3ZLWA

Crystal structure of mek1 in complex with fragment 3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
344
structure length
312
Chain Sequence
ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAANGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1 M
publication title The Use of Virtual Screening and Differential Scanning Fluorimetry for the Rapid Identification of Fragments Active Against Mek1.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 312
sequence length 344
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2013-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zlwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zlwA01
4AW2A 4QOXA 1R3CA 4K9YA 4IMYA 2W1HA 2I0HA 2VTLA 3PP0A 4O21A 3ZFXA 4CT2A 3C5IA 4BBMA 3ZS5A 3LJ0A 3MDYA 3PPZA 5HE0A 4PDPA 3R8UA 4H05A 2J0IA 2HELA 2BROA 1JSVA 3WBLA 2W05A 1JQHA 3KCKA 4YJPA 3JY0A 5BVFA 4G3EA 1NXKA 4CKIA 3OT8A 4LV8A 4MXOA 4FYOA 3KXHA 1REKA 3GB2A 3VWAA 4FZAB 1JSTA 3QTQA 2XIXA 2WQBA 4EH8A 5JN2A 5IMEA 3IONA 5AP0A 3TV7A 4R78A 3MS9A 3VW6A 2UW6A 3GU4A 3ENHA 5JZNA 1M2RA 5DT4A 3OW4A 3N4VA 1ZMUA 3E88A 3QHRA 3KB7A 3OUKA 4AN3A 4FSNA 4FKVA 3RK7A 4D4RA 3WIKA 2PVLA 2C30A 5I9VA 3NW5A 4F7JA 4KRCA 3UO5A 2OF2A 2XZSA 5IDNA 4I4EA 4XYFA 2R3RA 3OOGA 5H8BA 4IWDA 2OJGA 4FSTA 1AQ1A 3KK9A 5FM3A 5CEKA 2QOCA 3OEZA 4MAOA 2XJ2A 2B55A 2Y6MA 4WSQA 5M51A 5J87A 3ZDIA 2C3IB 2F2CB 4XS2A 4PL5A 4RA4A 3QD3A 4QP2A 3LKMA 3WZKA 5HX8A 3HMMA 4H1JA 4JJRA 3TV6A 4RIOA 3TACA 2CGUA 4PTEA 4Z3VA 1MQBA 5AR4A 5GZ8A 2ZMCA 3C5UA 1ZZLA 5F95A 3SW7A 1CMKE 2XBJA 3QZHA 4FV0A 4UMQA 4UMUA 4J71A 5AX9A 3A99A 5TF9A 2VTJA 3E5AA 5CQUA 3S3IA 4JRVA 4OGRA 2JEDA 2QNJA 3LM0A 4Y85A 2WQMA 2YABA 4YURA 3IDBA 1M17A 4IADA 5CZHA 5GJGA 4LRJA 4BDDA 4DINA 4RX5A 5F94A 2YCSA 4G6OA 3NAXA 4D5KA 3FE3A 2C5YA 3ZUUA 1GOLA 1PYXA 4FKRA 5ICPA 2HXLA 3DPKA 2R9SA 3NNXA 2DWBA 4IB3A 1J7IA 4FTCA 5KZ0A 3CY3A 4CG8A 3E64A 1I09A 4UALA 1H24A 5AFVA 1FVRA 3FHRA 4KS8A 3VW8A 4O0XA 2I0EA 4QMSA 3ZO4A 2WB8A 4OTPA 4S31A 5A4QA 2QKWB 3D5XA 4E4LA 3HMOA 5J7HA 3MN3A 3AD4A 2IW8A 3ZO1A 2RFEA 4K11A 2EXCX 5DH3A 4TYEA 3SLSA 5FD2A 3GCPA 4CZUA 4F70A 3NYOA 5CANA 2VGPA 5FXRA 5DFPA 4AA4A 4KUJA 1OM1A 2NP8A 3ZLYA 5M44A 1PKDA 2CN8A 1B38A 2X39A 5J1WA 4ANQA 5JFVA 5FP6A 1PXNA 4CRSA 3QWKA 5IF1A 4JI9A 3IS5A 3QCYA 3E7OA 4AGCA 4EZ5A 1Q61A 4LFIA 5JK3A 3PIXA 4O91A 3RNIA 3EN9A 3UQFA 4AOJA 4RLKA 5EW9A 3ORIA 5A46A 3R9DA 4EOQA 3BRBA 3HA8A 3UOJA 4GKHA 3NLBA 3SX9A 3QCXA 2VTQA 1YI4A 2XNBA 1K3AA 1YWVA 2WQEA 5FEDA 4FKLA 3RPSA 5AA8A 4IE9A 3P0MA 2VAGA 3LFFA 4LGDA 1VYZA 5KX8A 3SRVB 5KMLA 4FV4A 2VO0A 3K54A 5FEQA 3S2PA 3R8MA 4DT9A 4ZY6A 4MXYA 1XH6A 4FZ7A 2ITTA 4H1MA 1OKZA 5C9CA 2RGPA 4K8AA 4QQJA 4C38A 4AA0A 3RAWA 2W1CA 3D5UA 4CFUA 2WTDA 3L1SA 1J7LA 1ERKA 4C33A 2YIRA 3HDMA 1A06A 3RHXA 5K0XA 4DG2E 4IWOA 4FMQA 2RFNA 3HECA 2BZHB 5IEYA 3ZUTA 4CFMA 4FKUA 4C8BA 3GCSA 4YHTA 4BHNA 4RGJA 3ALNA 4BF2A 2CPKE 4HPUE 3QLGA 4JAIA 2ZYBA 5E9EA 4GK4A 2X7OA 3DK3A 3Q3BA 4U5JA 3SXFA 4A9YA 4D9UA 2C47A 4EK3A 5J7BA 2GS6A 5M55A 4DEGA 4B9DA 3FXZA 1ZYJA 4CV9A 4F0FA 4F9BA 3IKAA 3A7JA 3RHKA 4EH6A 3IW5A 3EKKA 4WG3A 1KSWA 5A4CA 1R1WA 4KSPA 3MV5A 1H07A 3RZBA 4NJDA 2EXEA 2GFSA 3P7CA 2DS1A 4JXFA 5TOZA 1IEPA 4YC6A 4D2SA 5F9EA 5M09A 1H8FA 3F5XA 4A4LA 4P2KA 1ZYSA 4TYIA 3VHEA 2ITOA 1UU8A 3BLQA 3FWQA 3KQ7A 3E8NA 3QA0A 5IA5A 2BHEA 4PP9A 1PYEA 1ZRZA 3OY1A 3EB0A 3KEXA 4XV1A 2XBAA 3I6UA 3R9NA 1OECA 3HDNA 4S33A 4MTAA 5DA3A 3UOKA 5ETAA 4PMPA 3DTCA 2PVMA 2W0JA 5C1QB 3PIYA 5GJFA 1WBVA 3ERKA 3Q9ZA 4EK8A 4AFJA 3R7IA 4NW5A 4EC8A 4L00A 4FI1A 4RLLA 3N51A 5M4CA 3H3CA 4DTAA 4C37A 1Z9XA 4FV8A 4LV5A 3MIAA 4QQ5A 3FDNA 4L45A 4BCMA 4XUFA 4IC8A 2OH4A 3TN8A 4QPMA 4E8AA 3R7YA 1W98A 2OJIA 3D7TA 3V5PA 2YM5A 4E6QA 3AGMA 4X2FA 3W8QA 3ZDUA 3W2CA 1SVGA 3OG7A 2Z8CA 2O64A 4V0GB 5DR6A 5AR3A 5C26A 3NVKI 3BLHA 3CQWA 3Q4UA 4FVPA 4HJOA 3AC1A 1LP4A 2QHMA 4JIKA 3TNHA 1VR2A 1OL2A 3DZOA 4UWYA 4QMXA 2JC6A 4IVBA 5DLSA 4CRLA 1BL6A 4BWPA 5KO1A 4OT6A 5CTPA 4CZTA 3LCSA 3PWYA 3CTJA 3VAPA 1TQPA 5FDPA 3BCEA 4ZOGA 5ACBC 3KF4A 3O8TA 4RRVA 4QMYA 4I6BA 5JFWA 5AP3A 3P23A 5HVKA 2ETRA 4HYSA 2UZTA 4Z7HA 1BYGA 1Q8ZA 4ANSA 5LCKA 5FUTA 4QQCA 4NKSA 3FSKA 3AC5A 3QGWA 2C0OA 3CTQA 3G0FA 5BMSA 2OWBA 1Q24A 2W4OA 4U42A 3GNIB 4ASXA 3DBCA 3PG3A 1GIIA 2WELA 2WQNA 1XHAA 3BEGA 4RJ5A 3B2TA 3HAVA 2UZDA 3MB6A 4GEOA 4CFVA 5EQYA 4UYNA 2C6TA 4IX3A 2YWVA 2JDTA 5GJDA 5L8LA 2CN5A 3RMFA 2WEIA 4Y72A 5TKDA 1GIJA 4JLCA 4CXAA 1PMNA 3C50A 1IA8A 2A27A 3OCTA 3VS3A 2BFYA 3C4EA 2PULA 4L01A 4UYAA 2VWUA 4FICA 4BDEA 5IG1A 3R7UA 4BBFA 5AAEA 2J2IB 4QTEA 3W2OA 3QALE 1Q8YA 4BGHA 2F9GA 1PMUA 2XIZA 4LRMA 3UVPA 3HEGA 1J1BA 3VBYA 3ZEPA 4AZEA 4L43A 4DGGA 4HZSA 1H0WA 4DFZE 2BHHA 4ZLOA 3BU3A 3LXNA 4O0SA 1NVSA 2ZV8A 3BPRA 3Q4CA 4MKCA 4FG9A 3RPRA 5CF6A 5DVRA 5BPYA 4FX3A 2O2UA 4UMRA 3AOXA 3KULB 2ZDTA 5HE2A 4EWHA 3WYXA 5A9UA 2IO6A 1PW2A 2PZYA 3AQVA 3U55A 3PRIA 1YOJA 5BX0A 5A6OA 5HOAA 2XNNA 4FV3A 2Y4IC 3O7LD 3WZJA 3GCVA 4G3FA 4AT4A 2QO9A 3SQQA 5CS6A 5GZ9A 1YW2A 2B9FA 2J6MA 2J90A 3LM5A 3R0TA 4WUAA 3BZ3A 4XV2A 4YPDA 4BTKA 5HO7A 2J4ZA 4YLLA 3KRLA 3KKVA 4YJOA 3QWJA 2VWWA 5D12A 5CI6A 4F7LA 5IU2A 4HGLA 3QCQA 5F1ZA 3U54A 5L2IA 3D83A 1M2PA 3SAYA 4NJ3A 4DGOA 4LMNA 1NW1A 3P78A 4FF8A 4LOPA 3VVHA 3NVMB 4BI0A 3S1HA 4RX8A 3R71A 4D5HA 1RW8A 3UOLA 4IIRA 3UIUA 5CEOA 5L8KA 4K33A 4FBXA 5C8NA 5BYLA 3H10A 3Q4ZA 3U9CA 2VX1A 1W83A 4F7NA 5AIKA 3VUDA 3PY0A 5BMMA 3U51A 3OFMA 3P5KA 3PJCA 2YAAA 3BE2A 3DJ7A 2KTYA 1QCFA 2XNMA 4U79A 5CYIA 4BZDA 3DOGA 4FEQA 1ZY4A 1PMEA 4OTQA 2E9VA 5CWZA 4MXXA 3LFAA 3VRYA 4RT7A 5HZNA 3RJCA 4WBBB 3TXOA 3QZGA 5EH0A 4R3PA 5LMAA 2ZVAA 2XIKA 4H39A 2YIWA 4FIFA 4F0IA 2BTRA 5E92A 4AS0A 4R7BA 4JDKA 1KOBA 4DA5A 4IANA 3MVHA 3FYKX 3V5JA 4IW0A 3IK3A 3L9PA 4ZSLA 3V3VA 4CCBA 5KZIA 3OC1A 5LQFA 1PMVA 4B6LA 1FMOE 1UU3A 4UEUA 2OJFE 2BCJA 2BUJA 4EUUA 1H01A 2ZOQA 2ZM3A 3WE8A 3EFKA 3F3ZA 5H9BA 3OT3A 4TPTA 5K0KA 4A9UA 2YDKA 3NRMA 4BDJA 4D2WA 4EEVA 3EL7A 3F88A 4GIHA 2AUHA 1U4DA 4L7SA 4M0YA 4MHAA 4W9WA 4GW8A 5CSWA 3PY3A 4FTMA 4ITJA 2ZB0A 1Y8YA 4ZTMA 2C1BA 4GYIA 3VNTA 3ZUVA 1P2AA 2XJ0A 3DJ6A 1TKIA 1JNKA 3CIKA 3GFEA 5BVDA 3VULA 5I9YA 2W9FB 4S2ZA 3LZBA 2B0QA 3W16A 4RC3A 5E8UA 4IBMA 5CSHA 5BVOA 3UZTA 1WVXA 3O0GA 4D4VA 2P2HA 4WRSA 3WF8A 1J7UA 4IX5A 5CAPA 4BI2A 4IM3A 4EORA 3BWFA 4UMPA 5IA4A 3MPTA 4MH7A 2W1DA 3HLLA 4FTTA 4L3PA 4IDTA 4YC3A 3S4QA 4LI5A 4UV0A 5EQEA 4KD1A 2B1PA 2RSVA 3G6HA 4FKJA 5D7VA 2PVKA 3F5GA 4YZBA 5FM2A 3RVGA 4ZTLA 3KFAA 1R0EA 5FRIA 3FMNA 3M42A 2QODA 1OIRA 5EYKA 3VUKA 5HCZA 3GENA 4PQNA 4Z9LA 2R3JA 3PJ8A 3DV3A 2OZOA 1SMHA 3DNEA 4GT4A 4M66A 2OIDA 3R73A 3I1AA 4BC6A 4U6RA 2QOHA 2GNJA 2UW9A 4FT3A 5CU2A 5B2MA 4IAZA 4YJQA 3TL8A 4USFA 3EJ1A 4BL1A 4KWPA 5CAOA 3HX4A 1G8SA 3OVVA 2NRYA 4ZMEA 1O6LA 3VUGA 4I20A 3T9TA 2X2KA 1AGWA 3AT2A 1GZNA 3FMDA 3O17A 4PF4A 2BVAA 5DRBA 1Q99A 2OFUA 2XK4A 3T3VA 3IW6A 4KB8A 3C51A 1IASA 2B9HA 3SG8A 4QYYA 4GU9A 2P3GX 5HNGA 3VJOA 3FZSA 4UX9A 4KIPA 3QTZA 2WAJA 4PDOA 4E6CA 4FKGA 2JKMA 3CBLA 3Q5IA 4CSVA 3ORMA 1U46A 3UMXA 4EZ3A 4BDKA 2XM8A 3NUYA 2Y8OA 2XYNA 5JMSA 4EJ7A 4YJSA 5HLNA 1YI6A 1H26A 4ZY4A 4USEA 1MRVA 4EOKA 2BAKA 1H28A 3QQJA 3IDPA 1HOWA 2PMLX 5KKRC 4JG7A 4CKRA 3DXPA 5CF8A 2IZRA 4IB1A 4NCTA 2WMTA 2UZNA 2VTOA 3ANQA 4R5YA 4DH3A 4J99A 4KS7A 2BAJA 4I41A 1WBNA 4JX7A 4QMTA 4QTCA 3UO6A 4I21A 5DR2A 4UB7A 5J8IA 4Z55A 4CYJA 2WTWA 5JGAA 3QC9A 3QXPA 2PE2A 1WBTA 2VX3A 3OHTA 4TNBA 3LCKA 3VBXA 4E5BA 4M8TA 4WUNA 4RWIA 5DIAA 4O1OA 4NT4A 2JDOA 5M4IA 1TQIA 5CEQA 1Q5KA 3ZLWA 5CALA 4ACGA 4O6EA 3RP9A 4F6UA 2R3FA 3LE6A 4OTDA 3LFEA 5HVJA 4AW1A 5IKWA 1FVTA 2GNFA 1UKIA 3DAJA 4FVQA 5EHOA 3VUHA 4O0VA 2C1AA 4QP1A 2V0DA 2ZV2A 1HCLA 1U59A 4RC2A 3UNJA 1JSUA 4C4JA 2YM4A 2BILB 3LJ1A 4RJ3A 4WKQA 4IB0A 4RIWB 2IVTA 4BZNA 4QPAA 4F99A 5I9XA 3L9NA 2X4FA 3EQFA 4F6WA 4C3RA 3QRKA 2XH5A 1QPJA 2UW7A 4XH6A 3WF6A 4F9CA 4ZSAA 5IMXA 3PG1A 4FV7A 4ZZNA 4D2TA 4FKIA 3N4TA 4D0WA 4BCNA 5L3AA 2G2HA 2BRBA 4F9WA 1LUFA 3LCOA 2ZV9A 2GTMA 4N57A 4P90A 4BZOA 3PXRA 1Q3WA 5BUEA 5AV2A 4IM0A 3DBDA 2UV2A 3C4XA 3IW8A 4JBQA 5IUIA 5JFXA 3EQRA 4HVHA 4IVDA 4BI1A 5JQ5A 3TNWA 4O7WA 4CNHA 5AR2A 1ZZ2A 1OL7A 2B9IA 2YLEA 3R83A 2GTNA 3R00A 2XEZA 1SNUA 2WIPA 2FH9A 1PXKA 4AU8A 4ERKA 2QOBA 4GL9A 3UNZA 2UW3A 4UXLA 3CJGA 5CSVA 3SA0A 2J5FA 2IVVA 2HIWA 3BU5A 3K5UA 2IZSA 3NAYA 5ETIA 2ACXA 4FV2A 4KA3A 4DGMA 4FTQA 3WI6A 3W10A 2ERKA 2R0UA 4L67A 4RWKA 3K5VA 4EQMA 4XOZA 4FUXA 3RCDA 3BV2A 4XG4A 5EYDA 3C4CA 4WT6A 3FMMA 4HZRA 5HBEA 4XMOA 3UYSA 5D10A 2HW6A 3DBQA 3DZQA 5HG9A 3AMBA 4RZWA 3BYSA 1JKTA 3OROA 3NDMA 4D28A 4GS6A 4CTBA 4PV0A 3O8PA 3F3WA 5HIBA 4CQGA 4JBOA 2I0VA 2QOIA 2ZM1A 5LVMA 4G6NA 5AWMA 2HY81 5LOHA 3QLFA 3E92A 4USDA 3HV7A 1ZY5A 2W4KA 3R28A 2R4BA 5E8SA 2VTPA 3TNQB 2PVRA 3UVRA 5EI8A 5HICA 4ANLA 4IX6A 2IZTA 3E7VA 5L2QA 4JS8A 5ETCA 4AXAA 3OTUA 5DGZA 2PMIA 4ITHA 2XKFA 4GFMA 4GU6A 2JIIA 2JDSA 2PHKA 3H9FA 4X3FB 3NUXA 2C6LA 3VS4A 2WHBA 4O7ZA 1Z5MA 5K9IA 1KUTA 3P86A 2C3LA 2UZVA 2O63A 4K1BA 2QO2A 3COKA 3ZCLA 1XBCA 3DDPA 1BLXA 3KRRA 1Y6BA 4MD9E 4OTFA 4R77A 3ACKA 4L46A 1RQQA 1OUYA 4ZSEA 3AC8A 2JDVA 5L6WL 4NTTA 3WZEA 1TQMA 5DT0A 1VJYA 2V7AA 3PVGA 4B7TA 3RALA 4RWLA 4I5MA 3WF5A 4HYHA 3V6RA 3A4OX 2IVSA 4BGQA 3MA3A 2WD1A 3JUHA 4FOBA 4TWPA 2Z02A 2XCHA 3PXQA 4AOIA 3FYJX 3QZFA 2ZMDA 5HD4A 4U9AA 2ONLC 4NUSA 3FV8A 3NYNA 2OI4X 1YDRE 3IECA 3PXZA 2Z60A 3QKMA 4BIDA 3RNYA 4EHEA 4GKIA 4TT7A 3V51A 5LCJA 3R1SA 4OBOA 2H96A 3D14A 2WMSA 4FL3A 4ZZOA 5KNJA 2W96B 3EYGA 3OXZA 2I6LA 3F69A 1QMZA 4CFXA 1PXOA 3PY1A 3D5WA 5IA3A 1JKLA 3C7QA 3IW7A 4U44A 1H08A 3DCVA 3CPCA 2CJMA 5A6NA 4IAAA 3ZSIA 4IZAA 3DGKA 2XA4A 3HA6A 4F63A 3WF7A 3EZVA 2OXDA 2HOGA 2W4JA 4XG8A 4KIKB 5B7VA 5A4LA 4GMYA 2Y4IB 3PSBA 4QTDA 4ALWA 2GDOA 1YWRA 3BWJA 4TN6A 4WO5A 4X7QA 4I94A 1XKKA 4TWCA 2ITUA 3KA0A 4ONAA 3LMGA 3PXYA 3H9OA 4LGGA 4XG2A 3HL7A 2Y7JA 5DWRA 1UA2A 3LCDA 4Q2AA 3E93A 5EI6A 3SDJA 4NL0A 4MNEB 4FIHA 4MYGA 3Q2JA 3HVCA 4MCVA 1UWJA 3R2YA 4DEAA 4TYHB 5LVLA 2R3IA 2FSTX 5KBQA 4YHFA 2UZWE 2ITQA 3S95A 4BICA 1ZARA 3GI3A 5K4IA 3DLSA 3MFTA 3L8PA 3QUEA 4BTFA 5HKMA 5KUPA 4C02A 5HLPA 4IHPA 4QMPA 2X9FA 2HENA 2ZM4A 3EH9A 3MPAA 4LQMA 3FPQA 4CCUA 2C6DA 4CLJA 4JR3A 2C6IA 5D11A 2Y6OA 1OKYA 3GCQA 4FEUA 1Q41A 3DFAA 2PVJA 1YXVA 1R78A 3ODZX 3EQPA 2YAKA 3PXKA 2CKEA 4L68A 5C03A 3TCPA 4AE9A 5HG7A 4CMTA 3FKOA 4DBNA 2OU7A 2WMVA 3IOPA 2YA9A 2C3JA 3ID6C 3KXZA 3QU0A 5IEVA 3ET7A 4E7WA 2ETMA 4NZWB 1DI8A 4O7LA 3D7ZA 3ANRA 5HNBA 5TT7A 3QTWA 3ACJA 4HGTA 4IEBA 5F4NA 3WYYA 2Y4PA 4FL2A 5AJQA 2HK5A 2I40A 3OZ6A 2VD5A 3WARA 4Y73A 5B0XA 4B99A 4ERWA 2E9NA 3DDQA 2P55A 3DLZA 4ZEGA 3MTLA 4AZSA 3R02A 3PP1A 4MF1A 4DCEA 4YSJA 2Y9QA 3ORNA 4YZNA 1XBBA 2XK8A 3BYOA 3QXOA 4HOKA 2RKUA 4IZ5A 4P5QA 5HESA 4TXCA 3TNPC 3ATTA 3F5UA 5I3OA 5HCYA 3C0GA 2PVFA 4FSWA 3Q53A 5AUYA 2LAVA 5JRQA 1ZMWA 3DK7A 2J5EA 3GU7A 3PIZA 3DKFA 4JBPA 4RIXB 3ZM4A 4PWNA 4CEGA 4GVAA 1Q8UA 3HRCA 4PL4A 4N6YA 4U8ZA 1VEBA 2WFYA 5CQWA 4FSYA 3MGYA 4FEVA 2C0TA 5KBRA 2VV9A 3QYZA 4BWKA 3DY7A 3MTFA 3BX5A 4B0GA 4PMTA 4DC2A 3CPBA 3FY0A 2B7AA 2UW0A 3II5A 4C34A 3O2MA 2C6MA 2R7BA 2UZLA 3OXIA 4G34A 3O7LB 3UIMA 5LMBA 3VS5A 2JKKA 5CASA 1WFCA 4EH9A 1Q62A 3R30A 4F1TA 4WIHA 2OXYA 2BRMA 4J8NA 2WZJA 4ANMA 5B2KA 2YZAA 4L8MA 5LWMA 3VUTA 5CU0A 3BHTA 4ARKA 5IH4A 3QTRA 5D41A 5HTIA 4JX3A 4EK4A 3CXWA 4GG7A 4KIQA 5FTQA 4DG0E 1U54B 3AMYA 5HI2A 3POOA 1PY5A 5LJJA 2YIYA 4YO4A 3V6SA 4CD0A 3VRZA 2YACA 4PDYA 4Z16A 1BMKA 2SRCA 4MF0A 2WXVA 4DLIA 1GJOA 1JWHA 1YKRA 3MVJA 4U3ZA 4YJVA 4IM2A 4ZXTA 4UXQA 2A1AB 3LHJA 4FKOA 4HGSA 5EK7A 5M4FA 3SXSA 1W7HA 3JY9A 1OUKA 3FXXA 3SRVA 4DFLA 5HE1A 5C8KA 2IG7A 3T8OA 1PHKA 1ZOEA 3F82A 4F65A 4FSQA 1K9AA 2NO3A 3PA3A 2VGOA 3LFCA 4LUEA 5IA0A 4E6DA 2VTAA 1ZYCA 1WBOA 2BMCA 3Q04A 4Y5HA 5GHVA 3CLYA 3QQFA 1R0PA 1W82A 4NFNA 3F66A 3VHKA 5KKRB 2IZUA 3F61A 1XBAA 4O84A 2YM8A 3FKLA 4BYJA 3V01A 1Y57A 3QTSA 1XO2B 4NCTC 4YZ9A 2I7QA 3ENMA 3CCNA 2CGWA 3M11A 1J1CA 3FZ1A 5E8TA 3W18A 4C35A 5DNRA 4B8LA 3GT8A 3BHHA 4GUBA 3Q5ZA 3KREA 4C61A 2EU9A 4QT1A 5LXMA 5AAFA 4CMOA 5M57A 2CNUA 1F0QA 3GOPA 4U97A 2PMOX 5EHYA 3DBEA 4AAAA 2FB8A 3ZRKA 4GIIA 2W5BA 1P4FA 3LFQA 4QMLA 3IO7A 1V0BA 1B6CB 2Q83A 4L52A 3U87A 4DFYA 4M0ZA 5IQEA 4XEYA 3AC4A 4YTCA 3TM0A 4U40A 5EHLA 2FSLX 4XCUA 3QHWA 4C4IA 3NUUA 3EN7A 2QVSE 3DBFA 2WMXA 2F49A 5CSXA 5CVHA 5LMKC 3I79A 1OIUA 4EI4A 4J53A 2JIUA 4FSZA 1P4OA 2BRNA 4JR7A 4FC0A 4OR5A 4QMUA 5I3RA 5JEBA 4EOJA 3PSCA 3D4QA 4NSTA 5IQCA 5EDQA 2JD5A 4O83A 3A7FA 5D7AA 3C4ZA 4RFYA 3OBGA 4X21A 2WMAA 2X7FA 2R3HA 4CV8A 2GNHA 3RM7A 5IUGA 1H1RA 4G9CA 3FL5A 3Q9YA 4P5ZA 4FV1A 4YSMA 2QI8A 3CQEA 4MWHA 1FGKA 4RG0A 3RGFA 3FBVA 3D2IA 3UODA 5JGBA 4DF3A 4J96A 4Y5QA 1A9UA 4MBLA 4O38A 2JFLA 2YZLA 2XF0A 3QZIA 4YC8A 2VTNA 2XK7A 4I24A 2F7EE 3MFRA 3ORKA 2A0CX 4FGBA 4V0GA 4MXAA 5DRDA 3GC9A 1OL6A 2WTJA 3NYVA 5FP5A 3A7HA 3PYYA 2G15A 4YZMA 3QFVA 5G6VA 1UNLA 1E1VA 3AG9A 4LOQA 5FTGA 2PE0A 3FLNC 2VZ6A 4CLIA 3FKNA 4FIJA 1W84A 5M07A 3KGAA 3PVWA 4QP3A 4I6QA 3QQLA 2PVYA 4EKKA 2OG8A 3BBWA 2G9XA 4NU1A 4XG6A 4I92A 3FJQE 1VYWA 1LPUA 5H3QA 3D9VA 4FIGA 1T45A 5J1VA 4RVKA 4O7YA 2ZDUA 3DKGA 4M12A 4XP2A 5CEPA 4K0YA 3NSZA 2X6DA 3HUBA 3Q32A 4D1XA 2X0GA 5K5NA 1U5RA 2J51A 5L2TA 4WBOA 3UOHA 3UVQA 4JQ7A 3FEGA 5ANOA 4S34A 2YEXA 4U81A 5HGIA 2J0KA 3VC4A 4D0XA 3ROCA 4AP7A 5A4TA 4K18A 3RBWA 3TKHA 5T68A 4EOIA 3H30A 4PPBA 3NUSA 2W9ZB 5FEEA 2WEVA 4N70A 4ZAUA 5IUHA 4RC4A 5L2WA 3VS2A 4HVIA 4M67A 5DEYA 4FL1A 5CAQA 4ACDA 4J52A 5C4LA 4O7SA 5EM7A 3TEIA 4Y83A 4B4LA 4BKYA 2R3QA 3BEAA 4BTMA 3PLSA 4QMNA 3AGLA 2UW5A 4U43A 3MBLA 4IAFA 1XJDA 1UNHA 4IWQA 3UJGA 3S00A 2Y0AA 2CNQA 4D4YA 3VBQA 2VTHA 2A4LA 3UQGA 5GIOE 2B4SB 3NNVA 2B9JA 4WOVA 5C4KA 3PDTA 3QRIA 3ZLXA 4D2PA 3V8SA 3DXNA 4DTBA 3V04A 1WVYA 5GIPE 3NEWA 3ZONA 3MY5A 4NKAA 3O51A 4IDVA 3HV4A 5AM7A 3F2AA 5JQ8A 3C1XA 2PE1A 3LIJA 3G2FA 4R1VA 3KULA 5ANIA 2XM9A 4FTJA 2GQSA 3GUBA 2QD9A 4CZYB 2IPXA 4ZTSA 2YCFA 2PZ5A 2X4ZA 2NNWB 3B8QA 4X2KA 2JAMA 5IQIA 2JBPA 1WAKA 2VNWA 4YJNA 3VS1A 3EFJA 2OIQA 3OW3A 3NIEA 5DR9A 4AOTA 1Q3DA 2PZRA 3QA8A 4FK3A 3ORXA 4OUCA 4Y8DA 3ALOA 4IC7A 4RX9A 4FTNA 1QPEA 4E26A 3DAEA 2ZJWA 3GGFA 1CKIA 4KBCA 5M56A 5IA1A 3W33A 4OBQA 4BKJA 2W1IA 3S0OA 2YFXA 3KN6A 4FZDB 3LMIA 3UG1A 4IVCA 4FKPA 5AUVA 3QUPA 3UZPA 4EHGA 4F64A 4XP3A 4JRNA 3N9XA 4F6SA 5HNIX 4G3DA 1Q4LA 5FBOA 1YXTA 4O22A 1YHSA 4WHZA 5AV0A 4RA5A 3RTPA 1NA7A 3TUBA 3G9LX 3QD2B 4P7EA 5CT7A 4AN2A 5KE0A 2X1NA 4A4OA 2RF9A 3CGOA 3KMWA 3QTIA 3TJDA 1HCKA 3CKXA 4D4SA 1S9IA 4G31A 3FL4A 5LWNA 3CR0A 4YZDA 2WGJA 4KKHA 4OBPA 4QMVA 5AX3A 3GEQA 4O7RA 3K3IA 4G3CA 4LMUA 3ROYA 3A7GA 5HORA 2BALA 2GHMA 3MY1A 2X6EA 4G17A 3OD6X 4KABA 4LOOA 4LUDA 4TNDA 5AUXA 3TV4A 5KMKA 3MVMA 5AADA 4FKSA 5C27A 4PRJA 4BDFA 1SM2A 1NT2A 1SVEA 2WO6A 3E8EA 3WIGA 2CKQA 2C6KA 3PA4A 2J50A 1OKVA 5IQGA 2XCKA 4FT0A 4GT3A 2PVHA 2V55A 2FSMX 3BHUA 3DAKA 4ITIA 4OT5A 4LL0A 1ZLTA 2R3NA 4DEEA 4BCKA 4M13A 1PXLA 1H0VA 5EKOA 3SVVA 2VTTA 3ZC6A 5H2UA 2V7OA 4GFGA 4ZTQA 5CXZA 5CU6A 2PL0A 3LFBA 1OL5A 3FLYA 3HKOA 2YM7A 3FMKA 4AZFA 4M68A 3JS2A 4I5HA 4N0SA 4R3CA 5H8EA 1W0XC 4FNZA 4JBVA 3BELA 3UPXA 4YJUA 5AV4A 4U45A 3FLWA 3EN6A 4CGAA 4I4FA 1OI9A 2C5OA 1OPKA 2HZ0A 1YHWA 3UDBA 4BDCA 3F2NA 5IH5A 1FOTA 5FLFA 3SV0A 4I5CA 2WTKC 1GIHA 5BNJA 5EOLA 3BIZA 3FLZA 3KRJA 5JSMA 3ZFYA 1H1PA 2I1MA 1CDKA 5DT3A 1LEWA 4FSMA 3G6GA 4XHKB 3KF7A 4BY9E 2OZAB 1JBPE 3UE4A 4I0SA 4BCOA 3V5LA 1A48A 4DFUA 1OIYA 4DCAA 4YGAA 2P0CA 3LFNA 4MQ2A 5E8WA 2AYPA 2Z2WA 1MQ4A 4EH2A 3LLAA 5IPJA 4OLIA 2X81A 3EHAA 4TYGA 4MVFA 5J9YA 2LGCA 3DB8A 2C6EA 4TRLA 5FBNC 3SC1A 5J79A 3IOKA 3RPVA 1O6KA 5AUUA 1ZOGA 5HO8A 3IG7A 3O23A 2WIHA 4E5WA 4C57A 4R6VA 3P79A 4TL0A 3CC6A 4M7IA 1M7QA 3QC4A 3UTOA 3H0YA 2G01A 4FT5A 4MBJA 1STCE 4K2RA 4BDAA 2GU8A 3TUDA 5EOBA 2EXMA 2GS7A 5TR6A 4RSSA 5DN3A 2BR1A 4IFGA 4YTIA 4EOPA 4C3FA 2O8YA 5L2SA 2B53A 3G9NA 5AAGA 3HYHA 1PXMA 1KWPA 3PZEA 4IFCA 5HIDA 2J0LA 2VX0A 3TWJA 4C4EA 1DAWA 3RAHA 4WA9A 4WG5A 1OVEA 2BAQA 1G3NA 3H9RA 4PPAA 3VS7A 4HW7A 3ZOSA 4BKZA 1LR4A 2REIA 3FC2A 4TZRA 2WOTA 5ACKA 4ANBA 4DN5A 5CF4A 2Z7RA 2EWAA 2HZNA 4YZCA 3PSDA 1O9UA 5HG8A 4GUEA 3KK8A 3LAUA 4YHJA 2AC3A 1KE9A 4UBAA 4A9SA 4WNMA 5KHWA 4RIWA 4FTKA 2X8EA 2R64A 5JT2A 4ENYA 5AP1A 1CM8A 2PWLA 3UZRA 2OO8X 3ZBFA 3JVRA 4ACHA 5DG5A 3QX4A 4L6QA 4O0TA 5LVPA 2JITA 4DEBA 3PRFA 3BBTB 1UVRA 4FTRA 2HW7A 3BV3A 3EQIA 3ZTXA 3MI9A 3HV3A 3G33A 3EIDA 5HO6A 4EONA 5T6KA 1MRUA 2XKCA 4XV3A 3SOCA 3KY2A 4ZK5A 3ZU7A 5HTCA 1WZYA 5EFQA 3C0HA 3ODYX 3NW6A 4RPVA 3LQ3A 3LOKA 4PP7A 1NY3A 5L4QA 3Q52A 3F9NA 1XQZA 4YUQA 2XEYA 3DQWA 3KU2A 3PJ1A 2XJ1A 3KMUA 4FTIA 4IWPA 4YLKA 5BYYA 4D58A 3UYTA 2R3MA 2OK1A 3LW0A 3Q9XA 4B8MA 2BPMA 2RIOA 4QP7A 5FQDC 2EB3A 2UZOA 3NYXA 4MNFA 1GNGA 4WNPA 5DEWA 4LGHA 5F20A 3RI1A 2VU3A 5FGKA 3UPZA 3EQGA 4IZ7A 2WKMA 4IX4A 3I60A 4YJRA 1Y6AA 2RG6A 4Z7GA 3HV5A 2H34A 2FUMA 2NPQA 2CGVA 3VQHA 4YMJA 5EM5A 3G15A 3P7AA 2H6DA 3DNDA 3PUPA 3ORPA 2EUFB 4XLIA 3QAME 3TIYA 4HNFA 4NW6A 3ZH8A 2FVDA 5KHXA 5LVOA 5BVNA 4I93A 2E9UA 5CAUA 4CKJA 5HLWA 4AUAA 3FI3A 1XH7A 4YLJA 4EUTA 2B54A 4YJTA 3R21A 3P4KA 2W17A 4RMZA 2YN8A 5J5SA 2OFVA 3NNUA 4AZVA 5EDRA 2VWVA 2FO0A 3FXWA 2WU7A 4HCVA 4J95A 4GJ3A 2AC5A 5DBXA 2UZEA 2VWBA 2YLFA 3DFCB 4F4PA 4CT1A 4GG5A 4A9RA 1OL1A 1OZ1A 4F1MA 4QO9A 4CVAA 4ASEA 3GQLA 3QGYA 4D9TA 5A54A 4GYGA 3UG2A 3NCGA 3IQ7A 2YIQA 2Z7SA 4IB5A 5IQDA 4R3RA 2BDFA 3GU6A 3QQHA 3LVPA 3HP5A 5AP5A 4ZSGA 1IRKA 3Q6WA 3R6XA 2WTIA 4YBJA 1MP8A 3F3UA 3W1FA 4AA5A 4BRXA 1DS5A 2XVDA 3QRJA 2ZAZA 4LM5A 1Y8GA 5DOSA 3R04A 5BQ0A 4FE2A 2PSQA 1FINA 2ETKA 4H3QA 4I3ZA 4NK9A 3U4UA 1OITA 3LQ5A 3FI8A 4NM5A 4EKLA 5E8ZA 4L7FA 4ID7A 3SD0A 5LARA 2YHVA 3MYGA 4X3FA 2OJ9A 4HVDA 3FQHA 2ITWA 3QD0A 2QC6A 3FLSA 3Q96A 1IAJA 2CKPA 1BKXA 4W9XA 4A06A 3G90X 3HGKA 4AFEA 1Q8TA 3NUNA 1URWA 3QRTA 2XRWA 2UW8A 5K5XA 3TZMA 4AG8A 3UP2A 1FVVA 4CFWA 3OUNB 2QG5A 4PMMA 3K2LA 3VS6A 4A7CA 5EW8A 1Z57A 4G6LA 1IG1A 3QD4A 2CLXA 3DT1A 4EHZA 1GY3A 3AMAA 1YVJA 4FOCA 4X3JA 2GQGA 4ACMA 4L44A 4APPA 3R7OA 5CEMA 4TWOA 4C59A 4I22A 4FSRA 4XOYA 1H00A 3R8PA 4S30A 3SXRA 4M84A 2F2UA 4DFBA 4L3LA 4C4HA 3R9OA 2JDRA 4NIFB 4OAVB 3OY3A 3GBZA 2C5XA 3V5TA 5D1JA 2W06A 3N4UA 4QMOA 1BX6A 2X8IA 5EI2A 3GU8A 1XH8A 3V8WA 4MXZA 1KE7A 4HCUA 5AM6A 3CS9A 4FKTA 4MD7E 5HX6A 3I5NA 3F3TA 2Q0NA 4DLJA 4ORKA 2UVZA 3L8XA 4G16A 4EQCA 5E91A 1OGUA 3R7EA 1OB3A 3G51A 2X2LA 2HZIA 4YTHA 4FIIA 4DE4A 3R01A 4X2JA 2J0MB 2GHLA 1VZOA 5CVGA 3MFSA 1JVPP 4QP4A 4D1SA 3FQEA 4DFXE 3TNIA 1REJA 2OIBA 5C8MA 3T9IA 4KIKA 3KRWA 3RK9A 3QQUA 1QPCA 4DYMA 5L8JA 4NWMA 5AP7A 4EL9A 1UKHA 1M7NA 4WSYA 3KXMA 4H36A 2IVUA 2X2MA 1JPAA 4M14A 4KKEA 2YCQA 4EK6A 3JYAA 2OGVA 2FSOX 3C13A 4MBIA 5HE3A 4MNEA 4AF3A 4QMMA 1YRPA 2GNGA 3EL8A 4J1RA 5HHWA 4TYHA 3TDWA 4IACA 4QMWA 3BGQA 4AWIA 3F6XA 4FKWA 4KSQA 2R3OA 4BIBA 3QBNA 4EZ7A 2EVAA 4PTCA 4OTRA 2QURA 3M2WA 4FSUA 4QNAA 2OSCA 5KCVA 4JT3A 2CSNA 2QCSA 4C2WA 4EBVA 5IQFA 2VO7A 3UIBA 3Q2MA 4ZP5A 2UVXA 4IAYA 4BGGA 4MX9A 4BDBA 4DAWA 4A07A 3FI4A 3I7BA 3NGAA 4AQCA 4NM3A 3OBJA 2BKZA 3OCBA 3HRFA 1EH4A 5IH6A 3FPMA 3AT4A 4UWCA 2YITA 2HWOA 3E8DA 3RINA 2X8DA 3DS6A 3COIA 3FZTA 4X2GA 4GT5A 2J9MA 4HCTA 3DK6A 3CQUA 1H25A 3BGPA 3TIZA 1GZKA 4E3CA 3BQRA 2GS2A 3LLTA 3PTGA 4EYJA 2PK9A 3FZRA 4FG8A 4ASDA 4ZY5A 4HVGA 3NNWA 3ZXTA 4DTKA 3HAMA 1U5QA 1YXUA 3R2BA 4OAUC 3AD5A 2YJSA 3P08A 3GC7A 3R8VA 2OH0E 3EWHA 4R7IA 4ZTHA 4NH1A 4RFMA 1XH4A 3IGGA 4K77A 2CKOA 4KAOA 3A8XA 5AP4A 5E7RA 2UVYA 3UBDA 5JKGA 5M53A 4IJ9A 4ALVA 2GPHA 4F9YA 2W1ZA 4HYIA 4RVMA 5HEZA 5CT0A 3UNKA 2C0IA 4U7ZA 4RIXA 5DPVA 4O0RA 1ZWSA 3OWJA 1V0PA 5KMNA 3QQGA 4U41A 3A61A 2YIXA 1FBNA 2OF4A 4NFMA 4X0MA 4BWXA 4RFZA 3L8SA 4FV9A 5FXSA 3ZRMA 5A14A 4GSBA 4W4YA 4YNOA 4U0IA 3GOKA 2BDWA 4BDIA 2WU6A 1YHVA 2DQ7X 4GJ2A 3HV6A 4DEDA 2CCIA 4JG6A 1Q8WA 3E8CA 4BBEA 3TI1A 5I4NA 3A4PA 3AD6A 1L8TA 2VWIA 3U6JA 1FGIA 2GQRA 1ZXEA 2ITZA 1LEZA 3HMPA 3SOAA 2CDZA 3QRUA 4A9TA 4AX8A 4QTBA 4FEWA 1U54A 4V05A 4HGEA 2ITXA 4RVLA 4ANOA 4XG7A 4X6QC 3T3UA 3ZO3A 5HQ0A 1CTPE 4FTUA 4Y46A 3NX8A 3OWLA 2WTKB 2X7GA 5CZIA 4DEHA 2CNVA 4M3QA 3Q60A 4XV9A 5DHJA 4NM0A 4QYEA 1K2PA 4E5AX 2BFXA 3FMHA 3RZFA 1WBSA 3ZC5A 3QTUA 4XG3A 3MVLA 2W5AA 4FIEA 1M52A 4DBXA 4JVGA 1YWNA 2VNYA 4EOMA 5I9UA 4FNXA 1QL6A 3KVWA 2KULA 3GXLA 3R1NA 4JL9A 3LMHA 5JRSA 3P7BA 4E4XA 2R3GA 4ALUA 2I0YA 1MRYA 4C62A 3E62A 3EFWA 1KOAA 3BE9A 1W8CA 2C4GA 2HZ4A 2XIRA 3K3JA 3NZ0A 4J8MA 5G1XA 2R3KA 3G0EA 4RJ6A 2O3PA 5K3YA 4EWQA 4E20A 1IR3A 1KV1A 5IDPA 4NTSA 2JKQA 2HYYA 3LPBA 5DMZA 4O7NA 4FT9A 4DH1A 1FMKA 2QONA 3EFLA 3MY0A 4YBKA 3WOWA 4QYFA 3DTWA 3MSSA 1OKWA 4GK3A 4EHVA 5CNNA 3OOMA 3MJ2A 3MH2A 2XNPA 3B2WA 4ZS0A 4PPCA 2P2IA 2VTSA 4M15A 4KBKA 2R5TA 1CSNA 4RZVA 5HTBA 5E1EA 4CQEA 3KRXA 1XH9A 3CD3A 3FUPA 3R22A 3B8RA 4ENXA 3QKKA 3VQUA 3ZFMA 3TT0A 3CKWA 4JNWA 4RJ4A 3W2RA 3HRBA 2J0JA 3VJNA 2B52A 4XLVA 2VO6A 3LXKA 2WQOA 3E87A 5GINE 4R1YA 3U6IA 5M08A 3F3VA 3UC4A 3WILA 3MIYA 5CVFA 3O50A 1G5SA 4WG4A 2VTMA 1APME 3BYMA 3QCSA 3VN9A 5HU9A 2FA2A 4ZLYA 3EQHA 4CFNA 2IJMA 4BR3A 1OBDA 3PLAE 3JPVA 2ZV7A 1KV2A 1TVOA 2JAVA 3I0OA 4QPSA 4PX6A 1WVWA 2RG5A 2C5NA 3ZM9A 3KVXA 3PXFA 4H58A 4RJ7A 5A4EA 1YDSE 4O2PA 2BDJA 2A19B 3PFQA 3VF9A 2VRXA 4WRGA 4BCIA 4U80A 5FDXA 2GHGA 5CSPA 3TDVA 3VO3A 3RCJA 5AMNA 2PUUA 3CGFA 3GC0A 1J91A 4BDGA 4EH4A 3BI6A 5BUJA 3QYWA 5LVNA 1WBWA 3FLQA 3WZUA 4DH7A 1ATPE 3VUMA 2WTCA 4UN0C 4MK0A 1H27A 2XNGA 2YCRA 3FSFA 3FZOA 4K6ZA 4TKSA 5CNOA 4FEXA 3NUPA 2BIYA 5E90A 5AR5A 5JH6A 1V1KA 4J7BA 4EH5A 4F08A 2E9OA 4MQ1A 3ZZEA 2V62A 1BI7A 3PPJA 3TZ7A 5HBJA 3EQBA 4C3PA 4EH7A 3MJ1A 1ND4A 3FMEA 4RJ8A 3ORTA 2BIKB 3BKBA 2OLCA 5M4UA 3CSVA 3CTHA 4PL3A 3FZPA 4FA2A 2WMQA 4DHFA 5ANGA 3R9RA 4QNYA 3D2KA 3KMMA 4X2NA 3W55A 4IAKA 3VF8A 2QR7A 2QG7A 1SYKA 5HIEA 3F5PA 3D7TB 4FZFB 4Q9SA 5CEIA 3RM6A 1T46A 2YJRA 4EH3A 4PMSA 4AACA 4AT3A 2DUVA 5EYCA 1OMWA 5L6PA 2JBOA 3RWPA 2PPQA 3OWPA 1NVRA 2PMNX 3A7IA 4YR8A 4BN1A 2GSFA 2PUIA 1F5QA 5A3XA 3V5QA 4N6ZA 4V04A 5B2LA 3VUIA 3H0ZA 3QKLA 1M14A 4AT5A 3BQCA 4E93A 4DH8A 4BB4A 3VS0A 3UO4A 1RE8A 4X3FC 1URCA 2QOQA 3KN5A 1O6YA 3L8VA 4ZJJA 3KXXA 4PY1A 3EOCA 3CEKA 5KMIA 3A2CA 3ZYAA 1MUOA 3Q4TA 1CKJA 3PJ3A 5EKNA 2UUEA 2QOLA 3LJ2A 3ZBXA 2JGZA 4Q5HA 5EM8A 4I6HA 4PNIA 3ZZWA 1H4LA 4RQKA 5DI1A 3F7WA 2F4JA 2RFSA 4G5JA 1P14A 3CD8A 4XRJA 4II5A 2CMWA 2WMUA 3GP0A 4BTJA 4W4WA 4LRKA 3BLRA 2IW6A 3O71A 1UU7A 2BRHA 4N4SA 4RIYA 1RDQE 4CYIA 5AV1A 4RIYB 4ZJVA 5AA9A 3EKNA 2EB2A 2GCDA 2P33A 3ELJA 2IW9A 1UV5A 4AN9A 5K4JA 2ONLA 4HNIA 1XR1A 2YM6A 4BCHA 3TKUA 5IQAA 5TE0A 3EYHA 4RWJA 4XJ0A 1SVHA 2YERA 3E63A 3AC3A 4LG4A 4TWNA 5CU3A 5DE2A 4C58A 4PNKA 1PRYA 1P5EA 2VO3A 3OCSA 4G9RA 4QQTA 2WOUA 1G8AA 3DQXA 2XKEA 4IJPA 4BCJA 3TZ9A 3EMGA 4XBRA 5DYJA 3NMUF 5CU4A 4OTGA 3WE4A 2H9VA 4RX7A 5IQHA 4QD6A 2WTVA 5I9WA 2BZKB 4WNKA 1UWHA 4I0TA 2QOKA 3FY2A 4ASZA 2GNLA 4EQUA 1KE8A 4ZIMA 1PXJA 4IAIA 4PUZA 5HCXA 4AW0A 2OW3A 3MW1A 3PPKA 3R7GA 3NCZA 4W8EA 3VBTA 4BCFA 3UMWA 4CMUA 3UIXA 1WCCA 3DA6A 3I7CA 5ANJA 4JQEA 3THBA 5E8YA 3WZDA 4O96A 3ETAA 4FT7A 2C6OA 3KXGA 4E6AA 5AUZA 2BRGA 2VWZA 2BZJA 4IXPA 4M97A 4EOOA 3V8TA 2HCKA 2OBJA 3H4JA 4FTOA 4ACCA 2CCHA 4O82A 4S32A 4I6FA 3ZMMA 4X6RA 4PTGA 4QP6A 3RWQA 1JAMA 2C68A 3PE1A 4RVTA 2ESMA 2YDJA 2VWXA 5BVKA 5ANKA 2UZUE 2F7ZE 4D2VA 2V22A 1S9JA 3UP7A 3DJ5A 1PF8A 3KL8A 3TG1A 3ZXZA 1UNGA 3BHVA 4DEIA 3ATSA 4FGRA 2QHNA 5AIRA 4F09A 5BUIA 1JLUE 5E1SA 2R0IA 4EOSA 2HXQA 3D5VA 4GFOA 4F1OA 3C0IA 3I4BA 4F0GA 3EN5A 5AUWA 4H3PA 4UZDA 3IW4A 1V0OA 1SZMA 2VTRA 4IZYA 4C36A 2IWIA 4QMZA 2QU5A 1H1WA 4I0RA 2XNEA 4J98A 2XYUA 3UC3A 5AP6A 4FYNA 4BVUA 4QMQA 3A60A 3CP9A 3G5DA 3O8UA 1ZYDA 4I1ZA 4MD8E 5CENA 1YOMA 3REPA 3D0EA 2HWPA 5J95A 2PTKA 2C5VA 3OTVA 2ITVA 4FNWA 2PVNA 3ZO2A 4RQVA 1E1XA 4YO6A 3CE3A 4FTLA 1Y91A 5HVYA 3HNGA 4GH2A 2QO7A 5FTOA 4WNOA 3MPMA 4QRCA 2PUPA 1FPUA 2IN6A 4MWIA 5L6OA 4R8QA 3E3PA 4XNEA 4BYIA 4FVRA 3TTIA 3RPYA 4QYHA 2GFCA 1ZAOA 2Z7LA 3DU8A 3KXNA 3P9JA 5GZAA 4FK6A 4R7HA 3SGCA 5GNKA 2PY3A 2V5QA 4FG7A 3W2QA 4FR4A 4C4FA 5HU3A 2W1FA 4O0WA 2XRUA 4L42A 4ZLZA 2O65A 5JGDA 2W1EA 3POZA 2BKKA 3CY2A 3R8ZA 2BZIB 4OTWA 1R39A 3U8WA 4DT8A 3MESA 4CFFA 3C9WA 2OXXA 2OZAA 3HZTA 4L53A 2XS0A 4IVAA 3RKBA 4DGLC 3MWUA 3COHA 3IPHA 5H8GA 4G2FA 4O86A 3DB6A 4HYUA 4JOAA 4YTFA 3LFSA 5AEPA 3NIZA 5IISA 3Q6UA 5IZFA 3VIDA 2PU8A 3SG9A 5E8VA 5IQBA 3I0QA 5EQPA 4O27B 4BCPA 2X9EA 5ITAA 5CI7A 3FHIA 4EYMA 4LL5A 4YP8A 4OTHA 4OW8A 2C69A 4W4XA 4P4CA 3TUCA 4UWBA 3RAKA 4ZMFA 3FMLA 1ZOHA 2QLUA 4IH8A 4AGUA 4ZS4A 3NR9A 4O81A 3C4WA 3PJ2A 3OP5A 4TY1A 3FC1X 3PA5A 4O0UA 3KCFA 3UGCA 1YQJA 4V01A 4E4MA 2HY0A 1H1SA 3DKCA 2XNOA 3FQSA 3PE2A 4QP8A 4ZZMA 4AGDA 3BYVA 3JR1A 5M06A 3NS9A 5EM6A 4AZTA 1GZOA 5I5ZA 3HMIA 4R5SA 2O5KA 5EDPA 5I0BA 2G2FA 5EG3A 4C0TA 5J9ZA 1YI3A 3MH0A 1JKKA 4Y95A 2QU6A 3FI2A 4ZSJA 4C2VA 4D2RA 3BYUA 3PVUA 2BTSA 1NVQA 2FYSA 2WMBA 4FZ6A 3F7ZA 3PWDA 4XRLA 2JFMA 5HBHA 4EBWA 5JZJA 5J5TA 1OIQA 2HAKA 4BFMA 2DYLA 2G1TA 4QTAA 5BVWA 3JXWA 5KMOA 1PJKA 3MB7A 3IGOA 4GRBA 5AV3A 2XK9A 5CXHA 3U9NA 3M1SA 4D1ZA 4GCJA 3W2SA 5E8XA 2R3PA 3Q9WA 3GFWA 3W8LA 5CAVA 4DH5A 3NW7A 3ZRLA 1CKPA 4KNBA 5CY3A 2Q0BA 3R1YA 3OCGA 4AZWA 3EQCA 4C4GA 4U3YA 5JFSA 2QOFA 2XIYA 3QQKA 2R2PA 2XP2A 4FKQA 4EC9A 3EQDA 4KIOA 2CLQA 1L3RE 3V5WA 2R3LA 1JKSA 3TJCA 3OWKA 2F57A 5EW3A 5EYMA 2J7TA 2Z7QA 3QUDA 1M2QA 4AE6A 4I23A 2PUNA 4RBLA 4WD5A 3DXQA 3O96A 3LQ8A 4KRDA 4ZTNA 4PDSA 4CTCA 4EJNA 5LMKA 1PKGA 2A2AA 3CJFA 2CHLA 1UU9A 3ZEWA 2JIVA 1ZYLA 2W99B 4GK2A 2PYWA 4OTIA 3RPOA 2PZIA 3GQIA 3OMVA 3EN4A 3ULZA 2QR8A 3UQCA 3U4WA 2QOOA 4CG9A 2RL5A 3BHYA 3L9LA 2OJJA 1B39A 4W8DA 3QL8A 4FV6A 4H3BA 5T3QA 1KE6A 3MH3A 4G3GA 4KINA 2XK3A 5HG5A 3VBVA 4ZTRA 1X8BA 4MEDA 2O0UA 3OS3A 3LCTA 4M69A 4HPTE 3R63A 3FAAA 4W4VA 2FGIA 3TZ8A 4M69B 2YM3A 3SHEA 3R8LA 1YXXA 2WPAA 2QKRA 4G1WA 3W2PA 3LFDA 1YXSA 1I44A 1BUHA 4TTHB 4L3JA 5KMMA 1RJBA 3L9MA 2XB7A 3R1QA 3OEFX 3IDCA 2WMWA 4O1PA 2R7IA 5CF5A 4Q5EA 5BVEA 3GU5A 3LXPA 2XUUA 2WMRA 4KKGA 5FXQA 2CGXA 4QYGA 2PZPA 1YOLA 4FUYA 4UMTA 5C01A 5IA2A 1BL7A 4XX9A 3PVBA 4O2ZA 4AW5A 4F9AA 2YDIA 3EZRA 3MA6A 3QX2A 4DGNA 2GNIA 2ITPA 4D55A 2C3KA 5IEXA 4FODA 4EK5A 1SNXA 1IA9A 3QTXA 4JDHA 4F7SA 3I6WA 3D94A 3MFUA 4JIAA 3TKIA 5J9LA 4JQ8A 3F2RA 4FV5A 4ZJIA 1FQ1B 4NYEA 3ULIA 4BCQA 4IQ6A 4XG9A 3E3BX 4UY9A 5AUTA 5E4HA 1QPDA 4HVSA 4JDIA 2QQ7A 2UZBA 4ANNA 4E73A 4NEUA 2ITNA 3GVUA 4I5PA 4DG3E 4GVJA 5AP2A 3HP2A 3QF9A 3ITZA 4XP0A 1YDTE 2ERZE 4GV1A 1DI9A 3HMNA 2JLDA 2GMXA 3BGZA 3I81A 2P4IA 4XBUA 3U6HA 2YISA 1DAYA 4E1ZA 5FG8A 1XWSA 1E9HA 1KE5A 4FNYA 3I5ZA 3KC3A 3AXWA 3HUCA 4FTAA 4BIEA 5ANEA 3ORZA 3PZHA 3GC8A 4JAJA 5KMJA 3BU6A 3RK5A 3TTJA 4C7TA 4MXCA 4NIFA 3JVSA 1OPLA 5AR7A 4YU2A 2VWYA 3SW4A 3OXTA 4J97A 2H8HA 5D9HA 1PXPA 2F7XE 1BI8A 4YNEA 3GCUA 2NRUA 5FWKK 4AGWA 1IAHA 3C4FA 3NWWA 5CLPA 5ANDA 4O6LA 4O7VA 3R9HA 2VUWA 1F3MC 3ORLA 4O0YA 3AC2A 3OF0A 3MH1A 2OKRA 3LXLA 5TO8A 1JOWB 1GZ8A 2XK6A 4L9IA 3ZHPC 2WNTA 4O7TA 3DKOA 3P1AA 1WMKA 1XH5A 4KBAA 3SKCA 5AR8A 5HD7A 2E9PA 3VBWA 3W32A 4BHZA 1J3HA 1PXIA 4APCA 5ETFA 1Q97A 2JKOA 4YPSA 4BDHA 1AD5A 5I9ZA 3ZLSA 3RAIA 1DM2A 1OPJA 4EOLA 2E2BA 3A8WA 4TW9A 4NM7A 5BYZA 5CX9A 3NPCA 4LYNA 3WF9A 1H1QA 4DITA 2W1GA 3COMA 2VTIA 4UZHA 4JG8A 2W5HA 4TYJA 2W7XA 2ITYA 4JDJA 1ZMVA 4A4XA 4Q9ZA 3FMJA 1OBGA 3D15A 4DFNA 3ZSGA 1WBPA 3R7VA 2OICA 3ZSHA 2RFDA 1GAGA 2G2IA 3AT3A 2ZB1A 2QLQA 2YWPA 4QP9A 3A62A 4BCGA 2XKDA 3NUAA 4G5PA 2UW4A 2XMYA 4E4NA 2VN9A
chains in the Genus database with same CATH superfamily
4AW2A 4QOXA 1R3CA 4K9YA 4IMYA 2W1HA 2I0HA 2VTLA 3PP0A 4O21A 3ZFXA 4CT2A 3C5IA 4BBMA 3ZS5A 3LJ0A 3MDYA 3PPZA 5HE0A 4PDPA 3R8UA 4H05A 2J0IA 2HELA 2BROA 1JSVA 3WBLA 2W05A 1JQHA 3KCKA 4YJPA 3JY0A 5BVFA 4G3EA 3W0NA 1NXKA 4CKIA 3OT8A 4LV8A 4MXOA 4FYOA 3KXHA 1REKA 3GB2A 3VWAA 4FZAB 1JSTA 3QTQA 2IF8A 2XIXA 2WQBA 4EH8A 5JN2A 5IMEA 3IONA 5AP0A 3TV7A 4R78A 3MS9A 3VW6A 2UW6A 3GU4A 3ENHA 5JZNA 1M2RA 5DT4A 3OW4A 3N4VA 1ZMUA 3E88A 3QHRA 3KB7A 3OUKA 4AN3A 4FSNA 4FKVA 3RK7A 4D4RA 3WIKA 2PVLA 2C30A 5I9VA 3NW5A 4F7JA 4KRCA 3UO5A 2OF2A 2XZSA 5IDNA 4I4EA 4XYFA 2R3RA 3OOGA 5H8BA 4IWDA 2OJGA 4FSTA 1AQ1A 3KK9A 5FM3A 5CEKA 2QOCA 3OEZA 4MAOA 2XJ2A 2B55A 2Y6MA 4WSQA 5M51A 5J87A 3ZDIA 2C3IB 2F2CB 4XS2A 4PL5A 4RA4A 3QD3A 4QP2A 3LKMA 3WZKA 5HX8A 3HMMA 4H1JA 4JJRA 3TV6A 4RIOA 3TACA 2CGUA 4PTEA 4Z3VA 1MQBA 5AR4A 5GZ8A 2ZMCA 3C5UA 1ZZLA 5F95A 3SW7A 2ZFYA 1CMKE 2A98A 2XBJA 3QZHA 4FV0A 4UMQA 4UMUA 4J71A 5AX9A 3A99A 5TF9A 2VTJA 3E5AA 5CQUA 3S3IA 4JRVA 4OGRA 2JEDA 2QNJA 3LM0A 4Y85A 2WQMA 2YABA 4YURA 3IDBA 1M17A 4IADA 5CZHA 5GJGA 4LRJA 4BDDA 4DINA 4RX5A 5F94A 2YCSA 4G6OA 3NAXA 4D5KA 3FE3A 2C5YA 3ZUUA 1GOLA 1PYXA 4FKRA 5ICPA 2HXLA 3AKLA 3DPKA 2R9SA 3NNXA 3TYKA 2DWBA 4IB3A 1J7IA 4FTCA 5KZ0A 3CY3A 4CG8A 3E64A 1I09A 4UALA 1H24A 5AFVA 1FVRA 3FHRA 4KS8A 3VW8A 4O0XA 2I0EA 4QMSA 3ZO4A 2WB8A 4OTPA 4S31A 5A4QA 2QKWB 3D5XA 4E4LA 3HMOA 5J7HA 3MN3A 3AD4A 2IW8A 3ZO1A 2RFEA 4K11A 2EXCX 5DH3A 4TYEA 3SLSA 5FD2A 3GCPA 4CZUA 4F70A 3NYOA 5CANA 2VGPA 5FXRA 5DFPA 4AA4A 4KUJA 1OM1A 2NP8A 3ZLYA 5M44A 1PKDA 2CN8A 1B38A 2X39A 5J1WA 4ANQA 5JFVA 5FP6A 3W0OA 1PXNA 4CRSA 3QWKA 5IF1A 4JI9A 3IS5A 3BL9A 3QCYA 4I6LA 3E7OA 4AGCA 4EZ5A 1Q61A 4LFIA 5JK3A 4AAYA 3PIXA 4O91A 3RNIA 3EN9A 3UQFA 4AOJA 4RLKA 5EW9A 3ORIA 5A46A 3R9DA 4EOQA 3BRBA 3HA8A 3UOJA 3O5AA 4GKHA 3NLBA 3SX9A 3QCXA 2VTQA 1YI4A 2XNBA 1K3AA 1YWVA 2WQEA 5FEDA 4FKLA 3RPSA 5AA8A 4IE9A 3P0MA 2VAGA 3LFFA 4LGDA 1VYZA 5KX8A 3SRVB 5KMLA 4FV4A 2VO0A 3K54A 5FEQA 3S2PA 3R8MA 4DT9A 4ZY6A 4MXYA 1XH6A 4FZ7A 2ITTA 4H1MA 1OKZA 5C9CA 2RGPA 4K8AA 4QQJA 4C38A 4AA0A 3RAWA 2W1CA 3D5UA 4CFUA 2WTDA 3L1SA 1J7LA 1G8KA 1ERKA 4C33A 2YIRA 4FRFA 3HDMA 1A06A 3RHXA 5K0XA 4DG2E 4IWOA 4FMQA 2RFNA 3HECA 2BZHB 5IEYA 3ZUTA 4CFMA 4FKUA 4C8BA 3GCSA 4YHTA 4BHNA 4RGJA 3ALNA 4BF2A 2CPKE 4HPUE 3QLGA 4JAIA 2ZYBA 5E9EA 4GK4A 2X7OA 3DK3A 3Q3BA 4U5JA 3SXFA 4A9YA 4D9UA 2C47A 4EK3A 5J7BA 2GS6A 5M55A 4DEGA 4B9DA 3FXZA 1ZYJA 4CV9A 4F0FA 4F9BA 3IKAA 3A7JA 3RHKA 4EH6A 3IW5A 3EKKA 4WG3A 1KSWA 5A4CA 1R1WA 4KSPA 3MV5A 1H07A 3RZBA 4NJDA 2EXEA 2GFSA 3P7CA 2DS1A 4JXFA 5TOZA 1IEPA 4YC6A 4D2SA 5F9EA 5M09A 1H8FA 3F5XA 4A4LA 4P2KA 1ZYSA 4TYIA 3VHEA 2ITOA 1UU8A 3BLQA 3FWQA 3KQ7A 3E8NA 3QA0A 5IA5A 2BHEA 4PP9A 1PYEA 1ZRZA 3OY1A 3EB0A 3KEXA 4XV1A 2XBAA 3I6UA 3R9NA 1OECA 3HDNA 4S33A 4MTAA 5DA3A 3UOKA 5ETAA 4PMPA 3DTCA 2PVMA 2W0JA 5C1QB 3PIYA 5GJFA 1WBVA 3ERKA 3Q9ZA 4EK8A 4AFJA 3R7IA 4NW5A 4EC8A 4L00A 4FI1A 4RLLA 3N51A 2AEGA 5M4CA 3H3CA 4DTAA 4C37A 1Z9XA 4FV8A 4LV5A 3MIAA 4QQ5A 3FDNA 4L45A 4BCMA 4XUFA 4IC8A 2OH4A 3TN8A 4QPMA 4E8AA 3R7YA 1W98A 2OJIA 3D7TA 3V5PA 2YM5A 4E6QA 4AXDA 3AGMA 4X2FA 3W8QA 3ZDUA 3W2CA 1SVGA 3OG7A 2Z8CA 2O64A 4V0GB 5DR6A 5AR3A 5C26A 3NVKI 3BLHA 3CQWA 3Q4UA 4FVPA 4HJOA 3AC1A 1LP4A 2QHMA 4JIKA 3TNHA 1VR2A 1OL2A 3DZOA 4UWYA 4QMXA 2JC6A 4IVBA 5DLSA 4CRLA 1BL6A 4BWPA 5KO1A 4OT6A 5CTPA 4CZTA 3LCSA 3PWYA 3CTJA 3VAPA 1TQPA 5FDPA 3BCEA 4ZOGA 5ACBC 3KF4A 3O8TA 4RRVA 4QMYA 4I6BA 5JFWA 5AP3A 3P23A 5HVKA 2ETRA 4HYSA 2UZTA 4Z7HA 1BYGA 1Q8ZA 4ANSA 5LCKA 5FUTA 4QQCA 4NKSA 3FSKA 3AC5A 3QGWA 2C0OA 3CTQA 3G0FA 5BMSA 2OWBA 1Q24A 2W4OA 4U42A 3GNIB 4ASXA 3DBCA 3PG3A 1GIIA 2WELA 2WQNA 1XHAA 3BEGA 4RJ5A 3B2TA 3HAVA 2UZDA 3MB6A 4GEOA 4CFVA 5EQYA 4UYNA 2C6TA 4IX3A 2YWVA 2JDTA 5GJDA 5L8LA 2CN5A 3RMFA 2WEIA 4Y72A 5TKDA 1GIJA 4JLCA 4CXAA 1PMNA 3C50A 1IA8A 2A27A 3OCTA 3VS3A 2BFYA 3C4EA 2PULA 4L01A 4UYAA 2VWUA 3W0RA 4FICA 4BDEA 5IG1A 3R7UA 4BBFA 5AAEA 2J2IB 4QTEA 3W2OA 3QALE 1Q8YA 4BGHA 2F9GA 1PMUA 2XIZA 4LRMA 3UVPA 3HEGA 1J1BA 3VBYA 3ZEPA 4AZEA 4L43A 4DGGA 4HZSA 1H0WA 4DFZE 2BHHA 4ZLOA 3BU3A 3LXNA 4O0SA 1NVSA 2ZV8A 3BPRA 3ML1A 3Q4CA 4MKCA 4FG9A 3RPRA 5CF6A 5DVRA 5BPYA 4FX3A 2O2UA 4UMRA 3AOXA 3KULB 2ZDTA 5HE2A 4EWHA 3WYXA 5A9UA 2IO6A 1PW2A 2PZYA 3AQVA 3U55A 3PRIA 1YOJA 5BX0A 5A6OA 5HOAA 2XNNA 4FV3A 2Y4IC 3AKKA 3O7LD 3WZJA 3GCVA 4G3FA 4AT4A 2QO9A 3SQQA 5CS6A 5GZ9A 1YW2A 2B9FA 2J6MA 2J90A 3LM5A 3R0TA 4WUAA 3BZ3A 4XV2A 4YPDA 4BTKA 5HO7A 2J4ZA 4YLLA 3KRLA 3KKVA 4YJOA 3QWJA 2VWWA 5D12A 5CI6A 4F7LA 5IU2A 4HGLA 3QCQA 5F1ZA 3U54A 5L2IA 3D83A 1M2PA 3SAYA 4NJ3A 4DGOA 4LMNA 1NW1A 3P78A 4FF8A 4LOPA 3VVHA 3NVMB 4BI0A 3S1HA 4RX8A 3R71A 4D5HA 1RW8A 3UOLA 4IIRA 3UIUA 5CEOA 5L8KA 4K33A 4FBXA 5C8NA 5BYLA 3H10A 3Q4ZA 3U9CA 2VX1A 1W83A 4F7NA 5AIKA 3VUDA 3PY0A 5BMMA 3U51A 3OFMA 3P5KA 3PJCA 2YAAA 3BE2A 3DJ7A 2KTYA 1QCFA 2XNMA 4U79A 1G8JA 5CYIA 4BZDA 3DOGA 4FEQA 1ZY4A 1PMEA 4OTQA 2E9VA 5CWZA 4MXXA 3LFAA 3VRYA 4RT7A 5HZNA 3RJCA 4WBBB 3TXOA 3QZGA 5EH0A 4R3PA 5LMAA 2ZVAA 2XIKA 4H39A 2YIWA 4FIFA 4F0IA 2BTRA 5E92A 4AS0A 4R7BA 4JDKA 1KOBA 4DA5A 4IANA 3MVHA 3FYKX 3V5JA 4IW0A 3IK3A 3L9PA 4ZSLA 3V3VA 4CCBA 5KZIA 3OC1A 5LQFA 4F78A 1PMVA 4B6LA 1FMOE 1UU3A 4UEUA 2OJFE 2BCJA 2BUJA 4EUUA 1H01A 2ZOQA 2ZM3A 3WE8A 3EFKA 3F3ZA 5H9BA 3OT3A 4TPTA 5K0KA 4A9UA 2YDKA 3NRMA 4BDJA 4D2WA 4EEVA 3EL7A 3F88A 4GIHA 2AUHA 1U4DA 4L7SA 4M0YA 4MHAA 4W9WA 4GW8A 5CSWA 3PY3A 4FTMA 4ITJA 2ZB0A 1Y8YA 4ZTMA 2C1BA 4GYIA 3VNTA 3ZUVA 1P2AA 2XJ0A 3DJ6A 1TKIA 1JNKA 3CIKA 3GFEA 5BVDA 3VULA 5I9YA 2W9FB 4S2ZA 3LZBA 2B0QA 3W16A 4RC3A 5E8UA 4IBMA 5CSHA 5BVOA 3UZTA 1WVXA 3O0GA 4D4VA 2P2HA 4WRSA 3WF8A 1J7UA 4IX5A 5CAPA 4BI2A 4IM3A 4EORA 3BWFA 4UMPA 5IA4A 3MPTA 4MH7A 2W1DA 3HLLA 4FTTA 4L3PA 4IDTA 4YC3A 3S4QA 4LI5A 4UV0A 5EQEA 4KD1A 2B1PA 2RSVA 3G6HA 4FKJA 5D7VA 2PVKA 3F5GA 4YZBA 5FM2A 3RVGA 4ZTLA 3KFAA 1R0EA 5FRIA 3FMNA 3M42A 2QODA 1OIRA 5EYKA 3VUKA 3AKJA 5HCZA 3GENA 4PQNA 4Z9LA 2R3JA 3PJ8A 3DV3A 2OZOA 1SMHA 3DNEA 4GT4A 4M66A 2OIDA 3R73A 3I1AA 4BC6A 4U6RA 2QOHA 2GNJA 2UW9A 4FT3A 5CU2A 5B2MA 4IAZA 4YJQA 3TL8A 4USFA 3EJ1A 4BL1A 4KWPA 5CAOA 3HX4A 1G8SA 3OVVA 2NRYA 4ZMEA 1O6LA 3VUGA 4I20A 3T9TA 2X2KA 1AGWA 3AT2A 1GZNA 3FMDA 3O17A 4PF4A 2BVAA 5DRBA 1Q99A 2OFUA 2XK4A 3T3VA 3IW6A 4KB8A 3C51A 1IASA 2B9HA 3SG8A 4QYYA 4GU9A 2P3GX 5HNGA 3VJOA 3FZSA 4UX9A 4KIPA 3QTZA 2WAJA 4PDOA 4E6CA 4FKGA 2JKMA 3CBLA 3Q5IA 4CSVA 3ORMA 1U46A 3UMXA 4EZ3A 4BDKA 2XM8A 3NUYA 2Y8OA 2XYNA 5JMSA 4EJ7A 4YJSA 5HLNA 1YI6A 1H26A 4ZY4A 4USEA 1MRVA 4EOKA 2BAKA 1H28A 3QQJA 3IDPA 1HOWA 2PMLX 5KKRC 4JG7A 4CKRA 3DXPA 5CF8A 2IZRA 4IB1A 4MUQA 4NCTA 2WMTA 2UZNA 2VTOA 3ANQA 4R5YA 4DH3A 4J99A 4KS7A 2BAJA 4I41A 1WBNA 4JX7A 4QMTA 4QTCA 3UO6A 4I21A 5DR2A 4UB7A 5J8IA 4Z55A 4CYJA 2WTWA 5JGAA 3QC9A 3QXPA 2PE2A 1WBTA 2VX3A 3OHTA 4TNBA 3LCKA 3VBXA 4E5BA 4M8TA 4WUNA 4RWIA 5DIAA 4O1OA 4NT4A 2JDOA 5M4IA 1TQIA 5CEQA 1Q5KA 3ZLWA 5CALA 4ACGA 4O6EA 3RP9A 4F6UA 2R3FA 3LE6A 4OTDA 3LFEA 5HVJA 4AW1A 5IKWA 1FVTA 2GNFA 1UKIA 3DAJA 4FVQA 5EHOA 3VUHA 4O0VA 2C1AA 4QP1A 2V0DA 2ZV2A 1HCLA 1U59A 4RC2A 3UNJA 1JSUA 4C4JA 2YM4A 2BILB 3LJ1A 4RJ3A 4WKQA 4IB0A 4RIWB 2IVTA 4BZNA 4QPAA 4F99A 5I9XA 3L9NA 2X4FA 3EQFA 4F6WA 4C3RA 3QRKA 2XH5A 1QPJA 2UW7A 4XH6A 3WF6A 4F9CA 4ZSAA 5IMXA 3PG1A 4FV7A 4ZZNA 4D2TA 4FKIA 3N4TA 4D0WA 4BCNA 5L3AA 2G2HA 2BRBA 4F9WA 1LUFA 3LCOA 2ZV9A 2GTMA 4N57A 4P90A 4BZOA 3PXRA 1Q3WA 5BUEA 5AV2A 4IM0A 3DBDA 2UV2A 3C4XA 3IW8A 4JBQA 5IUIA 5JFXA 3EQRA 4HVHA 4IVDA 4BI1A 5JQ5A 3TNWA 4O7WA 4CNHA 5AR2A 1ZZ2A 1OL7A 2B9IA 2YLEA 3R83A 2GTNA 3R00A 2XEZA 1SNUA 2WIPA 2FH9A 1PXKA 4AU8A 4ERKA 2QOBA 4GL9A 3UNZA 2UW3A 4UXLA 3CJGA 5CSVA 3SA0A 2XAMA 2J5FA 2IVVA 2HIWA 3BU5A 3K5UA 2IZSA 3NAYA 5ETIA 2ACXA 4FV2A 4KA3A 4DGMA 4FTQA 3WI6A 3W10A 2ERKA 2R0UA 4L67A 4RWKA 3K5VA 4EQMA 4XOZA 4FUXA 3RCDA 3BV2A 4XG4A 5EYDA 3C4CA 4WT6A 3FMMA 4HZRA 5HBEA 3W0QA 4XMOA 3UYSA 5D10A 2HW6A 3DBQA 3DZQA 5HG9A 3AMBA 4RZWA 3BYSA 1JKTA 3OROA 3NDMA 4D28A 4GS6A 4CTBA 4PV0A 3O8PA 3F3WA 5HIBA 4CQGA 4JBOA 2I0VA 2QOIA 2ZM1A 5LVMA 4G6NA 5AWMA 2HY81 3PUFC 5LOHA 3QLFA 3E92A 4USDA 3HV7A 1ZY5A 2W4KA 3R28A 2R4BA 5E8SA 2VTPA 3TNQB 2PVRA 3UVRA 5EI8A 5HICA 4ANLA 4IX6A 2IZTA 3E7VA 5L2QA 4JS8A 5ETCA 4AXAA 3OTUA 5DGZA 2PMIA 4ITHA 2XKFA 4GFMA 4GU6A 2JIIA 2JDSA 2PHKA 3H9FA 4X3FB 3NUXA 2C6LA 3VS4A 2WHBA 4O7ZA 1Z5MA 5K9IA 1KUTA 3P86A 2C3LA 2UZVA 2O63A 4K1BA 2QO2A 3COKA 3ZCLA 1XBCA 3DDPA 1BLXA 3KRRA 1Y6BA 4MD9E 4OTFA 4R77A 3ACKA 4L46A 1RQQA 1OUYA 4ZSEA 3AC8A 2JDVA 5L6WL 4NTTA 3WZEA 1TQMA 5DT0A 1VJYA 2V7AA 3PVGA 4B7TA 3RALA 4BJJB 4RWLA 4I5MA 3WF5A 4HYHA 3V6RA 3A4OX 2IVSA 4BGQA 3MA3A 2WD1A 3JUHA 4FOBA 4TWPA 2Z02A 2XCHA 3PXQA 4AOIA 3FYJX 3QZFA 2ZMDA 5HD4A 4U9AA 2ONLC 4NUSA 3FV8A 3NYNA 2OI4X 1YDRE 3IECA 3PXZA 2Z60A 3QKMA 4BIDA 2XAOA 3RNYA 4EHEA 4GKIA 4TT7A 3V51A 5LCJA 3R1SA 4OBOA 2H96A 3D14A 2WMSA 4FL3A 4ZZOA 5KNJA 2W96B 3EYGA 3OXZA 2I6LA 3F69A 1QMZA 4CFXA 1PXOA 3PY1A 3D5WA 5IA3A 1JKLA 3C7QA 3IW7A 4U44A 1H08A 3DCVA 3CPCA 2CJMA 5A6NA 4IAAA 3ZSIA 3W0PA 4IZAA 3DGKA 2XA4A 3HA6A 4F63A 3WF7A 3EZVA 2OXDA 2HOGA 2W4JA 4XG8A 4KIKB 5B7VA 5A4LA 4GMYA 2Y4IB 3PSBA 4QTDA 4ALWA 2GDOA 1YWRA 3BWJA 4TN6A 4WO5A 4X7QA 4I94A 1XKKA 4TWCA 2ITUA 3KA0A 4ONAA 3LMGA 3PXYA 3H9OA 4LGGA 4XG2A 3HL7A 2Y7JA 5DWRA 1UA2A 4DHZA 3LCDA 4Q2AA 3E93A 5EI6A 3SDJA 4NL0A 4MNEB 4FIHA 4MYGA 3Q2JA 3HVCA 4MCVA 1UWJA 3R2YA 4DEAA 4TYHB 5LVLA 2R3IA 2FSTX 5KBQA 4YHFA 2UZWE 2ITQA 3S95A 4BICA 1ZARA 3GI3A 5K4IA 2XARA 3DLSA 3MFTA 3L8PA 3QUEA 4BTFA 5HKMA 5KUPA 4C02A 5HLPA 4IHPA 4QMPA 2X9FA 2HENA 2ZM4A 3EH9A 3MPAA 4LQMA 3FPQA 4CCUA 2C6DA 4CLJA 4JR3A 2C6IA 5D11A 2Y6OA 1OKYA 3GCQA 4FEUA 1Q41A 3DFAA 2PVJA 1YXVA 1R78A 3ODZX 3EQPA 2YAKA 3PXKA 2CKEA 4L68A 5C03A 3TCPA 4AE9A 5HG7A 4CMTA 3FKOA 4DBNA 2OU7A 2WMVA 3IOPA 2YA9A 2C3JA 3ID6C 3KXZA 3QU0A 5IEVA 3ET7A 4E7WA 2ETMA 4NZWB 1DI8A 4O7LA 3D7ZA 3ANRA 5HNBA 5TT7A 3QTWA 3ACJA 4HGTA 4IEBA 5F4NA 3WYYA 2Y4PA 4FL2A 5AJQA 2HK5A 2I40A 3OZ6A 2VD5A 3UDTA 3WARA 4Y73A 5B0XA 4B99A 4ERWA 2E9NA 4O4CA 3DDQA 2P55A 3DLZA 4ZEGA 3MTLA 4AZSA 3R02A 3PP1A 4MF1A 4DCEA 4YSJA 2Y9QA 3ORNA 4YZNA 1XBBA 2XK8A 3BYOA 3QXOA 4HOKA 2RKUA 4IZ5A 4P5QA 5HESA 4TXCA 3TNPC 3ATTA 3F5UA 5I3OA 5HCYA 3C0GA 2PVFA 4FSWA 3Q53A 5AUYA 2LAVA 5JRQA 1ZMWA 3DK7A 2J5EA 3GU7A 3PIZA 3DKFA 4JBPA 4RIXB 3ZM4A 4PWNA 4CEGA 4GVAA 1Q8UA 3HRCA 4PL4A 4N6YA 4U8ZA 1VEBA 2WFYA 5CQWA 4FSYA 3W0SA 3MGYA 4FEVA 2C0TA 5KBRA 2VV9A 3QYZA 4BWKA 3DY7A 3MTFA 3BX5A 4B0GA 4PMTA 4DC2A 3CPBA 3FY0A 2B7AA 2UW0A 3II5A 4C34A 3O2MA 2C6MA 2R7BA 2UZLA 3OXIA 4G34A 3O7LB 3UIMA 5LMBA 3VS5A 2JKKA 5CASA 1WFCA 4EH9A 4AXFA 1Q62A 3R30A 4F1TA 4WIHA 2OXYA 2BRMA 4J8NA 2WZJA 4ANMA 5B2KA 2YZAA 4L8MA 5LWMA 3VUTA 5CU0A 3BHTA 4ARKA 5IH4A 3W0MA 3QTRA 5D41A 5HTIA 4JX3A 4EK4A 3CXWA 4GG7A 4KIQA 5FTQA 4DG0E 1U54B 3NFGB 3AMYA 5HI2A 3POOA 1PY5A 5LJJA 2YIYA 4YO4A 3V6SA 4CD0A 3VRZA 2YACA 4PDYA 4Z16A 1BMKA 2SRCA 4MF0A 2WXVA 4DLIA 1GJOA 1JWHA 1YKRA 3MVJA 4U3ZA 4YJVA 4IM2A 4ZXTA 4UXQA 2A1AB 3LHJA 4FKOA 4HGSA 5EK7A 5M4FA 3SXSA 1W7HA 3JY9A 1OUKA 3FXXA 3SRVA 4DFLA 5HE1A 5C8KA 2IG7A 3T8OA 1PHKA 1ZOEA 3F82A 4F65A 4FSQA 1K9AA 2NO3A 3PA3A 2VGOA 3LFCA 4LUEA 5IA0A 4E6DA 2VTAA 1ZYCA 1WBOA 2BMCA 3Q04A 4Y5HA 5GHVA 3CLYA 3QQFA 1R0PA 1W82A 4NFNA 3F66A 3VHKA 5KKRB 2IZUA 3F61A 1XBAA 4O84A 2YM8A 3FKLA 4BYJA 3V01A 1TZDA 1Y57A 3QTSA 1XO2B 4NCTC 4YZ9A 2I7QA 3ENMA 3CCNA 2CGWA 3M11A 1J1CA 3FZ1A 5E8TA 3W18A 4C35A 5DNRA 4B8LA 3GT8A 3BHHA 4GUBA 3Q5ZA 3KREA 4C61A 2EU9A 4QT1A 5LXMA 5AAFA 4CMOA 5M57A 2CNUA 1F0QA 3GOPA 4U97A 2PMOX 5EHYA 3DBEA 4AAAA 2FB8A 3ZRKA 4GIIA 2W5BA 1P4FA 3LFQA 4QMLA 3IO7A 1V0BA 1B6CB 2Q83A 4L52A 3U87A 4DFYA 4M0ZA 5IQEA 4XEYA 3AC4A 4YTCA 3TM0A 3UDZA 4U40A 5EHLA 2FSLX 4XCUA 3QHWA 4C4IA 3NUUA 3EN7A 2QVSE 3DBFA 2WMXA 2F49A 5CSXA 5CVHA 5LMKC 3I79A 1OIUA 4EI4A 4J53A 2JIUA 4FSZA 1P4OA 2BRNA 4JR7A 4FC0A 4OR5A 4QMUA 5I3RA 5JEBA 4EOJA 3PSCA 3D4QA 4NSTA 5IQCA 5EDQA 2JD5A 4O83A 3A7FA 5D7AA 3C4ZA 4RFYA 3OBGA 4X21A 2WMAA 2X7FA 2R3HA 4CV8A 2GNHA 3RM7A 5IUGA 1H1RA 4G9CA 3FL5A 3Q9YA 4P5ZA 4FV1A 4YSMA 2QI8A 3CQEA 4MWHA 1FGKA 4RG0A 3RGFA 3FBVA 3D2IA 3UODA 5JGBA 4DF3A 4J96A 4Y5QA 1A9UA 4MBLA 4O38A 2JFLA 2YZLA 2XF0A 3QZIA 4YC8A 2NYAA 4AXCA 2VTNA 2XK7A 4I24A 2F7EE 3MFRA 3ORKA 2A0CX 4FGBA 4V0GA 4MXAA 5DRDA 3GC9A 4DDIA 1OL6A 2WTJA 3NYVA 5FP5A 3A7HA 3PYYA 2G15A 4YZMA 3QFVA 5G6VA 1UNLA 1E1VA 3AG9A 4LOQA 5FTGA 2PE0A 4QDEA 3FLNC 2VZ6A 4CLIA 3FKNA 4FIJA 1W84A 5M07A 3KGAA 3PVWA 4QP3A 4I6QA 3QQLA 2PVYA 4EKKA 2OG8A 3BBWA 2G9XA 4NU1A 4XG6A 4I92A 3FJQE 1VYWA 1LPUA 5H3QA 3D9VA 4FIGA 1T45A 5J1VA 4RVKA 4O7YA 2ZDUA 3DKGA 4M12A 4XP2A 5CEPA 4K0YA 3NSZA 2X6DA 3HUBA 3Q32A 4D1XA 2X0GA 5K5NA 1U5RA 2J51A 5L2TA 4WBOA 3UOHA 3UVQA 4JQ7A 3FEGA 5ANOA 4S34A 2YEXA 4U81A 5HGIA 2J0KA 3VC4A 4D0XA 3ROCA 4AP7A 5A4TA 4K18A 3RBWA 3TKHA 5T68A 4EOIA 3H30A 4PPBA 3NUSA 2W9ZB 5FEEA 2WEVA 4N70A 4ZAUA 5IUHA 4RC4A 5L2WA 3VS2A 4HVIA 4M67A 5DEYA 4FL1A 5CAQA 4ACDA 4J52A 5C4LA 4O7SA 5EM7A 3TEIA 4Y83A 4B4LA 4BKYA 2R3QA 3BEAA 4BTMA 3PLSA 4QMNA 3AGLA 2UW5A 4U43A 3MBLA 4IAFA 1XJDA 1UNHA 4IWQA 3UJGA 3S00A 2Y0AA 2CNQA 4D4YA 3VBQA 2VTHA 2A4LA 3UQGA 5GIOE 2B4SB 3NNVA 2B9JA 4WOVA 5C4KA 3PDTA 3QRIA 3ZLXA 4D2PA 3V8SA 3DXNA 4DTBA 3V04A 1WVYA 5GIPE 3NEWA 3ZONA 3MY5A 4NKAA 3O51A 4IDVA 3HV4A 5AM7A 3F2AA 5JQ8A 3C1XA 2PE1A 3LIJA 3G2FA 4R1VA 3KULA 5ANIA 2XM9A 4FTJA 2GQSA 3GUBA 2QD9A 4CZYB 2IPXA 4ZTSA 2YCFA 2PZ5A 2X4ZA 2NNWB 3B8QA 4X2KA 1W2DA 2JAMA 5IQIA 2JBPA 1WAKA 2VNWA 4YJNA 3VS1A 3EFJA 2OIQA 3OW3A 3NIEA 5DR9A 4AOTA 1Q3DA 2PZRA 3QA8A 4FK3A 3ORXA 4OUCA 4Y8DA 3ALOA 4IC7A 4RX9A 4FTNA 1QPEA 4E26A 3DAEA 2ZJWA 3GGFA 1CKIA 4KBCA 4AXEA 5M56A 5IA1A 3W33A 4OBQA 4BKJA 2W1IA 3S0OA 2YFXA 3KN6A 4FZDB 3LMIA 3UG1A 4IVCA 4FKPA 5AUVA 3QUPA 3UZPA