5J8IA

Crystal structure of tl11-113 bound to tak1-tab1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
306
structure length
288
Chain Sequence
SLHMIDYKEIEVEEVVGRFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGCLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 7/TGF-beta-ac
publication title Structure-guided development of covalent TAK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 288
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j8iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5j8iA01
2Z7LA 4ERKA 1BX6A 2YM4A 5ANOA 4BIEA 1OPJA 3C0HA 2BDFA 2W96B 1ZWSA 3EFKA 3F3UA 3G51A 3MVJA 3DKOA 4Y73A 3LKMA 3QL8A 3ROYA 3C4CA 2VWYA 2YM7A 2Z02A 1NT2A 1V0OA 4FT0A 5A14A 4L67A 4DH8A 3V5TA 5I9WA 3LCOA 4N0SA 1OKWA 4XX9A 5AP6A 2J0KA 3TV6A 4YJRA 4U97A 3IOKA 5ETFA 5E8TA 4B0GA 3LFQA 4QP9A 5H9BA 4XG3A 4USEA 3PTGA 2X2KA 3JY9A 4FV8A 4DEIA 5E8YA 3E88A 5AP1A 4AXAA 4JAIA 3N4UA 3GXLA 4YC3A 3QTIA 4O86A 4AA0A 4ITIA 3CXWA 2W0JA 3NUPA 2PU8A 2RFNA 4RWIA 5IA3A 4L3PA 4X2JA 3ZDUA 4IDVA 3THBA 2GPHA 4YZ9A 4C38A 5DH3A 1F5QA 4JDIA 4HVHA 3AMYA 2JDOA 2C0TA 3QHRA 3ZLSA 4FZAB 5EFQA 2BRNA 4UY9A 2J0MB 3FI2A 3POOA 1UV5A 4RVLA 3PY3A 4G9CA 5HBJA 3RKBA 1CKIA 4AFEA 3MA6A 4O7VA 5HVKA 4EORA 3EKNA 5KMNA 4D2VA 4I24A 4MTAA 2C5XA 4X0MA 4AZWA 2VTRA 3ZOSA 4CZTA 5KMJA 2WU7A 4M12A 4DEEA 2WHBA 2DS1A 3KXHA 2V7OA 3C50A 2IVTA 1M2PA 3R04A 5L8LA 3DFCB 1M7QA 1Y6AA 3KVWA 3NNVA 3I6UA 4L8MA 4M14A 3ZH8A 4M84A 4FKIA 3R28A 4JR7A 3RCDA 4CQEA 1MUOA 3GUBA 2B0QA 5I3OA 1HCLA 1G5SA 2EXEA 3E5AA 3HRCA 3KREA 4DTAA 3IW7A 3NYOA 4F9YA 4RA4A 4EH2A 1Y6BA 3AC2A 4E6QA 4TYHA 3LPBA 2WXVA 3KULA 3PFQA 4NTTA 4PDSA 3ZO1A 4PDPA 4Z55A 4D1ZA 1W82A 3C5IA 2YM3A 3ZDIA 2QHNA 3S95A 4U81A 3JVSA 4BF2A 4EOLA 4U3ZA 2JEDA 4BIDA 4O7WA 3U9NA 1O9UA 3VBQA 3CGOA 4QYGA 2RIOA 4O0VA 2I0YA 3KK9A 3HNGA 3L8XA 3LFSA 2P55A 3R7YA 3FMDA 4FKQA 4FTIA 4I6FA 4Y8DA 2QCSA 2X2MA 3MH3A 5J9YA 4BYJA 2OK1A 4O21A 4D0WA 4B8MA 2CCHA 4BDEA 3GCQA 3WARA 1Z9XA 2HOGA 4L7SA 5IEXA 3DT1A 3NCGA 3ZSGA 4JS8A 4RRVA 3ZMMA 4RJ4A 3ZZEA 2CKOA 3L9PA 2XUUA 4G6LA 3FKOA 3QQFA 4FV0A 3RAIA 3ULZA 2YCRA 2W1HA 5J87A 3NMUF 5K5NA 5HD7A 3VW8A 2ETKA 3ZUTA 3TUCA 4FK3A 2OKRA 3H0ZA 5ACKA 3G9LX 3SKCA 3TACA 2OJIA 2CN8A 3HYHA 4AZVA 5JT2A 4GEOA 2E9UA 3B2WA 4HJOA 4QYFA 5EDRA 4XOZA 5KBRA 3ACJA 3H3CA 1RE8A 3WZDA 4KSQA 4XNEA 4EK5A 5BUJA 3A4OX 1OVEA 4QT1A 1GIIA 2W1ZA 3DS6A 1Z5MA 2XK4A 5TOZA 1Q41A 4ZZNA 2XZSA 3BEGA 3F61A 3COIA 3F2RA 4XH6A 3PPZA 2ZM3A 3O71A 4KA3A 4IWOA 1PXMA 2OI4X 2XK6A 2E9NA 4RWKA 4YPSA 1PHKA 4K9YA 4RIYA 3TNIA 4TXCA 2CGXA 3V3VA 3VS1A 5JZJA 5CEQA 2WPAA 5EW9A 4CV8A 5EK7A 4JX7A 3I0QA 3H0YA 3ZS5A 4CFFA 1PMNA 5M4UA 3EN9A 3AC1A 5A4QA 5L8JA 2V55A 2PVRA 2VO6A 2Z2WA 4TYEA 4MWHA 2JKKA 3L8PA 3BPRA 3PSCA 2J6MA 3EKKA 4JRVA 3NIZA 3OW4A 3QUEA 5TE0A 4CCBA 1P2AA 3PE2A 3K2LA 5AR5A 4BCNA 3FAAA 4G1WA 4WA9A 5ETAA 5B0XA 5HLNA 1YHVA 4V05A 4YJUA 2C68A 3R00A 2EVAA 3TT0A 5FBNC 1YXVA 2BMCA 1JVPP 5E8VA 3R0TA 4TT7A 2AC5A 2B54A 2FSTX 4M15A 3BYOA 4GVAA 3HVCA 2RKUA 4RLKA 4E1ZA 5FBOA 4GYIA 3PIZA 4G31A 4I4FA 4G3DA 3TZMA 5J7BA 3FE3A 5CNNA 5LCJA 3MY5A 3EN7A 4EOQA 4E93A 4IW0A 1QCFA 2WTWA 4GFGA 3CEKA 3REPA 1YHSA 2NRYA 3PWYA 3I0OA 4QMWA 3QYWA 3W2OA 3DY7A 5L3AA 3BYUA 1XH7A 2A2AA 3O7LD 5GJGA 3IW8A 4FT5A 1NVQA 4NH1A 1A48A 3GP0A 4ONAA 3QRIA 5IA4A 4P5QA 3ALNA 4B9DA 3W8QA 3OEFX 2EU9A 3RWPA 5HG9A 4XMOA 3G15A 1UU7A 4CRSA 4DEDA 2F2UA 2PZPA 4DFZE 4FV9A 2JDSA 4O27B 4Y5HA 3AOXA 3I4BA 4FV3A 4FEWA 3ID6C 2Y6MA 3OHTA 1ZMVA 5AADA 4FOBA 3TM0A 3VULA 4YNEA 2BAQA 1NA7A 5BVEA 2BFXA 2ONLC 5FEDA 4EHVA 4EZ3A 3MSSA 2FUMA 2V7AA 4RJ6A 2BKZA 4A9RA 4OTDA 2OFVA 3CP9A 5IMEA 3C51A 5AIRA 3I1AA 4R77A 4OBOA 1CMKE 2JFLA 2PVMA 3D83A 4KABA 4YTIA 3UBDA 5IQAA 4HNFA 5HU9A 4QP3A 3AC4A 3KN6A 1K3AA 4I0SA 2E2BA 4YZCA 5L2WA 5EYMA 3BHVA 3VUIA 3DPKA 4QMXA 5EI8A 2XKFA 2PVYA 2VTMA 1ZMUA 3SQQA 4DGOA 2UW0A 4ACHA 4HYHA 4YZNA 3VBTA 3Q9XA 4YLKA 3UG1A 2YDIA 3E63A 4C36A 3EWHA 3POZA 4LL5A 3GC7A 5A54A 1JKSA 1VYZA 1H25A 2XKEA 4J8NA 4X3JA 2UZUE 2ITTA 3O23A 4LYNA 3ORPA 4JG6A 4ANOA 4BY9E 2XIKA 1IRKA 1VEBA 2A4LA 3D5UA 5K4JA 4GH2A 3IS5A 3ULIA 4IDTA 3GGFA 1Y57A 4IB0A 3HMOA 1JPAA 3R1YA 1H0WA 2WMBA 3CKWA 4AGCA 5CSPA 5I0BA 4I92A 3PVUA 2W99B 3B8RA 3SC1A 3SA0A 4TW9A 2PMLX 2R3LA 5F95A 2QG7A 2C5NA 4JI9A 5LQFA 5GIOE 4KBCA 3C0GA 3TNHA 4FSRA 5IF1A 3AMBA 4KNBA 5K0KA 2GQRA 3G9NA 5C01A 2XBJA 3CTJA 4EOOA 1ZYLA 3UZRA 4FKGA 4X7QA 2BZHB 5HBHA 1I09A 4N57A 3N51A 5F94A 3QKLA 3VS4A 4I6BA 5ANJA 3R8LA 3E93A 3LCTA 3ORIA 1XBBA 1PJKA 2YA9A 3EFJA 3PY0A 4QNYA 4D5KA 1IAJA 3I7CA 3PVGA 3C4XA 2AC3A 4UXQA 5F9EA 1H1QA 4FNYA 2Z7QA 5J79A 2C6KA 5HO8A 5IA1A 4RJ7A 4QQJA 4LGGA 2HWPA 4GU9A 4WOVA 1OL1A 2UV2A 3RM6A 2B55A 1AD5A 3QZGA 1ZOEA 2ACXA 2FSMX 1P4FA 4NM0A 4YJNA 2VUWA 3PPKA 3F3TA 1TQPA 4FTQA 3QTQA 4U41A 3PA5A 3P86A 2R3GA 3I5ZA 3V01A 1R3CA 2WMRA 1JQHA 2CDZA 5CY3A 4LGHA 4GJ3A 4OT5A 2WFYA 2RG5A 3Q04A 1L3RE 3QC9A 4QMLA 4D4VA 4F7LA 1Q62A 3GCUA 5BQ0A 4BCOA 4CYIA 3T9TA 3R1NA 4A4LA 5HLWA 2Y8OA 4WG3A 3WF6A 4W8EA 2G9XA 2PZ5A 2YDJA 4MXAA 3T3UA 4DCEA 3CS9A 1KE5A 4FKOA 4X6QC 2EUFB 4M8TA 2HW6A 4U8ZA 2R3QA 1ZRZA 4O83A 3IG7A 4HVSA 4KS7A 1WCCA 3F69A 4AS0A 4CT2A 3ATTA 5L2TA 3ATSA 3AXWA 5K4IA 4DG0E 5EM5A 4BCIA 4CKRA 3ENMA 5D11A 2YM6A 4LI5A 3RMFA 3F3ZA 4HVGA 4HZRA 3GC0A 4ORKA 3ZHPC 2ZV2A 3PE1A 3R01A 4JXFA 4AZEA 3VO3A 1KE9A 2C3JA 3EZVA 4MBLA 4YGAA 2WTIA 3KFAA 4XG9A 3AC5A 5A6NA 2BAJA 3MFRA 2QKRA 1WBOA 1SYKA 5EYKA 2ZDTA 3ZONA 4AG8A 3PXZA 5A6OA 3BV3A 4LOOA 3HECA 5DWRA 4WNMA 3IPHA 2VRXA 2ZMDA 1QL6A 4IHPA 2C6DA 4YR8A 3MH1A 3GOKA 4FKSA 5CEPA 3VUKA 4IM0A 4L01A 4L7FA 2C4GA 3UJGA 3ZLWA 2FVDA 3LFNA 3O0GA 4YZMA 4HOKA 2GNGA 3O8PA 3PUPA 5HE0A 4UZDA 1CDKA 5AFVA 3ODZX 4XCUA 3QU0A 4NIFB 5KMMA 3EQRA 3W18A 3PSBA 2Y4PA 4EUTA 5B7VA 4BHNA 4ZZOA 1YDRE 4U45A 5LMKC 2W17A 3COKA 4PUZA 4LGDA 4Q9SA 3IGOA 2HYYA 4NM7A 5DEYA 4XG8A 1ND4A 4E3CA 4EWQA 3QCYA 2QOKA 4I23A 3VIDA 1FMOE 2RGPA 3BI6A 4Z7HA 2W1EA 3ZUVA 5HU3A 3UTOA 4W4YA 1JOWB 2XNOA 2EXCX 2WQMA 4CFNA 1QPJA 4F9CA 4TY1A 4BCHA 4CFXA 2NPQA 5CVFA 4QYEA 5DOSA 5IA5A 5M4IA 3D5XA 3MB7A 2GNLA 4FODA 2R7IA 4PDYA 2VWVA 3P5KA 4TZRA 2WQNA 4QQCA 3PWDA 4RIXB 4YPDA 3W2CA 4D58A 1FBNA 3GB2A 3F82A 3F3VA 3KVXA 3ZXTA 3DTCA 3MVLA 3MJ2A 3ZO2A 2AYPA 1TKIA 2WB8A 3QTZA 1P4OA 2BTRA 2QLQA 4FICA 3RP9A 5AUTA 2WTJA 1OPLA 3KF7A 3LCKA 4CKJA 4W4VA 4QMTA 3KXMA 3LAUA 5CT0A 3T3VA 1YWNA 4F64A 5FQDC 4QYYA 4TRLA 2PVLA 2XA4A 1UNLA 2OO8X 4KWPA 2R4BA 4IVDA 5HQ0A 3G5DA 3FC2A 3H10A 2CNVA 4YLLA 3D2KA 4O22A 4O7YA 3ODYX 3EQCA 3H9RA 3NUAA 2QOIA 1Q5KA 5KZIA 2XYUA 4WO5A 5HNGA 5LOHA 4FUXA 3SLSA 3RWQA 1KE6A 4EQCA 5EW8A 2YJSA 4TNDA 3NZ0A 4GMYA 3D7TA 2QO2A 2B4SB 4QMUA 4WBBB 3BYSA 4UMUA 1VJYA 2PL0A 4PL4A 5IU2A 2XNEA 4AAAA 4XRLA 4BWXA 3ZM9A 3DJ5A 5C8MA 3C1XA 2HCKA 2O8YA 2PVHA 1YI3A 5I4NA 5JRQA 1MRVA 4GV1A 2DUVA 4TYGA 5AP4A 1PXIA 4CTCA 5BYZA 1J3HA 2BROA 2R3PA 3E92A 5M06A 3CTHA 1IAHA 5AA9A 2GSFA 2WMAA 3ENHA 4TWPA 1WVWA 3FBVA 4FKUA 4AN9A 5FP5A 3R73A 5IUIA 2G15A 2JKQA 5DT0A 5EI6A 2EB3A 5M57A 1MP8A 3NNXA 4CTBA 5CANA 4PX6A 4GUEA 1YOJA 2CN5A 4U80A 5ANKA 3OZ6A 5DT3A 2GDOA 4AWIA 3MY1A 3Q52A 1J91A 2KTYA 5CAQA 1OKYA 4FIFA 5FWKK 2X2LA 5CEKA 4F9AA 3UIBA 1Q24A 2WQOA 3Q3BA 5HCYA 3AQVA 4KSPA 5L2IA 4DFLA 5K9IA 2XH5A 3UVPA 4R3PA 5AR8A 3D9VA 4A9SA 4DFBA 1GZNA 2UVXA 5DPVA 5I3RA 3UOKA 3I5NA 4FGRA 2GNHA 5CXZA 3H9FA 3EH9A 4MK0A 3BLHA 2QHMA 4BDCA 2YAAA 3DKGA 1UKIA 4BL1A 4IX4A 2YWPA 1UA2A 1YI4A 4BDIA 4FTNA 4GT4A 4BI2A 3LLAA 3MH0A 4CCUA 3AGMA 4YSMA 4GUBA 3EOCA 4DN5A 2YIXA 1H00A 3E7OA 4NFMA 2QOFA 4EQUA 4IX5A 3FWQA 4ZMFA 1FMKA 3EQIA 4YTCA 5HICA 4FTOA 4QOXA 4BN1A 4BCJA 4IANA 4C4FA 4W4XA 3ZU7A 3ALOA 4DFXE 5AUXA 3NEWA 4AX8A 4A9TA 2XK3A 2P3GX 2WOTA 4IAZA 3CQUA 3PP1A 4MD8E 3DKFA 4YNOA 5EKOA 4ZTNA 3QWJA 2RG6A 4J97A 3FZSA 4U43A 5M55A 5C4LA 2V22A 4AE6A 2QD9A 4HGEA 4WSQA 4RX8A 5EM6A 4BTJA 3PIXA 4ZSAA 3QUDA 2HENA 3PVWA 1OKZA 3LXNA 1WBPA 2OJFE 5A4CA 2R3JA 4OBQA 3OC1A 4Y83A 4J95A 5E92A 3R6XA 2W1GA 3HRFA 4MD7E 4R7BA 1U59A 2ZV7A 3D5WA 1VZOA 3EQPA 3MVHA 2JDVA 3DGKA 4DLIA 5BVFA 2QR8A 3QGYA 5C26A 4OT6A 2B7AA 1GZ8A 5GZ9A 4AZTA 3LVPA 4G5PA 4CGAA 3VF9A 2B9JA 3CC6A 4CQGA 2WEVA 2BCJA 3E7VA 5G6VA 4D9UA 2EWAA 3QKMA 5HE3A 4WG4A 2OJJA 4RIWA 5A4LA 2R3KA 2PVJA 2WKMA 2X8IA 4UBAA 2IJMA 4I94A 5JN2A 3EL8A 3RBWA 2WAJA 4RC4A 4PY1A 1PXPA 2ZM1A 3DK6A 3Q5ZA 5AJQA 4C4JA 2QOBA 4H39A 4USFA 1PRYA 4MQ1A 5AAEA 1YXUA 2GS2A 3LFCA 4O1PA 2VWXA 3A2CA 4XP0A 2V62A 4ZOGA 4DGGA 4HCVA 2ZB0A 4WT6A 1PKGA 4FOCA 4XJ0A 4G3FA 3ZZWA 4C3FA 3GCPA 1WMKA 2C5OA 2Z7RA 3UDBA 4DEBA 4FTTA 3BELA 3NUSA 2IW9A 5L4QA 3RPYA 2ITUA 3R63A 3QZFA 4ACCA 3KXGA 3W16A 3UOLA 4JBPA 4IAKA 3FLWA 4YBJA 4Y72A 4AQCA 3R71A 4O81A 5HOAA 3QYZA 1L8TA 2XNBA 3BWJA 2O63A 2OGVA 4IIRA 3SXSA 4O7TA 4O84A 3O2MA 5HEZA 3GQLA 4C4IA 4PDOA 5CASA 4PTGA 4S34A 3OF0A 3UGCA 2CLXA 2VWIA 4S31A 3V5PA 3WF9A 5IDPA 5FDXA 4AOTA 5IH4A 3VW6A 1OGUA 3F5GA 3OP5A 4F1OA 3A62A 3BGQA 3IK3A 4TL0A 3HV7A 2YAKA 4F63A 1PW2A 3DFAA 3W8LA 4WBOA 2VN9A 3TWJA 2IPXA 5CVHA 3VRYA 3HLLA 4GKHA 4KS8A 3O8UA 4XRJA 2PHKA 3LFDA 4USDA 1J7UA 3LXKA 4ZTLA 4O0SA 1YWVA 5BVKA 2VO0A 3TNQB 1YDTE 3MFUA 3QQGA 1JSTA 5HG8A 4JQEA 3PJ2A 3PLAE 2R2PA 5AMNA 3DNEA 5E8WA 3QAME 3EN5A 4BHZA 4PP9A 4ZSEA 4LL0A 4HYUA 1OL7A 2WMUA 3DK3A 4IFGA 4KKGA 5EDQA 3R2BA 3RCJA 3U87A 1B39A 1KWPA 2CMWA 2HXLA 4U7ZA 5KMIA 3OCBA 3R30A 4EK6A 5A46A 4MEDA 4F6UA 5ICPA 4AW0A 3CTQA 1MRUA 4ZTHA 2PUPA 3NWWA 5H8GA 3AT4A 2E9PA 3DBFA 4FIJA 1RJBA 3C4WA 2A19B 5CWZA 1OIRA 4KD1A 4EEVA 3Q4CA 3E62A 3AD5A 3KL8A 3QX4A 4FL3A 3DLZA 3VBYA 3VS6A 2OF4A 4BZNA 4JQ8A 3V5QA 4CNHA 4Z16A 3U6HA 4EHGA 4O96A 3V8WA 1IA8A 2KULA 2UW7A 3ZC5A 2HWOA 1LEZA 4X3FB 4YURA 2A1AB 3V5JA 2X7GA 4IX3A 3ZO3A 3HP5A 3C4FA 4NIFA 1Q8TA 3MJ1A 3O7LB 4IADA 2OFUA 5TO8A 1ZYSA 5CSWA 4CD0A 4IMYA 1TQIA 5H3QA 1M17A 4AN3A 2VTOA 4M69A 5J9LA 4PNIA 3V6SA 5CEOA 2F7EE 3FLQA 4KINA 3RAWA 2C1AA 3COHA 3D2IA 4WKQA 5H2UA 2CNQA 3ORZA 1BUHA 1HOWA 1QPEA 2VWZA 3NR9A 3ZBXA 4EOSA 2BUJA 2GHMA 2AUHA 4L3LA 3FEGA 1OZ1A 1BKXA 2R64A 4FSUA 3R7EA 3JUHA 4EBVA 3A99A 2HZIA 2C30A 3NX8A 4I41A 4ZSGA 4BICA 4EK8A 3OUKA 5DG5A 5EW3A 4EZ7A 5C9CA 2O5KA 4ACMA 3PYYA 3P4KA 5LMAA 4OUCA 2W5BA 4RIXA 3RI1A 3TZ9A 3CCNA 3D7ZA 2CJMA 2W5HA 4IFCA 4K11A 5JZNA 4ZS4A 4RWJA 3B2TA 4ARKA 4FF8A 4EJ7A 4Z7GA 4FV5A 2QOHA 2YM5A 5AUZA 2XIYA 1WVYA 3PIYA 2UZTA 2CGVA 5HG7A 5C27A 3BYMA 4Y95A 2XVDA 3UNJA 3QHWA 2BHEA 1B38A 2ITXA 1OI9A 2C3KA 3O50A 4PTCA 4CXAA 4G3CA 4MBJA 3M1SA 1IG1A 2I0HA 4QRCA 5E8XA 5TR6A 4IH8A 3G0FA 3UPZA 2VWBA 1YHWA 5CZIA 4W9WA 4IWPA 3RK5A 4TN6A 4FA2A 3H9OA 4YZBA 5E8SA 4D55A 2X9EA 4MHAA 3VN9A 4DE4A 5CSVA 4M3QA 3NCZA 4H58A 3FI4A 2C6LA 2ZAZA 5TT7A 4IZ5A 2GHLA 2GFSA 3DK7A 1FINA 4O1OA 3EFWA 3KQ7A 3P1AA 3FMNA 2J0JA 3UIXA 4F1MA 1BL6A 2BPMA 3HDMA 4S33A 3PVBA 3F2NA 4NKAA 4ZJIA 4IB5A 5IISA 3UYSA 2OIBA 3RZFA 4HW7A 3PRIA 4ZJJA 3RNYA 2Y7JA 2IZTA 4JNWA 1UU3A 3TZ8A 2QO7A 4X2FA 4AW5A 4C59A 2ZM4A 4JAJA 4FR4A 4KIPA 4NEUA 5CF6A 5FEQA 3Q5IA 1HCKA 3UQGA 5AP0A 5E4HA 1W0XC 5AUUA 3QQHA 2XB7A 2YIQA 5CEIA 2I0VA 4BDHA 2YEXA 3DXNA 2X7FA 1PF8A 2X0GA 4WG5A 3QRJA 4L44A 3ZFYA 4BCQA 3DDPA 5HE1A 1JSVA 2R7BA 2WZJA 1FQ1B 4FBXA 4YJQA 2IW6A 3QRKA 1KV2A 2OXYA 2REIA 3ORLA 4QMYA 1TVOA 4V0GB 3RM7A 3ZEPA 4K18A 1Y8YA 3OD6X 5CF8A 1Z57A 4BCPA 3BGPA 3Q53A 2YJRA 5AAGA 1NW1A 2CPKE 3BGZA 5TF9A 1ZLTA 3OFMA 3V8TA 3KRRA 4H1JA 2LGCA 3PA3A 4FSYA 4QQ5A 3OY3A 3CSVA 3D7TB 3DXQA 2XF0A 5CF4A 4XYFA 5L2QA 5JGDA 1ZYJA 1LUFA 3UP7A 4FNXA 1NVSA 2G1TA 3BWFA 4AOJA 2FA2A 4RJ8A 3MPAA 3E8EA 1W84A 4RVMA 4BKZA 3HKOA 3D4QA 2OICA 2J51A 1KUTA 1V1KA 1UKHA 3BQRA 5DA3A 5DNRA 3R9DA 4F0GA 2OF2A 3D94A 3QTSA 2W4OA 5HTCA 5BPYA 3M2WA 3FLNC 4GU6A 1WAKA 4ZTRA 1OM1A 4FNZA 4EBWA 3UNKA 3UC3A 4ZIMA 3QD2B 4M66A 5BYLA 1Q4LA 4Y46A 4LG4A 4IM2A 4KAOA 4V01A 4EC9A 5HKMA 4L9IA 3MIYA 5ETCA 3AT3A 1P14A 4YHFA 4KRCA 5FM3A 4R6VA 5AV2A 5BNJA 4R3CA 2Z7SA 1KE7A 4AW1A 5FD2A 4Q2AA 3GFEA 3HV5A 3VS3A 4DH1A 5LVPA 4F08A 5GJDA 1GOLA 4EHZA 4JG7A 2GMXA 3BLRA 4XLIA 4EOIA 4QMSA 5EM8A 4FEUA 1OIYA 4ACGA 3FI8A 1PXOA 3ZSIA 4FC0A 2QG5A 4OAVB 4MXOA 4OTFA 4UYNA 1OB3A 3LIJA 3DBQA 3LJ2A 3QZHA 5AP7A 3GCVA 2BZKB 3RPVA 4RZWA 4D9TA 2ETRA 4KRDA 2W7XA 4JBQA 4JBOA 3EZRA 1KV1A 3HGKA 5KKRB 4D28A 4P2KA 2RF9A 4ASDA 3WI6A 4EH6A 4EWHA 4CMTA 2ITQA 4D2PA 3ELJA 1H27A 3NNUA 3P9JA 4OGRA 1ZZLA 3CLYA 4H3BA 3VS2A 5CEMA 4EYJA 2VGPA 2JFMA 2X6DA 5DYJA 2HZNA 3D5VA 3F5UA 2H34A 4R1YA 4ZSJA 2OZAB 3FLYA 3NAYA 3WF8A 2QLUA 5EOBA 5AUYA 5IQEA 2ZDUA 3IO7A 1DM2A 5DFPA 3RGFA 4AGWA 2JAVA 3LFBA 4DF3A 4TWNA 3EQHA 4XS2A 3U51A 5HI2A 2YWVA 4CG9A 3TJDA 4A7CA 2WMXA 4QTBA 4R5YA 3CQEA 3NRMA 4HPUE 4JQ7A 4X2NA 4ZMEA 3DQWA 4XV1A 3N4VA 3HL7A 4ZZMA 4C4EA 3LQ5A 4CSVA 4UWYA 4QMVA 3LM0A 2WGJA 5JFVA 4U79A 3R8PA 1F0QA 5JKGA 4AT4A 3E8DA 4DH3A 4BCFA 1LP4A 4IAYA 4KIKB 5L8KA 1Q8YA 5JGBA 3FSKA 4EI4A 2ZVAA 1ZOHA 5CZHA 5E1SA 2X39A 3TI1A 4RX9A 3QRUA 4XV3A 3FHRA 3QX2A 4V04A 3VS0A 3UVQA 3UZPA 1YWRA 2YLEA 5CU4A 2J0IA 4B4LA 3A7GA 2IZSA 3CBLA 4ZLYA 4FTLA 5J1WA 1XH9A 3I60A 5LCKA 5EHOA 5EQYA 3ZFXA 4NSTA 4HCUA 5FTGA 5IZFA 2IVUA 4AF3A 3BKBA 5L2SA 3UZTA 3FV8A 4G34A 3R9HA 4IWDA 2ITNA 2GNFA 2OWBA 3MWUA 4XLVA 2PE2A 2X4FA 4G16A 4RIWB 4BDJA 2XK9A 3AC3A 5DVRA 4DFYA 3JR1A 3OTVA 1KE8A 4FTCA 1H1WA 4JVGA 2IVVA 4XP3A 2HIWA 2FGIA 4DHFA 4I5MA 1WBVA 2C3IB 4JX3A 4MF1A 1XR1A 5AP5A 5H8BA 3WZJA 3V5LA 2J5FA 1U54A 3DKCA 3LM5A 4JDJA 3KRWA 1H08A 3FZOA 5ANGA 5EHLA 4CFWA 3WF7A 4AN2A 3FMHA 4JJRA 2H8HA 3ZLYA 2ZV8A 1JKTA 5FM2A 4S32A 4FUYA 4I5PA 3G33A 3H30A 5JK3A 5HO6A 3VJOA 4BBFA 3IW5A 3Q9YA 3DAJA 1M2QA 3KGAA 2QI8A 4QP2A 3V8SA 3DJ7A 4S2ZA 3W2SA 2E9VA 3E8NA 2WELA 3HMIA 4TYJA 2I7QA 2A27A 3NYVA 4J52A 4ZJVA 3P78A 4GVJA 4KIOA 3U6JA 3CD3A 4DITA 1PY5A 1ZYDA 3BHUA 4NKSA 3Q32A 2WMWA 4ZTSA 5FGKA 3MS9A 4CEGA 3JY0A 3FI3A 4OTQA 4C8BA 4E6AA 2I1MA 5HX6A 4IQ6A 1Y8GA 1GIJA 4RJ3A 4ANMA 4TYIA 2VGOA 1DI9A 3R1QA 4BRXA 1JLUE 3UNZA 4F09A 4NL0A 1CTPE 4K2RA 5I9VA 4X3FA 3OMVA 3KRJA 2ZYBA 4D2WA 2JBPA 2VWUA 2WMQA 3PDTA 3R1SA 3OWJA 5A3XA 2B9HA 3LJ0A 1FGIA 4UEUA 2CGUA 3DBCA 3LHJA 3LMIA 4N4SA 1NVRA 2J0LA 2UUEA 4O7RA 2QVSE 2ERKA 5ANEA 2IG7A 4BTKA 3ZSHA 3Q9ZA 2C69A 4E6DA 3PJ1A 1R0EA 1S9IA 2XJ0A 2E9OA 3C9WA 4JG8A 3U4UA 1G8AA 3FMJA 2IVSA 4FVRA 1A9UA 5CS6A 4FMQA 1QPCA 3FMKA 3VHEA 5CSXA 3GC8A 2P4IA 2X8EA 4ZY6A 3BU5A 3OW3A 2VTIA 3P23A 3T8OA 2DYLA 2YCQA 4YP8A 3C4ZA 4EH8A 4RGJA 5HBEA 3R83A 4O82A 5E91A 4JLCA 4OR5A 4WNKA 5CYIA 4AT3A 5DBXA 1PXLA 3NDMA 5GNKA 3ZUUA 3WYXA 3CQWA 3Q60A 1QPDA 5EH0A 3CE3A 2R0IA 5IUHA 4GT3A 4JR3A 3R7VA 3ZRMA 5L6PA 2GCDA 3QA8A 3QXOA 4C34A 2BALA 5M53A 3QTWA 1XH8A 4QPAA 3KRXA 1H4LA 3K5UA 4UMTA 3WBLA 1XH6A 3QTXA 2R3IA 3HMNA 5CT7A 1R1WA 3BU3A 4M69B 4WUNA 2JLDA 4M7IA 2F9GA 5CSHA 3FYJX 3DAEA 5KHWA 3Q4UA 3BCEA 5KZ0A 4DEHA 3ZRLA 4MYGA 4APCA 5HCXA 4ITHA 2ITPA 4FKJA 3W55A 4RVTA 1DAYA 5HNBA 4EZ5A 1H1SA 4PMSA 4ACDA 4F9WA 3JPVA 4MD9E 4C3RA 4O7LA 4HYSA 1LEWA 2BRMA 3ET7A 4YZDA 4MCVA 2OSCA 1R78A 3VBXA 4LUEA 1TQMA 3KXZA 4AFJA 1WBTA 5HG5A 4GJ2A 1BL7A 5E90A 4TYHB 1KSWA 4QMMA 3RAKA 5AUWA 2ETMA 4C02A 4RFZA 1YVJA 2J90A 3HZTA 4J53A 1XO2B 4R7HA 4BCMA 2FSOX 3G2FA 3QALE 4L45A 4RFYA 4CMUA 4EH4A 5CAUA 3VUHA 4EH9A 2X6EA 5IDNA 1RQQA 1MQBA 3SDJA 3U8WA 2CKQA 3RK7A 4JDHA 2YIYA 2PTKA 5J7HA 2G01A 5FEEA 4JDKA 4IEBA 3VQUA 3PPJA 4ASXA 3F5XA 3QUPA 4L68A 3PXYA 2GTNA 4IBMA 4CFUA 4DT8A 5LVOA 3OROA 2QODA 4V0GA 3OWLA 1OL6A 1U5RA 4C7TA 5T3QA 3HRBA 3MH2A 3QQJA 4IWQA 2QO9A 3R22A 2BVAA 4G2FA 4FTRA 1P5EA 3MI9A 2VX0A 4EK3A 2QOQA 2JITA 2UZNA 1OUKA 1MRYA 4F7JA 2W4JA 3KA0A 1O6KA 2F2CB 4R1VA 3SXFA 4IZ7A 3SAYA 2ITYA 3HMPA 1GZKA 3LXPA 4GL9A 3KF4A 2VTAA 3TKHA 3L8SA 3JXWA 2NO3A 2XIRA 1PYXA 4AA5A 2UZOA 1AQ1A 3O8TA 3LMGA 3QQLA 2BIYA 3BE2A 3RPOA 2JIUA 4Q5EA 1YW2A 2JKMA 5LMBA 4QTAA 1APME 1SVGA 4Q5HA 3A7HA 3GCSA 4M13A 1WZYA 4AU8A 3SHEA 2WTCA 4C4HA 2BKKA 4AOIA 4E4LA 5B2LA 5ETIA 5AV0A 5EQPA 2OH0E 3GI3A 4E5WA 3PJ8A 1CKJA 4HGTA 4QP4A 3VUGA 4Y5QA 4ALUA 2XJ2A 1O6LA 3KC3A 3E3PA 1SZMA 3OS3A 3Q4TA 2UZBA 4L00A 4MVFA 4YLJA 2CCIA 2ZJWA 4UWBA 4YJVA 3QWKA 3BX5A 2XEYA 2OU7A 4YJPA 4D4YA 4FX3A 5KO1A 4O0RA 1ZYCA 3DJ6A 4RWLA 4AT5A 4PTEA 2X9FA 2EXMA 4QYHA 3R8VA 5DR6A 5J9ZA 4Z3VA 4QTDA 3UIUA 4I6QA 1H8FA 5L6WL 2OG8A 3A7FA 3S3IA 5LXMA 1CSNA 5IH5A 5IQBA 3KXNA 2R3OA 3OWKA 2UZDA 5IMXA 4J98A 3C13A 4BDAA 3IECA 4OTGA 1Y91A 4O2ZA 4QPMA 1FVTA 2X7OA 1PMVA 4AGUA 5CTPA 4CZYB 1W83A 4A07A 3IDBA 2WMSA 4ZSLA 2ZOQA 5KBQA 3GU4A 4PWNA 4AACA 4UZHA 2ESMA 4MF0A 5JH6A 4LOPA 5LVLA 2OZAA 2R3FA 1VYWA 2BRBA 1IA9A 4IXPA 4F6WA 5C8NA 2XK8A 3OWPA 4GKIA 2PZIA 3R2YA 3SOCA 4FTKA 5DT4A 4YSJA 2IWIA 3LMHA 4LMUA 4LV8A 4DBNA 2WEIA 4ASZA 4FZ6A 4I3ZA 3VBVA 4CVAA 4YBKA 1WBWA 3QTUA 4U5JA 2UW5A 3GOPA 5A9UA 5CU3A 4ERWA 3V04A 3VBWA 2OXXA 5HLPA 2HZ4A 4O91A 3QBNA 3MYGA 3W2PA 4FT7A 4NCTA 3QD3A 3W33A 3UOHA 3MY0A 2PK9A 2XYNA 3DU8A 3HUCA 4O0XA 4KIKA 4YJTA 2PVNA 4XP2A 3SV0A 4OTWA 4ZLOA 4FSQA 2O65A 2WO6A 5IQIA 4Q9ZA 3CY2A 3P7CA 2H9VA 4MKCA 2CSNA 2QC6A 3FYKX 3P7AA 4CMOA 3GFWA 4CKIA 1DS5A 3IW4A 3MTFA 5C03A 4FL1A 3M42A 4QP7A 3RHKA 3WILA 2R3HA 4D1SA 5C8KA 3PG1A 3UO5A 4EQMA 3WF5A 4F9BA 2WTVA 3GU7A 1FPUA 4H3QA 3ZYAA 3NLBA 4BR3A 4XBUA 4ALWA 2YHVA 2WNTA 3PJ3A 4J7BA 3A7JA 5CALA 4RQKA 5J5SA 4R7IA 2OIQA 3ZFMA 4IM3A 5DE2A 1YXSA 3BLQA 3KEXA 2Y4IB 5E1EA 4D5HA 2VTTA 2OIDA 5M08A 3AGLA 4RLLA 4E20A 5FXQA 4IVCA 5IA0A 3LLTA 3V6RA 4S30A 4YC8A 4E6CA 3FC1X 4AA4A 4F0FA 3DNDA 3UMXA 3ORTA 1REKA 4L43A 2BTSA 2I0EA 4IB1A 2YERA 4D2TA 2GTMA 3UP2A 1X8BA 3QA0A 1IEPA 4C35A 5B2KA 4EOKA 1OECA 1UWJA 1WFCA 3NPCA 2OW3A 4RG0A 5FLFA 3K5VA 4BDKA 3S1HA 4K8AA 5JMSA 4XOYA 1PXNA 3A8XA 3D15A 3FXXA 2Q0BA 4KBKA 4W9XA 2CNUA 4WNOA 4ZAUA 4L46A 5IEVA 2WIHA 3ORMA 3PXRA 4TWCA 4DBXA 2XNNA 4NW5A 1GJOA 5KNJA 1PXJA 2XMYA 2ITZA 3NW6A 3QLGA 5DR9A 1URWA 3BHTA 3RVGA 4CLIA 3I81A 2V5QA 3R7GA 1URCA 4FTMA 4FV7A 5IA2A 3BHYA 2WOUA 1XJDA 2BDJA 4FZDB 5CNOA 3Q9WA 3V5WA 5HNIX 5DHJA 3FQSA 4YU2A 4DEAA 4RFMA 4DC2A 4NZWB 5HIDA 4FEXA 2OBJA 4DFUA 5AR7A 2WU6A 1WBSA 4IAAA 4JT3A 5I9YA 4O0TA 3K3IA 2G2FA 5HO7A 2R3RA 4M67A 5M51A 5M56A 3BBTB 3M11A 3QCSA 1FOTA 4PQNA 5CXHA 3A61A 5GINE 3P08A 1Q8WA 3ZC6A 5CU6A 3LE6A 4HZSA 4AE9A 3CY3A 4BB4A 1Q61A 1U54B 5JQ5A 2Y9QA 5JGAA 4GG7A 3KCKA 3WIKA 4EC8A 3EN6A 2VTNA 5T6KA 3RINA 3VUTA 1H07A 3ZM4A 4YJOA 3CR0A 5LJJA 1XKKA 2GHGA 1XH4A 4GS6A 2C0OA 4PPBA 4YHJA 2FYSA 4O6EA 3FXZA 3TKUA 4C2WA 4C58A 2Y6OA 5FDPA 1ZY4A 3QTRA 2WTKB 4FYNA 2JDTA 2YACA 5GZAA 4DTBA 4MAOA 3IDPA 1GIHA 1NXKA 4QMZA 4FNWA 2F4JA 4LFIA 4TWOA 5EYCA 3TL8A 4BZOA 1OMWA 5AA8A 4RZVA 3NUNA 4FYOA 5J95A 4FSZA 4RPVA 2YCFA 4EKLA 2ERZE 5FUTA 4BTFA 1CKPA 4FV6A 4WUAA 3T9IA 3N9XA 1YRPA 3WZEA 2GS6A 2UW3A 3FPMA 4F65A 3IDCA 4RC3A 5JRSA 3QGWA 5M4CA 3KMWA 4C0TA 4XEYA 3P79A 3Q2MA 3PZHA 4L52A 4LRJA 4TTHB 3TDWA 1JSUA 4FK6A 4QO9A 2PPQA 3OG7A 4NJDA 4BWKA 3HX4A 5HORA 3BYVA 1M14A 4FSWA 1UWHA 4U42A 2VX1A 4II5A 4DTKA 4B8LA 3RJCA 4ANLA 4UYAA 1Q3DA 2VZ6A 4FV4A 4HCTA 3Q96A 3FL5A 1H1PA 3WE4A 3DBEA 4YUQA 2GU8A 4O0UA 1OBGA 4OBPA 5AP3A 5HZNA 4MQ2A 2ONLA 2ITWA 3PJCA 3QZIA 3DLSA 4IC8A 4CFVA 4DGLC 4G5JA 3QRTA 1U5QA 4GFOA 4DH7A 2YN8A 5KKRC 4C33A 1M52A 1DAWA 3TTJA 3OXIA 2IZRA 4K1BA 4MNFA 4ZK5A 4L53A 2GS7A 3W1FA 4LUDA 3H4JA 5F1ZA 2G2HA 3G90X 3UG2A 3FUPA 3PLSA 4MH7A 3W2QA 5C4KA 4GT5A 2BHHA 3E87A 4GYGA 5M4FA 3BZ3A 4MBIA 3QCQA 4C57A 3U55A 2VNYA 4BDGA 1K9AA 3DB6A 4EOMA 3MBLA 5IQGA 4PF4A 5E8UA 5BVNA 4G3GA 5IG1A 4U6RA 4QQTA 3VVHA 4UXLA 4YMJA 4DLJA 5LVMA 4RJ5A 4DAWA 1J7IA 5IQDA 5GIPE 3HA6A 2PUNA 3MDYA 3NIEA 4GRBA 2Q0NA 2HW7A 2VNWA 1BYGA 3WYYA 3OT3A 5TKDA 1K2PA 4EH5A 4M0ZA 4HNIA 1SNUA 4RC2A 5K0XA 4CT1A 2XNPA 2OJGA 4F1TA 4EH3A 4NCTC 3NUXA 3NAXA 2I40A 2NNWB 1PMEA 3E64A 1SM2A 2C6OA 4M0YA 4IX6A 1R39A 3TDVA 2DQ7X 5DIAA 2UZLA 1H1RA 3LZBA 5AUVA 3TN8A 2PYWA 4LRKA 1OIQA 3EFLA 4BDFA 5LWMA 3NSZA 3RK9A 3PP0A 4UALA 4J99A 4Z9LA 4R78A 1M2RA 4U0IA 5CU0A 2BRHA 4FTAA 4FVQA 5HHWA 2UZWE 3PXQA 3MIAA 4U44A 4UWCA 2XCHA 4E7WA 4C3PA 4PPCA 4LRMA 3ZEWA 4FIHA 3TIZA 2R3NA 4QNAA 1CM8A 2VTQA 4RVKA 2GFCA 3EYGA 1F3MC 2F7ZE 5BVWA 1PKDA 3Q6UA 3COMA 3FL4A 5E8ZA 4O6LA 5BVOA 2QOCA 3MB6A 3VF8A 5HTBA 3ORKA 2VO7A 4IVBA 4I1ZA 1SNXA 4I4EA 4BI0A 4JL9A 1RDQE 3KCFA 3SW4A 3P7BA 4A9YA 4EONA 4F7SA 4DYMA 3F5PA 4JIKA 4A06A 3N4TA 3R9RA 2C6MA 4OTHA 3JS2A 4ANQA 4E26A 2XM9A 4D4SA 5AP2A 2UZEA 5KMOA 5JFXA 4PP7A 3AMAA 3F66A 5DEWA 4EOJA 5CAPA 2X1NA 1OL5A 5H8EA 3FZRA 4YO6A 4FKVA 3R02A 2VAGA 4BKJA 2XM8A 5KX8A 2IN6A 2XIZA 3G0EA 3HP2A 4RT7A 2QU6A 4BGGA 4E73A 4BFMA 3DOGA 1I44A 3FJQE 4FI1A 4EH7A 3E8CA 3MVMA 1YXXA 5CVGA 3HUBA 3OCSA 4I5CA 4HVDA 2OJ9A 4KIQA 2JD5A 2YITA 1JAMA 3A7IA 3KKVA 4HPTE 4CZUA 4F99A 4G6OA 4UX9A 3ERKA 3WZUA 5KCVA 5C1QB 3ZLXA 3OTUA 2JGZA 4C2VA 4I22A 3DB8A 3VS5A 3SOAA 4F0IA 5F20A 3BIZA 3FQEA 1JBPE 3BEAA 3QKKA 4HVIA 3EHAA 3BRBA 4LQMA 4XG7A 3C5UA 3ZXZA 3GVUA 3UQCA 4O7SA 5ANIA 3WZKA 4E5AX 4XV9A 1H28A 5AWMA 3K3JA 3FLZA 1PYEA 3CJGA 3TJCA 1H26A 4H3PA 3QF9A 1ZXEA 3KXXA 4YC6A 4ZXTA 4GK3A 2UW8A 4N6ZA 2UW6A 5M44A 1JWHA 4FEQA 1XBAA 4K0YA 4P4CA 3DBDA 3SVVA 1OBDA 2F57A 2VTSA 2C6IA 2LAVA 3ETAA 2OZOA 4FE2A 1Q8ZA 3NUUA 3AD4A 3V51A 1AGWA 3DA6A 3JVRA 3CPBA 2J9MA 3IOPA 4GK2A 4JOAA 4IACA 4NFNA 2VU3A 4KKHA 3PXKA 4RSSA 3VWAA 4EL9A 4LOQA 1J1BA 4WIHA 4IJ9A 4C37A 4QP1A 3LW0A 3VUMA 3Q2JA 2GQGA 3R7IA 1A06A 2HZ0A 4G3EA 3F7WA 5AR2A 2CLQA 2HY81 4DG3E 2VX3A 3IGGA 4O38A 4B99A 5LWNA 2F49A 3NW7A 2XCKA 2O0UA 5LMKA 3MFTA 5BMSA 3UIMA 4X21A 1V0BA 5AV3A 5EOLA 3R9NA 3U4WA 3U9CA 2FO0A 4IZAA 2YDKA 5CQUA 4MNEB 1EH4A 3DZOA 4MXCA 4AUAA 3QQUA 2PMIA 4GCJA 4U40A 4PMPA 3R7OA 4GK4A 5CAOA 4K77A 2YABA 4O2PA 3LFFA 1UU9A 4BC6A 2GQSA 5HESA 4H05A 3FMLA 2C6EA 3OCTA 4XV2A 2QNJA 3F9NA 3P0MA 4XG6A 3SRVA 5G1XA 3ANQA 4BBEA 5HIEA 5KMKA 3S00A 2O64A 4J96A 3TV4A 4UMQA 4O0YA 5L6OA 5E7RA 3FSFA 3IW6A 2VV9A 3BQCA 3TIYA 4DH5A 2XKCA 5KMLA 3OBGA 3CD8A 4P7EA 1PMUA 2IZUA 3WOWA 2UZVA 5J8IA 4QP6A 4P90A 4NT4A 2J2IB 4NU1A 3A60A 3TUBA 3VHKA 2ZMCA 2C5YA 2Z8CA 1JKLA 2WTDA 3QD4A 4EJNA 4X6RA 3AG9A 5KHXA 4OAUC 4NTSA 3RTPA 5T68A 4WSYA 3UYTA 4PL5A 4CRLA 2VWWA 3DDQA 3R8ZA 4B7TA 4I20A 4FEVA 3R8MA 3OOMA 2PE0A 4WHZA 1YOLA 2BRGA 4FG9A 4PMMA 3QXPA 2WQEA 3UMWA 4QTEA 3EL7A 3O17A 3QCXA 2C6TA 4BDDA 3QFVA 2YM8A 2H96A 4YHTA 4DINA 3G6HA 3LCDA 3HEGA 3I79A 4G17A 4NM3A 5CF5A 2YISA 1LPUA 3E3BX 3EQBA 3NGAA 3OEZA 4R8QA 2NP8A 5JFSA 4FL2A 4CLJA 3UODA 2XNGA 3TKIA 4X2KA 3UC4A 4IC7A 4GSBA 3VNTA 4OW8A 2B52A 4ID7A 3NVMB 2W05A 2XBAA 2YZAA 5JEBA 3SD0A 4W4WA 5M07A 3EB0A 3FKNA 2YZLA 3NW5A 2QONA 3II5A 1BLXA 4D2SA 1E1XA 5DI1A 4F70A 4FIGA 2HAKA 3MV5A 3UO4A 4L42A 5AM6A 5EHYA 5K3YA 2IW8A 5HX8A 2PMOX 5EKNA 2YIRA 5EM7A 5GJFA 3DTWA 3ZBFA 1Q8UA 3KMUA 1XH5A 2BZIB 4XUFA 1VR2A 3UO6A 3AD6A 4BI1A 3TG1A 4ZY5A 4DCAA 3NNWA 2B1PA 2XS0A 4GIHA 1H01A 2J5EA 4CG8A 5I9ZA 3EQFA 2ITVA 3FQHA 5D10A 4BCGA 5JSMA 2QQ7A 2YCSA 2C1BA 3GNIB 3ACKA 2ITOA 4ZTMA 2W1FA 3RHXA 4IB3A 3PA4A 3FKLA 1IR3A 4AP7A 3UVRA 4DGNA 3BU6A 2Z60A 4FVPA 4PL3A 2X4ZA 2QKWB 4ENXA 2R0UA 1U4DA 1XHAA 2BDWA 4FKRA 5IH6A 2BAKA 5ANDA 4N70A 3GENA 1U46A 4FT3A 3ZO4A 3KRLA 1XQZA 3ZRKA 2YIWA 3CKXA 4APPA 3DAKA 3HV3A 1W98A 2CKEA 2W4KA 1FVRA 1QMZA 4U3YA 4WRSA 4Y85A 2PVKA 3ORNA 1WBNA 5BUEA 4E4MA 4I21A 3HA8A 3W10A 4DGMA 4C4GA 4QMPA 3LQ8A 1FVVA 1XBCA 2PY3A 4JBVA 4MXYA 3FY2A 3FZ1A 1YKRA 4LMNA 3RAHA 4FKTA 5DN3A 3VAPA 3UQFA 4KKEA 2C47A 1ZOGA 4C61A 4E5BA 3IONA 5BMMA 3R21A 2CKPA 3SGCA 2GNIA 5DRDA 4L6QA 3MFSA 4R5SA 5J1VA 2PWLA 3U54A 1ATPE 2CGWA 3K54A 3CIKA 1BI7A 1OUYA 4FTUA 5FRIA 1YXTA 4YO4A 2XEZA 5F4NA 4U9AA 2X81A 4ASEA 3F7ZA 4KB8A 4D1XA 3ORXA 2RFDA 2PUUA 4J1RA 4BVUA 4UB7A 2JKOA 2JBOA 5GZ8A 1ZZ2A 3C0IA 3HV6A 3EYHA 4RIOA 5CLPA 3BV2A 3SX9A 2VD5A 5AM7A 4E8AA 2Y0AA 4UMPA 2PULA 1W8CA 1WVXA 3L8VA 1OIUA 4ZTQA 3TNPC 4PMTA 3MGYA 4HGSA 5HCZA 1E9HA 2RFEA 5IPJA 2VTPA 4UV0A 3FDNA 5KUPA 1ZMWA 4YTFA 1J1CA 3A8WA 3R7UA 5I9XA 2QR7A 3OXTA 3MTLA 2HK5A 4XHKB 3HAVA 3L9LA 1MQ4A 3L9NA 1J7LA 2UW9A 2VTHA 3KY2A 3D14A 3DQXA 5DMZA 3ZCLA 4DA5A 4FTJA 4W8DA 4AW2A 3FZPA 5AEPA 5IQFA 4IAFA 3U6IA 4FZ7A 3UOJA 3MPTA 4FV1A 4BDBA 3TUDA 2G2IA 4TPTA 3RPRA 1ERKA 2B9FA 5DR2A 1UVRA 2J50A 4PNKA 5K5XA 4UMRA 2W1IA 4H1MA 2XRUA 3VUDA 5BYYA 3UPXA 3Q6WA 1UNGA 4PV0A 4X2GA 2XRWA 3MA3A 4P5ZA 5FXRA 4NWMA 5IQHA 4HYIA 3FPQA 4M68A 2W1DA 4L3JA 1LR4A 3S4QA 4TNBA 2W9ZB 2P0CA 3NYXA 2BILB 5EDPA 4BYIA 3OXZA 3GU8A 2Y4IC 2PUIA 3GU5A 2UVZA 3DCVA 2ZV9A 2C5VA 1Q97A 3W2RA 5I5ZA 3R8UA 4I0TA 1V0PA 4DEGA 3NVKI 3RZBA 5CAVA 2J7TA 2B53A 1W7HA 5HIBA 1OL2A 4ANSA 4MX9A 3MPMA 4PPAA 2P2IA 2EB2A 2J4ZA 3GC9A 3KULB 1REJA 2JAMA 2JIIA 1GY3A 4ITJA 5D7AA 4GIIA 1M7NA 3HAMA 2VTJA 1ZY5A 2FH9A 4FT9A 4YJSA 5D1JA 2XP2A 3C7QA 1H24A 4TKSA 1G8SA 4F7NA 3FZTA 3OT8A 5M09A 1OPKA 4F6SA 3VJNA 2WMTA 4J8MA 3MN3A 4FKPA 4GW8A 4MXXA 5A4TA 3AC8A 3ZTXA 3PY1A 4ENYA 5B2MA 5EYDA 1NY3A 3Q4ZA 4XBRA 4C62A 4BBMA 2F7XE 2XNMA 3AT2A 4F4PA 3LJ1A 2C3LA 2IO6A 2YLFA 4LV5A 2PSQA 1STCE 1RW8A 4A9UA 1Q99A 2V0DA 3DZQA 5DGZA 3A4PA 4WRGA 4K33A 3S2PA 1KOBA 5LVNA 4B6LA 4FG8A 4G6NA 3LFEA 5AV4A 2W5AA 2BIKB 4FGBA 3BHHA 4NM5A 2I6LA 4KBAA 5AX3A 2X8DA 2H6DA 1O6YA 5DRBA 5FTQA 3FY0A 2XJ1A 5IUGA 1R0PA 4QMOA 4BZDA 5IQCA 4CYJA 4FG7A 3VS7A 3IQ7A 2Q83A 4IZYA 4FIIA 2W06A 4NK9A 3KB7A 4EHEA 4ZLZA 3G6GA 3KMMA 5KE0A 1E1VA 4R3RA 4ALVA 1Q3WA 5E9EA 2PMNX 1OKVA 3MW1A 2WTKC 4RQVA 5AV1A 3FMEA 3UE4A 5DLSA 3EQDA 4FSNA 4RIYB 4WNPA 4RBLA 2VTLA 3EJ1A 4BWPA 2DWBA 1GNGA 1GZOA 3C4EA 5HE2A 2QURA 4O7ZA 1ZAOA 4NW6A 1UU8A 1XWSA 1UNHA 2RL5A 3EMGA 4AZFA 5IEYA 1KOAA 4FKLA 5I9UA 1T46A 4UN0C 4NUSA 5BX0A 2R3MA 2CHLA 2OXDA 3TCPA 3CJFA 3FHIA 5CQWA 1IASA 2WIPA 4ZEGA 3DXPA 4NJ3A 4OTRA 5HTIA 3KN5A 3NYNA 4I0RA 5ITAA 4QMNA 4IJPA 2NRUA 4X3FC 4MNEA 4EYMA 3TZ7A 3PRFA 5AAFA 2JDRA 3TTIA 4ANBA 3SG9A 5IKWA 4EKKA 1YDSE 1SMHA 3JYAA 2BZJA 3RNIA 1JNKA 3GEQA 4D2RA 2OH4A 2W1CA 2WQBA 3O51A 4FV2A 4MWIA 4YTHA 5JFWA 4IAIA 1YQJA 1SVHA 4XG4A 3FXWA 1H0VA 5HGIA 2A0CX 5HD4A 3QQKA 4RA5A 4FZFB 4CFMA 4E4NA 4EOPA 3PSDA 2RSVA 3BE9A 5FXSA 3OY1A 3HDNA 4IVAA 4LM5A 4RX5A 4I93A 3FLSA 5CU2A 4HGLA 2QOOA 1T45A 4EUUA 4FIEA 2O2UA 3L1SA 4WD5A 3TNWA 2R5TA 3GT8A 3PXFA 4RX7A 4BGHA 4G9RA 4QMQA 4DFNA 1DI8A 2ZB1A 5AIKA 4M97A 4A4OA 5BVDA 5EQEA 2XIXA 3W32A 3LOKA 5LARA 1JKKA 4OLIA 4ZY4A 4QPSA 2OLCA 2FSLX 3ANRA 4BTMA 5EI2A 1G3NA 4I6HA 3B8QA 4GG5A 4RMZA 3NUYA 4OTPA 5D9HA 2FB8A 4E4XA 2RFSA 4FKWA 2PZRA 2QU5A 2UVYA 1GAGA 2XKDA 5CENA 3VRZA 5GHVA 3SXRA 2WMVA 4AGDA 5CI7A 3PZEA 5D7VA 2BR1A 5FTOA 3F88A 3KU2A 4H36A 3KK8A 2P2HA 2PVFA 3HMMA 3SG8A 4OTIA 3SRVB 3WE8A 2PZYA 5D41A 3WIGA 3RPSA 4A4XA 3QD0A 4FSTA 3HV4A 3OVVA 5J5TA 2PE1A 5A4EA 3BBWA 3QLFA 3OUNB 4JRNA 1ZARA 4XG2A 4GFMA 2YFXA 2QOLA 3NS9A 3EN4A 3EIDA 4QTCA 3TV7A 4D0XA 4AZSA 3DV3A 3LCSA 2O3PA 2HELA 4O0WA 5AR3A 1BI8A 3FMMA 3IKAA 3ITZA 1BMKA 2UW4A 3R9OA 3QC4A 4DG2E 4QP8A 2P33A 3F2AA 4ZP5A 1B6CB 1YOMA 2XK7A 5ACBC 3TXOA 3EQGA 5CI6A 3PG3A 4CV9A 5HVYA 3S0OA 4EK4A 2WD1A 5FP6A 1FGKA 1YI6A 4PRJA 5AR4A 4FSMA 4BCKA 2JIVA 2JC6A 3MESA 4O7NA 3SW7A 3CGFA 3LQ3A 4KUJA 2R9SA 3I7BA 3RALA 4MXZA 3VC4A 3I6WA 2B9IA 3F6XA 3OOGA 2SRCA 4N6YA 2C0IA 5HVJA 3GBZA 4K6ZA 4BKYA 3LFAA 5BUIA 3LXLA 5JQ8A 5AX9A 4NYEA 5FG8A 3VQHA 3OBJA 3D0EA 4BGQA 4DT9A 5CX9A 4ANNA 2HXQA 3L9MA 3GQIA 3CPCA 1SVEA 2GNJA 2W9FB 3OCGA 5EG3A 2BFYA 5D12A 4D4RA 3O96A 4JIAA 3GU6A 3F3WA 4ZS0A 2VO3A 3ROCA 1OITA 4IE9A 1S9JA 2HY0A 4QD6A 3TEIA 4I5HA 4BIBA 1PXKA 4J71A
chains in the Genus database with same CATH superfamily
2Z7LA 4ERKA 1BX6A 2YM4A 5ANOA 4BIEA 1OPJA 3C0HA 2BDFA 2W96B 1ZWSA 3EFKA 3F3UA 3G51A 3MVJA 3DKOA 4Y73A 3LKMA 3QL8A 3ROYA 3C4CA 2VWYA 2YM7A 2Z02A 1NT2A 1V0OA 4FT0A 4DDIA 5A14A 4L67A 1VLRA 4DH8A 3V5TA 4AXDA 5I9WA 3LCOA 4N0SA 1OKWA 4XX9A 5AP6A 1XMMA 2J0KA 3TV6A 4YJRA 4U97A 3IOKA 5ETFA 5E8TA 4B0GA 3LFQA 4QP9A 5H9BA 4XG3A 4USEA 3PTGA 2X2KA 3JY9A 4FV8A 4DEIA 5E8YA 3E88A 5AP1A 4AXAA 4JAIA 3N4UA 3GXLA 4YC3A 3QTIA 4O86A 4AA0A 4ITIA 3CXWA 2W0JA 3NUPA 2PU8A 2RFNA 4RWIA 5IA3A 4I6LA 4L3PA 4X2JA 3ZDUA 4IDVA 3THBA 2GPHA 4YZ9A 4C38A 5DH3A 1F5QA 4JDIA 4HVHA 3AMYA 2JDOA 2C0TA 3QHRA 3ZLSA 4FZAB 5EFQA 2BRNA 4UY9A 2J0MB 3FI2A 3POOA 1UV5A 4RVLA 3PY3A 4G9CA 5HBJA 3RKBA 1CKIA 4AFEA 3MA6A 4O7VA 5HVKA 4EORA 3EKNA 5KMNA 4D2VA 4I24A 4MTAA 2C5XA 4X0MA 4AZWA 2VTRA 3ZOSA 4CZTA 5KMJA 2WU7A 4M12A 4DEEA 2WHBA 4F78A 2DS1A 3KXHA 2V7OA 3C50A 2IVTA 1M2PA 3R04A 5L8LA 3DFCB 1M7QA 1Y6AA 3KVWA 3NNVA 3I6UA 4L8MA 4M14A 3ZH8A 4M84A 4FKIA 3R28A 4JR7A 3RCDA 4CQEA 1MUOA 3GUBA 2B0QA 5I3OA 1HCLA 1G5SA 2EXEA 3E5AA 3HRCA 3KREA 4DTAA 3IW7A 3NYOA 4F9YA 4RA4A 4EH2A 1Y6BA 3AC2A 4E6QA 4TYHA 3LPBA 2WXVA 3KULA 3PFQA 4NTTA 4PDSA 3ZO1A 4PDPA 4Z55A 4D1ZA 1W82A 3C5IA 2YM3A 3NFFB 3ZDIA 2QHNA 3S95A 4U81A 3JVSA 4BF2A 4EOLA 4U3ZA 2JEDA 4BIDA 4O7WA 3U9NA 1O9UA 3VBQA 3CGOA 4QYGA 2RIOA 4O0VA 2I0YA 3KK9A 3HNGA 3L8XA 3LFSA 2P55A 3R7YA 3FMDA 4FKQA 4FTIA 4I6FA 4Y8DA 2QCSA 2X2MA 3MH3A 5J9YA 4BYJA 2OK1A 4O21A 4D0WA 4B8MA 2CCHA 4BDEA 3GCQA 3WARA 1Z9XA 2HOGA 4L7SA 5IEXA 3DT1A 3NCGA 3ZSGA 4JS8A 4RRVA 3ZMMA 4RJ4A 3ZZEA 2CKOA 3L9PA 2XUUA 4G6LA 3FKOA 3QQFA 4FV0A 3RAIA 3ULZA 2YCRA 2W1HA 5J87A 3NMUF 5K5NA 5HD7A 3VW8A 2ETKA 3ZUTA 3TUCA 4FK3A 2OKRA 3H0ZA 5ACKA 3G9LX 3SKCA 3TACA 2OJIA 2CN8A 3HYHA 4AZVA 5JT2A 4GEOA 2E9UA 3B2WA 4HJOA 4QYFA 5EDRA 3UDSA 4XOZA 5KBRA 3ACJA 3H3CA 1RE8A 3WZDA 4KSQA 4XNEA 4EK5A 5BUJA 3A4OX 1OVEA 4QT1A 1GIIA 2W1ZA 3DS6A 1Z5MA 2XK4A 5TOZA 1Q41A 4ZZNA 2XZSA 3BEGA 3F61A 3COIA 3F2RA 4XH6A 3PPZA 2ZM3A 3O71A 4KA3A 4IWOA 1PXMA 2OI4X 2XK6A 2E9NA 4RWKA 4YPSA 1PHKA 4K9YA 4RIYA 3TNIA 4TXCA 2CGXA 3V3VA 3VS1A 5JZJA 5CEQA 2WPAA 5EW9A 4CV8A 5EK7A 3NFGB 4JX7A 3I0QA 3H0YA 3ZS5A 4CFFA 1PMNA 5M4UA 3EN9A 3AC1A 5A4QA 5L8JA 2V55A 2PVRA 2VO6A 2Z2WA 4TYEA 4MWHA 2JKKA 3L8PA 3BPRA 3PSCA 2J6MA 3EKKA 4JRVA 3NIZA 3OW4A 3QUEA 5TE0A 4CCBA 1P2AA 3PE2A 3K2LA 5AR5A 4BCNA 3FAAA 4G1WA 4WA9A 5ETAA 5B0XA 5HLNA 1YHVA 4V05A 4YJUA 2C68A 3R00A 2EVAA 3TT0A 5FBNC 1YXVA 2BMCA 1JVPP 5E8VA 3R0TA 4BJJB 4TT7A 2AC5A 2B54A 2FSTX 4M15A 3BYOA 4GVAA 3HVCA 2RKUA 4RLKA 4E1ZA 5FBOA 4GYIA 3PIZA 4G31A 4I4FA 4G3DA 3TZMA 5J7BA 3FE3A 5CNNA 5LCJA 3MY5A 3EN7A 4EOQA 4E93A 4IW0A 1QCFA 2WTWA 4GFGA 3CEKA 3REPA 1YHSA 2NRYA 3PWYA 3I0OA 4QMWA 3QYWA 3W2OA 3DY7A 5L3AA 3BYUA 1XH7A 2A2AA 3O7LD 5GJGA 3IW8A 4FT5A 1NVQA 4NH1A 1A48A 3GP0A 4ONAA 3QRIA 5IA4A 4P5QA 3ALNA 4B9DA 3W8QA 3OEFX 2EU9A 3RWPA 5HG9A 4XMOA 3G15A 1UU7A 4CRSA 1W2CA 2F2UA 2PZPA 4DEDA 4DFZE 4FV9A 2JDSA 4O27B 4Y5HA 3AOXA 3I4BA 4FV3A 4FEWA 3ID6C 2Y6MA 3OHTA 1ZMVA 5AADA 4FOBA 3TM0A 3VULA 4YNEA 2BAQA 1NA7A 5BVEA 2BFXA 2ONLC 5FEDA 4EHVA 4EZ3A 3MSSA 2FUMA 2V7AA 4RJ6A 2BKZA 4A9RA 4OTDA 2OFVA 3CP9A 5IMEA 3C51A 5AIRA 3I1AA 4R77A 4OBOA 1CMKE 2JFLA 2PVMA 3D83A 4KABA 4YTIA 3UBDA 5IQAA 4HNFA 5HU9A 4QP3A 3AC4A 3KN6A 1K3AA 4I0SA 2E2BA 4YZCA 5L2WA 5EYMA 3BHVA 3VUIA 3DPKA 4QMXA 5EI8A 2XKFA 2PVYA 2VTMA 1ZMUA 3SQQA 4DGOA 2UW0A 4ACHA 4HYHA 4YZNA 3VBTA 3Q9XA 4YLKA 3UG1A 2YDIA 3E63A 4C36A 3EWHA 3POZA 4LL5A 3GC7A 5A54A 1JKSA 1VYZA 1H25A 2XKEA 4J8NA 4X3JA 2UZUE 2ITTA 3O23A 4LYNA 3ORPA 4JG6A 4ANOA 4BY9E 2XIKA 1IRKA 1VEBA 2A4LA 3D5UA 5K4JA 4GH2A 3IS5A 3ULIA 4IDTA 3GGFA 1Y57A 4IB0A 3HMOA 1JPAA 3R1YA 1H0WA 2WMBA 3CKWA 4AGCA 5CSPA 5I0BA 4I92A 3PVUA 2W99B 3B8RA 3SC1A 3SA0A 4TW9A 2PMLX 2R3LA 5F95A 2QG7A 2C5NA 4JI9A 5LQFA 5GIOE 4KBCA 3C0GA 3TNHA 4FSRA 5IF1A 3AMBA 4KNBA 5K0KA 2GQRA 3G9NA 5C01A 2XBJA 3CTJA 4EOOA 1ZYLA 3UZRA 4FKGA 4X7QA 2BZHB 3UDZA 5HBHA 1I09A 4N57A 3N51A 5F94A 3QKLA 3VS4A 4I6BA 5ANJA 3R8LA 3E93A 3LCTA 3ORIA 2YA9A 1XBBA 1PJKA 3EFJA 3PY0A 4QNYA 4D5KA 1IAJA 3I7CA 3PVGA 3C4XA 2AC3A 4UXQA 5F9EA 1H1QA 4FNYA 2Z7QA 5J79A 2C6KA 5HO8A 5IA1A 1TFFA 4RJ7A 4QQJA 4LGGA 2HWPA 4GU9A 4WOVA 1OL1A 2UV2A 3RM6A 2B55A 1AD5A 3QZGA 1ZOEA 2ACXA 3W0QA 2FSMX 1P4FA 4NM0A 4YJNA 2VUWA 3PPKA 3F3TA 1TQPA 4FTQA 3QTQA 4U41A 3PA5A 3P86A 2R3GA 3I5ZA 3V01A 1R3CA 2WMRA 1JQHA 2CDZA 5CY3A 4LGHA 4GJ3A 4OT5A 2WFYA 2RG5A 3Q04A 1L3RE 3QC9A 4QMLA 4D4VA 4F7LA 1Q62A 3GCUA 5BQ0A 4BCOA 4CYIA 3T9TA 3R1NA 4A4LA 5HLWA 2Y8OA 4WG3A 3WF6A 4W8EA 2G9XA 2PZ5A 2YDJA 4MXAA 3T3UA 4DCEA 3CS9A 1KE5A 4FKOA 4X6QC 2EUFB 4M8TA 2HW6A 4U8ZA 2R3QA 1ZRZA 4O83A 3IG7A 4HVSA 4KS7A 1WCCA 3F69A 4AS0A 4CT2A 3ATTA 5L2TA 3ATSA 3AXWA 5K4IA 4DG0E 5EM5A 4BCIA 4CKRA 3ENMA 5D11A 2YM6A 4LI5A 3RMFA 3F3ZA 4HVGA 4HZRA 3GC0A 4ORKA 3ZHPC 2ZV2A 3PE1A 3R01A 4JXFA 4AZEA 3VO3A 1KE9A 2C3JA 3EZVA 4MBLA 4YGAA 2WTIA 3KFAA 4XG9A 3AC5A 5A6NA 2BAJA 3MFRA 2QKRA 1WBOA 1SYKA 5EYKA 2ZDTA 3ZONA 4AG8A 3PXZA 3BLAA 5A6OA 3BV3A 4LOOA 3HECA 5DWRA 4WNMA 3IPHA 2VRXA 2ZMDA 1QL6A 4IHPA 2C6DA 4YR8A 3MH1A 3GOKA 4FKSA 5CEPA 3VUKA 4IM0A 4L01A 4L7FA 2C4GA 3UJGA 3ZLWA 2FVDA 3LFNA 3O0GA 4YZMA 4HOKA 3P5JC 2GNGA 3O8PA 3PUPA 5HE0A 4UZDA 1CDKA 5AFVA 3ODZX 4XCUA 3QU0A 4NIFB 5KMMA 3EQRA 3W18A 3PSBA 2Y4PA 4EUTA 5B7VA 4BHNA 4ZZOA 1YDRE 4U45A 5LMKC 2W17A 3COKA 4PUZA 4LGDA 4Q9SA 3IGOA 2HYYA 4NM7A 5DEYA 4XG8A 1ND4A 4E3CA 4EWQA 3QCYA 2QOKA 4I23A 3VIDA 1FMOE 2RGPA 3BI6A 4Z7HA 2W1EA 3ZUVA 5HU3A 3UTOA 4W4YA 1JOWB 2XNOA 2EXCX 2WQMA 4CFNA 1QPJA 4F9CA 4TY1A 2X0QA 4BCHA 4CFXA 2NPQA 5CVFA 4QYEA 5DOSA 5IA5A 5M4IA 3D5XA 3MB7A 2GNLA 4FODA 2R7IA 4PDYA 2VWVA 3P5KA 4TZRA 2WQNA 4QQCA 3PWDA 4RIXB 4YPDA 3W2CA 4D58A 1FBNA 3GB2A 3F82A 3F3VA 3KVXA 3ZXTA 3DTCA 3MVLA 3MJ2A 3ZO2A 2AYPA 1TKIA 2WB8A 3QTZA 1P4OA 2BTRA 2QLQA 4FICA 3RP9A 5AUTA 2WTJA 1OPLA 3KF7A 3LCKA 4CKJA 4W4VA 4QMTA 3KXMA 3LAUA 5CT0A 3T3VA 1YWNA 4F64A 5FQDC 4QYYA 4TRLA 2PVLA 2XA4A 1UNLA 2OO8X 4KWPA 2R4BA 4IVDA 5HQ0A 3G5DA 3FC2A 3H10A 2CNVA 4YLLA 3D2KA 4O22A 4O7YA 3ODYX 3EQCA 3H9RA 3NUAA 2QOIA 1Q5KA 5KZIA 2XYUA 4WO5A 5HNGA 5LOHA 4FUXA 3SLSA 3RWQA 1KE6A 4EQCA 5EW8A 2YJSA 4TNDA 3NZ0A 4GMYA 2XAMA 3D7TA 2QO2A 2B4SB 4QMUA 4WBBB 3BYSA 4UMUA 1VJYA 2PL0A 4PL4A 5IU2A 2XNEA 4AAAA 4XRLA 4BWXA 3ZM9A 3DJ5A 5C8MA 3C1XA 2HCKA 2O8YA 2PVHA 1YI3A 5I4NA 5JRQA 1MRVA 4GV1A 2DUVA 4TYGA 5AP4A 4BJJA 1PXIA 4CTCA 5BYZA 1J3HA 2BROA 2R3PA 3E92A 5M06A 3CTHA 1IAHA 5AA9A 2GSFA 2WMAA 3ENHA 4TWPA 1WVWA 3FBVA 4FKUA 4AN9A 5FP5A 3R73A 5IUIA 2G15A 2JKQA 5DT0A 3TMOA 5EI6A 2EB3A 5M57A 1MP8A 3NNXA 4CTBA 5CANA 4PX6A 4GUEA 1YOJA 2CN5A 4U80A 5ANKA 3OZ6A 4O4BB 2GDOA 5DT3A 4AWIA 3MY1A 3Q52A 1J91A 2KTYA 5CAQA 1OKYA 4FIFA 5FWKK 2X2LA 5CEKA 4F9AA 3UIBA 1Q24A 2WQOA 3Q3BA 5HCYA 3AQVA 4KSPA 5L2IA 4DFLA 5K9IA 2XH5A 3UVPA 4R3PA 5AR8A 3D9VA 4A9SA 4DFBA 1GZNA 2UVXA 5DPVA 5I3RA 3UOKA 3I5NA 4FGRA 2GNHA 5CXZA 3H9FA 3EH9A 4MK0A 3BLHA 2QHMA 4BDCA 2YAAA 3DKGA 1UKIA 4BL1A 4IX4A 2YWPA 1UA2A 1YI4A 4BDIA 4FTNA 4GT4A 4BI2A 3LLAA 3MH0A 4CCUA 3AGMA 4YSMA 4GUBA 3EOCA 4DN5A 2YIXA 1H00A 3E7OA 4NFMA 2QOFA 4EQUA 4IX5A 3FWQA 4ZMFA 1FMKA 3EQIA 4YTCA 5HICA 4FTOA 4QOXA 4BN1A 4BCJA 4IANA 4C4FA 4W4XA 3ZU7A 3ALOA 4DFXE 5AUXA 3NEWA 4AX8A 4A9TA 2XK3A 2P3GX 2WOTA 4IAZA 2NYAA 3CQUA 3PP1A 4MD8E 3DKFA 4YNOA 5EKOA 4ZTNA 3QWJA 2RG6A 4J97A 3FZSA 4U43A 5M55A 5C4LA 2V22A 4AE6A 2QD9A 4HGEA 4WSQA 4RX8A 1W2DA 5EM6A 4BTJA 3PIXA 4ZSAA 3QUDA 2HENA 3PVWA 1OKZA 3LXNA 1WBPA 2IEWA 2OJFE 5A4CA 2R3JA 4OBQA 3OC1A 4Y83A 4J95A 5E92A 3R6XA 2W1GA 3HRFA 4MD7E 4R7BA 1U59A 2ZV7A 3D5WA 1VZOA 3EQPA 3MVHA 2JDVA 3DGKA 4DLIA 5BVFA 2QR8A 3QGYA 5C26A 4OT6A 2B7AA 1GZ8A 5GZ9A 4AZTA 3LVPA 4G5PA 4CGAA 3VF9A 2B9JA 3CC6A 4CQGA 2WEVA 2BCJA 3E7VA 5G6VA 4D9UA 2EWAA 3QKMA 5HE3A 4WG4A 2OJJA 4RIWA 5A4LA 2R3KA 2PVJA 2WKMA 2X8IA 4UBAA 2IJMA 4I94A 5JN2A 3EL8A 3RBWA 2WAJA 4RC4A 4PY1A 1PXPA 2ZM1A 3DK6A 3Q5ZA 5AJQA 4C4JA 2QOBA 4H39A 4USFA 1PRYA 4MQ1A 5AAEA 1YXUA 2GS2A 3LFCA 4O1PA 2VWXA 3A2CA 4XP0A 2V62A 4ZOGA 4DGGA 4HCVA 2ZB0A 4WT6A 1PKGA 4FOCA 4XJ0A 4G3FA 3ZZWA 4C3FA 3GCPA 1WMKA 2C5OA 2Z7RA 3UDBA 4DEBA 4FTTA 3BELA 3NUSA 2IW9A 5L4QA 3RPYA 2ITUA 3R63A 3QZFA 4ACCA 3KXGA 3W16A 3UOLA 4JBPA 4IAKA 3FLWA 4YBJA 4Y72A 4AQCA 3R71A 4O81A 5HOAA 3QYZA 1L8TA 2XNBA 3BWJA 2O63A 2OGVA 4IIRA 3SXSA 4O7TA 4O84A 3O2MA 5HEZA 3GQLA 4C4IA 4PDOA 5CASA 4PTGA 4S34A 3OF0A 4QDEA 3UGCA 2CLXA 2VWIA 4S31A 3V5PA 3WF9A 5IDPA 5FDXA 4AOTA 5IH4A 3VW6A 3W0SA 1OGUA 3F5GA 3OP5A 4F1OA 3A62A 3BGQA 3IK3A 4TL0A 3HV7A 2YAKA 4F63A 1PW2A 3DFAA 3W8LA 4WBOA 2VN9A 3TWJA 2IPXA 5CVHA 3VRYA 3HLLA 4GKHA 4KS8A 3O8UA 4XRJA 2PHKA 3LFDA 4USDA 1J7UA 3LXKA 4ZTLA 4O0SA 1YWVA 5BVKA 2VO0A 3TNQB 1YDTE 3MFUA 3QQGA 1JSTA 5HG8A 4JQEA 3PJ2A 3PLAE 2R2PA 5AMNA 3DNEA 2A98A 5E8WA 3QAME 3EN5A 4BHZA 4PP9A 4ZSEA 4LL0A 4HYUA 1OL7A 2WMUA 3DK3A 4IFGA 4KKGA 5EDQA 3R2BA 3RCJA 3U87A 1B39A 1KWPA 2CMWA 2HXLA 4U7ZA 5KMIA 3OCBA 3R30A 4EK6A 5A46A 4MEDA 2XANA 4F6UA 5ICPA 4AW0A 3CTQA 1MRUA 4ZTHA 2PUPA 3NWWA 5H8GA 3AT4A 2E9PA 3DBFA 4FIJA 1RJBA 3C4WA 2A19B 5CWZA 1OIRA 4KD1A 4EEVA 3Q4CA 3E62A 3AD5A 3KL8A 3QX4A 4FL3A 3DLZA 3VBYA 3VS6A 2OF4A 4BZNA 4JQ8A 3V5QA 4CNHA 4Z16A 3U6HA 4EHGA 4O96A 3V8WA 1IA8A 2KULA 2UW7A 3ZC5A 2HWOA 1LEZA 4X3FB 4YURA 2A1AB 3V5JA 2X7GA 4IX3A 3ZO3A 3HP5A 3C4FA 4NIFA 1Q8TA 3MJ1A 3O7LB 4IADA 2OFUA 5TO8A 1ZYSA 5CSWA 4CD0A 4IMYA 1TQIA 5H3QA 1M17A 4AN3A 2VTOA 4M69A 5J9LA 4AXFA 4PNIA 3V6SA 5CEOA 2F7EE 3FLQA 4KINA 3RAWA 2C1AA 3COHA 3D2IA 4WKQA 5H2UA 2CNQA 3ORZA 1BUHA 1HOWA 1QPEA 2VWZA 3NR9A 3ZBXA 4EOSA 2BUJA 2GHMA 2AUHA 4L3LA 3FEGA 1OZ1A 1BKXA 2R64A 4FSUA 3R7EA 3JUHA 4EBVA 3A99A 2HZIA 2C30A 3NX8A 4I41A 4ZSGA 4BICA 4EK8A 3OUKA 5DG5A 5EW3A 4EZ7A 5C9CA 2O5KA 4ACMA 3PYYA 3P4KA 5LMAA 4OUCA 2W5BA 4RIXA 3RI1A 3TZ9A 3AKJA 3CCNA 3D7ZA 2CJMA 2W5HA 4IFCA 4K11A 5JZNA 4ZS4A 4RWJA 3B2TA 4ARKA 4FF8A 4EJ7A 4Z7GA 4FV5A 2QOHA 2YM5A 5AUZA 2XIYA 1WVYA 3PIYA 2UZTA 2CGVA 5HG7A 5C27A 3BYMA 4Y95A 2XVDA 3UNJA 3QHWA 2BHEA 1B38A 2ITXA 1OI9A 2C3KA 3O50A 4PTCA 4CXAA 4G3CA 4MBJA 3M1SA 1IG1A 2I0HA 4QRCA 5E8XA 5TR6A 4IH8A 3G0FA 3UPZA 2VWBA 1YHWA 5CZIA 4W9WA 4IWPA 3RK5A 4TN6A 4FA2A 3H9OA 4YZBA 5E8SA 4D55A 4DHJA 2X9EA 4MHAA 3VN9A 4DE4A 5CSVA 4M3QA 3NCZA 4H58A 3FI4A 2C6LA 2ZAZA 5TT7A 2XAOA 4IZ5A 2GHLA 2GFSA 3DK7A 1FINA 4O1OA 3EFWA 3KQ7A 3P1AA 3FMNA 2J0JA 3UIXA 4F1MA 1BL6A 2BPMA 3HDMA 4AXCA 4S33A 3PVBA 3F2NA 4NKAA 4ZJIA 4IB5A 5IISA 1OGYA 3UYSA 2OIBA 3RZFA 4HW7A 3PRIA 4ZJJA 3RNYA 2Y7JA 2IZTA 4JNWA 1UU3A 3TZ8A 2QO7A 4X2FA 4AW5A 4C59A 2ZM4A 4JAJA 4FR4A 4KIPA 4NEUA 5CF6A 5FEQA 3Q5IA 1HCKA 2IF8A 5AP0A 3UQGA 5E4HA 1W0XC 5AUUA 3QQHA 2XB7A 2YIQA 5CEIA 2I0VA 4BDHA 2YEXA 3DXNA 2X7FA 1PF8A 2X0GA 4WG5A 3QRJA 4L44A 3ZFYA 4BCQA 3DDPA 5HE1A 1JSVA 2R7BA 2WZJA 1FQ1B 4FBXA 4YJQA 2IW6A 3QRKA 1KV2A 2OXYA 2REIA 3ORLA 4QMYA 1TVOA 4V0GB 3RM7A 3ZEPA 4K18A 1Y8YA 3OD6X 4AXEA 5CF8A 1Z57A 4BCPA 3BGPA 3Q53A 2YJRA 5AAGA 1NW1A 2CPKE 3BGZA 5TF9A 1ZLTA 3OFMA 3V8TA 3KRRA 4H1JA 2LGCA 3PA3A 4FSYA 4QQ5A 3OY3A 3CSVA 3D7TB 3DXQA 2XF0A 5CF4A 4XYFA 5L2QA 5JGDA 1ZYJA 1LUFA 3UP7A 4FNXA 1NVSA 2G1TA 3BWFA 4AOJA 2FA2A 4RJ8A 3MPAA 3E8EA 4QEBA 1W84A 4RVMA 4BKZA 3HKOA 3D4QA 2OICA 2J51A 1KUTA 1V1KA 1UKHA 3BQRA 5DA3A 5DNRA 3R9DA 4F0GA 2OF2A 3D94A 3QTSA 2W4OA 5HTCA 5BPYA 3M2WA 3FLNC 4GU6A 1WAKA 4ZTRA 1OM1A 4FNZA 4EBWA 3UNKA 3UC3A 4ZIMA 3QD2B 4M66A 5BYLA 1Q4LA 4Y46A 4LG4A 4IM2A 4KAOA 4V01A 4EC9A 5HKMA 4L9IA 3MIYA 5ETCA 3AT3A 1P14A 4YHFA 4KRCA 5FM3A 4R6VA 5AV2A 5BNJA 4R3CA 2Z7SA 1KE7A 4AW1A 5FD2A 4Q2AA 3GFEA 3HV5A 3VS3A 4DH1A 5LVPA 4F08A 5GJDA 1GOLA 4EHZA 4JG7A 2GMXA 3BLRA 4XLIA 4EOIA 4QMSA 5EM8A 4FEUA 1OIYA 4ACGA 3FI8A 1PXOA 3ZSIA 4FC0A 2QG5A 4OAVB 4MXOA 4OTFA 4UYNA 1OB3A 3LIJA 3DBQA 3LJ2A 3QZHA 5AP7A 3GCVA 2BZKB 3RPVA 4RZWA 4D9TA 2ETRA 4KRDA 2W7XA 1W2FA 4JBQA 4JBOA 3EZRA 1KV1A 3HGKA 5KKRB 4D28A 4P2KA 2RF9A 4ASDA 3WI6A 4EH6A 4EWHA 4CMTA 2ITQA 4D2PA 3ELJA 1H27A 3NNUA 3P9JA 4OGRA 1ZZLA 3CLYA 4H3BA 3VS2A 5CEMA 4EYJA 2VGPA 2JFMA 2X6DA 5DYJA 2HZNA 3D5VA 3F5UA 2H34A 4R1YA 4ZSJA 2OZAB 3FLYA 3NAYA 3WF8A 2QLUA 5EOBA 5AUYA 5IQEA 2ZDUA 3IO7A 1DM2A 5DFPA 3RGFA 4AGWA 2JAVA 3LFBA 4DF3A 4TWNA 3EQHA 4XS2A 3U51A 5HI2A 2YWVA 4CG9A 3TJDA 4A7CA 2WMXA 4QTBA 4R5YA 3CQEA 3NRMA 4HPUE 4JQ7A 4X2NA 4ZMEA 3DQWA 4XV1A 3N4VA 3HL7A 4ZZMA 4C4EA 3LQ5A 4CSVA 4UWYA 4QMVA 3LM0A 2WGJA 5JFVA 4U79A 3R8PA 1F0QA 5JKGA 4AT4A 3E8DA 4DH3A 4BCFA 1LP4A 4IAYA 4KIKB 5L8KA 1Q8YA 5JGBA 3FSKA 4EI4A 2ZVAA 1ZOHA 5CZHA 5E1SA 2X39A 3TI1A 4RX9A 3QRUA 4XV3A 4FJVA 3FHRA 3QX2A 4V04A 3VS0A 3UVQA 3UZPA 1YWRA 2YLEA 5CU4A 2J0IA 4B4LA 3A7GA 2IZSA 3CBLA 4ZLYA 4FTLA 5J1WA 2AEGA 1XH9A 3I60A 5LCKA 5EHOA 5EQYA 3ZFXA 4NSTA 4HCUA 5FTGA 5IZFA 2IVUA 4AF3A 4JMQA 3BKBA 5L2SA 3UZTA 3FV8A 4G34A 3R9HA 4IWDA 2ITNA 2GNFA 2OWBA 3MWUA 4XLVA 2PE2A 2X4FA 4G16A 4RIWB 4BDJA 2XK9A 3AC3A 5DVRA 4DFYA 3JR1A 3OTVA 1KE8A 4FTCA 1H1WA 4JVGA 2IVVA 4XP3A 2HIWA 2FGIA 4DHFA 4I5MA 1WBVA 2C3IB 4JX3A 4MF1A 1XR1A 5AP5A 4LV7A 5H8BA 3WZJA 3V5LA 2J5FA 1U54A 3DKCA 3LM5A 4JDJA 3KRWA 1H08A 3FZOA 5ANGA 5EHLA 4CFWA 3WF7A 4AN2A 3FMHA 4JJRA 4QDVA 2H8HA 3ZLYA 2ZV8A 1JKTA 5FM2A 4S32A 4FUYA 4I5PA 3G33A 3H30A 5JK3A 5HO6A 3VJOA 4BBFA 3IW5A 3Q9YA 3DAJA 1M2QA 3KGAA 2QI8A 4QP2A 3V8SA 3DJ7A 4S2ZA 3W2SA 2E9VA 3E8NA 2WELA 3HMIA 4TYJA 2I7QA 2A27A 3NYVA 4J52A 4ZJVA 3P78A 4GVJA 4KIOA 3U6JA 3CD3A 4DITA 1PY5A 1ZYDA 3BHUA 4NKSA 3Q32A 2WMWA 4ZTSA 5FGKA 3MS9A 4CEGA 3JY0A 3FI3A 4OTQA 4C8BA 4E6AA 2I1MA 5HX6A 4IQ6A 1Y8GA 1GIJA 4RJ3A 3O5AA 4ANMA 4TYIA 2VGOA 1DI9A 3R1QA 4BRXA 1JLUE 3UNZA 4F09A 4NL0A 1CTPE 4K2RA 5I9VA 4X3FA 3OMVA 3KRJA 2ZYBA 4D2WA 2JBPA 2VWUA 2WMQA 3PDTA 3R1SA 3OWJA 5A3XA 2B9HA 3LJ0A 1FGIA 4UEUA 3KIOC 2CGUA 3DBCA 3LHJA 3LMIA 4N4SA 1NVRA 2J0LA 2UUEA 4O7RA 2QVSE 2ERKA 5ANEA 2IG7A 4BTKA 3ZSHA 1TZDA 2C69A 3Q