNJA 4K33A 3PE1A 3MY0A 2EU9A 2YLEA 3SRVA 2A1AB 3R73A 4IZ5A 4XRLA 3RAWA 1TKIA 3TNQB 4ANMA 4JR7A 4FE2A 4NCTA 2O65A 2UW5A 4G6NA 4N4SA 3F5GA 3CCNA 4FZAB 4ZTHA 3WOWA 5JMSA 4TWPA 2V7AA 5CWZA 4KIQA 1ND4A 1CKIA 1T45A 2QOBA 2JAMA 3VJOA 1UV5A 4FTUA 4MAOA 3PWYA 1YI4A 3BV2A 3UPZA 4WT6A 4PUZA 5C26A 3SDJA 3BYMA 3QRIA 1LEZA 3KULA 5K0KA 2OK1A 1J1BA 5CSXA 4B9DA 3TKHA 3DZOA 4YLJA 3MTLA 1Y6AA 4DEIA 4CYJA 5A54A 3WYYA 4DH1A 3REPA 5TF9A 1KOAA 4FKOA 3GC8A 5DNRA 5E8YA 4C37A 4DG2E 2X9FA 4FEVA 2JIVA 4IE9A 5CEKA 1B38A 4UBAA 3QF9A 1PXIA 2QOKA 5M55A 3TZ9A 4NIFA 5TT7A 2R0IA 4BDGA 5DN3A 4FTRA 4XBRA 1UU9A 4U3YA 2CPKE 3QLGA 4AW1A 3U6IA 3SAYA 2YM8A 3R7UA 4FV7A 4HPUE 3CBLA 3GCSA 1YOLA 3OT8A 4QMSA 5DEYA 5CXZA 1YXSA 4E3CA 3FUPA 3VBQA 4AACA 5CT0A 4CLJA 2PZPA 1GZKA 3HUCA 4R7IA 5ETCA 5HU3A 2CGUA 2GHMA 2PVHA 5J7HA 1QPJA 2QOCA 1K9AA 4FV0A 4CD0A 2HOGA 5CX9A 3ZFMA 4ZLOA 3A60A 3ZU7A 5FEQA 4TXCA 4FSUA 3GNIB 1T46A 4XG8A 2BRNA 2GHLA 5LQFA 4R3PA 4ENYA 2PVJA 4QMUA 4QP8A 4EH5A 5L2SA 2C3KA 1K2PA 3P5KA 2BDWA 3VS5A 3ZZWA 2C6TA 4E5WA 4W8DA 5BNJA 4DFNA 2GFSA 5AR3A 2FVDA 3F5XA 2W9FB 4XG6A 4QQJA 5GZAA 3V5WA 1F0QA 3BGQA 5IKWA 3PXRA 4K9YA 4H1JA 1URWA 3EYGA 2G2FA 4HGLA 4QP3A 4ERWA 3RK9A 1H8FA 3LQ5A 5FEDA 3E7OA 2OW3A 4WSQA 5CLPA 4IIRA 5ANGA 5JRSA 5HE3A 2CMWA 3LLTA 5G1XA 1TQIA 5ANJA 2OXYA 2GPHA 4FSZA 4O7TA 2OO8X 3W32A 5HLWA 4RX8A 3S95A 3SHEA 5EYDA 3UE4A 4KS8A 2REIA 2RFDA 3E87A 2OI4X 2FSTX 4YHFA 5JQ5A 3VRYA 3FXXA 5E92A 1ZMWA 2GNGA 2WMSA 5CY3A 3EFLA 5FXSA 4KNBA 3LE6A 1JKTA 2QU5A 1UU8A 3U87A 2R3OA 1ZOEA 3F7ZA 4Z3VA 2CDZA 2PVYA 1ZRZA 1R0PA 5HTBA 5LXMA 1H24A 2VTNA 4L3JA 3TZ7A 4FEWA 2IPXA 3R01A 2JDOA 3IW5A 4KKEA 3RCJA 1LUFA 3EN6A 3IW6A 3ZHPC 3CC6A 3NW7A 4CXAA 4IAAA 1FBNA 5ANDA 4X21A 1E1VA 2LAVA 2LGCA 3FLQA 5CQUA 4HOKA 4G17A 3O7LB 5AP2A 4BKZA 2Z60A 3E93A 1UKIA 4HYHA 3G5DA 5IA5A 4TZRA 1M2PA 2VTJA 4R3CA 2BKZA 3DKOA 1GIJA 4LRMA 1PMUA 2Y4IC 4YJNA 4GCJA 2WQOA 3C4ZA 4CMOA 3IW8A 4MD7E 4C36A 3PXQA 4EKKA 3D15A 2XYNA 5ETFA 3PWDA 4QMXA 3UG2A 5ANIA 1M2QA 1YXTA 3UVRA 3DKCA 4A9RA 1U5RA 4MD8E 5DHJA 5C03A 4D2WA 4BF2A 2B9FA 3ZLWA 4DINA 2GS2A 4DEHA 1DAWA 4ZJIA 3S2PA 4AN9A 3IO7A 4IZYA 4ANBA 1PXKA 5A3XA 3CQEA 1LP4A 3ORXA 4J1RA 4MBJA 4WUNA 3KF7A 4JBPA 3OMVA 3CTQA 2H6DA 4PL3A 2YN8A 1H1WA 1KV2A 3ZBXA 5B2LA 2BZKB 1JAMA 3PJCA 3QRJA 4FYNA 3G2FA 2W05A 3WZJA 2VWYA 2Z7SA 1PXLA 3FQHA 3QL8A 3DBEA 3ZUVA 2WB8A 1E1XA 1PXJA 1CMKE 1OBGA 1A48A 1XBBA 4E7WA 4QTAA 1YI3A 4NW6A 5HE2A 1OL7A 2BDJA 4O91A 3KRJA 5JZJA 4FTMA 3ZM9A 2W1ZA 4XLIA 3TV7A 2XIYA 4ZK5A 4F6UA 3MH3A 5J8IA 2JDRA 4D4RA 3MESA 5ETIA 2IVVA 3SG8A 4GVAA 4E6AA 2IJMA 4XH6A 5E8VA 1TVOA 2VTPA 4RBLA 2XNGA 4XX9A 2ZJWA 5AUWA 3SXSA 2OXDA 3ATSA 3DNDA 4BCPA 4FL2A 4U45A 2ITVA 3KMUA 2WMRA 3FZOA 3PZEA 5EM7A 3NYNA 3NYVA 5CSHA 4IACA 3FE3A 4TW9A 5KZ0A 2R3GA 3NWWA 4PTEA 5IA1A 2QOOA 2XIXA 5A4CA 4GIIA 5CEMA 2VO0A 2ONLC 2P33A 4FYOA 3VS2A 4EH7A 1OECA 2YDIA 4MXOA 3DB6A 2C0TA 2X4FA 1QPEA 4CV9A 5HU9A 3FSFA 2OICA 5I0BA 4QMOA 3ULIA 4OBQA 3P9JA 5J87A 2HW7A 4BDDA 1OI9A 3D0EA 5DR2A 3HDNA 2FSMX 2PE1A 4NJ3A 4BCJA 1YOMA 1PXOA 2AYPA 3QGWA 5CF4A 1OIRA 2F49A 1CKJA 3PP1A 1XH5A 5HO7A 4ZY4A 4FIGA 3W2PA 4AU8A 3WF9A 3QQJA 2RF9A 2W96B 5M4IA 3RINA 4OLIA 2XK4A 3L8PA 3FMJA 5HKMA 3HKOA 1BX6A 1SNUA 3SKCA 2UV2A 5HIDA 3UC3A 4BIEA 2GCDA 4AE6A 2C3JA 4Y73A 3SRVB 3EQIA 5CF6A 3AQVA 3PZHA 3O50A 3HMPA 4M15A 4PTCA 3UJGA 4C4HA 4LGDA 4AZVA 4RIWB 2YZAA 3NSZA 1KE7A 4ANOA 2YM5A 3A4OX 4UXLA 5LJJA 2VRXA 4TWNA 2ITPA 2OZOA 4EWHA 2QKWB 2HWOA 3PFQA 3BQCA 1U46A 1WBTA 2YHVA 3BYOA 2UW8A 5AV2A 1H00A 1S9IA 3C0IA 3NUPA 4AOIA 5CU0A 3C0GA 4GL9A 4P4CA 4D1SA 2OJJA 3DQXA 1Q3WA 4D4YA 2E9OA 3O7LD 4GW8A 3PIZA 4RQVA 1GIHA 3EFKA 2YZLA 2BILB 2PSQA 5E8TA 1ERKA 5KO1A 4MWIA 2BZJA 4NJDA 1XO2B 2XMYA 3CEKA 3G0EA 3NUUA 4ALUA 2VD5A 3A7IA 4NSTA 2C5OA 5E90A 5B2MA 2GDOA 3QTWA 5KZIA 4B4LA 5CSWA 4FV1A 5DYJA 4I5PA 4HW7A 2A4LA 4R7HA 2HY0A 3WE4A 3Q4CA 3EN9A 4JOAA 2ONLA 5HVKA 1HCLA 3ROYA 4L01A 4N0SA 4HYIA 5AR2A 4A4XA 4CCUA 5HICA 5I3RA 1O9UA 4ITHA 3Q6UA 2C6MA 4FGBA 3KCKA 5EI6A 4EH8A 4R77A 3LHJA 3ZSGA 5KMOA 4YLKA 3AC3A 5HVYA 3RAKA 1JNKA 3HGKA 2I0VA 3VHKA 3WILA 4FVRA 1RW8A 3L9LA 3RAIA 4O86A 3GU5A 4NZWB 4BCOA 3NW5A 2VTOA 4I6BA 3ZC6A 1ZWSA 2A0CX 4O96A 3Q2JA 4IB0A 2GMXA 3ZO2A 2QOIA 5FLFA 3Q04A 2YM3A 3FY2A 5GNKA 1GZ8A 4FKGA 4E26A 3GP0A 2W5AA 3KREA 5JGAA 3ODYX 2XCHA 1ZZLA 4FL3A 3RNYA 3PSDA 4BDKA 4ALVA 4O1OA 4O2ZA 5FTOA 3EB0A 4R8QA 1R39A 5EH0A 4ITIA 5D7AA 4BTFA 1IEPA 4GK4A 1OB3A 4QP9A 4D58A 2PUPA 3FZ1A 4I92A 1YHVA 1NVRA 3ZUTA 3KMWA 1XH7A 4G9CA 3AC8A 3G9NA 3LJ0A 5CI7A 3HX4A 4RQKA 3R9RA 3T3VA 5HQ0A 4DFLA 1CM8A 4FZFB 3HMNA 5IQBA 3PJ8A 4MNEA 5EQYA 1GOLA 1IR3A 2UW4A 5HLPA 1S9JA 4RMZA 4AOTA 4BHNA 4FG7A 4NM0A 3MA6A 3ANQA 3Q53A 2ZOQA 3FI2A 3NUYA 3QTSA 2R7BA 4PNKA 5HORA 4O7RA 4CTCA 4CFUA 2ZMDA 1JPAA 2NO3A 4WRGA 3C50A 4YBJA 4K1BA 4TRLA 3ZSHA 4BDAA 1ZMUA 2BVAA 2VZ6A 4TN6A 4YZMA 4ZEGA 2PVRA 1W83A 2FSOX 3W2CA 3GEQA 4MQ1A 3CXWA 4JT3A 3KRWA 2WIHA 2QCSA 5FG8A 4FNWA 4G2FA 4RGJA 3BKBA 5AV4A 2VGOA 4FTAA 5AIRA 3RHKA 4ONAA 2PZRA 2PMOX 2W1CA 2UW6A 4OUCA 3HVCA 3QTZA 3Q5IA 5HD7A 5M08A 1YHSA 2XKCA 5GZ9A 2X9EA 2XEZA 1BKXA 4M3QA 4YJQA 5JSMA 1JSVA 4OAVB 4FGRA 4QMVA 3CY3A 2PWLA 1MP8A 5IUIA 4B0GA 3VBVA 4XJ0A 2OH4A 4PPAA 4QMYA 3TIZA 3MYGA 5L4QA 5D12A 3R28A 4DFUA 4OR5A 2JKMA 3BELA 3DLZA 1W84A 4ENXA 3W55A 2BFYA 4FTJA 2ITNA 3PA3A 1H27A 3IQ7A 5M51A 3ZSIA 1OL5A 2BRMA 3Q52A 5IQDA 2XYUA 2B52A 5GJDA 4R1VA 3H9RA 4Q2AA 4X6QC 3TXOA 1J91A 2R3RA 3EL8A 3FQEA 2OJGA 4DC2A 3DU8A 4NEUA 2F57A 4DEEA 5CTPA 2OJIA 4WNOA 1FVRA 4UY9A 3QUDA 4X2JA 5CU4A 3VJNA 4CZTA 4EKLA 4CGAA 1KE9A 3H0YA 1OPLA 4C02A 5FP5A 3DCVA 4M14A 4IM3A 4HJOA 2QHNA 4UMQA 2ETMA 1ZOGA 3CQUA 4AZTA 1WFCA 5HNIX 2RGPA 3HDMA 4PWNA 4JXFA 3OEFX 2VO3A 4K11A 4KWPA 4LYNA 5AP0A 2VWVA 3OEZA 1OBDA 4WD5A 2XCKA 2WTCA 1DS5A 4JJRA 4JL9A 4L9IA 4ALWA 2R3IA 4U3ZA 2H34A 3NRMA 4D2VA 4E6DA 4LMUA 5L2IA 3QQGA 4ANLA 3B2WA 1IAJA 3DXQA 4P7EA 3BLRA 3PPZA 4DEGA 3NEWA 3EOCA 4YZ9A 1F5QA 2W1IA 2W06A 3IPHA 3OFMA 4PQNA 5IEXA 1UNHA 2BRHA 2X81A 2XNNA 1F3MC 2GQGA 4QRCA 4X2KA 4DCEA 2XJ1A 4AX8A 1FVVA 2XK6A 3AD5A 3WF5A 3R30A 5DI1A 4AP7A 2R7IA 4OW8A 4QQTA 3ORTA 4UWYA 5FRIA 5D9HA 4JIKA 5DWRA 3F5UA 5FBOA 3P79A 4RLKA 3KMMA 3EQRA 1YDTE 3N51A 3LMHA 2QURA 3MA3A 4UALA 3LFDA 1IRKA 3PJ1A 3V6RA 4AOJA 4TYJA 4EOPA 3F6XA 4WHZA 3R2BA 3TG1A 3C0HA 3GGFA 5M57A 2XM8A 4B99A 3PSCA 4IAIA 1QPDA 1M52A 3DTCA 4D5KA 2C68A 3OY3A 4BFMA 1FQ1B 2P2HA 3DK3A 2HYYA 3P7AA 2IVSA 5GJGA 4DG0E 2J0IA 1BL7A 2PVKA 2PVLA 2W1DA 2FA2A 4CRSA 3HLLA 5BYLA 3QQHA 4DCAA 1JSUA 4J97A 5C8NA 3QA0A 4BICA 2VV9A 3JR1A 1Y57A 4FSYA 4IBMA 3UIBA 1P2AA 5DVRA 3A7FA 3E7VA 4MK0A 4O0WA 4PV0A 4DYMA 2CKQA 4AZSA 3FC1X 3FAAA 3F2RA 5GINE 4IWPA 2CLQA 2UW3A 2WQMA 4BYJA 5K3YA 3OY1A 3QCYA 4LUEA 5CAPA 4NYEA 3V8SA 3BU3A 3GQIA 3I5NA 3U9CA 3Q2MA 2ITWA 2A2AA 4RWJA 3SXFA 3FI3A 4G34A 4LV5A 3WIKA 4EH4A 3NNVA 1ZAOA 2WIPA 4LM5A 5EI2A 1Q41A 4DGMA 4DLJA 1G8AA 4C7TA 3EN7A 2E2BA 2ESMA 3ACKA 5K4JA 3IW7A 4ZZOA 2VWWA 4NCTC 4RIOA 5AJQA 1Y8GA 3UVQA 3ZBFA 4HCUA 1FPUA 4FT0A 2VWXA 4WNPA 4I5CA 4J8MA 4JBQA 2GQRA 4DBXA 3S1HA 1PMNA 2B9IA 1PMEA 3L8SA 5EHYA 3R7EA 3PP0A 4I1ZA 1XKKA 4ZJJA 4FSNA 3R1QA 3MGYA 3F88A 4BBFA 5IMXA 4BDJA 3VUMA 3NAXA 3C4FA 3WF6A 2ZVAA 3RPOA 1OL1A 2RFEA 2WOUA 3KGAA 3A62A 5C1QB 4YTHA 5ITAA 3LMIA 2ZDUA 3FL4A 3FKLA 2IZTA 2OFVA 4AE9A 4QQCA 1VYZA 3BE9A 5DT4A 4F9BA 3MH1A 1Q24A 4L00A 2XNPA 2WPAA 2QKRA 2YCSA 5CI6A 2GS7A 5D1JA 3VN9A 4ACCA 3NDMA 4MNFA 2WMVA 4BCFA 1SYKA 2WEIA 4IW0A 5I4NA 1VEBA 4HCVA 4KBAA 4RWLA 1YDSE 1ZY4A 1KE5A 1BUHA 3PJ2A 4JNWA 4XG2A 3Q60A 4L45A 5FM2A 4DITA 4YU2A 5HBJA 2X8EA 1NVSA 4KB8A 4BDEA 4C4IA 3FI4A 4FUXA 3UOHA 2NNWB 4PY1A 4FBXA 4U9AA 2YJSA 3BPRA 5BVDA 3QCSA 3QTUA 3R8VA 2ERKA 4AUAA 4ZJVA 1UWHA 4UMRA 1Q4LA 2GNFA 3BYSA 2EVAA 4CVAA 4KKHA 5HESA 1YWRA 2EXCX 3COMA 1OUYA 5AWMA 4ERKA 4BCKA 2YEXA 3R83A 4KA3A 4MXYA 1VJYA 4W9XA 3UO4A 3RM6A 1IG1A 3DBFA 3WBLA 4V01A 1H25A 4J7BA 3UZPA 3GFEA 4OT5A 4LL0A 4M8TA 4YNOA 4CFWA 2C1AA 3QTIA 5AP7A 4IANA 5GZ8A 4FV2A 3UODA 1FVTA 1SVGA 2BZHB 3EFWA 3I0OA 3OOMA 4BHZA 3OCTA 4BI0A 5CSPA 3NUSA 3DOGA 3G51A 4ZTRA 5AX9A 5IQEA 3RCDA 3VWAA 4LGHA 5I9VA 3Q5ZA 3R1YA 4YJVA 3BYUA 5AV0A 4J96A 5CZIA 4DLIA 3II5A 3C51A 4WKQA 4CKIA 3QTQA 5DG5A 2YDJA 4IC7A 2ERZE 5E8UA 3UP7A 2IO6A 3R00A 1ZMVA 4C4FA 4C34A 3DKGA 3QWJA 4O22A 4Y8DA 5DEWA 2XEYA 3P08A 1YXUA 2XKDA 5JFSA 4ZS0A 3NNWA 5KMLA 2WTKB 5J5SA 4KIPA 4XRJA 4BDFA 5JZNA 3QKLA 3ZDIA 5AA8A 1APME 1R3CA 1U4DA 3LFSA 4ZZNA 2CGXA 3OP5A 4S2ZA 2R3PA 4IWDA 1WBOA 4BR3A 3R8ZA 4FTNA 4ZOGA 3FC2A 3ORMA 2G2HA 3Q4UA 3SX9A 4E20A 4RVLA 4XMOA 2B53A 5I9UA 3RTPA 4AGWA 4D9TA 4IJ9A 3MH0A 4KAOA 4BGQA 3CJFA 4UB7A 3EMGA 3LM0A 4O0YA 4CZUA 3DK7A 3I60A 3VO3A 3P86A 4NW5A 2F7ZE 5CEOA 2WGJA 3GCUA 1PKGA 4C62A 4FIEA 2AC5A 2CCIA 3MWUA 3MI9A 4O0RA 1Q61A 2OF2A 3FYKX 4E93A 5DIAA 4AT3A 1GZNA 3HA6A 3L9NA 4D28A 2CGWA 4BWKA 5AM6A 2WXVA 3R7GA 4FEXA 2R3JA 2W1FA 4CEGA 4W4XA 1O6YA 3ZZEA 3OD6X 3TNWA 3ZH8A 2X4ZA 5M4UA 4LQMA 2AUHA 3EKNA 2XIZA 4IC8A 5EQPA 3F9NA 3O96A 2UZWE 2BMCA 2ETRA 3FHIA 4TNDA 5CVFA 3VIDA 1UU7A 3RWPA 4RWIA 1STCE 2BROA 4E4LA 4ZLZA 4PDPA 4L52A 3IOKA 5TKDA 5KMKA 4DEBA 2VNYA 3BI6A 2I7QA 3OBJA 3ZUUA 3A8WA 4OT6A 2XUUA 3F3ZA 5IPJA 2YDKA 4F9AA 4Z7GA 1W0XC 3GQLA 5C01A 1KE8A 4O7NA 1Q8YA 2VTAA 4A06A 3Q4ZA 4JQ8A 3LW0A 3RKBA 2XIKA 4HZSA 4L53A 5E8WA 4EK6A 4AW5A 3NVMB 3DAKA 2XA4A 2QR7A 4HVGA 1FINA 3HP2A 4JS8A 3R8MA 3CJGA 2ZB0A 2EUFB 3QHWA 2V0DA 4AXAA 3Q9XA 3SOCA 4C4EA 1XQZA 1W82A 3S4QA 5AUVA 1YQJA 3QKMA 2J7TA 1P4OA 1OUKA 4Y5QA 2XNBA 4RG0A 3K3IA 5J9YA 3WYXA 3PY3A 1SVHA 1JBPE 4Z55A 4AGDA 2G1TA 3OF0A 3PVUA 2XK8A 4IJPA 3VUIA 5H8BA 4Z16A 4YSJA 1UWJA 4YTCA 5F1ZA 5HOAA 3JVSA 4AGCA 5IQAA 2W4JA 2B54A 4Z9LA 4RA5A 1VYWA 4FVPA 4BBMA 4HVDA 4DT9A 2X39A 2UZUE 2O64A 3PLAE 4MH7A 5EDQA 5BX0A 4RVMA 2OF4A 3BV3A 3R9HA 5KKRB 2JFLA 3LCSA 2B1PA 3DTWA 3IOPA 3H4JA 4C4GA 5A46A 3L9MA 4K8AA 2GS6A 5F4NA 1MQBA 2Z8CA 2OIQA 2W1GA 2RFSA 4EK5A 5AR5A 4RIXB 4F64A 3FLWA 3V51A 4FSTA 5KBQA 3F66A 3WZEA 2EXEA 4F7SA 4GT4A 2WKMA 4U97A 4EOOA 2QLQA 1PY5A 4MXZA 3ORIA 4E1ZA 2R9SA 2WFYA 2YERA 4MXAA 4A4OA 3UTOA 4C2WA 5M4CA 4OTQA 3FXZA 3T8OA 1IA8A 4EZ3A 1AGWA 5C8MA 4PDYA 3SOAA 3EN4A 4GUEA 4YJSA 3AC4A 3ZO3A 3OWPA 3QTXA 4GVJA 3U6JA 3KCFA 2FO0A 2IVUA 4FSWA 2QD9A 2XH5A 3SG9A 3HRCA 4MCVA 2UW7A 4BKYA 2WMAA 5C8KA 3HV3A 4UMPA 2QOQA 4BZOA 4E6CA 4DFBA 3ALNA 3GOKA 4FT9A 5E8SA 4O82A 2VO6A 2HZ4A 4IVCA 4WIHA 5CEQA 5EW9A 5IEYA 1H4LA 3GCQA 1GZOA 3D5XA 4IFCA 5CF5A 5KHWA 4DTKA 5LWMA 4XP2A 1XJDA 2BAQA 3I7CA 5DA3A 5FM3A 3LKMA 5L2QA 3DJ6A 4JVGA 5T3QA 3OWLA 4O27B 5LVLA 3DGKA 4ACDA 5HCYA 3C5UA 4ZP5A 3OUKA 4AW0A 5I9ZA 2HXLA 3EQHA 2UZTA 1PF8A 1BLXA 4RLLA 3U8WA 4TWCA 3UOLA 4EC8A 4RZWA 4D0XA 5CAQA 1ZYJA 3SXRA 4L43A 3N4TA 3FPQA 4L42A 4PL5A 1MRUA 4RJ3A 3R8LA 3GC0A 4XOYA 4A9SA 3LM5A 3UVPA 3IDCA 3E8EA 4PL4A 3LFCA 4YNEA 4C35A 3MY5A 4EUTA 4FZ6A 4G5PA 2QOHA 1UVRA 3SW4A 4X3JA 3W33A 2I40A 2QG7A 5HG7A 4DF3A 4A4LA 4BCHA 3ENHA 1U54A 2V55A 2XB7A 4EOJA 1OM1A 3EN5A 4B6LA 4F0IA 3SVVA 3ET7A 2P0CA 4W4YA 5D11A 3U51A 1R78A 1H1PA 2FH9A 2WMWA 3AGMA 3LCOA 4APPA 3GVUA 2CNUA 2PVMA 2YCQA 4FNXA 4G16A 4L68A 4LL5A 4F08A 2Q0BA 5DR9A 3CY2A 3MY1A 3RBWA 3JY9A 3L8VA 4FUYA 4KBKA 3QRKA 4AW2A 4Q9ZA 3TUDA 4WA9A 3MTFA 4O2PA 4RA4A 2UZDA 3DKFA 4ZZMA 3FMHA 4F9CA 4AG8A 2C30A 4U80A 3BWFA 3ALOA 3ZDUA 5IA0A 5FXRA 4AN3A 4BI2A 5DT3A 4EH3A 4J98A 3IS5A 3V5JA 4QD6A 4YZNA 3VS6A 3W2QA 4FTCA 4L7FA 4EJNA 3CSVA 4IM2A 4JG6A 3OUNB 4H3QA 3KU2A 4N70A 3MDYA 3F61A 4OGRA 2C6OA 3QUPA 3RZBA 3ZRMA 4E8AA 3VS7A 4F0GA 2BHEA 5J1VA 4GKIA 5IQIA 2JEDA 3V01A 4W4VA 4AA0A 1SZMA 2WTWA 2IG7A 3BLHA 5K9IA 3MS9A 4YP8A 5C4LA 2XZSA 3EHAA 4YJUA 2YIXA 4M69B 4FIJA 5D41A 3F3UA 4FV5A 4GFMA 4UYAA 1XH4A 4USFA 4NWMA 3RK7A 5EHOA 2ITOA 3W8QA 3Q9YA 4QYHA 3TDWA 4DEAA 1OITA 4JRNA 3HA8A 4X2GA 4YTIA 3ZTXA 4UX9A 3VUHA 5KNJA 5M07A 4GH2A 4XLVA 4U0IA 4ZSGA 2BAJA 3V5PA 2Z7QA 4XG3A 4V0GA 3QZFA 5AM7A 4C38A 3H10A 4GYIA 3VBXA 4CMUA 4EHGA 5IA2A 4FZDB 4L7SA 5DLSA 2PUIA 4CG9A 2JBOA 5H3QA 3CPCA 4QT1A 1JQHA 4O1PA 4QP2A 4YC6A 2JAVA 5HBHA 1BI7A 1V0OA 4O7SA 1TQMA 4IM0A 3FKOA 1MRYA 1Z9XA 2YA9A 4MKCA 4L44A 4FTTA 3CLYA 5ANKA 3AMBA 3BHUA 4MF1A 3ERKA 3OTUA 5HVJA 2HIWA 4RPVA 4I4FA 3D94A 3DZQA 4FSMA 1IAHA 4G5JA 1WBVA 2OJ9A 4GJ2A 1XWSA 5AIKA 4HVIA 3P7CA 2F7XE 1H01A 1OVEA 3I5ZA 4MEDA 5DGZA 2WMUA 3ID6C 4QMZA 4BRXA 2Z7RA 4NUSA 1OKYA 5I3OA 1K3AA 3FMDA 4IB3A 1NT2A 1JVPP 4YPDA 4YZDA 4EL9A 3U4WA 4EK8A 4U7ZA 4RJ5A 2W17A 3DV3A 4CT1A 2YWVA 3FLZA 2IWIA 4CYIA 5L2WA 1YDRE 4XG4A 4C2VA 3F2NA 3LQ8A 3F7WA 2YIRA 2X2KA 4H36A 4PMTA 4D1XA 4I24A 4K0YA 3E88A 5CALA 2FSLX 4X2NA 4EHEA 3MN3A 3JXWA 3C7QA 1ZARA 5J95A 1U54B 3ZCLA 3KRLA 3QQUA 3QGYA 4F7JA 2BKKA 5JQ8A 5CAVA 3KULB 4NTSA 3PJ3A 2YM4A 3PG1A 2P4IA 3IONA 4FV4A 1H1SA 4NT4A 3OOGA 2BALA 4F1OA 5BUJA 4LOQA 5IF1A 2XRUA 5HIEA 2VTHA 4DA5A 2I0YA 3K5UA 1OKZA 5B0XA 5HG5A 2VWBA 1YRPA 1PXNA 3LVPA 2ZV8A 4RIYB 2XKFA 2I0EA 5BQ0A 5IA3A 3CPBA 5EI8A 4H58A 5TO8A 4J99A 3NUXA 4KS7A 4UYNA 1ZLTA 3ZFXA 4XEYA 1KSWA 2JDTA 2W1HA 3MB7A 4MNEB 1Y91A 2VTTA 5DRBA 4EOKA 2XKEA 4QMMA 2R3FA 2XIRA 3ITZA 4YJRA 2WTVA 3KXGA 2HCKA 3UDBA
chains in the Genus database with same CATH superfamily
3PUPA 1OL6A 3OCBA 4FJVA 4MBLA 2KULA 3NAYA 3BHVA 4YMJA 2BTSA 4AGUA 4HYUA 5FTGA 3MVLA 3QCQA 4YC8A 3VNTA 4FODA 4FVQA 4BWXA 4DAWA 3UDSA 4FR4A 4GSBA 4AT5A 4CQEA 2PMIA 2YM7A 1URCA 2WQBA 1JKKA 4JAJA 1NA7A 4QPMA 2WEVA 4EZ7A 4ZSAA 3AC1A 5IEVA 3G6GA 3NS9A 5ACBC 5B7VA 5HX6A 3E8NA 2JIIA 2JKKA 3SD0A 4WO5A 1Q97A 4G3DA 1B6CB 1CSNA 2BPMA 2E9UA 2W9ZB 3JVRA 3FHRA 2UZVA 2ZV2A 3GFWA 2IW8A 3ZLSA 5FBNC 2IVTA 3TNHA 2PPQA 2OZAA 3GBZA 4AXDA 3RM7A 4EBVA 3TIYA 5FP6A 3TTIA 2X1NA 5J1WA 3UIXA 4S31A 5L6OA 5DH3A 2R3LA 3QQKA 3BLQA 1JSTA 4EQUA 3AT3A 4IXPA 3GOPA 4FT5A 3R1NA 4M68A 5FDXA 4CFVA 3PG3A 3EQFA 5EDPA 4IZAA 4WBOA 1NXKA 3F5PA 4RJ4A 3A61A 3AT4A 2XBAA 3BGZA 2WELA 2Y6MA 4GRBA 2C4GA 3LFAA 4GJ3A 5D7VA 2C6LA 4AZWA 3A7GA 5AUXA 5IDPA 3KXMA 2R64A 3MPTA 3ZFYA 5E8XA 2BAKA 1G8KA 1G3NA 4F1TA 2SRCA 3PSBA 3QU0A 3UMXA 5HG8A 4U44A 4OAUC 2XRWA 3MFTA 4FKSA 4FNZA 4UWBA 3A7JA 2BFXA 2BIYA 4QNYA 4PDSA 5EHLA 3DJ7A 3HP5A 4KABA 3A99A 3WIGA 4BGGA 3NIEA 5I9WA 3UNJA 3FZTA 5LCJA 4DHFA 2RG6A 1V0PA 4V05A 3ZS5A 3F82A 4DGOA 2J6MA 4IX5A 4C33A 4DH7A 4EQCA 4DHZA 5JH6A 2VUWA 2RL5A 4F99A 4YJPA 4HNIA 3A2CA 3FPMA 3K54A 4BDIA 3QWKA 1BI8A 2HELA 4FKLA 5EM5A 3EQGA 3NLBA 4LFIA 3DDQA 2JD5A 4NH1A 5CNOA 5CVGA 4AA5A 2NRYA 2XK7A 4TTHB 5A9UA 1QL6A 4M12A 4GU9A 5HTIA 5ETAA 5HE1A 3V5QA 3I7BA 5FWKK 2CKEA 5EG3A 3T9TA 4Y5HA 5IDNA 2G2IA 3QFVA 4EYJA 1JKLA 3V6SA 3B2TA 4FMQA 3ML1A 2UUEA 2XNMA 5LMKA 4ASEA 4EOMA 3IKAA 5AUYA 5H2UA 2GTNA 2HZ0A 5K0XA 2Y9QA 5EOLA 3C9WA 2CN8A 2OWBA 3AMAA 4JLCA 2X8IA 3EQPA 1M2RA 3PTGA 4FKRA 4IAZA 4L6QA 3HNGA 4NKAA 2R0UA 4PDOA 4CKRA 4EH6A 3TNPC 4KUJA 1X8BA 3M2WA 4RJ6A 1G5SA 4I23A 2QVSE 4C3RA 2I0HA 2YAAA 2C0OA 4ZTLA 3AD6A 3QD2B 4CZYB 1PKDA 4WG3A 1KUTA 4JRVA 3GU6A 4GIHA 4N6YA 4FOBA 5BMMA 2OKRA 4M97A 3ZO4A 2JDSA 4OTWA 3D14A 5J79A 3UZTA 4IDTA 4UEUA 3LFNA 4I22A 3BU6A 4QTCA 2IZRA 5AUZA 3TKUA 3WI6A 3H0ZA 3ANRA 3QX2A 5IUHA 5IH4A 3MJ2A 3EWHA 4UZDA 3E3PA 4FTIA 4BTMA 3MFSA 2W4OA 2CNVA 1RQQA 5HG9A 3WZKA 2PHKA 3U4UA 1RDQE 3E3BX 5EOBA 3KXXA 1O6KA 3EYHA 4RC3A 4XCUA 4NM7A 4XUFA 1OMWA 4EK4A 4QMQA 2EXMA 2C5VA 3BHTA 3KFAA 4ORKA 1M14A 2GU8A 2WTIA 1XMMA 3H30A 5M56A 4G3GA 3V5TA 4Y72A 2Q83A 3OWKA 4MQ2A 2OJFE 4ZY5A 4XBUA 1ATPE 2GHGA 3DQWA 4TWOA 5E7RA 4F0FA 2C5XA 5LVOA 3DFAA 4E5AX 5E4HA 3W0QA 3TDVA 3DBCA 5AR7A 3UQFA 4TL0A 1UU3A 4NTTA 2VU3A 3LXLA 4JX7A 4USDA 2ZM4A 4QTEA 2Z02A 2RG5A 1TZDA 4FL1A 2GNJA 3RJCA 3NX8A 2GSFA 3RPSA 4FKTA 5F95A 4XS2A 3ZLXA 3CIKA 3NNXA 2WMTA 2VWUA 3LFBA 2VTMA 4HCTA 4AN2A 5JFXA 4P5QA 1UNLA 4U81A 3HECA 5EKNA 5GIPE 1XH8A 2A27A 2FB8A 2XK3A 3NFGB 2UZBA 1BYGA 2QU6A 5BVOA 3W0NA 4KSPA 1CTPE 5TE0A 4CTBA 5IA4A 4BZNA 3HUBA 2G15A 5LVNA 3CQWA 2ZM3A 2GNLA 2B4SB 1ZYCA 3BZ3A 4H3PA 3AXWA 4QYEA 3BBWA 4EBWA 4IVBA 1OPKA 3QTRA 5IMEA 4F1MA 5AAEA 3QALE 3GC9A 4J8NA 3KN5A 4J52A 4OTGA 3W16A 1XH9A 3PRFA 4D2PA 4O21A 4IWOA 3QHRA 4JIAA 2Y7JA 3M11A 2ZDTA 5CU6A 1RJBA 4I21A 3LLAA 3FLYA 5FQDC 2CLXA 4EH2A 5CAOA 5E9EA 4PTGA 1H08A 1H28A 4M84A 3R21A 2O63A 1OPJA 2QQ7A 3EZRA 3LZBA 1I09A 4UV0A 3CR0A 2X6EA 2ITYA 2C47A 4JDKA 3LFFA 2C6EA 4IX3A 4UZHA 4UWCA 2W5HA 3KL8A 4CNHA 4FV8A 4GG5A 4MXCA 3MJ1A 3RHXA 2CNQA 1YI6A 4FV9A 4M13A 4S30A 2ZYBA 1MQ4A 4RSSA 4F6SA 3R1SA 3VVHA 2BRGA 3K3JA 3TZMA 1J3HA 2E9NA 2XBJA 4F6WA 2DS1A 3N4VA 1M17A 2O0UA 2JDVA 2PTKA 4BB4A 3PPJA 5GIOE 4KD1A 3WE8A 3S00A 4BDHA 5ANOA 3PVGA 3FEGA 4FT3A 3R9NA 3QKKA 4YO4A 1HCKA 3FZRA 4FEQA 1H0VA 4BGHA 3TWJA 4FX3A 3E92A 4JDHA 5JK3A 5CVHA 3IG7A 2OG8A 3F3WA 3ZONA 2DWBA 4BBEA 4O7WA 3SQQA 4TNBA 1Y8YA 2R5TA 3M42A 3R8PA 3TV4A 2GTMA 2R3KA 5CU2A 5ACKA 4EOQA 4ZMFA 3W2OA 5DBXA 4G3EA 4O0VA 2YCFA 4X6RA 5FD2A 3I1AA 2WTDA 2V62A 1L8TA 3HMMA 4GKHA 3D7TA 2ZB1A 3LIJA 2XNOA 1KOBA 4FA2A 4BKJA 1FGKA 1P5EA 4KRDA 3AGLA 4I94A 3PY0A 3PRIA 5IQCA 2PZYA 3LAUA 4I93A 2PY3A 5L3AA 4DTAA 2IZUA 3L1SA 4O0TA 2B9HA 4CQGA 4QP7A 4U43A 1WVXA 2C6KA 2OBJA 3UIMA 3ZC5A 3JUHA 2QOLA 3GUBA 3LOKA 4F78A 4QOXA 2WMBA 3I4BA 1A9UA 2XK9A 3MH2A 2I1MA 4MYGA 4RVTA 3RK5A 3U9NA 2J4ZA 3Q9WA 3P78A 1PHKA 4WUAA 3ZLYA 3SC1A 5CF8A 4ZTNA 2PL0A 4GT5A 2XJ0A 5A6OA 2WTKC 1W8CA 3W0MA 2ITTA 3EQCA 3R7VA 3UDTA 4YC3A 3H9OA 3HL7A 4WSYA 4XYFA 4YHTA 4EONA 5HO6A 3RAHA 5LMBA 4KIKB 4EI4A 2G01A 2VAGA 2XM9A 4FSRA 4I4EA 3LPBA 2V22A 3JYAA 3VBYA 3I0QA 1AD5A 1H1QA 1I44A 5EDRA 1OIQA 3Q4TA 3VF8A 3R71A 4M67A 3OXZA 1PYXA 2FYSA 2VX0A 4FK6A 4C4JA 1W7HA 4WG5A 5HX8A 3DDPA 3NYXA 1GAGA 4XP0A 4RJ8A 3T9IA 5AEPA 3TI1A 4ANQA 1YHWA 2JBPA 3QD4A 4BIDA 2VWZA 2YABA 4OTRA 4H05A 3UC4A 3DY7A 4J71A 4AAYA 4DFYA 4KKGA 5CS6A 1KE6A 1TQPA 2W5BA 3Q32A 3RPVA 4FC0A 3W0SA 4IMYA 4AFJA 1WMKA 3GENA 3UGCA 3QRUA 5J9LA 4O4BB 2GNHA 3G90X 2QO9A 3Q3BA 5H8EA 2B0QA 3LCDA 3OCSA 4IZ7A 4IAFA 4X0MA 2IN6A 2R3QA 3R22A 3GC7A 2YIWA 3BWJA 1YWNA 4U40A 2VX3A 4YJOA 4I0RA 5CT7A 2DUVA 4GU6A 4PMPA 2PVNA 3D2KA 4RX7A 4YURA 4M7IA 2E9VA 4YUQA 3KXHA 5IZFA 5LOHA 5FGKA 4BVUA 3ROCA 5AP1A 4YJTA 4KBCA 4CFXA 4BJJA 4GV1A 2OSCA 2Z2WA 4D0WA 4GFOA 2PULA 5AADA 2BCJA 1OIYA 2O2UA 3I6UA 4RRVA 2HK5A 4YLLA 3QAME 2RIOA 5I5ZA 1OZ1A 3A7HA 2WOTA 4R5YA 3FL5A 3CKWA 3KVXA 4FTQA 1YWVA 1NVQA 4BDBA 4DFXE 2UVXA 2WAJA 1GJOA 4FT7A 3K5VA 4GK3A 4PF4A 5EW8A 3QBNA 2HXQA 4JAIA 1E9HA 4XNEA 1WBNA 3QC4A 3OHTA 3FJQE 3EQDA 4M66A 3QLFA 4OTIA 2J90A 2BZIB 1ZY5A 4RX9A 3VUKA 4A7CA 5JN2A 4F9WA 4NFMA 1H26A 2W1EA 3DAEA 3RGFA 1SMHA 4W9WA 4XP3A 2X6DA 4MWHA 5F20A 5DMZA 2VO7A 4C3PA 4M0YA 1BL6A 1DM2A 3COKA 4C59A 1Q99A 3ATTA 4FI1A 4D5HA 2WMXA 2H9VA 4FNYA 4DFZE 1FMOE 2CN5A 3DJ5A 5CSVA 4DGLC 3ACJA 4FK3A 4XV3A 5H9BA 4PPBA 5LWNA 1LEWA 5D10A 5C9CA 5K5NA 3A8XA 4FKJA 4S33A 4OBOA 4QTDA 3TL8A 5HHWA 1PRYA 3ZOSA 3D5WA 4O0XA 5DPVA 3HZTA 4CFNA 4O4DA 5BVKA 1Q8TA 2ZV7A 3C4CA 4EZ5A 2H96A 1XH6A 1Q3DA 2UZOA 3DAJA 3FYJX 2QO7A 3ZRLA 3VQUA 3R8UA 3DXNA 2W0JA 1YXVA 3MW1A 4AT4A 3TCPA 3R7IA 5HGIA 4R7BA 2WHBA 4R1YA 2YWPA 2P2IA 1IASA 4U8ZA 4DDGA 2OZAB 4G3CA 3R9OA 4ZTMA 4DT8A 1Q8ZA 3MFRA 3QXOA 5E8ZA 4DH3A 4ASXA 2VTQA 5L8KA 3FBVA 4PX6A 4RFYA 4LMNA 3PXYA 4U79A 4X3FA 5AP4A 5AP5A 2PYWA 3CD8A 2OU7A 4BCNA 3I81A 2OGVA 4TYHB 2Y4IB 4CFMA 3RMFA 3NUNA 4GG7A 1NY3A 4O81A 3C1XA 2EWAA 3DS6A 3OXIA 4N57A 2O5KA 2VX1A 3DBDA 1SM2A 3L8XA 4TKSA 4ASZA 3VS0A 3G33A 4ZSJA 3FV8A 5KE0A 3D2IA 2F2UA 2F7EE 4D9UA 3KB7A 5AMNA 2OIBA 4P2KA 2VNWA 4XG7A 5AUTA 3R0TA 5J9ZA 3LXNA 2BR1A 2EB3A 1ZXEA 2CSNA 5CANA 4IVAA 2QR8A 3ORKA 3PVBA 2BIKB 2ZM1A 2HWPA 3MPAA 4E6QA 3BGPA 3ORLA 4FIIA 4GK2A 4HZRA 3JPVA 3ODZX 4R5SA 5HCXA 4O84A 3B8QA 3BL7A 3UO6A 3MB6A 3R9DA 3FMLA 1JLUE 3QD3A 3CTJA 3R2YA 5A6NA 4D1ZA 1G8SA 3QCXA 2HAKA 4WRSA 4CLIA 3UOJA 4RC4A 2C5YA 2WU6A 4G6OA 2J0MB 2WD1A 1Z57A 5E1EA 3UIUA 5L8LA 3SW7A 4EJ7A 4DBNA 4QQ5A 4FIFA 4CFFA 2WTJA 3FMMA 5H8GA 4AAAA 3GU7A 4IAYA 4HGEA 4A9YA 1V1KA 1REJA 3QRTA 1WAKA 1SNXA 5JGDA 4NKSA 4P5ZA 2ETKA 5M44A 3UP2A 4OBPA 2VGPA 2ITZA 4RVKA 5ANEA 3UG1A 5LARA 2W4KA 4R3RA 4O7LA 3THBA 3V8TA 3NW6A 2UW9A 2VTRA 5L2TA 4K77A 5HNBA 3Q6WA 2HY81 3E62A 1J7IA 2GQSA 2R3HA 4C8BA 4I6QA 5IISA 3PUFC 4AXCA 5AR4A 4YPSA 5BYZA 4D55A 4RIXA 5J5TA 4BY9E 4PP7A 4F7LA 3POOA 2AQXA 4TPTA 4K18A 2QODA 5CU3A 3MIYA 4MX9A 4DH8A 3VQHA 3O8TA 1PMVA 2UZNA 5KCVA 3KC3A 3TJDA 3GU4A 4NU1A 5HD4A 4V04A 3FY0A 3PLSA 4Z7HA 2R4BA 3F69A 3FLNC 1UA2A 1KV1A 4FIHA 1PYEA 2DQ7X 3F3VA 3FQSA 4IQ6A 4ACGA 2WQEA 1B39A 3F3TA 4O4FA 4MF0A 3FKNA 3MPMA 2UZEA 2QI8A 3VW8A 1H1RA 4EUUA 3HAVA 2HZIA 5HBEA 3V3VA 3DPKA 3BHHA 4WOVA 3D9VA 4YHJA 5IQHA 2QHMA 2NP8A 2IZSA 3ZXTA 3RPRA 2A98A 3DBQA 3O8PA 4WNKA 1JOWB 4R6VA 4YSMA 5LMAA 3PXFA 4QMNA 3FXWA 4BCQA 4KIOA 5BVWA 4CSVA 3AC2A 2PZ5A 3BCEA 3BEGA 1VZOA 1R0EA 4IHPA 2PE2A 2QO2A 3QC9A 4RIWA 4NM5A 2NRUA 3PPKA 3C4WA 5EKOA 5IU2A 3D83A 3FWQA 2W99B 1XMLA 3TUBA 1WBSA 4C3FA 1ZYDA 3C4XA 5ICPA 2X2MA 1IA9A 2J0JA 3PYYA 3W8LA 5JGBA 4QTBA 2WNTA 5EQEA 2WQNA 3KQ7A 2C1BA 3NIZA 5BMSA 3SA0A 3EH9A 3O71A 4X3FB 4Y83A 1OKWA 4HYSA 2XJ2A 4D2SA 3BQRA 2JIUA 2UW0A 3OROA 2OLCA 1WVWA 3AC5A 4L3LA 4H1MA 5FEEA 5HE0A 4CCBA 5GHVA 2Y6OA 3DXPA 5KBRA 4I41A 4DTBA 3KRRA 2PUUA 3O8UA 4X7QA 2C69A 4BL1A 2UVZA 4I5MA 4I6FA 1OKVA 4EHZA 3KA0A 3OXTA 2C6IA 5HIBA 3PXKA 4Y95A 1Y6BA 2WO6A 2B7AA 4JDJA 4G1WA 5EW3A 3HV4A 2WMQA 3PVWA 2O8YA 3UMWA 1UKHA 4O6LA 3RVGA 2VTSA 4QP4A 5BUEA 3W2SA 4ANNA 2YAKA 2XALA 1WZYA 3WZUA 1XBAA 2XNEA 3IK3A 4C61A 2VWIA 3C13A 4D4SA 4EQMA 3CS9A 4GFGA 4W4WA 4UN0C 3V5LA 4EH9A 3V8WA 4DEDA 3EZVA 5IQFA 4EHVA 1XR1A 5HO8A 2PU8A 3EJ1A 4BWPA 3PY1A 5C4KA 3LXPA 3AOXA 3H9FA 3O5AA 5BVEA 4RJ7A 1P14A 4F70A 4YTFA 5A4EA 3TMOA 5AFVA 4HPTE 4I3ZA 4Q5HA 5DR6A 4O7ZA 5BYYA 3EKKA 4O38A 1YOJA 4ZSEA 4ZXTA 5L8JA 5I9XA 5EFQA 3NNUA 3MIAA 4NFNA 2OH0E 4IX4A 4F7NA 3E8DA 4ZIMA 4O0UA 5I9YA 4QMLA 3O2MA 3PIYA 4FG8A 5A4LA 2YLFA 2J9MA 2HENA 4OTDA 4QMPA 2UVYA 3KRXA 2YACA 2J5FA 5B2KA 3OT3A 4P90A 2A19B 2J0LA 4F65A 3ORZA 3F2AA 2C5NA 3QZHA 4YR8A 3O0GA 4KSQA 2KTYA 5FUTA 3PA5A 4BCMA 1DI9A 2X7FA 3O23A 4L3PA 2WZJA 3O51A 3PIXA 3IDPA 3D7TB 4NIFB 3S3IA 3BRBA 5BVFA 5L6PA 4MBIA 1MRVA 3KK8A 1U59A 1ZYLA 3QYWA 4M0ZA 2XAMA 4BN1A 1J7UA 4AWIA 4U6RA 4B7TA 4PRJA 3ZEPA 5FXQA 1DI8A 3BX5A 4FKVA 3G6HA 4G9RA 3WZDA 5AA9A 3LJ2A 3ZEWA 3HV7A 4TYEA 3I6WA 3TN8A 2F2CB 5KX8A 3C5IA 5EYMA 3Q96A 1WBWA 2R3NA 5JFWA 3SLSA 1YVJA 5EYKA 4IB5A 5F94A 5BPYA 5JKGA 5KMNA 3OG7A 4EOLA 4EORA 4QP6A 3FSKA 4IDVA 3VHEA 3U6HA 3NUAA 2RFNA 4LUDA 3E5AA 3TTJA 2OXXA 5KUPA 4IWQA 4NM3A 4MUQA 2BRBA 2PZIA 1NW1A 2UZLA 3A4PA 4YZCA 4E73A 4Y46A 4XV2A 4ZTQA 1PW2A 4OTPA 3VW6A 3DA6A 4GT3A 5DOSA 1Q8WA 1LR4A 4DN5A 2NPQA 3UDZA 3KKVA 4FZ7A 5LCKA 3PE2A 5K4IA 4AZEA 2X0GA 3PA4A 4IFGA 1HOWA 4LRJA 4RIYA 3QX4A 3RNIA 3QD0A 5J7BA 4ZS4A 3L9PA 4IH8A 2C3LA 4TYHA 3MVHA 4LOPA 3HYHA 3R04A 4RZVA 4AF3A 5JT2A 1FOTA 4MXXA 3VBWA 3R02A 2PVFA 3AG9A 3DB8A 2ZV9A 2OIDA 2BTRA 3RP9A 4EEVA 4QYGA 1SVEA 3ETAA 5DT0A 3KK9A 3UNZA 4BDCA 1LPUA 4BYIA 4ZTSA 1P4FA 5CAUA 2HW6A 3E63A 3KF4A 4LRKA 2ITXA 4X3FC 5AAGA 1FMKA 2XP2A 2Y8OA 4L67A 1PJKA 4G6LA 3VS4A 4Y85A 1W98A 3BBTB 2ZAZA 3MV5A 4A9TA 4ACMA 4FTKA 4HNFA 4I0SA 2V7OA 3IGOA 4PNIA 2Z7LA 5TOZA 3IDBA 2YM6A 1WCCA 4C57A 3EL7A 4XHKB 4FKUA 4O0SA 4CT2A 5HI2A 3CGOA 3U55A 3C4EA 3MBLA 5T68A 2ITUA 3HV6A 3HRBA 1Q62A 3TJCA 5HNGA 2QONA 5CZHA 4ANSA 2VN9A 3CGFA 5G6VA 4Q5EA 4E4XA 3UYSA 3ZXZA 4MHAA 4I5HA 5TR6A 3D5UA 1QPCA 3TZ8A 3BYVA 2F9GA 2PK9A 3E64A 4FICA 3NVKI 4NK9A 5LVPA 4X2FA 2FUMA 4KIKA 3ENMA 3FMNA 1R1WA 2JKQA 4JQEA 2CKPA 3FZPA 3VS3A 1EH4A 3WF8A 4UMTA 4ITJA 4BCGA 4BTJA 3PXZA 1JWHA 4QP1A 4RFMA 4WBBB 3VAPA 2Y4PA 4EC9A 5A4QA 3ORPA 2JLDA 4HGSA 5HZNA 5CQWA 2B9JA 3OVVA 4BI1A 4C58A 5C27A 2Q0NA 4C0TA 4D4VA 1XHAA 5IH6A 4XV9A 4IEBA 2DYLA 3UBDA 4E5BA 3P4KA 3W18A 4CMTA 2JITA 4JBOA 4O4CA 3UQCA 4LG4A 5M4FA 2IEWA 3TEIA 2JC6A 2PUNA 3CE3A 5A14A 5F9EA 3GCVA 1U5QA 3RI1A 4FEUA 3W1FA 3G9LX 4FTLA 3RZFA 2X0QA 3NYOA 3R7OA 3HEGA 1M7NA 4Q9SA 3OS3A 5E1SA 5AV3A 3VBTA 3OW3A 5KKRC 4U42A 4TYIA 1QCFA 2J51A 4DGGA 4B8LA 3B8RA 3QZIA 3KXZA 4QDVA 2E9PA 3MSSA 3D7ZA 4ZSLA 1ST4A 4FKPA 4NL0A 3UZRA 3TNIA 3CKXA 3VUTA 3GU8A 4AS0A 5AUUA 3MVJA 3P7BA 3VUDA 1J7LA 1CDKA 4L8MA 3ORNA 2WU7A 3QZGA 4BZDA 3NR9A 4GS6A 4ACHA 3KN6A 3FMEA 5JEBA 4JX3A 1Q5KA 2YIQA 3QQFA 3FMKA 4H3BA 4RWKA 3M1SA 5KMMA 4QMWA 5KMJA 3OWJA 3VUGA 4FSQA 2VTLA 4D2TA 4HVHA 1RE8A 5IUGA 4CG8A 3KY2A 4K2RA 2P3GX 3DFCB 4APCA 3COHA 3P1AA 5AX3A 3NCZA 5LMKC 4QPSA 2R3MA 1A06A 2CHLA 3FDNA 4BC6A 4G3FA 1GNGA 2V5QA 2R2PA 3UOKA 3O17A 4PMSA 3W2RA 4QO9A 4HGTA 3LJ1A 3WARA 5CNNA 3GB2A 1J1CA 4GYGA 1JKSA 2RSVA 2GNIA 4PMMA 4QNAA 2J0KA 4GUBA 3TACA 2O3PA 2I6LA 2PMNX 3KIOC 3E8CA 1QMZA 3TV6A 4PPCA 1PXPA 4DG3E 1MUOA 4MVFA 4E4MA 4IADA 4EOSA 4F63A 3T3UA 3V04A 3ULZA 3UNKA 2ZMCA 3LMGA 1OIUA 4S32A 3OC1A 5AR8A 2J5EA 3S0OA 2CGVA 2QC6A 5EM6A 3LFEA 5M06A 4A07A 4TY1A 4KINA 3BU5A 2C0IA 1KWPA 3I79A 3LFQA 3MVMA 1Z5MA 4IAKA 3DK6A 1AQ1A 1ZYSA 2X8DA 3QYZA 4KRCA 3LXKA 2ACXA 5JRQA 5K5XA 3UO5A 2CJMA 4I0TA 4TYGA 2XS0A 5JFVA 4A9UA 5IH5A 4R78A 5AP6A 3CP9A 4JI9A 4DH5A 4N6ZA 4JDIA 3P23A 5CXHA 4RT7A 1UNGA 4IX6A 4U41A 5AP3A 1OL2A 4B8MA 1YW2A 3FLSA 4JBVA 3BEAA 3QQLA 4BTKA 5CENA 2PE0A 4S34A 3UYTA 3VULA 4MTAA 3AT2A 4QYFA 4FTOA 5KMIA 4FKIA 4MD9E 4UXQA 4O6EA 5AAFA 3SGCA 1ZOHA 4D2RA 3BLAA 3PDTA 1V0BA 1M7QA 3VS1A 3TUCA 3VONA 3LCTA 4QYYA 5FDPA 4EK3A 1DAYA 2CKOA 5EK7A 3QUEA 4QPAA 2AC3A 3W10A 3COIA 4L46A 3CTHA 3N4UA 3LQ3A 3H3CA 4YBKA 3GXLA 5HLNA 4HVSA 3NFFB 5EYCA 4EOIA 2FGIA 5HEZA 3IGGA 4ZY6A 4ZAUA 2BHHA 3TT0A 5IQGA 1BMKA 2JFMA 4FKQA 3OTVA 4M69A 1GIIA 4H39A 3HRFA 4LI5A 2YITA 4DE4A 5LVMA 4LOOA 4ARKA 4LGGA 1VR2A 3GT8A 3U54A 3GI3A 4FV3A 4GEOA 4JQ7A 4LV8A 5DFPA 3JY0A 5CASA 2X7GA 2JKOA 3EFJA 3G0FA 4USEA 2VTIA 4V0GB 1FGIA 2BUJA 5HTCA 3CD3A 1L3RE 4J95A 3ZM4A 2B55A 4I6HA 4CV8A 3OZ6A 5EM8A 1YXXA 3QXPA 4XOZA 2YIYA 4FKWA 5DRDA 1Q8UA 2XVDA 3TM0A 5GJFA 2OFUA 5FTQA 3WF7A 2W7XA 4EYMA 4F9YA 4XV1A 4AZFA 3SV0A 1GY3A 1WBPA 3VRZA 4O7YA 4ID7A 2J2IB 2C3IB 3R63A 2QOFA 4YZBA 4WNMA 3UPXA 2YFXA 1W2FA 4BIBA 3OBGA 1YKRA 4AQCA 4UMUA 3HMIA 3JS2A 4QMTA 3EIDA 3OW4A 3TKIA 3POZA 3N9XA 3RWQA 2IW9A 4GMYA 3FZSA 4FV6A 3HAMA 2Y0AA 3DNEA 1H07A 1CKPA 3AMYA 4PP9A 2CCHA 3NPCA 3P0MA 3IECA 2F4JA 4JG7A 4CKJA 4FF8A 2BDFA 4CRLA 4K6ZA 3ZRKA 3AKLA 3R7YA 5KHXA 5AV1A 5HCZA 2QLUA 4JG8A 2X2LA 4JR3A 3LCKA 3NCGA 2PMLX 5CYIA 3BIZA 4ZLYA 2XF0A 4OTFA 3ZO1A 4E4NA 4ZMEA 4IVDA 3DLSA 2HZNA 4XG9A 2ITQA 3KVWA 2C6DA 3AD4A 5CEIA 3K2LA 3NZ0A 3FI8A 3Q9ZA 5DE2A 2G9XA 4J53A 3ZMMA 5BVNA 1OGUA 3KEXA 5A4TA 2X7OA 2YISA 4W8EA 3UQGA 4YO6A 2QG5A 5BUIA 2YJRA 3D4QA 2J50A 2YCRA 3HMOA 4WG4A 4RFZA 4AFEA 3ZYAA 4ASDA 4EWQA 4RX5A 1ST0A 4DGNA 2EB2A 3R6XA 4OTHA 3ELJA 2IW6A 4O83A 4U5JA 5M53A 1H0WA 3BE2A 4FOCA 3G15A 3NGAA 4FG9A 3RALA 1O6LA 4AA4A 3DT1A 3D5VA 4TT7A 4F4PA 1WVYA 2H8HA 4IB1A 3BHYA 4O7VA 2JGZA 3OCGA 3EQBA 1XBCA 5T6KA 3NMUF 3VC4A 4G31A 5IG1A 5M09A 4RC2A 3QA8A 4F09A 2GFCA 2P55A 1PXMA 3VF9A 5L6WL 5CEPA 3MFUA 1REKA 5E91A 4YGAA 3IW4A 4I20A 1ZZ2A 2RKUA 3GCPA 3HV5A 4II5A 3KXNA 3RPYA 4BCIA 2QNJA 4K33A 3PE1A 3MY0A 2EU9A 2YLEA 3SRVA 2A1AB 3R73A 4IZ5A 4XRLA 3RAWA 1TKIA 3TNQB 4ANMA 4JR7A 4FE2A 4NCTA 2O65A