4ZIMA

Crystal structure of janus kinase 2 in complex with a 9h-carbazole-1-carboxamide inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
285
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title 9H-Carbazole-1-carboxamides as potent and selective JAK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 285
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zimA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zimA01
3KN5A 4FNYA 2ZYBA 4DTAA 4M67A 3H30A 5C27A 2J2IB 4HYIA 3PTGA 2Y4IB 3AC5A 2W1ZA 3LCTA 1URCA 2VWUA 2HW6A 4LI5A 5E8ZA 3Q53A 1ZOEA 4X2GA 4I20A 4QTEA 5J9YA 2XK6A 1TKIA 4ZLYA 3O51A 2GNLA 4IAIA 3OT3A 2W5BA 4RVMA 4QMWA 2X4ZA 2ERKA 4AW2A 4QQTA 2RFSA 5IQBA 4D4YA 4HYUA 4XP3A 5HGIA 5HNBA 4FSNA 4A07A 5HKMA 3ENMA 3FLQA 2Z8CA 4ZZOA 3HL7A 4JNWA 3RNIA 3ZUTA 4MBLA 4BCHA 2XJ0A 3BX5A 4CVAA 1DI9A 3NUXA 4D2SA 2FSMX 4IX6A 3FQEA 5F4NA 5HVYA 3ZRLA 3RPSA 5AIKA 4AN2A 4BCGA 5M53A 3A7GA 3WOWA 3RM6A 2OF2A 4AXAA 4OT6A 4X2JA 2C6DA 3Q4TA 2WTCA 4FSZA 3M1SA 2R0IA 1JSUA 5FEQA 3TN8A 2PVMA 1Q3DA 4UN0C 3Q9XA 2P55A 1TVOA 2I7QA 2GTNA 3Q2MA 4PV0A 3A61A 4J99A 5CEQA 3QLGA 2BIYA 2XNMA 4D55A 5K4JA 4S34A 4J8MA 4QMOA 5CT7A 5JKGA 2UZUE 4L00A 4FTKA 5CU6A 5ETAA 4D5KA 5IA5A 4EH4A 5EKNA 3H9OA 3I0OA 3IK3A 3R1YA 5HEZA 3TL8A 2ZV8A 3MY0A 3UO4A 4FT5A 1M17A 1XBCA 2GQRA 3E3PA 4XNEA 3C4CA 4QP2A 2PU8A 2PY3A 3EN6A 3H3CA 3PY1A 5D7AA 5J5TA 4YBKA 3TCPA 5HO7A 2GMXA 3TUDA 2PMOX 5JN2A 3PPZA 2RKUA 3HV4A 4O82A 3DPKA 4K77A 3KFAA 3A2CA 3BYMA 1Q3WA 2QU6A 4BC6A 2EU9A 5A4LA 2OF4A 3F82A 2UZVA 1M7QA 4IC7A 3PIXA 4CXAA 4WUAA 3WBLA 3CTHA 4IM2A 4P5QA 4UBAA 4XS2A 2YM5A 4LL0A 4IZYA 4O2PA 4ZTRA 3NNVA 3QALE 5I9WA 3HKOA 2CKPA 5EDRA 3ZDIA 3NYVA 4FKUA 4ENXA 3ZDUA 1IR3A 5J1WA 2FUMA 4ZSLA 2QO7A 3MDYA 1SM2A 4IACA 2IW8A 3EZVA 3L9PA 3RM7A 1IEPA 4I21A 4QMTA 4F4PA 3CY2A 4LV8A 5BQ0A 5AM6A 5CU0A 2ITOA 3LFNA 1WZYA 3AT4A 4C37A 3KL8A 4FIJA 3TZ7A 4TNBA 3PP1A 3QD3A 4C4JA 4FR4A 2AYPA 2HW7A 4AE9A 2WELA 3C4FA 3LVPA 3MW1A 4AGDA 4F64A 4BGGA 1FPUA 4MQ2A 2C5XA 2C5NA 1H24A 1LPUA 2KULA 2GNHA 4IXPA 4JDKA 3HEGA 4MBJA 5FTQA 3WZUA 2RF9A 4EEVA 2OU7A 3MN3A 4UEUA 3U55A 3PWDA 4F9WA 3FSFA 4O0SA 5AJQA 4L45A 3PXYA 1H00A 4R78A 3ROCA 5HG9A 4C3RA 5EKOA 4N57A 4JX3A 2WMSA 5ETFA 5T6KA 5HTCA 5JQ8A 2ZMCA 1F0QA 3JXWA 4XLVA 4F1OA 2CKQA 3UGCA 3S3IA 4YPDA 3GCVA 4C4IA 1PXKA 2VGPA 5HE0A 3VHEA 4DCAA 3SX9A 3DTCA 4F9YA 4MF1A 3DS6A 3UPZA 2HY81 3KKVA 5FBNC 3UYTA 3VQUA 3ZFXA 2ITTA 4PMMA 3OXTA 3LMHA 4DFUA 4W9XA 3NW6A 3BV2A 2ZB0A 5FD2A 3VS1A 5A6OA 3QTRA 5M4UA 4PDYA 2CGUA 2XNPA 2BRNA 4AFJA 4DBXA 2OSCA 3GU8A 3DZQA 4YU2A 4TWOA 3IKAA 5AP6A 3R63A 4Y5HA 4CYIA 3ZLWA 3R30A 3R6XA 4AW5A 4HGEA 1STCE 2B9FA 2V55A 3U9CA 3U6JA 2BR1A 4BCNA 1AQ1A 2XNBA 1YW2A 2HZ4A 4CKRA 2YJRA 2A1AB 1H8FA 5KMIA 1CTPE 5K0XA 4I6QA 4F70A 1M2RA 2C6TA 4FKSA 4CTCA 3PA3A 4AZTA 3KRXA 2BUJA 5IF1A 2IWIA 4MBIA 2FB8A 3AC8A 2IPXA 4UWCA 2J90A 4YZ9A 3DA6A 3VS0A 4FT7A 4NL0A 1Y57A 3OTVA 4EQMA 5HQ0A 3QTZA 4QPAA 3SV0A 4AOTA 3ATSA 5I5ZA 4MXZA 2CMWA 5L4QA 4RWIA 4OT5A 4C4HA 2JIIA 3KVWA 3IW8A 4IWQA 4CFNA 4YHFA 5AAGA 4IDVA 5L2SA 3PLSA 3LLAA 3NAXA 3MS9A 4H1JA 3TJCA 4D4SA 3HDMA 5L2IA 3VUKA 3QU0A 1OITA 3MWUA 2OH4A 4YSMA 3Q2JA 3HMPA 4J98A 2Y4IC 3Q9YA 1J7IA 3OF0A 4FIGA 4A9TA 2GQGA 2XF0A 3U4WA 4APCA 2QO2A 4OLIA 5A4QA 4ORKA 2A27A 2X9EA 3PWYA 2ZV9A 4HGTA 5FQDC 3OS3A 3ZM4A 2DYLA 3ALNA 3QX4A 5L8JA 3O17A 5CWZA 4TTHB 2ONLA 1CMKE 3VVHA 1Q62A 1U5QA 3Q96A 3ZOSA 2PMNX 3P7AA 2JDRA 1S9IA 4KABA 2OW3A 3AMBA 3B8RA 4ZY4A 3TT0A 4EH3A 3LKMA 3G51A 2WMTA 1ATPE 1BL6A 2ZM3A 5BMSA 1IASA 2UW7A 5E8VA 3GC7A 2VGOA 2NNWB 3C7QA 4BDEA 2WTVA 4DA5A 3UZTA 3LFFA 4IM0A 3CIKA 5HORA 3NS9A 4YHJA 3AQVA 4D2VA 4IH8A 5AR3A 1Z57A 2O3PA 3RP9A 3UG1A 4UMPA 3OBJA 2B9IA 3KULA 3QX2A 3R02A 4FODA 1PRYA 1APME 4II5A 4RQVA 3LE6A 2J9MA 1ZYLA 4D2RA 4F6WA 5M4IA 4G3FA 3F69A 2BCJA 2X9FA 3C51A 4YLLA 4C4FA 1K9AA 4O6EA 4OTQA 3F61A 2PL0A 5M07A 3CD8A 2X6EA 4ZSEA 4AA5A 1B39A 1ZARA 3QRTA 5EQYA 1WVWA 1JKSA 3QRJA 1ZLTA 2GNIA 4X3FA 4ZTHA 3C0HA 4ACCA 2EXCX 1PF8A 3CGFA 4I5PA 4M3QA 4OTRA 5EM8A 3QHWA 3MTFA 5HD7A 1OUKA 2BZKB 4ZEGA 4BBFA 3ZEWA 3F88A 4DN5A 1W7HA 1NVQA 3L8SA 1YI4A 2R9SA 4TYIA 3F6XA 4IFGA 4E93A 2J5FA 2WMBA 5I4NA 3KF7A 2Y6MA 3AD4A 1LEWA 2XKDA 3PJ8A 5B7VA 3QCSA 4PRJA 3GGFA 4RG0A 2NO3A 4EOJA 4D1XA 5F9EA 4AT5A 4F99A 4EWQA 3B8QA 4DG3E 1WBOA 3IECA 4FGBA 4IJ9A 4WNPA 4FTTA 3LXPA 4EKKA 4A06A 5IQFA 3VBTA 3R1NA 3E62A 2QOLA 3KB7A 4JDHA 3BYVA 3PVBA 5DA3A 3DAJA 1MRYA 4O0VA 3SQQA 1NW1A 5TO8A 3NSZA 1DS5A 5BX0A 3HAMA 5E8SA 5AIRA 5AUZA 4CZUA 2H8HA 3OCGA 4IEBA 3GQLA 5IA0A 3AC2A 3Q3BA 4BCFA 4E73A 5AV2A 2BAKA 4KIKA 3QD2B 5HHWA 4E5AX 1E9HA 2VX0A 4D0XA 4XMOA 5DVRA 5BVWA 2YLFA 3BWFA 4FEWA 1V0PA 3VNTA 2IVTA 5HI2A 4L3PA 2OFUA 2BDWA 2W1CA 3NUPA 4IAKA 5FDXA 3OBGA 3RHXA 1Q61A 2PVFA 3V8TA 3FJQE 3R2YA 4FIIA 3D7TA 5AV1A 4DH1A 3CS9A 3B2TA 2X8IA 4IHPA 5BYYA 3E8CA 3EYGA 3FZOA 3WF8A 5IQAA 4TXCA 4A9RA 4RIOA 4NW5A 4IFCA 2W9ZB 4FTRA 2WZJA 3I0QA 4G3GA 3ZUUA 2JGZA 2XRUA 1PXNA 2QU5A 3GCUA 5CYIA 3PXZA 5DBXA 1WVYA 4ZMFA 5HOAA 3CQWA 4PUZA 3R2BA 2JIVA 4QNAA 4MXAA 1KWPA 3GC0A 5A6NA 3N4UA 3W2SA 3HVCA 4C3FA 5C8KA 3ZXZA 1XH5A 4GU6A 2W1DA 1SVEA 1YXVA 3FHIA 4CFFA 5E1EA 3ZM9A 3EQIA 3R7GA 3ZS5A 3MH0A 3LXKA 5ANDA 3IDBA 2O0UA 3FAAA 3KMWA 4C3PA 5LCJA 4O7NA 1H08A 3BHVA 5BVNA 2OIQA 2H9VA 4MNEA 4BCOA 3BU3A 1YXTA 3PJ1A 3ORLA 4ANOA 2X7OA 4WO5A 4R8QA 5CAUA 4APPA 3MA3A 2ITVA 4BGHA 3JR1A 1UVRA 3PJ3A 1O6YA 4ZSAA 1Y8YA 2REIA 2RFDA 4QTDA 4BTKA 4DITA 2C68A 4EONA 2PZIA 3R8LA 1W84A 4KKEA 3HMOA 4GK3A 2V7OA 4C61A 1P4OA 5JGDA 2UZBA 5E90A 3LLTA 3IO7A 3ORMA 5FRIA 4AW1A 4CZYB 3PSBA 5D10A 3CPBA 1OPJA 4R7BA 3D0EA 3FMNA 4DT8A 2WQOA 3EWHA 4C57A 3ORTA 3ZTXA 2PTKA 1OKWA 3DTWA 3MH1A 1YOMA 3QD0A 4FZDB 1XWSA 1F3MC 2QLQA 3WYYA 4A7CA 4GMYA 4RLKA 3ZCLA 3PDTA 3QQHA 5EM6A 3U8WA 1PMEA 3R00A 2IO6A 3UYSA 4EJ7A 1KOBA 5DFPA 4YTIA 2XEYA 4LGDA 4I4FA 4L7SA 2HOGA 2VX3A 3TIYA 4M12A 4X6RA 4XH6A 3TJDA 3KXXA 3QTSA 2BFYA 3HRCA 4BRXA 4FT3A 4TY1A 3FLNC 2C69A 2ERZE 4WRGA 3REPA 4HOKA 4MD9E 3JY9A 2W1FA 2VO3A 4NSTA 2XBAA 4D1SA 3KREA 5DIAA 5A4EA 2OJ9A 4UWYA 3FKNA 3ODZX 2QLUA 3GCSA 5CVHA 4O22A 3UPXA 3AMYA 4E6DA 4XG6A 3FUPA 5HICA 2J0JA 4ZTLA 2F2UA 2HY0A 4BZNA 4HYHA 1J7LA 2BTSA 4C0TA 3FI8A 4F6UA 1SNUA 5C01A 2RL5A 2YFXA 4OTIA 3TZMA 2C6EA 4QMNA 4NK9A 2FGIA 3T3VA 2ZAZA 4I0TA 5HO8A 3NYOA 5HLWA 5FXQA 3P23A 1R39A 4R7IA 2CGVA 5ITAA 3UVRA 4IZAA 4O1PA 5LMBA 5AEPA 4QQJA 3EN5A 3FMHA 3PVWA 3VQHA 2GDOA 3GT8A 4OTFA 4F7SA 1QMZA 1CSNA 3PA5A 4RFMA 2XZSA 4FZ6A 4C58A 4RJ3A 3KCKA 2ITZA 4RC3A 4LV5A 1YXUA 5AX9A 3R8MA 5LVPA 1ZOHA 2WMRA 3CXWA 3HMMA 4TYEA 3S1HA 1A06A 1J3HA 4X2FA 5AMNA 2QOKA 3THBA 3PIZA 4FEUA 2IZUA 3VUGA 4X3FB 5JFWA 4K9YA 2OIDA 4ZP5A 2Y6OA 2X0GA 3LFEA 1CKPA 1QPCA 3VW6A 2VTHA 1T45A 2A19B 2EB2A 2ITYA 4CD0A 5HU3A 1Q5KA 4FIFA 4LOQA 4DFNA 5HBJA 5JFSA 4QQCA 3WF9A 4F08A 2YABA 2R7IA 3PG3A 5CEMA 4JXFA 4BL1A 3BHHA 1KUTA 4K6ZA 2YISA 2I0HA 1URWA 3R01A 1IAJA 4L67A 4CFMA 1IA9A 4IVAA 2YWPA 3D5VA 3TKUA 5FXRA 2QOQA 3L9NA 3QTIA 4WT6A 5L8KA 4OR5A 4WA9A 3UP7A 2XIRA 2R3LA 5EQPA 1OZ1A 5KMNA 2YZLA 3V6RA 3P4KA 2QOFA 2WQMA 3R22A 4UMRA 5ANIA 3MTLA 4JRNA 3V04A 1WCCA 5CXZA 3G33A 3VRYA 3D2KA 4GT3A 1P5EA 1XH6A 3VS6A 3KRRA 3COIA 4FYOA 4C34A 5I3OA 4B7TA 4RZWA 1PMUA 2BALA 2YCQA 2X2KA 4NM7A 3S4QA 2WTIA 3OMVA 2OGVA 2E9OA 2XIXA 3MY1A 3ZSIA 4ACDA 3HZTA 4N70A 3VS2A 2B0QA 3BELA 3D5WA 4H3BA 1UU3A 3CC6A 3QAME 4Y95A 4IWDA 3GC9A 1GZ8A 1YOJA 2EVAA 3FY2A 4FUXA 4NKAA 4BDCA 2UW6A 2G2HA 1Y6BA 4GJ2A 4RC2A 4U7ZA 4D4RA 3COMA 1WAKA 3ACJA 4ASXA 3FQSA 2UZTA 4IC8A 4ZSGA 4KS8A 3D5UA 2HYYA 1Q8WA 2QHMA 2C4GA 4USEA 2HENA 4Z7HA 2QD9A 5HBEA 3OWPA 3OWJA 5HVKA 5CSWA 1KV1A 4IVDA 4YZCA 3LFBA 4BDAA 1PXLA 4A4XA 5BUIA 3IOPA 5KZ0A 5JZJA 1Q24A 4KIOA 5A3XA 3G0FA 1GZKA 3GNIB 3PE1A 4JIKA 5CSVA 4RX5A 2IW9A 4LUEA 5A9UA 5FEDA 5A4CA 5EYCA 3RTPA 2C47A 3DU8A 3P7BA 4KKHA 4YBJA 5DOSA 3QHRA 5E8XA 5AV4A 3VW8A 3NDMA 5CANA 3AC4A 3MIYA 2PVRA 4PPBA 1FMKA 4R5YA 2QG7A 1H0VA 4DHFA 3LCKA 3PVGA 4IX5A 3LHJA 4JX7A 3EN9A 4MNEB 3V51A 4EOKA 2QR8A 3V01A 4EZ3A 3MVLA 3RPVA 2GHLA 3BYUA 4TW9A 4U42A 5BYZA 3L9LA 2YIYA 3MIAA 1JVPP 5LWMA 4DH3A 2W05A 4CLJA 5IEYA 4FTAA 2PVHA 2Z60A 3TWJA 3ZO3A 4GIHA 4D28A 4GJ3A 4UZDA 4GU9A 5H2UA 4JR3A 3AT3A 3R8VA 4TNDA 5TE0A 5I9ZA 3GCQA 4C2WA 3F3TA 2BRHA 1RW8A 2GSFA 4V04A 1UKHA 2RG6A 3W8QA 4E20A 2VX1A 3V5JA 3UIUA 5JFVA 3KXNA 4UZHA 4CYJA 3P5KA 2IVVA 4C62A 2BZHB 2J51A 1ZAOA 3E92A 3P1AA 4CQGA 3QUPA 4RQKA 3LIJA 3DXPA 5ICPA 5AA8A 3AD5A 2JKQA 2KTYA 2P2IA 2XUUA 4H36A 4JG7A 4N6YA 3R7EA 3U87A 4YZDA 3OWLA 1ZYDA 4IWOA 5HNIX 3HUCA 4WNMA 2W17A 4FV7A 2VTIA 4KBCA 3RCJA 4NEUA 1ZOGA 4LMNA 3V5LA 4QQ5A 4M66A 3FEGA 3GQIA 3MB6A 2YDIA 3FWQA 4LOPA 4QMUA 3R8ZA 4HJOA 4YJTA 3SVVA 3VS7A 2VV9A 4U9AA 2ONLC 3DFAA 4PWNA 1FBNA 2JDTA 2A4LA 3HNGA 4ERWA 5CT0A 3VUHA 5M08A 1Q8YA 2QKWB 4CKIA 3QA0A 2X4FA 3GI3A 3H9RA 4FV1A 4YLKA 3E3BX 5B2MA 1W0XC 5IUHA 4WUNA 4XV9A 1ZWSA 3QYZA 3BHUA 2R3GA 2I40A 1H1QA 3GVUA 4IQ6A 3BBWA 4FV0A 5AM7A 3MPTA 1KSWA 5CVGA 1AGWA 4Z55A 3A99A 4TYHA 3BQRA 3UVQA 3D5XA 3KMMA 4U80A 3TV6A 4FVQA 3HP2A 1VYZA 3FLWA 3T9TA 3TNPC 2QVSE 3U9NA 4UWBA 3PFQA 3SXSA 1Y6AA 3RPOA 3KCFA 4YZMA 3I1AA 5KMOA 5LMAA 4PL3A 3DLSA 3DLZA 4U44A 4MXOA 3BLQA 1ERKA 1RE8A 3K5UA 5AWMA 2F7XE 2C5YA 3FBVA 4G2FA 2J0LA 3DBFA 3I7CA 2XK7A 4JLCA 3BEAA 5I9UA 2XS0A 5ETIA 1MP8A 3M42A 3C1XA 1JKLA 5DG5A 4AOJA 2CNVA 3PSDA 4O7LA 4DGGA 4I0RA 4ZJJA 3LCDA 4O0TA 3R9RA 3FSKA 4YR8A 3LAUA 3COKA 1PXPA 4FYNA 1JSVA 2XJ1A 4IAYA 4JIAA 4GL9A 4X3FC 2BVAA 3MFUA 4DGNA 3FMLA 4BBEA 3PUPA 3N51A 4CQEA 2W0JA 3BYOA 3F7ZA 2VNWA 1HCLA 3O8UA 4Q2AA 4H39A 2OBJA 4IZ7A 5HG5A 4AE6A 4C2VA 3CPCA 1R3CA 4PDOA 3KRLA 5DT3A 4PTGA 1IRKA 4OTDA 4YC6A 2BROA 3QKKA 5EK7A 3JVSA 2G1TA 1H1SA 2GNJA 4YJSA 3NW5A 4EHEA 4L68A 4GH2A 3JUHA 4PPAA 4F9AA 2B1PA 5TT7A 2XVDA 4EQCA 3OCTA 3QWJA 4MYGA 4BDJA 2DUVA 3DGKA 2LAVA 3QRUA 4CNHA 5EI8A 3IONA 4FNXA 3FZRA 2C0IA 5AA9A 5EOLA 3ORIA 4B0GA 5JQ5A 2PZPA 4FSYA 1ZYCA 3ZEPA 4QMVA 3PJ2A 4M0ZA 1TQMA 4XUFA 2YDKA 2PMLX 1AD5A 3QGWA 3SOCA 4P4CA 4E6QA 2Y7JA 3SXRA 3FZSA 4CFUA 5A14A 3JPVA 4PP9A 3NCZA 4GW8A 4QPMA 3TUCA 4BTJA 2HZ0A 4BDDA 4FK6A 3TACA 2PPQA 4RX9A 1YI3A 3G90X 4IB3A 4OTWA 1KV2A 3E7VA 1PKDA 4PL4A 4USDA 3F5PA 1Q97A 4ZMEA 4QYHA 4TWCA 3ODYX 1ZXEA 4RX7A 3NNWA 1ZY5A 4G17A 4AQCA 3OT8A 5I9YA 2JD5A 4S2ZA 3HX4A 3M11A 4IWPA 4GFGA 4FTMA 4LGHA 3WI6A 5M56A 2ZDUA 3NAYA 4UMTA 2VZ6A 3BGZA 3TUBA 4U3ZA 5HTIA 2PE2A 3DQXA 3PYYA 2E2BA 4RIYA 3RVGA 5KX8A 4QYEA 2XIYA 3OCBA 2IG7A 3DKOA 4R1VA 2R0UA 3COHA 2JKOA 4EL9A 4I22A 1UWJA 5HLNA 4X21A 3DOGA 1Z5MA 3NIEA 1M2QA 4QOXA 5IKWA 2Z7SA 4FNWA 4TKSA 5CNOA 3L1SA 3OC1A 1YKRA 4Y8DA 5DH3A 4S33A 2R3MA 1OPLA 4XOYA 4OTGA 4DH5A 4U81A 4YTHA 3GEQA 3BLRA 3HUBA 3EYHA 5EW8A 5FLFA 2Y8OA 4UB7A 4Q9ZA 5DE2A 2QI8A 5BVEA 4N4SA 3R0TA 5IA4A 4FKLA 4FV2A 4AZVA 4UMUA 4UX9A 3VC4A 1FVVA 4RFYA 4GT4A 4ZOGA 2OI4X 4O7SA 4KSQA 2EUFB 2XA4A 4FL1A 3DK3A 5DWRA 4NFMA 1YDRE 1HCKA 3QKMA 2QR7A 3C0GA 3ORNA 1XBBA 1WMKA 4FK3A 4E8AA 4YP8A 3QTXA 4DTKA 3NUUA 2W1HA 1XH4A 4L3JA 3LMIA 2W1GA 1FQ1B 2QC6A 2VTAA 4E6AA 4G5PA 3MFTA 3QF9A 4DINA 4J96A 2YCSA 1OI9A 2OG8A 4QMQA 4XG4A 2XNEA 4EZ5A 3BEGA 4Y72A 1ZYJA 5JFXA 3ATTA 3V3VA 2R3KA 2J6MA 4WNOA 3CKWA 3FC2A 4LQMA 1H0WA 2DWBA 3KC3A 3OXZA 4FNZA 3BE9A 3OW4A 4O0UA 4QTCA 4ANLA 3UNKA 4ZTMA 1H1WA 4FGRA 2VTRA 4CSVA 3MI9A 2XYUA 2PHKA 2OIBA 3AC1A 4ZS4A 2WTDA 3KY2A 4KKGA 4X7QA 5GHVA 5AV0A 3VS4A 2WPAA 4BIEA 4O0XA 5E7RA 4OTPA 2G15A 2WMUA 5C8MA 4EI4A 2QG5A 3FLSA 3MH3A 4M68A 2W5HA 3RKBA 3IGOA 4EH2A 2FO0A 3ORZA 3HA6A 3ZUVA 3Q04A 4EK3A 1OBDA 5DR2A 4L43A 2C3IB 1EH4A 1OL2A 3PA4A 3Q4CA 2YM6A 5JRSA 2WD1A 5IA2A 3CY3A 3LPBA 4DTBA 3R9OA 1NVRA 2W99B 4EK5A 4TYHB 2UW0A 3RBWA 1WBNA 5I9VA 4TPTA 3EQBA 2F7EE 3FL4A 5IISA 3DK6A 4FZAB 4V0GA 4ZY6A 1XH8A 2UZWE 2WTKC 3DBDA 4YURA 3NLBA 3JYAA 4MAOA 5FG8A 2R4BA 4QT1A 5J7HA 5C9CA 4OGRA 3LFSA 5D41A 5L6PA 5LOHA 2B4SB 1P14A 3DAEA 3ANRA 4CCUA 3D9VA 4JBVA 3UTOA 5DYJA 5L3AA 2UUEA 2VWIA 1UV5A 1BI7A 3SC1A 5GZ9A 3R8PA 3HGKA 3ZRKA 5KHXA 3RMFA 3QQJA 4GIIA 4ZS0A 4D9TA 3B2WA 5GIPE 2NRYA 3GC8A 4PMSA 4I5HA 1YVJA 3TKHA 4F0IA 4FZFB 2V62A 4I1ZA 2W5AA 3AGMA 3F2AA 3OWKA 4EHGA 3HA8A 5AP7A 4GT5A 4E4NA 3ET7A 3UQGA 2ACXA 4AWIA 2WMAA 2HXQA 2C3LA 2R3PA 3TXOA 2PUPA 3HV6A 2C30A 1PY5A 4ZK5A 2YJSA 2Y0AA 4PNIA 5HTBA 5HCYA 4WG4A 5A4TA 5K5XA 3R1SA 3EOCA 2YM8A 3R21A 3KMUA 1OIYA 3QCQA 4X3JA 5AAEA 5IQHA 4AGUA 4I41A 2YWVA 5M55A 4FICA 1M52A 3W8LA 4X2NA 4AGCA 4ALWA 4NU1A 4BR3A 4JS8A 3TNIA 4W9WA 3BGQA 1R0EA 4IAFA 1OIRA 4J7BA 4NJDA 3PRFA 4DEDA 4PP7A 2J0MB 4RC4A 4BWKA 2R3RA 2X8EA 2PUNA 3R1QA 4I0SA 1YXXA 2UV2A 2CGXA 2QOBA 4RJ5A 4WG5A 4CZTA 3F3ZA 2R64A 4FTQA 1Q8ZA 3UC4A 1GIIA 4MEDA 4ANNA 4BKYA 1MUOA 2BAQA 5AX3A 2VTJA 4BN1A 3LQ8A 3GBZA 4J97A 4KWPA 4YUQA 4X6QC 2OH0E 3A60A 3BI6A 3LW0A 3WIKA 2YACA 3F3UA 5C4KA 3UP2A 2GU8A 2ZJWA 3C50A 4W8EA 4C33A 2B9JA 4E26A 3ZRMA 1ZMUA 5HLPA 3V5PA 1YHVA 4NIFA 2W7XA 4I92A 4YJRA 5CSXA 2ZM4A 4IBMA 4YGAA 4BYIA 1K2PA 4HGLA 4S31A 4RVTA 5BUEA 4DC2A 3ERKA 4EOLA 1FGKA 2OZAA 4FIHA 3T9IA 3LM5A 4OBOA 4JI9A 3QTUA 3RK9A 4CG9A 4BCMA 2R2PA 5LWNA 5AR4A 4NH1A 2GHMA 5DMZA 1OIQA 4M0YA 5F1ZA 4EBWA 5HBHA 4OAVB 4I93A 3ZFMA 2B55A 4ZTSA 5IH4A 1M2PA 4R3RA 2EXEA 1SNXA 3K3IA 3S2PA 4CLIA 4NCTA 3KA0A 4FTIA 5AAFA 3WZDA 5JT2A 3CD3A 3QQLA 3PJCA 3D4QA 4FG9A 3Q6WA 5FUTA 3ANQA 4ZAUA 1LP4A 3F7WA 5G1XA 3LJ2A 3R7YA 1Y91A 4CT2A 2NP8A 5EG3A 3CCNA 3FKLA 4RIYB 3W2OA 4ZZNA 4CFVA 4B9DA 2QODA 4BCPA 4YO4A 5CU3A 3HECA 4XX9A 5D1JA 4BWXA 3UQCA 1E1XA 2OJJA 5DI1A 4D58A 2C6OA 2UW5A 1RJBA 4DFLA 4NTTA 3PXQA 2XNGA 3MBLA 4F7LA 3H4JA 4XOZA 2PSQA 3VJOA 4BI0A 3P7CA 1J1BA 3E87A 4CMTA 5DRDA 4AT3A 1BUHA 3HV7A 4IW0A 5E8TA 3ZONA 5KCVA 4FSQA 4HCUA 4BTMA 4J95A 5CALA 5M44A 3F9NA 2HELA 3LFDA 2XIZA 4R7HA 4AW0A 3BV3A 2GQSA 1B38A 1JKKA 3QQFA 3BPRA 3QZHA 3PVUA 2YAAA 5A46A 1H4LA 2P33A 3Q5ZA 5EOBA 1FVTA 2WGJA 2FSLX 2G2FA 3UG2A 4QTAA 2R5TA 3R7IA 2VWXA 3NW7A 3ZYAA 3W2RA 4P90A 1X8BA 3OXIA 3BLHA 2PE1A 3DDQA 3OZ6A 4RPVA 1JSTA 3FQHA 2YIQA 2W4KA 1MQBA 4U0IA 4FEQA 4D2TA 2W4OA 3IDPA 2IN6A 4PDPA 3UIMA 3FZ1A 4IIRA 5HD4A 4FV5A 2OXYA 3TDVA 4IADA 3RWPA 3U4UA 4RGJA 3TZ8A 5I3RA 5E8YA 2YZAA 4FIEA 4NYEA 4EHVA 3Q9ZA 3AG9A 4ACMA 3Q5IA 1LR4A 1KE5A 4I23A 2I6LA 5AADA 5J9ZA 2W1IA 4R1YA 2CSNA 5L6WL 3SGCA 2WXVA 4FX3A 2WOUA 3F3VA 5AR5A 3A7FA 4FV8A 3FPMA 5DNRA 3E64A 4XG9A 3DV3A 2ITPA 4DG0E 3ALOA 4UYNA 4XG2A 4R77A 4BIDA 2C1AA 4DEBA 4P2KA 3RALA 4AFEA 4KAOA 5KBQA 4F63A 5T3QA 2XB7A 3BWJA 2WTJA 1M14A 3O71A 3ZC6A 4D5HA 2XEZA 3WF6A 3N4VA 4EK6A 2G01A 4PQNA 1R78A 4L52A 4O0YA 3W1FA 3OVVA 4JR7A 3W2CA 5F95A 2VTPA 3AXWA 3QCXA 2XKEA 4FV9A 3LCSA 4IANA 1B6CB 4WSYA 1I44A 1KE7A 4RT7A 4DFXE 3FZPA 4NM3A 5C8NA 2ITWA 3QUDA 3N9XA 4S30A 2R3FA 5EW9A 1TQPA 4V0GB 2ETKA 4FC0A 3HLLA 3WZKA 5IU2A 3POOA 4N6ZA 3P08A 3F2NA 2RSVA 5J5SA 3IGGA 2XH5A 3T3UA 1SZMA 1JOWB 4E4LA 4EH8A 2Q0BA 2UZOA 3KK8A 3EKNA 4DGLC 5IH5A 1V0BA 5KNJA 3F66A 3EH9A 3K3JA 3C9WA 4RJ6A 1V1KA 3GENA 2YIWA 3G2FA 3WIGA 5L2TA 3DKCA 5AFVA 2R3NA 3WILA 4RBLA 4Z9LA 4JQEA 5C4LA 5M06A 2BAJA 4NT4A 4KBKA 3KF4A 3PZEA 4JAIA 4MK0A 1YWVA 3S95A 3UZPA 3O50A 4IE9A 4RWJA 1XJDA 3UODA 3O0GA 4A4LA 1YHWA 2RGPA 3LZBA 2XK8A 2UW8A 2X8DA 2FYSA 4BYJA 4FVRA 4YTCA 2FVDA 5IQDA 4M97A 1WBSA 2UW4A 4E4MA 3A4OX 4C36A 5M57A 3SKCA 2WMWA 1SVGA 3R9NA 1OKVA 3KULB 5CU4A 4QMSA 1GNGA 5K5NA 2PYWA 5JK3A 3RPYA 5CF8A 4LRJA 1MQ4A 2Z02A 5F94A 4FSWA 3EQPA 3BBTB 4OTHA 1U54A 4U3YA 3QZFA 4E7WA 5ACBC 2XCKA 3H0YA 3LQ3A 5JZNA 4ASEA 2QKRA 4MHAA 3H0ZA 5KO1A 3ZFYA 1XO2B 3D7ZA 3O7LB 1UNLA 4KRCA 5JGBA 4QYFA 3NUNA 5IPJA 2Z7LA 1VJYA 4DFZE 2RFEA 4DBNA 3QQKA 5BUJA 1IA8A 4YC8A 5CASA 2HAKA 2JEDA 3O23A 2CKOA 4WKQA 1GIHA 3F5UA 1Q99A 3AMAA 5JGAA 2O64A 1H1RA 5AP4A 3UO6A 2OICA 5J95A 3VIDA 2C0OA 4EH9A 4KD1A 2XM9A 2WFYA 3ACKA 3W55A 4CKJA 3UIBA 5CI7A 2H34A 4FUYA 2VD5A 5CENA 3QXPA 3ULZA 4ITHA 3VBVA 4E1ZA 3BQCA 4E6CA 4KUJA 3VWAA 5EYMA 3HYHA 4XBRA 2JC6A 4DF3A 3PRIA 4NIFB 3QGYA 4O6LA 4KB8A 3QTQA 3ZLYA 4HVGA 2G9XA 3LQ5A 4MNFA 4UXLA 3ZU7A 4BDIA 2OZAB 3TZ9A 4FA2A 4QP8A 3FL5A 4WD5A 5CAPA 4UV0A 3DXNA 3IW5A 2BIKB 1WBPA 5ANGA 2UW9A 3ULIA 3F2RA 5AUYA 3TTJA 2J50A 4LOOA 4EJNA 3W18A 4EBVA 3RI1A 4X2KA 4EK8A 3CBLA 2GPHA 3BHYA 4ANQA 4RVLA 3FLYA 4BI2A 4KIKB 3F3WA 4OUCA 4E4XA 4YZNA 3RAHA 1CKJA 3GU5A 4BGQA 4LFIA 1FVRA 4K33A 4M84A 1QPJA 2YA9A 3EFLA 4JBOA 4FT0A 4GFOA 4ACHA 3OTUA 2XK9A 4O0WA 4ZSJA 2R3QA 4BY9E 4Q5HA 3D7TB 4FKOA 2ITXA 4J53A 2Q83A 1BLXA 2VTNA 3DB8A 3K2LA 4A9YA 3O96A 3JS2A 4BKJA 1IAHA 4TWPA 3KQ7A 1PXJA 4GG7A 2EXMA 4HVHA 4WHZA 3AGLA 5BNJA 5EQEA 3NR9A 3PPJA 4MXYA 2ITUA 4W8DA 1OECA 1J1CA 3N4TA 3DJ5A 3OG7A 4LMUA 4DFYA 2XK3A 4U40A 3DBQA 3LM0A 4XG8A 4O7TA 2EB3A 3EHAA 2R3IA 2P3GX 3U51A 4DLIA 4GK2A 5IDPA 5T68A 4H05A 3FE3A 3KXGA 3NPCA 4QMXA 2O8YA 3PY0A 5FM2A 4C4GA 4ENYA 1T46A 4OW8A 4ZLZA 2CNQA 1WBTA 1OL5A 4BHNA 4DH7A 3NVMB 1OKZA 2R7BA 2JDOA 3WF7A 3IOKA 1MRUA 4RIXA 1J7UA 2W1EA 5CLPA 2BMCA 3DXQA 3MGYA 4O81A 4YHTA 3WF5A 4AZSA 4EOMA 5J9LA 3P79A 2XP2A 4E5WA 3EQCA 2OXXA 4FG7A 3CLYA 3G6GA 4BDKA 4KNBA 4FBXA 4ALVA 3R04A 4A9SA 4AACA 3BKBA 4H58A 4AZEA 4WBBB 4O7YA 4L8MA 3IDCA 3RZFA 3DBCA 3PXFA 4YZBA 4GEOA 5B0XA 4HPUE 4J1RA 4FKJA 4MXCA 3FXZA 2XJ2A 4M13A 4XV3A 5H8BA 3SDJA 2QNJA 3ZSHA 4DEIA 4LRKA 5D12A 4BBMA 4IAAA 3RNYA 3NMUF 2ZV7A 4QP7A 4IB5A 4W4VA 2O65A 3C0IA 5DN3A 1Q8TA 2ETMA 2CLQA 2NPQA 3OOGA 3II5A 3EFJA 3QUEA 4PL5A 3RK5A 4CMUA 1PJKA 4KINA 4F1MA 5LVOA 1U5RA 3GCPA 2HWOA 2QQ7A 5KMKA 5HX8A 4LUDA 4ACGA 2R3JA 3FZTA 4M8TA 4XCUA 3GP0A 1BYGA 1QPDA 3C13A 3E8NA 1WFCA 3EN7A 4FOCA 4QP1A 3NNUA 2HZNA 3EQRA 4CRLA 4G34A 4DEAA 4I6FA 2WTWA 4TRLA 4PDSA 4DGMA 4HNFA 2VAGA 2IZSA 4MD7E 3E5AA 2AC5A 3KXMA 3JVRA 1SVHA 3LJ1A 3BHTA 3QA8A 3C5IA 4FL3A 2B54A 3GU6A 5K4IA 3NVKI 4IB0A 4BZDA 1H07A 5JH6A 4FKWA 3WE4A 4QMMA 3VF9A 4MCVA 4F65A 5BPYA 5AR7A 4DFBA 3PXRA 3AC3A 1TQIA 4Z16A 2VTMA 2YN8A 3VBWA 3BGPA 3R7UA 2C0TA 5CF4A 1FMOE 2JAVA 2X7GA 3QC4A 3P9JA 3D94A 3RHKA 4FTUA 4EUTA 3DKGA 4HNIA 5CQWA 4ONAA 2X81A 5CVFA 3V8WA 2F2CB 4AAAA 3FV8A 4PTCA 3Q52A 3IS5A 1JAMA 4RSSA 5HZNA 1GY3A 5CZIA 4QNYA 1Q4LA 2VWBA 4FVPA 4JVGA 2WOTA 5IZFA 3IW6A 1L8TA 1BKXA 1VZOA 3C4ZA 5DR6A 5J8IA 5K0KA 2P0CA 3LFAA 4DE4A 4I6BA 4P7EA 1SYKA 1VYWA 3JY0A 4O2ZA 3QRKA 4M7IA 2EWAA 4GYIA 3UJGA 5BVOA 3A7IA 3QBNA 5AP2A 1NY3A 4XRLA 3NX8A 2WTKB 3EIDA 4FG8A 2CPKE 2CN8A 3C4EA 4UALA 4B8MA 4Y5QA 4QTBA 4JDIA 4HW7A 5DLSA 5BMMA 3LJ0A 3QKLA 4EOOA 4NUSA 1UNHA 1UWHA 2V5QA 4EC8A 5J7BA 2XCHA 4NJ3A 5E91A 4K2RA 5EM7A 4F7NA 5CU2A 2P2HA 2QOCA 2W96B 4QMZA 4FKPA 4F7JA 4ASDA 1U54B 4G3DA 4IX4A 4CRSA 4M69A 3MB7A 4XYFA 2WIPA 1NA7A 3CSVA 2GS6A 2VO0A 2WEVA 3NYXA 3RAKA 2FH9A 2JKKA 4AF3A 1RDQE 1ZRZA 3SLSA 3MA6A 4F0GA 3EL7A 3FDNA 3P86A 3R28A 4FMQA 4HYSA 3VUDA 3RK7A 2PVNA 3FLZA 4G6LA 2XYNA 4NM5A 5KZIA 3IW4A 4GSBA 3O7LD 2SRCA 5LJJA 2YM7A 3KEXA 2X6DA 4FF8A 2BKKA 2VWZA 2PZYA 4HGSA 3KRJA 3QRIA 2VN9A 4NWMA 3V5WA 4HZRA 4O0RA 4RWLA 4CFWA 5KE0A 3UOHA 1JPAA 1H1PA 1L3RE 1PW2A 1V0OA 1ZY4A 4L42A 3G9NA 3WE8A 3D2IA 5CAOA 3L8VA 4EOQA 3DB6A 2VWYA 1H25A 3FMKA 3FPQA 4HVDA 2A2AA 4IDTA 2PE0A 2PULA 4RX8A 1DAWA 3MV5A 4FKVA 2J7TA 1XR1A 4FKIA 4BZOA 2JFLA 1SMHA 2HZIA 3CGOA 4JG6A 4QPSA 4GV1A 3W32A 2XBJA 3ZO4A 2AC3A 4QP9A 2WO6A 5H3QA 3K54A 4DEHA 2YHVA 4JQ7A 4NCTC 4OAUC 3ORKA 2BRMA 3FYJX 2UZNA 4G5JA 3OY1A 5K3YA 5A54A 2R3HA 3DDPA 3VBYA 2BRBA 1OB3A 4D2WA 3TM0A 1P2AA 1REJA 2IJMA 3WZEA 4AN9A 3Q9WA 2JAMA 4N0SA 3NEWA 4X0MA 4HZSA 4D1ZA 3FYKX 5AR2A 4QMLA 3VJNA 2B52A 1ZMVA 3LXNA 3R9HA 2NRUA 3ZZWA 4GVAA 1YOLA 2W06A 3D14A 4RFZA 3DT1A 1YRPA 4BCKA 5JMSA 4QRCA 4O7WA 2WQBA 5HCZA 4MVFA 4YJOA 5AV3A 4JAJA 3SXFA 5LXMA 4RLLA 4MTAA 3UE4A 4O27B 2DS1A 2VO7A 1NXKA 2YERA 2FA2A 4FKTA 2HXLA 4EOSA 2C5OA 1I09A 1O9UA 2VTOA 3A8XA 2PZRA 3MJ1A 4XV2A 3IQ7A 2IVUA 3A62A 2Q0NA 3OW3A 4K8AA 2R3OA 1LEZA 4NW6A 5HCXA 4W4WA 4K11A 3SOAA 3G6HA 3ZMMA 3PZHA 2PK9A 5AP5A 3SAYA 2F57A 3QQUA 2QO9A 1BI8A 3CP9A 5E8WA 4ZJVA 3ORPA 1U46A 1PMNA 3Q4UA 3RAWA 3UOLA 3HMNA 5FDPA 5BYLA 2HIWA 4RIXB 4LG4A 4Y83A 5IUIA 4TL0A 5J1VA 4U5JA 4FL2A 4U8ZA 5IUGA 5H9BA 1W82A 5L2QA 3DCVA 4F9CA 1GZOA 4GKIA 2XNOA 3DJ6A 4JBPA 4Q5EA 5DHJA 4FT9A 3UC3A 4B8LA 3A7HA 2V0DA 2QONA 5TR6A 2J0IA 3QQGA 3R71A 3ITZA 1YDSE 1XQZA 5DT0A 2VO6A 3BU5A 5K9IA 5M4CA 1ND4A 2O63A 5TF9A 4RWKA 4U97A 3SHEA 4TYJA 3G15A 4CT1A 3O8TA 5ACKA 2E9VA 2ZB1A 4JQ8A 5ANJA 5J87A 2Y4PA 3G0EA 4JJRA 3IPHA 5KHWA 5FXSA 2H6DA 5GINE 4GUBA 4QO9A 3FY0A 5KUPA 3KXHA 3E88A 3UMWA 5BVKA 1OGUA 5GZAA 5CTPA 1PYEA 4U6RA 4ITIA 4U45A 4E3CA 3AD6A 1Y8GA 4AG8A 4RJ4A 5M09A 4XJ0A 2VTLA 5FM3A 4DYMA 4YPSA 4QYGA 3ZC5A 5H8GA 5HIDA 2BHHA 4O7ZA 4FTCA 1QL6A 2YM3A 5DT4A 5EDQA 5KBRA 5JRQA 4PX6A 2B9HA 5IMEA 4RJ7A 4BCQA 4O96A 3VHKA 3BIZA 5EFQA 3MVJA 2OK1A 5IQEA 2YIRA 5F20A 5L8LA 4O83A 4F9BA 2VWWA 2ESMA 3F5GA 2VTQA 4W4XA 2BHEA 2CGWA 4BDGA 3QC9A 4XHKB 3UOKA 3KGAA 4U41A 4H3QA 3ZH8A 5IMXA 1HOWA 4K0YA 1UKIA 3TDWA 1GIJA 3K5VA 4MWIA 2JDVA 3CJGA 2IW6A 2ITNA 4JL9A 5CAQA 5EYDA 2Z2WA 4BTFA 3I5ZA 3MFRA 2UZDA 2WNTA 4AU8A 5E92A 1ZZ2A 1JBPE 4IZ5A 3C5UA 3EKKA 4J71A 1OL1A 3KXZA 1VEBA 2BDJA 3ZBFA 4BB4A 3D15A 4B6LA 5JEBA 4QP4A 1W98A 3DNDA 2GFSA 2GS7A 3A7JA 2H96A 5ANKA 3FXXA 1JWHA 4EZ7A 2WQNA 2UZLA 5EI2A 1W8CA 2IZTA 2VNYA 2WIHA 4C59A 2XKFA 3Q4ZA 5I0BA 2IZRA 3QYWA 4EC9A 1KE9A 1OUYA 5FBOA 3FMJA 3HP5A 4G31A 5HO6A 3ZO2A 4BF2A 2W4JA 4ZXTA 3LMGA 4EHZA 5EHOA 4AX8A 4NFNA 1WBWA 2JLDA 4PF4A 3VBQA 3MYGA 3OUKA 5CNNA 2OWBA 4ZTNA 2BILB 3CQEA 3EB0A 1KE8A 4MD8E 4K18A 2I0EA 1H01A 2FSOX 4TYGA 3EZRA 4RA4A 4FV6A 1G5SA 2WMQA 3OD6X 4ASZA 2X2MA 5CI6A 1PXOA 5EH0A 4M69B 2PVKA 4MF0A 5LVNA 1Q41A 3FMDA 3OCSA 4CG8A 3PIYA 3TNHA 3I79A 2JBOA 3CJFA 3L8PA 3MPAA 3QCYA 2Z7RA 4FSRA 4GRBA 5AR8A 3W33A 4D2PA 3A8WA 4UYAA 3FI4A 2B7AA 3GOPA 3TV7A 2B53A 2E9PA 2UZEA 5HE2A 1YWNA 3ELJA 5CXHA 2CLXA 5DEWA 4L53A 5FEEA 2OZOA 2WU6A 2YAKA 5GNKA 4EOIA 4FSMA 3GB2A 4YJPA 2CDZA 2HCKA 2XKCA 3U54A 4XG3A 1LUFA 4YJQA 3VBXA 2VRXA 4AA0A 2YDJA 2OJIA 1W83A 4AGWA 3CE3A 1JLUE 2OJGA 3C4XA 3OFMA 4O1OA 1PHKA 5FWKK 2F49A 3RGFA 3V5QA 4C4EA 3TV4A 4KSPA 4P5ZA 2O5KA 2XM8A 3CQUA 3FI2A 2OKRA 3TI1A 5KMLA 4IAZA 4FOBA 4BDBA 2C5VA 2BZJA 3GU4A 2GCDA 2LGCA 3LFCA 2XK4A 4EK4A 5E1SA 4F0FA 3DZOA 4S32A 2CNUA 2C6IA 3OOMA 3VF8A 4KA3A 5AUTA 3PPKA 5BVDA 1A48A 4E5BA 3D83A 4EH7A 3FMMA 3UDBA 5CY3A 4IM3A 1YI6A 3VS5A 3AT2A 2C3JA 4LYNA 2CCIA 4XP2A 3PG1A 5CZHA 4IVBA 3V6SA 4BWPA 3G5DA 3RJCA 3VN9A 4IX3A 4U43A 4FTLA 4K1BA 5C1QB 4C8BA 3Q32A 3NUAA 4XP0A 5E4HA 4RVKA 4PMTA 1FGIA 2BTRA 4RIWA 4TN6A 4QYYA 3DQWA 4D9UA 3FMEA 3ZLXA 1OMWA 4WG3A 4GKHA 4WSQA 3WYXA 3PE2A 4L9IA 2WU7A 3FC1X 4ID7A 2YM4A 1YWRA 3CKXA 3OEFX 3QWKA 3VUMA 2RFNA 4DH8A 2XNNA 2FSTX 4DLJA 1O6KA 3SA0A 4GCJA 3DBEA 2UVXA 4BDFA 4L01A 2OFVA 3UIXA 5IEVA 3KRWA 3HRBA 3RWQA 5EW3A 3SW4A 2C1BA 3VO3A 3KN6A 2UVZA 2GNGA 3ZO1A 4BVUA 1CM8A 1OKYA 4F09A 5HIEA 3NUYA 4GK4A 1F5QA 3KK9A 1E1VA 3I7BA 4FTJA 3RINA 2YITA 3VAPA 1OBGA 1JKTA 1P4FA 2YEXA 5AP1A 5TOZA 3I81A 5HU9A 3GUBA 4EWHA 3MH2A 4XLIA 1Z9XA 2BDFA 4YJUA 4G16A 3VUIA 4FSUA 5IDNA 1A9UA 4AZFA 2UW3A 4Z7GA 3E63A 4ITJA 5H8EA 3UBDA 5IA1A 4JT3A 4ZJIA 5AUWA 3VRZA 3DJ7A 3E8DA 3IG7A 4NKSA 4AA4A 2XMYA 5C26A 4IVCA 2PVLA 4YTFA 1FINA 5CSPA 2YCFA 4FE2A 4BDHA 3OHTA 4FKGA 2GFCA 4V05A 1H28A 2OJFE 3TNQB 1R1WA 2Y9QA 3G9LX 4HVSA 3S00A 4RA5A 5EHYA 5KKRB 4MXXA 2QOHA 3ID6C 4FEVA 4CGAA 2ZV2A 3ROYA 5ETCA 4I5CA 4FZ7A 2A0CX 5E9EA 3NIZA 4G3CA 4ANMA 2CJMA 3NRMA 1WVXA 2J5EA 2WAJA 3CEKA 4I24A 2BPMA 4O86A 2PZ5A 4M15A 3W2QA 2CKEA 1GOLA 4AT4A 1YDTE 4WRSA 3M2WA 3RZBA 5CAVA 3OEZA 3UOJA 3BE2A 3HDNA 5ANOA 2PUUA 3BRBA 1PXIA 3ENHA 3HRFA 5LQFA 4O84A 4YSJA 1PKGA 4NM0A 4UMQA 3EL8A 4O38A 2JITA 3WZJA 2ETRA 3DKFA 1RQQA 2VUWA 5GZ8A 5J79A 4CFXA 5LMKC 4D0WA 4I6HA 4ZZMA 4CV9A 5D11A 3QFVA 4RMZA 5JSMA 2F7ZE 1G3NA 2ZMDA 4MQ1A 4AP7A 4W4YA 2G2IA 3MVMA 4OBPA 3ORXA 4RZVA 3W10A 4DG2E 4DGOA 2DQ7X 2I0VA 4YNEA 5ANEA 4IJPA 4MX9A 3KU2A 4CCBA 5IEXA 1VR2A 2BZIB 2WQEA 2PVYA 4QP6A 2AUHA 4A4OA 2O2UA 3E8EA 5DPVA 2OLCA 3NCGA 4DEEA 4USFA 4D4VA 3CTJA 4BHZA 2J4ZA 3MSSA 3VS3A 3OP5A 5GJGA 3UZRA 4I4EA 5HE1A 2JFMA 5HG7A 3DAKA 1S9JA 5CQUA 3EN4A 5M51A 1YQJA 3PSCA 3R73A 4GYGA 1UU8A 4G6NA 1UU7A 3LFQA 4EYJA 3NGAA 4C7TA 3GFWA 1H27A 3MESA 3IW7A 3P0MA 2JDSA 3SRVA 4LRMA 2I1MA 4JG8A 1NVSA 3DNEA 4FV4A 4FEXA 3AOXA 1OPKA 5L6OA 4JDJA 5CEIA 4C35A 3W16A 5DR9A 4YO6A 3PLAE 1WBVA 3I4BA 3NZ0A 4EKLA 3BYSA 4Z3VA 3TIZA 2X2LA 1BMKA 4J52A 3A4PA 4KIQA 5AP3A 3TEIA 5AUUA 5CEKA 2HWPA 3C4WA 3VULA 3MVHA 1H26A 4HPTE 2YLEA 4XV1A 5LVLA 3PP0A 4H1MA 5D9HA 4Y73A 3PXKA 3L8XA 3EQDA 2XIKA 3EQHA 4U79A 3S0OA 2BFXA 4Q9SA 5HESA 2QHNA 2V7AA 5HIBA 4TZRA 4B4LA 2JKMA 5KMJA 4JRVA 5GIOE 3POZA 5C03A 5CF6A 1XHAA 2JIUA 2YCRA 5LCKA 3CR0A 3FI3A 4A9UA 3BCEA 3MFSA 4PPCA 4EORA 5BVFA 1OL7A 1IG1A 1KOAA 4EYMA 3UQFA 1XBAA 2HK5A 3GU7A 3TTIA 4B99A 2GTMA 5FP6A 5TKDA 3SD0A 4KBAA 4QMPA 3SG8A 4AZWA 4HCVA 4OBQA 1UA2A 5HE3A 1OIUA 3ZSGA 4I3ZA 3DFCB 5E8UA 2C6MA 1GAGA 2XRWA 1REKA 1U59A 5CX9A 3UO5A 1G8SA 1J91A 4BICA 3P78A 2GNFA 4LGGA 4IMYA 2PUIA 2PMIA 4QMYA 4ZLOA 5B2LA 4DAWA 5CEPA 3CTQA 2QOOA 2WKMA 4F6SA 3RAIA 3R7OA 4BCJA 5CS6A 3WARA 2VTSA 5IQCA 3T8OA 4DT9A 4RIWB 4YJNA 1O6LA 2P4IA 3TKIA 4QP3A 3UNJA 4CMOA 4WOVA 3PY3A 2VTTA 1DM2A 4AOIA 5D7VA 4CTBA 1FOTA 2W9FB 1ZZLA 4XEYA 4UY9A 4FSTA 1CDKA 2QCSA 2X1NA 3GFEA 5KMMA 4NTSA 4AN3A 5CF5A 2YIXA 1YXSA 3HAVA 3LOKA 5FTOA 5IG1A 1BL7A 1QPEA 1ZMWA 2X39A 4MWHA 3ETAA 4IB1A 1K3AA 4YC3A 3ZBXA 3TNWA 1PXMA 3QZGA 2ZDTA 4KRDA 3R7VA 4I94A 5G6VA 3H9FA 4GS6A 4J8NA 3LCOA 4ARKA 3FXWA 2J0KA 3EJ1A 4PTEA 3U6IA 3QLFA 1XH7A 4YLJA 2X7FA 1Q8UA 4PMPA 4BCIA 3DY7A 4O7VA 3H10A 4PY1A 3EQGA 2RIOA 2WB8A 4Y85A 4CEGA 2GS2A 4FV3A 5GJDA 4BFMA 3EFWA 3NWWA 3W2PA 3QD4A 3OUNB 3QTWA 3I5NA 1G8AA 1PYXA 3F5XA 2UVYA 4L46A 4L6QA 4LL5A 4YMJA 4L3LA 2IVSA 3O8PA 3QZIA 4GVJA 5EM5A 3ZLSA 1OL6A 3NYNA 2ZVAA 4ALUA 3I6WA 4RJ8A 4EUUA 4PNKA 3ZHPC 3MJ2A 4GUEA 5LARA 3VUTA 4WNKA 4YNOA 4C02A 5KKRC 4DCEA 2QURA 4G9CA 4KS7A 2VWVA 5EYKA 4R3CA 1GZNA 2C3KA 2ITQA 3GXLA 3I6UA 4G6OA 4GFMA 2PWLA 4Y46A 4ZIMA 3V5TA 3RCDA 4FI1A 5IA3A 3EQFA 5HX6A 3E93A 2CCHA 3HMIA 2V22A 3BU6A 3HV3A 4GG5A 3Q60A 5HG8A 2I0YA 3FKOA 2ZM1A 4JBQA 4ANBA 3UVPA 2E9UA 3Q6UA 4EH5A 3ZZEA 4ANSA 1MRVA 1DI8A 3HV5A 4R6VA 3NNXA 1NT2A 3R9DA 3I60A 3TG1A 2ZOQA 4G3EA 2F4JA 4XRJA 4G9RA 3MY5A 2VU3A 4NZWB 4KIPA 3GOKA 4FKRA 5AUXA 4EOPA 2BRGA 3DK7A 3QL8A 3SG9A 4XBUA 4L7FA 5EHLA 1PMVA 3LXLA 3V8SA 4FTOA 3OY3A 1OM1A 1UU9A 3MPMA 3EFKA 3SW7A 4F1TA 4C38A 5HVJA 1ZYSA 4H3PA 3FHRA 4M14A 1R0PA 4DEGA 3R8UA 4EQUA 3KVXA 5FGKA 1XKKA 2PVJA 5AP0A 4V01A 2OXDA 4JOAA 2C6KA 4FTNA 4BKZA 1M7NA 2OO8X 5HNGA 5DGZA 1JNKA 5GJFA 3R83A 2CHLA 4ERKA 2CN5A 4WBOA 4YJVA 5IH6A 3U6HA 5FP5A 2GHGA 4FKQA 5L2WA 4R3PA 2QOIA 4I5MA 4AS0A 4BI1A 5LMKA 3BZ3A 1BX6A 4MKCA 1OVEA 2JBPA 2E9NA 3EMGA 4XG7A 5FTGA 3OROA 5IQIA 5M4FA 4HCTA 4G1WA 3E7OA 4UXQA 4HVIA 4ZY5A 2WMXA 2RG5A 1CKIA 2WMVA 5EDPA 3QXOA 2WEIA 3UNZA 3L9MA 3SRVB 1GJOA 4ZTQA 4QD6A 4CV8A 3NUSA 3UMXA 1U4DA 3O2MA 2WHBA 4O7RA 4O91A 4RRVA 3ZXTA 5CEOA 5I9XA 4MH7A 5IQGA 5B2KA 5CSHA 4O21A 2F9GA 4TT7A 4AUAA 4L44A 4LM5A 4TWNA 5EI6A 4WIHA 1JQHA 1UNGA 4BIBA 2Z7QA 1XH9A 1YHSA 2BKZA 4EH6A 1QCFA 1DAYA 1KE6A 3RPRA 5LVMA 5DRBA 2C6LA 5DEYA 5AUVA 4R5SA
chains in the Genus database with same CATH superfamily
3KN5A 4FNYA 2ZYBA 4DTAA 1ST4A 4M67A 3H30A 5C27A 2J2IB 4HYIA 3PTGA 2Y4IB 3AC5A 2W1ZA 3LCTA 1URCA 2VWUA 2HW6A 4LI5A 5E8ZA 3Q53A 1ZOEA 4X2GA 4I20A 4QTEA 5J9YA 2XK6A 1TKIA 4ZLYA 3O51A 2GNLA 4IAIA 3OT3A 2W5BA 4RVMA 4QMWA 1W2CA 2X4ZA 2ERKA 4AW2A 4QQTA 2RFSA 5IQBA 4D4YA 4HYUA 4XP3A 5HGIA 5HNBA 4FSNA 4A07A 5HKMA 3ENMA 3FLQA 2Z8CA 4ZZOA 3HL7A 4JNWA 3RNIA 3ZUTA 4MBLA 4BCHA 2XJ0A 3BX5A 4CVAA 1DI9A 3NUXA 4D2SA 2FSMX 4IX6A 3FQEA 5F4NA 5HVYA 3ZRLA 3RPSA 5AIKA 4AN2A 4BCGA 5M53A 3A7GA 3WOWA 3RM6A 2OF2A 4AXAA 4OT6A 4X2JA 1XMMA 2C6DA 3Q4TA 2WTCA 4FSZA 3M1SA 2R0IA 1JSUA 5FEQA 3TN8A 2PVMA 1Q3DA 4UN0C 3Q9XA 2P55A 1TVOA 2I7QA 2GTNA 3Q2MA 4PV0A 3A61A 4J99A 5CEQA 3QLGA 2BIYA 2XNMA 4D55A 5K4JA 4S34A 4J8MA 4QMOA 5CT7A 5JKGA 2UZUE 4L00A 4FTKA 5CU6A 5ETAA 4D5KA 5IA5A 4EH4A 5EKNA 3H9OA 3I0OA 3IK3A 3R1YA 5HEZA 3TL8A 2ZV8A 3MY0A 3UO4A 4FT5A 1M17A 1XBCA 2GQRA 3E3PA 4XNEA 3C4CA 4QP2A 2PU8A 2PY3A 3EN6A 3H3CA 3PY1A 5D7AA 5J5TA 4YBKA 3TCPA 5HO7A 2GMXA 3TUDA 2PMOX 5JN2A 3PPZA 2RKUA 3HV4A 4O82A 3DPKA 4K77A 3KFAA 3A2CA 3BYMA 1Q3WA 2QU6A 4BC6A 2EU9A 5A4LA 2OF4A 3F82A 2UZVA 1M7QA 4IC7A 3PIXA 4CXAA 4WUAA 3WBLA 3CTHA 4IM2A 4P5QA 4UBAA 4XS2A 2YM5A 4LL0A 4IZYA 4O2PA 4ZTRA 3NNVA 3QALE 5I9WA 3HKOA 2CKPA 5EDRA 3ZDIA 3NYVA 4FKUA 4ENXA 3VONA 3ZDUA 1IR3A 5J1WA 2FUMA 4ZSLA 2QO7A 3MDYA 1SM2A 4IACA 2IW8A 3EZVA 3L9PA 3RM7A 1IEPA 4I21A 4QMTA 4F4PA 3CY2A 4LV8A 5BQ0A 5AM6A 5CU0A 2ITOA 3LFNA 1WZYA 3AT4A 4C37A 3KL8A 4FIJA 3W0SA 3TZ7A 4TNBA 3PP1A 3QD3A 4C4JA 4FR4A 2AYPA 2HW7A 4AE9A 2WELA 3C4FA 3LVPA 3MW1A 4AGDA 4F64A 4BGGA 1FPUA 4MQ2A 2C5XA 2C5NA 1H24A 1LPUA 2KULA 2GNHA 4IXPA 4JDKA 3HEGA 4MBJA 5FTQA 3WZUA 2RF9A 4EEVA 2OU7A 3MN3A 4UEUA 3U55A 3PWDA 4F9WA 3FSFA 4O0SA 5AJQA 4L45A 3PXYA 1H00A 4R78A 3ROCA 5HG9A 4C3RA 5EKOA 4N57A 4JX3A 2WMSA 5ETFA 5T6KA 5HTCA 5JQ8A 2ZMCA 1F0QA 3JXWA 4XLVA 4F1OA 2CKQA 3UGCA 3S3IA 4YPDA 3GCVA 4C4IA 1PXKA 2VGPA 4O4DA 5HE0A 3VHEA 4DCAA 3SX9A 3DTCA 4F9YA 4MF1A 3DS6A 3UPZA 2HY81 3KKVA 5FBNC 3UYTA 3VQUA 3ZFXA 2ITTA 4PMMA 3OXTA 3LMHA 4DFUA 4W9XA 3NW6A 3BV2A 2ZB0A 5FD2A 3VS1A 5A6OA 3QTRA 5M4UA 4PDYA 2CGUA 2XNPA 2BRNA 4AFJA 4DBXA 2OSCA 3GU8A 3DZQA 4YU2A 4TWOA 3IKAA 5AP6A 3R63A 4Y5HA 4CYIA 3ZLWA 3R30A 3R6XA 4AW5A 4HGEA 1STCE 2B9FA 2V55A 3U9CA 3U6JA 2BR1A 4BCNA 1AQ1A 2XNBA 1YW2A 2HZ4A 4CKRA 2YJRA 2A1AB 1H8FA 5KMIA 1CTPE 5K0XA 4I6QA 4F70A 1M2RA 2C6TA 4FKSA 4CTCA 3PA3A 4AZTA 3KRXA 2BUJA 5IF1A 2IWIA 4MBIA 2FB8A 3AC8A 2IPXA 3TMOA 4UWCA 2J90A 4YZ9A 3DA6A 3VS0A 4FT7A 4NL0A 1Y57A 3OTVA 4EQMA 5HQ0A 3QTZA 4QPAA 3SV0A 4AOTA 3ATSA 5I5ZA 4MXZA 2CMWA 5L4QA 4RWIA 4OT5A 4C4HA 2JIIA 3KVWA 3IW8A 4IWQA 4CFNA 4YHFA 5AAGA 4IDVA 5L2SA 3PLSA 3LLAA 3NAXA 3MS9A 4O4EA 4H1JA 3TJCA 4D4SA 3HDMA 5L2IA 3VUKA 3QU0A 1OITA 3MWUA 2OH4A 4YSMA 3Q2JA 3HMPA 4J98A 2Y4IC 3Q9YA 1J7IA 3OF0A 4FIGA 4A9TA 2GQGA 2XF0A 3U4WA 4APCA 2QO2A 4OLIA 5A4QA 4ORKA 2A27A 4O4FA 2X9EA 3PWYA 2ZV9A 4HGTA 5FQDC 3OS3A 3ZM4A 2DYLA 3ALNA 3QX4A 5L8JA 3O17A 5CWZA 4TTHB 2ONLA 1CMKE 3VVHA 1Q62A 1U5QA 3Q96A 3ZOSA 2PMNX 3P7AA 4QEBA 2JDRA 1S9IA 4KABA 2OW3A 3AMBA 3B8RA 4ZY4A 3TT0A 4EH3A 3LKMA 3G51A 2WMTA 1ATPE 1BL6A 2ZM3A 5BMSA 1IASA 2UW7A 5E8VA 3GC7A 2VGOA 2NNWB 3C7QA 4BDEA 2WTVA 4DA5A 3UZTA 3LFFA 4IM0A 3CIKA 5HORA 3NS9A 4YHJA 3AQVA 4D2VA 4IH8A 5AR3A 1Z57A 2O3PA 3RP9A 3UG1A 4UMPA 3OBJA 2B9IA 3W0NA 3KULA 3QX2A 3R02A 4FODA 1PRYA 1APME 4II5A 4RQVA 3LE6A 2J9MA 1ZYLA 4D2RA 4F6WA 5M4IA 4G3FA 3F69A 2BCJA 2X9FA 3C51A 4YLLA 4C4FA 4QDVA 1K9AA 4O6EA 4OTQA 3F61A 2PL0A 5M07A 3CD8A 2X6EA 4ZSEA 4AA5A 1B39A 1ZARA 3QRTA 5EQYA 1WVWA 1JKSA 3QRJA 1ZLTA 2GNIA 4X3FA 4ZTHA 3C0HA 4ACCA 2EXCX 1PF8A 3CGFA 4I5PA 4M3QA 4OTRA 5EM8A 3QHWA 3MTFA 5HD7A 1OUKA 2BZKB 4ZEGA 4BBFA 3ZEWA 3AKLA 3F88A 4DN5A 1W7HA 1NVQA 3L8SA 1YI4A 2R9SA 4TYIA 3F6XA 4IFGA 4E93A 2J5FA 2WMBA 5I4NA 3KF7A 2Y6MA 3AD4A 1LEWA 2XKDA 3PJ8A 5B7VA 3QCSA 4PRJA 3GGFA 4RG0A 2NO3A 4EOJA 4D1XA 5F9EA 4AT5A 4F99A 4EWQA 3B8QA 4DG3E 1WBOA 3IECA 4FGBA 4IJ9A 4WNPA 1TZDA 4FTTA 3LXPA 4EKKA 4A06A 5IQFA 3VBTA 3R1NA 3E62A 2QOLA 3KB7A 4JDHA 3BYVA 3PVBA 5DA3A 3DAJA 1MRYA 4O0VA 3SQQA 1NW1A 5TO8A 3NSZA 1DS5A 5BX0A 3HAMA 5E8SA 5AIRA 5AUZA 4CZUA 2H8HA 3OCGA 4IEBA 3GQLA 5IA0A 3AC2A 3Q3BA 4BCFA 4E73A 5AV2A 2BAKA 4KIKA 3QD2B 5HHWA 4E5AX 1E9HA 2VX0A 4D0XA 4XMOA 5DVRA 5BVWA 2YLFA 3BWFA 4FEWA 1V0PA 3VNTA 2IVTA 5HI2A 4L3PA 2OFUA 2BDWA 2W1CA 3NUPA 4IAKA 5FDXA 3OBGA 3RHXA 1Q61A 2PVFA 3V8TA 3FJQE 3R2YA 4FIIA 3D7TA 5AV1A 4DH1A 3CS9A 3B2TA 2X8IA 4IHPA 5BYYA 3E8CA 3EYGA 3FZOA 3WF8A 5IQAA 4TXCA 4A9RA 4RIOA 4NW5A 4IFCA 2W9ZB 4FTRA 2WZJA 3I0QA 4G3GA 3ZUUA 2JGZA 2XRUA 1PXNA 2QU5A 3GCUA 5CYIA 3PXZA 5DBXA 1WVYA 4ZMFA 5HOAA 3CQWA 4PUZA 3R2BA 2JIVA 4QNAA 4MXAA 1KWPA 3GC0A 5A6NA 3N4UA 3W2SA 3HVCA 4C3FA 5C8KA 3ZXZA 1XH5A 4GU6A 2W1DA 1SVEA 1YXVA 3FHIA 4CFFA 5E1EA 3ZM9A 3EQIA 3R7GA 3ZS5A 3MH0A 3LXKA 5ANDA 3IDBA 2O0UA 3FAAA 3KMWA 4C3PA 5LCJA 4O7NA 1H08A 3BHVA 5BVNA 2OIQA 2H9VA 4MNEA 4BCOA 3BU3A 1YXTA 3PJ1A 3ORLA 4ANOA 2X7OA 4WO5A 4R8QA 5CAUA 4APPA 3MA3A 2ITVA 4BGHA 3JR1A 1UVRA 3PJ3A 1O6YA 4ZSAA 1Y8YA 2REIA 2RFDA 4QTDA 4BTKA 4DITA 2C68A 4EONA 2PZIA 3R8LA 1W84A 4KKEA 3HMOA 4GK3A 2V7OA 4C61A 1P4OA 5JGDA 2UZBA 5E90A 3LLTA 3IO7A 3ORMA 5FRIA 4AW1A 4CZYB 3PSBA 5D10A 3CPBA 1OPJA 4R7BA 3D0EA 3FMNA 4DT8A 2WQOA 3EWHA 4C57A 3ORTA 3ZTXA 4AXEA 2PTKA 1OKWA 3DTWA 3MH1A 1YOMA 3QD0A 4FZDB 1XWSA 1F3MC 2QLQA 3WYYA 4DDGA 4A7CA 4GMYA 4RLKA 3ZCLA 3PDTA 3QQHA 5EM6A 3U8WA 1PMEA 3R00A 2IO6A 3UYSA 4EJ7A 1KOBA 5DFPA 4YTIA 2XEYA 4LGDA 4I4FA 4L7SA 2HOGA 2VX3A 3TIYA 4M12A 4X6RA 4XH6A 3TJDA 3KXXA 3QTSA 2BFYA 3HRCA 4BRXA 4FT3A 4TY1A 3FLNC 2C69A 2ERZE 4WRGA 3REPA 4HOKA 4MD9E 3JY9A 2W1FA 2VO3A 4NSTA 2XBAA 4D1SA 3KREA 5DIAA 5A4EA 2OJ9A 2AEGA 4UWYA 3FKNA 3ODZX 2QLUA 3GCSA 5CVHA 4O22A 3UPXA 3AMYA 4E6DA 4XG6A 3FUPA 5HICA 2J0JA 4ZTLA 2F2UA 2HY0A 4BZNA 4HYHA 1J7LA 2BTSA 4C0TA 3FI8A 4F6UA 1SNUA 5C01A 2RL5A 2YFXA 4OTIA 3NFFB 3TZMA 2C6EA 4QMNA 4NK9A 2FGIA 3T3VA 2ZAZA 4I0TA 5HO8A 3NYOA 5HLWA 5FXQA 3P23A 1R39A 4R7IA 2CGVA 5ITAA 3UVRA 4IZAA 4O1PA 5LMBA 5AEPA 5BV3A 4QQJA 3EN5A 3FMHA 3PVWA 3VQHA 2GDOA 3GT8A 4OTFA 4F7SA 1QMZA 1CSNA 3PA5A 4RFMA 2XZSA 4FZ6A 4C58A 4RJ3A 3KCKA 2ITZA 4RC3A 4LV5A 1YXUA 5AX9A 3R8MA 5LVPA 1ZOHA 2WMRA 3CXWA 3HMMA 4TYEA 3S1HA 3W0QA 1A06A 1J3HA 4X2FA 5AMNA 2QOKA 3THBA 3PIZA 4FEUA 2IZUA 3VUGA 4X3FB 5JFWA 4K9YA 2OIDA 4ZP5A 2Y6OA 2XARA 2X0GA 3LFEA 1CKPA 1QPCA 3VW6A 2VTHA 1T45A 2A19B 2EB2A 2ITYA 4CD0A 5HU3A 1Q5KA 4FIFA 4LOQA 4DFNA 5HBJA 5JFSA 4QQCA 3WF9A 4F08A 2YABA 2R7IA 3PG3A 5CEMA 4JXFA 4BL1A 3BHHA 1KUTA 4K6ZA 2YISA 2I0HA 1URWA 3R01A 1IAJA 4L67A 4CFMA 1IA9A 4IVAA 2YWPA 3D5VA 3TKUA 5FXRA 2QOQA 3L9NA 3QTIA 4WT6A 5L8KA 4OR5A 4WA9A 3UP7A 2XIRA 2R3LA 5EQPA 1OZ1A 5KMNA 2YZLA 3V6RA 3P4KA 2QOFA 2WQMA 3R22A 4UMRA 5ANIA 3MTLA 4JRNA 3V04A 1WCCA 5CXZA 2XALA 3G33A 3VRYA 3D2KA 4GT3A 1P5EA 1XH6A 3VS6A 3KRRA 3COIA 4FYOA 4C34A 5I3OA 4B7TA 4RZWA 1PMUA 2BALA 2YCQA 2X2KA 4NM7A 3S4QA 4MUQA 2WTIA 3OMVA 2OGVA 2E9OA 2XIXA 3MY1A 3ZSIA 4ACDA 3HZTA 4N70A 3VS2A 2B0QA 3BELA 3D5WA 4H3BA 1UU3A 3CC6A 3QAME 4Y95A 4IWDA 3GC9A 1GZ8A 1YOJA 2EVAA 3FY2A 4FUXA 4NKAA 4BDCA 2UW6A 2G2HA 1Y6BA 4GJ2A 4RC2A 4U7ZA 4D4RA 3COMA 1WAKA 3ACJA 4ASXA 3FQSA 2UZTA 4IC8A 4ZSGA 4KS8A 3D5UA 2HYYA 1Q8WA 1VLRA 2QHMA 2C4GA 4USEA 2HENA 4Z7HA 2QD9A 5HBEA 3OWPA 3OWJA 5HVKA 5CSWA 1KV1A 4IVDA 4YZCA 3LFBA 4BDAA 1PXLA 4A4XA 5BUIA 3IOPA 5KZ0A 5JZJA 1Q24A 4KIOA 5A3XA 3G0FA 1GZKA 3GNIB 3PE1A 4JIKA 5CSVA 4RX5A 2IW9A 4LUEA 5A9UA 5FEDA 1TFFA 5A4CA 5EYCA 3RTPA 2C47A 3DU8A 3P7BA 4KKHA 4YBJA 5DOSA 3QHRA 5E8XA 5AV4A 3VW8A 3NDMA 5CANA 3AC4A 3MIYA 2PVRA 4PPBA 1FMKA 4R5YA 2QG7A 1H0VA 4DHFA 3LCKA 3PVGA 4IX5A 3LHJA 4JX7A 3EN9A 4MNEB 3V51A 4EOKA 2QR8A 3V01A 4BJJA 4EZ3A 3MVLA 3RPVA 2GHLA 3BYUA 4TW9A 4U42A 5BYZA 3L9LA 2YIYA 3MIAA 1JVPP 5LWMA 4DH3A 2W05A 4CLJA 5IEYA 4FTAA 2PVHA 2Z60A 3TWJA 3ZO3A 4GIHA 4D28A 4GJ3A 4UZDA 4GU9A 5H2UA 4JR3A 3AT3A 3R8VA 4TNDA 5TE0A 5I9ZA 3GCQA 4C2WA 3F3TA 2BRHA 1RW8A 2GSFA 4V04A 1UKHA 2RG6A 3W8QA 4E20A 2VX1A 3V5JA 3UIUA 5JFVA 3KXNA 4UZHA 4CYJA 3P5KA 2IVVA 4C62A 2BZHB 2J51A 1ZAOA 3E92A 3P1AA 4CQGA 3QUPA 4RQKA 3LIJA 3DXPA 5ICPA 5AA8A 3AD5A 2JKQA 2KTYA 2P2IA 2XUUA 4H36A 4JG7A 4N6YA 3R7EA 3U87A 4YZDA 3OWLA 1ZYDA 4IWOA 5HNIX 3HUCA 4WNMA 2W17A 4FV7A 2VTIA 4KBCA 3RCJA 4NEUA 1ZOGA 4LMNA 3V5LA 4QQ5A 4M66A 3FEGA 3GQIA 3MB6A 2YDIA 3FWQA 4LOPA 4QMUA 3R8ZA 4HJOA 4YJTA 3SVVA 3VS7A 2VV9A 4U9AA 2ONLC 3DFAA 4PWNA 1FBNA 2JDTA 2A4LA 3HNGA 4ERWA 5CT0A 3VUHA 5M08A 1Q8YA 2QKWB 4CKIA 3QA0A 2X4FA 3GI3A 3H9RA 4FV1A 4YLKA 3E3BX 5B2MA 1W0XC 5IUHA 4WUNA 4XV9A 1ZWSA 3QYZA 3BHUA 2R3GA 2I40A 1H1QA 3GVUA 4IQ6A 3BBWA 4FV0A 5AM7A 3MPTA 1KSWA 5CVGA 1AGWA 4Z55A 3A99A 4TYHA 3BQRA 3UVQA 3D5XA 3KMMA 2XAOA 4U80A 3TV6A 4FVQA 3HP2A 1VYZA 3FLWA 3T9TA 3TNPC 2QVSE 3U9NA 4UWBA 3PFQA 3SXSA 1Y6AA 3RPOA 3KCFA 4YZMA 3I1AA 5KMOA 5LMAA 4PL3A 3DLSA 3DLZA 4U44A 4MXOA 3BLQA 1ERKA 1RE8A 3K5UA 5AWMA 2F7XE 2C5YA 3FBVA 4G2FA 2J0LA 3DBFA 3I7CA 2XK7A 4JLCA 3BEAA 5I9UA 2XS0A 5ETIA 1MP8A 3M42A 3C1XA 1JKLA 5DG5A 4AOJA 2CNVA 3PSDA 4O7LA 4DGGA 4I0RA 4ZJJA 3LCDA 4O0TA 3R9RA 3FSKA 4YR8A 3LAUA 3COKA 1PXPA 4FYNA 1JSVA 2XJ1A 4IAYA 4JIAA 4GL9A 4X3FC 2BVAA 3MFUA 4DGNA 3FMLA 4BBEA 3PUPA 3N51A 4CQEA 2W0JA 3BYOA 3F7ZA 2VNWA 1HCLA 3O8UA 4Q2AA 4H39A 2OBJA 4IZ7A 5HG5A 4AE6A 4C2VA 3CPCA 1R3CA 4PDOA 3KRLA 5DT3A 4PTGA 1IRKA 4OTDA 4YC6A 2BROA 3QKKA 5EK7A 3JVSA 2G1TA 1H1SA 2GNJA 4YJSA 3NW5A 4EHEA 4L68A 4GH2A 3JUHA 4PPAA 4F9AA 2B1PA 5TT7A 2XVDA 4EQCA 3OCTA 3QWJA 4MYGA 4BDJA 2DUVA 3DGKA 2LAVA 3QRUA 4CNHA 5EI8A 3IONA 4FNXA 3FZRA 2C0IA 5AA9A 5EOLA 3ORIA 4B0GA 5JQ5A 2PZPA 4FSYA 1ZYCA 3ZEPA 4QMVA 3PJ2A 4M0ZA 1TQMA 4XUFA 2YDKA 2PMLX 1AD5A 3QGWA 3SOCA 4P4CA 4E6QA 2Y7JA 3SXRA 3BL7A 3FZSA 4CFUA 5A14A 3JPVA 4PP9A 3NCZA 4GW8A 4QPMA 3TUCA 4BTJA 2HZ0A 4BDDA 4FK6A 3TACA 2PPQA 4RX9A 1YI3A 3G90X 4IB3A 4OTWA 1KV2A 3E7VA 1PKDA 4PL4A 4USDA 3F5PA 1Q97A 1XMLA 4ZMEA 4QYHA 4TWCA 3ODYX 1ZXEA 4RX7A 4LV7A 3NNWA 1ZY5A 4I6LA 4G17A 4AQCA 3OT8A 5I9YA 2JD5A 4S2ZA 3HX4A 3M11A 4IWPA 4GFGA 4FTMA 4LGHA 3WI6A 5M56A 2ZDUA 3NAYA 4UMTA 2VZ6A 3BGZA 3TUBA 4U3ZA 5HTIA 2PE2A 3DQXA 3PYYA 2E2BA 4RIYA 3RVGA 5KX8A 4QYEA 3UDTA 2XIYA 3OCBA 2IG7A 3DKOA 4R1VA 2R0UA 1OGYA 3COHA 2JKOA 4EL9A 4I22A 1UWJA 5HLNA 4X21A 3DOGA 1Z5MA 3NIEA 1M2QA 4QOXA 5IKWA 2Z7SA 4FNWA 4TKSA 5CNOA 3L1SA 3OC1A 1YKRA 4Y8DA 5DH3A 4S33A 2R3MA 1OPLA 4XOYA 1G8JA 4OTGA 4DH5A 4U81A 4YTHA 3GEQA 3BLRA 3HUBA 3EYHA 5EW8A 5FLFA 2Y8OA 4UB7A 4Q9ZA 5DE2A 2QI8A 5BVEA 4N4SA 3R0TA 5IA4A 4FKLA 4FV2A 4AZVA 4UMUA 4UX9A 3VC4A 1FVVA 4RFYA 4GT4A 4ZOGA 2OI4X 4O7SA 4KSQA 2EUFB 2XA4A 4FL1A 3DK3A 5DWRA 4NFMA 1YDRE 1HCKA 3QKMA 2QR7A 3C0GA 3ORNA 1XBBA 1WMKA 4FK3A 4E8AA 4YP8A 3QTXA 4DTKA 3NUUA 2X0OA 2W1HA 1XH4A 4L3JA 3LMIA 2W1GA 1FQ1B 2QC6A 2VTAA 4E6AA 4G5PA 3MFTA 3QF9A 4DINA 4J96A 2YCSA 1OI9A 2OG8A 4QMQA 4XG4A 2XNEA 4EZ5A 3BEGA 4Y72A 1ZYJA 5JFXA 3ATTA 3V3VA 2R3KA 2J6MA 4WNOA 3CKWA 3FC2A 4LQMA 1H0WA 2DWBA 3KC3A 3OXZA 4FNZA 3BE9A 3OW4A 4O0UA 4QTCA 4ANLA 3UNKA 4ZTMA 1H1WA 4FGRA 2VTRA 3O5AA 4CSVA 3MI9A 2XYUA 2PHKA 2OIBA 3AC1A 4ZS4A 2WTDA 3KY2A 4KKGA 4X7QA 5GHVA 5AV0A 3VS4A 2WPAA 4BIEA 4O0XA 5E7RA 4OTPA 2G15A 2WMUA 5C8MA 4EI4A 2QG5A 3FLSA 3MH3A 4M68A 2W5HA 3RKBA 3IGOA 4EH2A 2FO0A 3ORZA 3HA6A 3ZUVA 3Q04A 4EK3A 1OBDA 5DR2A 4L43A 2C3IB 1EH4A 1OL2A 3PA4A 3Q4CA 2YM6A 5JRSA 2WD1A 5IA2A 3CY3A 3LPBA 4DTBA 2NYAA 3R9OA 4AXDA 1NVRA 2W99B 4EK5A 4TYHB 2UW0A 3RBWA 1WBNA 5I9VA 4TPTA 3EQBA 2F7EE 3FL4A 5IISA 3DK6A 1ST0A 4FZAB 4V0GA 4ZY6A 1XH8A 2UZWE 2WTKC 3DBDA 4YURA 3NLBA 3JYAA 4MAOA 5FG8A 2R4BA 4QT1A 5J7HA 5C9CA 4OGRA 3LFSA 5D41A 5L6PA 5LOHA 2B4SB 1P14A 3DAEA 3ANRA 4CCUA 3D9VA 4JBVA 3UTOA 5DYJA 5L3AA 2UUEA 2VWIA 1UV5A 1BI7A 3SC1A 5GZ9A 3R8PA 3HGKA 3ZRKA 5KHXA 3RMFA 3QQJA 4GIIA 4ZS0A 4D9TA 3B2WA 5GIPE 2NRYA 3GC8A 4PMSA 4I5HA 1YVJA 3TKHA 4F0IA 4FZFB 2V62A 4I1ZA 2W5AA 3AGMA 3F2AA 3OWKA 4EHGA 3HA8A 5AP7A 4GT5A 4E4NA 3ET7A 3UQGA 2ACXA 4AWIA 2WMAA 2HXQA 2C3LA 2R3PA 3TXOA 2PUPA 3HV6A 2C30A 1PY5A 4ZK5A 2YJSA 2Y0AA 4PNIA 5HTBA 5HCYA 4WG4A 5A4TA 5K5XA 3R1SA 3EOCA 2YM8A 3R21A 3KMUA 3BLAA 1OIYA 3QCQA 4X3JA 5AAEA 5IQHA 4AGUA 4I41A 2YWVA 5M55A 4FICA 1M52A 3W8LA 4X2NA 4AGCA 4ALWA 4NU1A 4BR3A 4JS8A 3TNIA 4W9WA 3BGQA 1R0EA 4IAFA 1OIRA 4J7BA 4NJDA 3PRFA 4DEDA 4PP7A 2J0MB 4RC4A 4BWKA 2R3RA 2X8EA 2PUNA 3R1QA 4I0SA 1YXXA 2UV2A 2CGXA 2QOBA 4RJ5A 4WG5A 4CZTA 3F3ZA 2R64A 4FTQA 1Q8ZA 3UC4A 1GIIA 4MEDA 4ANNA 4BKYA 1MUOA 2BAQA 5AX3A 2VTJA 4BN1A 3LQ8A 3GBZA 4J97A 4KWPA 4YUQA 4X6QC 3UDSA 2OH0E 3A60A 3BI6A 3LW0A 3WIKA 2YACA 3F3UA 5C4KA 3UP2A 2GU8A 2ZJWA 3C50A 4W8EA 4C33A 2B9JA 4E26A 3ZRMA 1ZMUA 5HLPA 3V5PA 1YHVA 4NIFA 2W7XA 4I92A 4YJRA 5CSXA 2ZM4A 4IBMA 4YGAA 4BYIA 1K2PA 4HGLA 4S31A 4RVTA 5BUEA 4DC2A 3ERKA 4EOLA 1FGKA 2OZAA 4FIHA 3T9IA 3LM5A 4OBOA 4JI9A 3QTUA 3RK9A 4CG9A 4BCMA 2R2PA 5LWNA 5AR4A 4NH1A 2GHMA 4DHZA 5DMZA 1OIQA 4M0YA 5F1ZA 4EBWA 5HBHA 4OAVB 4I93A 3ZFMA 2B55A 4ZTSA 5IH4A 1M2PA 4R3RA 2EXEA 1SNXA 3K3IA 2A98A 3S2PA 4NCTA 4CLIA 3KA0A 4FTIA 5AAFA 3WZDA 5JT2A 3CD3A 3QQLA 3PJCA 3D4QA 4FG9A 3Q6WA 5FUTA 3ANQA 4ZAUA 1LP4A 3F7WA 5G1XA 3LJ2A 3R7YA 1Y91A 4CT2A 2NP8A 5EG3A 3CCNA 3FKLA 4DDIA 4RIYB 3W2OA 4ZZNA 4CFVA 4B9DA 2QODA 4BCPA 4YO4A 5CU3A 3HECA 4XX9A 5D1JA 4BWXA 3UQCA 1E1XA 2OJJA 5DI1A 4D58A 2C6OA 2UW5A 1RJBA 4DFLA 4NTTA 3PXQA 2XNGA 3MBLA 4F7LA 3H4JA 4XOZA 2PSQA 3VJOA 4BI0A 3P7CA 1J1BA 3E87A 4CMTA 5DRDA 4AT3A 1BUHA 3HV7A 4IW0A 5E8TA 3ZONA 5KCVA 4FSQA 4HCUA 4BTMA 4J95A 5CALA 5M44A 3F9NA 2HELA 3LFDA 2XIZA 4R7HA 4AW0A 3BV3A 2GQSA 1B38A 1JKKA 3QQFA 3BPRA 3QZHA 3PVUA 2YAAA 5A46A 1H4LA 2P33A 3Q5ZA 5EOBA 1FVTA 2WGJA 2FSLX 2G2FA 3UG2A 4QTAA 2R5TA 4FRFA 3R7IA 2VWXA 3NW7A 3ZYAA 3W2RA 4P90A 1X8BA 3OXIA 3BLHA 2PE1A 3DDQA 3OZ6A 4RPVA 1JSTA 3FQHA 2YIQA 2W4KA 1MQBA 4U0IA 4FEQA 4D2TA 2W4OA 3IDPA 2IN6A 4PDPA 3UIMA 3FZ1A 4IIRA 5HD4A 4FV5A <