4ZIMA

Crystal structure of janus kinase 2 in complex with a 9h-carbazole-1-carboxamide inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
285
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title 9H-Carbazole-1-carboxamides as potent and selective JAK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 285
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zimA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zimA01
5AR4A 4QMWA 2P33A 1B38A 1OL7A 3D4QA 4WD5A 2UW9A 4I92A 3ODZX 3LPBA 1KV1A 4RVTA 3PZEA 3ZXZA 5L6PA 5JT2A 3JVSA 4EH2A 1PYXA 5KNJA 4HYSA 3ROYA 4ORKA 4YZMA 3DAKA 3UE4A 4BICA 3GOPA 4F64A 3E7OA 2NNWB 3CTQA 2ZV8A 3L8SA 4X3FB 5EH0A 2UVYA 5GHVA 4AF3A 1SYKA 3BZ3A 4FTAA 4I5PA 1V0OA 3BQCA 4F1TA 3R9NA 3O17A 3NW6A 2HAKA 3U51A 2XB7A 4CRLA 4F9BA 3FMHA 1KWPA 4BZDA 4D2SA 2OZAA 3GUBA 5DHJA 5J1WA 5EM7A 4OTWA 4GK4A 4RIWA 3VVHA 1K2PA 1YHWA 4ZTHA 1O6KA 2HZIA 4LUEA 5KCVA 3QCSA 4FSZA 2AUHA 4E93A 4FTOA 5CSXA 3GU8A 3AMBA 5BX0A 4WKQA 4AZSA 3LE6A 3VBWA 3TZ8A 2C3IB 4JDHA 3EB0A 2PVJA 4CTCA 4PY1A 2BRNA 5BVKA 2Z7QA 4BDHA 1OB3A 2F7ZE 3QCQA 3W2QA 2PHKA 4PL5A 2YAAA 4CFWA 2Q83A 3ALNA 2QU6A 2CMWA 3FLQA 4K2RA 2CLQA 5H2UA 2VWIA 4Y83A 2XBAA 2Y8OA 4S31A 3UVQA 3OF0A 4FSYA 4PF4A 4A9TA 5CAQA 2W5BA 5LWMA 2ZMCA 4C33A 3KRXA 5GIPE 4JI9A 4LRMA 3DK7A 2Z7LA 4MXZA 4X21A 3RPSA 3POOA 2PVMA 4KKEA 3GQIA 2IN6A 4L53A 3CKWA 3KXMA 4M66A 3QWJA 3IS5A 5AR8A 3RALA 3D14A 2XNNA 3I5ZA 4WNKA 3RCJA 2CSNA 3QKLA 5H8GA 2PUIA 3Q9XA 3V5QA 2XUUA 3I60A 1K3AA 3E63A 2H9VA 5LVNA 4X0MA 4Y8DA 3VF9A 4WOVA 5CXZA 2RFEA 5FTQA 2ZM3A 5AM6A 2B55A 3DCVA 4JR3A 3NWWA 5AAGA 4B8MA 2JKOA 4I23A 3HNGA 3OROA 1IAHA 4ALUA 2PZ5A 4ANOA 2XEZA 4NCTC 3TJDA 3UIXA 2WTCA 3S95A 4YSJA 2HXQA 1NW1A 2DS1A 4OTRA 4A9RA 1PXPA 5J79A 1Q4LA 3PJCA 3FMNA 3PIXA 5FTOA 4XJ0A 4FTIA 3EQFA 5AM7A 1RE8A 1YDSE 3WYYA 3CLYA 2CKPA 1WAKA 3EHAA 3CIKA 2OZOA 3QCXA 3EJ1A 3TWJA 4CFXA 2GHLA 3AD5A 3DK6A 4ALWA 4BBMA 4MCVA 2GDOA 4EWQA 3I81A 3QUDA 2G2HA 1PMUA 2UZDA 4OT6A 4FK6A 3F3WA 2QOFA 4WUAA 4AFJA 2HZNA 3BRBA 4FNYA 4IVDA 4M14A 5IA0A 4CFFA 2QO2A 3LLTA 2GQRA 3OG7A 3MY1A 4O0XA 2YCRA 4OW8A 2VX3A 4ZTLA 1Q8UA 4I1ZA 2WAJA 3FSFA 4DCEA 4QP4A 5K4IA 1BI7A 4FT9A 3UYSA 1LR4A 4F9YA 2C0OA 3TL8A 3LFSA 4FTUA 4FYOA 1W0XC 4E5WA 3SA0A 5E4HA 2HW7A 4IC8A 4PDSA 2VWYA 5CSVA 1PJKA 2NRYA 1H1RA 4IVAA 5C27A 3UYTA 4C4IA 5M53A 1QMZA 3OOMA 4ERWA 4NM3A 2QOKA 4BDDA 5GZ9A 4I20A 3COMA 3G15A 3FHIA 1Y6AA 4IAAA 3CC6A 5I9VA 4XG4A 4HVHA 4EKKA 3LFFA 3DXNA 4HNIA 4GFGA 2JEDA 3KQ7A 3RAWA 4L00A 3FWQA 2H34A 4RLLA 4TYGA 3P78A 4ONAA 3LIJA 4G5JA 4YJTA 4ZJJA 4E26A 4UZHA 5HO6A 2CKEA 2UVXA 4YJOA 4R7HA 2JFMA 4R3PA 5CT7A 4FKGA 3QZIA 4U8ZA 4O7RA 4J95A 4O0SA 2OG8A 2YACA 4LL5A 4O7YA 4KIOA 5I5ZA 3O96A 1A9UA 2WTKC 4QP7A 4MXYA 3F5XA 3KK8A 5EOBA 2OKRA 1M2QA 3A7JA 5FTGA 3CGFA 3GCQA 2W1ZA 4HGLA 3ZCLA 1ND4A 4OGRA 1BX6A 3BWFA 3C13A 2RIOA 3FI4A 4GW8A 2J90A 5HX8A 4OAUC 1MRUA 2W4JA 4IB0A 4KINA 3TIYA 4FG9A 5A9UA 4CV8A 3D5VA 4BCIA 1U5QA 3EQHA 4ZTRA 5IA5A 3VBTA 4L3LA 2PZRA 2ITTA 4DINA 4YTFA 4EH3A 3Q5IA 3PXYA 3GQLA 3W2OA 4LV8A 5IISA 2X1NA 4K77A 4O0RA 1OZ1A 1ZY5A 4TNBA 5LMAA 4FZAB 3S4QA 4YO4A 4YR8A 1T46A 2RF9A 4JXFA 1UNGA 2C3JA 4C02A 4ITJA 2KTYA 4QMZA 2XZSA 4MBIA 1G5SA 3QRTA 4Y95A 5EYDA 4BDKA 5CU0A 5JRQA 5BUEA 3BHUA 2GNIA 3NRMA 2OJ9A 5FDXA 3UMXA 5ITAA 2WQBA 5HLPA 4E4XA 2JDOA 4M69A 5BVOA 3MJ2A 1NVRA 3FLZA 4CLIA 3EQDA 5BMMA 3RPVA 3RAHA 1ZYLA 3UC4A 3E3PA 2XEYA 3QD3A 2WOUA 5IEYA 4E6CA 2WHBA 2VTHA 3C0IA 3W8QA 1ZMVA 2IZTA 2XJ0A 2B4SB 2O5KA 3Q32A 5CYIA 2A0CX 5DRDA 5C8MA 4BCMA 5JGBA 3FMKA 3A7IA 4NKAA 4LG4A 4RJ6A 4V01A 2CNQA 2I40A 3R8MA 5H8BA 3PLSA 1APME 4FKQA 3D5UA 4MKCA 4AGCA 4V0GB 5ETAA 5F94A 5L8LA 2X8IA 3DZQA 2EB3A 3DPKA 3FZOA 3HMOA 3RMFA 4M15A 3R9DA 3V8WA 4KB8A 2WB8A 3VQUA 3MH2A 4BL1A 3P1AA 4LQMA 4F9CA 3QHWA 2ZV2A 3BHHA 3VQHA 5HD7A 3UQFA 3UQGA 4F0GA 3LKMA 2RG6A 2YIYA 3W2SA 2W1DA 4JBPA 3Q96A 3ZUVA 2VTNA 4C37A 2J5FA 2R3RA 1H4LA 2YM6A 5KKRB 4X7QA 4FEQA 4F70A 3DKFA 3NVMB 3EZVA 2WMUA 3FZ1A 1YW2A 3NYVA 3PSCA 4F09A 3Q9WA 3KULA 4ZZNA 1RDQE 2J7TA 4GU6A 2BKZA 3R22A 4H36A 5T6KA 2OBJA 3QXOA 4O38A 5T68A 2EVAA 4R1YA 4AOIA 4AX8A 4TYEA 4M84A 4EH5A 3E64A 3P5KA 2R3NA 4CZTA 2BMCA 1KOBA 5J95A 5T3QA 5LVLA 1PMNA 2CGXA 3PFQA 4FKVA 3D7ZA 1WVYA 3QTIA 4ZJIA 3FPQA 4C58A 1YDRE 5DEWA 4ZSAA 3W16A 5DOSA 3ELJA 4M97A 2GNLA 4L68A 3IGOA 3F3TA 1LEWA 2QODA 4TL0A 2F7EE 3MGYA 4DH8A 1G8AA 1FGIA 5GIOE 1OL1A 4EYMA 3FLWA 3SGCA 4FX3A 4I41A 2WMSA 4J99A 5ETFA 5IDPA 3KXNA 4PV0A 2CCHA 5M07A 1OUKA 3A8XA 2OJIA 1YOLA 5B2KA 4O86A 4HCVA 1YXSA 4R5YA 1H27A 2XNPA 4S32A 3EL8A 2YJRA 4AQCA 3AGMA 3PUPA 5JGAA 4J71A 3E8EA 1J91A 2X9EA 4AUAA 3PPKA 2BZIB 4HGEA 2QD9A 1IASA 4OBQA 5ANKA 1W7HA 1SMHA 4GVJA 4CCUA 3ORTA 4X6QC 3TEIA 4D0XA 1R3CA 3G6HA 2VTMA 3O8TA 3UZRA 2HW6A 4BHZA 2OLCA 3RNYA 2YABA 5CEMA 3WF7A 1UU9A 3I7BA 3Q9ZA 4KWPA 5FM3A 3TNPC 3M42A 4GEOA 3QRJA 4APCA 4H58A 2ETKA 3FHRA 3BYVA 4I94A 4WSQA 1ZOGA 2YISA 3W2CA 4CZUA 4EC9A 2PPQA 2QURA 1Y6BA 4JIAA 3HP2A 3W55A 4DEIA 2IPXA 3ZHPC 4AZVA 5EOLA 3QZFA 4FTQA 5K3YA 4TKSA 3GGFA 4FUXA 3ZFXA 5JFVA 1GZNA 4PPAA 1Q8WA 5FG8A 3UOKA 3MSSA 1GIHA 1UWHA 3QGYA 4J98A 3SXSA 3MPTA 3BGZA 3QWKA 1M7QA 3GCUA 4G6LA 2R3MA 4QP3A 3TZ9A 2WD1A 5CAUA 4I22A 4KUJA 4AGWA 2VX0A 4KIKB 4USEA 1FMKA 1XBCA 3P7BA 2X0GA 1M17A 4O96A 4KIPA 3V8SA 3NIEA 2VV9A 2ERZE 4G6OA 4BWKA 2B7AA 3RAIA 4QRCA 5IH5A 2UZLA 3KXXA 2QCSA 1DAWA 3C9WA 1OPLA 3D94A 3D9VA 3K2LA 4UB7A 1JKSA 4NT4A 5D9HA 3V5JA 5HTCA 3QRKA 4R78A 3U9NA 4CV9A 3H9RA 4JNWA 4RWLA 3ZDIA 4BWXA 2ZM4A 3QAME 4TTHB 4QT1A 4ZTNA 2YM8A 2HOGA 3SQQA 4EOOA 4P5QA 2ACXA 2PY3A 3P86A 4II5A 5AV1A 1PW2A 3ZEPA 3KN5A 2R64A 3R8LA 3TNWA 3KL8A 1YVJA 2R3HA 3H30A 5CAOA 4GIIA 1TQMA 3LMGA 5IA4A 4NIFA 5AUTA 4EOQA 4D2PA 3OVVA 5LWNA 1OITA 2Y0AA 4EK6A 5DMZA 4L52A 4CZYB 4A4LA 4E73A 4FOCA 4IX4A 2IW6A 4O6EA 4HCUA 1G3NA 3HYHA 2BRMA 2JDRA 3FYKX 5TO8A 4CTBA 3L9LA 3MB7A 3U6HA 4FF8A 2PVYA 4FVRA 3KC3A 3RM7A 4FTNA 3KRWA 3IW8A 4FVQA 4GFOA 2BIYA 5C4LA 4PP7A 2JKMA 3OWLA 2XK4A 2CCIA 4GSBA 2OSCA 4JG6A 3QUPA 4EKLA 1JQHA 2C5OA 3ZZWA 4DH5A 4ANNA 3UBDA 2JIVA 5IKWA 1BUHA 5DNRA 2X39A 4RJ8A 3TV4A 3VW8A 3EFKA 2UZNA 2FGIA 2JDSA 2X4FA 5LARA 4JDJA 3R0TA 2AC5A 1J7LA 4IWOA 3MFRA 2G01A 4FKIA 5LJJA 5TR6A 2YCSA 4AW1A 4O7VA 2ESMA 2X2MA 2W4OA 2CJMA 2LGCA 4D28A 3AC3A 4RSSA 2BZHB 4FGBA 4ZY4A 3IO7A 3RINA 4C4EA 4YTIA 4NK9A 4PDOA 4RVMA 1XBAA 4WT6A 3OFMA 5CASA 2O3PA 3FKOA 4IWPA 4UWBA 4YC6A 4LI5A 2XJ1A 3ZO2A 1OPKA 1QPCA 2IVUA 4EOPA 2XM9A 4L7SA 4Y46A 1HCLA 1ZZ2A 1DS5A 2Y4IC 3G6GA 5D7AA 4B9DA 5LOHA 3NUXA 4BIBA 4Z9LA 4J1RA 4QNYA 5CAVA 3ATTA 4QMSA 3OEFX 4H3BA 3QA0A 3WF5A 1X8BA 5HQ0A 1T45A 2XNEA 2QO9A 3LHJA 3BIZA 3NSZA 3PE1A 5F20A 3U6JA 1P4OA 1HCKA 3UO5A 2JGZA 1KE5A 3SHEA 2PZYA 3GC9A 5EDQA 1FGKA 1MQ4A 4QP8A 5HESA 2W17A 1XBBA 3NNWA 1WBVA 3QALE 3AG9A 5E8SA 4A4XA 4QOXA 3LCTA 3R7UA 2P2HA 3PVBA 5EW9A 4ZIMA 1W98A 1UA2A 1KSWA 5DRBA 3FDNA 5C8NA 3OXIA 4D5HA 4F6UA 4RFMA 5JFSA 4X3FC 4EBWA 4DBNA 3KK9A 3DQWA 3PA3A 2R3GA 4X3FA 5EQEA 3C5IA 1YQJA 2WTDA 3MH0A 3ATSA 3S3IA 3SW4A 3HMNA 4AT5A 3FYJX 3MW1A 4XOZA 5GJDA 2WEIA 2BAQA 3PA5A 5HD4A 1R78A 5HVJA 3UQCA 4Y85A 1PXMA 2C6LA 3FLYA 1IEPA 5GINE 2WMQA 3JYAA 5C8KA 3UZTA 2R3OA 3TNIA 5E8YA 2OGVA 3UNKA 4LUDA 2C6EA 3Q4UA 3HRBA 4EL9A 3CS9A 2QOQA 4L7FA 4CNHA 4C0TA 3DGKA 3MFTA 2X7OA 3GEQA 4Z55A 3E7VA 5EM6A 1URWA 2AYPA 5M56A 3UP2A 2ZYBA 3SRVA 3QGWA 3DKOA 4KD1A 4O6LA 3EN6A 5HU9A 5M57A 4D9TA 2BIKB 2GHGA 2HIWA 2XRWA 3DTWA 3FC2A 5HCZA 2WPAA 3OBGA 3F3UA 4IWDA 1HOWA 4F0FA 4EK8A 5HGIA 5CQWA 1YHSA 1JVPP 2O63A 2PVRA 3AGLA 5HCXA 3ZTXA 3NR9A 4H1JA 5HO8A 4DGNA 4PWNA 1JOWB 4EBVA 2ONLC 5ANEA 3OWPA 3ZO3A 3MV5A 1G8SA 3CBLA 1JBPE 4GT5A 2GCDA 3NZ0A 2ONLA 3D7TA 3EQCA 3QF9A 3ULIA 5BVFA 5AFVA 3SOCA 5EYCA 4XBUA 4GKIA 2YZLA 2OXDA 2F2CB 2ZM1A 5EM5A 4ZY5A 4UMUA 2O65A 3AMAA 3ET7A 4DBXA 4ACHA 4BKYA 5FLFA 3IW7A 5FGKA 5C26A 3BHVA 3PSBA 4UXQA 5AR2A 5KMNA 4DFUA 1H28A 1ZMUA 2F57A 2OF2A 3V01A 3LFAA 4LOQA 5AX3A 3GCVA 2PZPA 2V7AA 1ZYCA 4HYIA 3QD4A 3CTHA 2P4IA 4FL1A 4YC3A 2PVLA 4A4OA 2DWBA 2BZKB 2OF4A 3DTCA 2OIDA 3OOGA 4XEYA 4XUFA 5C01A 5HO7A 4IW0A 5JH6A 2NRUA 4BI2A 3PG3A 4YU2A 3WYXA 4ZSEA 1NY3A 3UOHA 2F49A 1BL6A 4XG6A 5IUIA 1A06A 3ZFYA 3DS6A 4RX9A 4KIQA 3OTVA 4W4YA 4GU9A 2B9JA 5KMIA 4FV7A 2C68A 3D15A 1Q3DA 4FICA 4E4NA 4RZWA 4JQ7A 3F3ZA 4U40A 2PL0A 4EOSA 1BYGA 1VJYA 3QUEA 1XH7A 4DFBA 2YHVA 5J8IA 3W18A 3FY0A 3BE2A 3HDNA 4L45A 4AFEA 1WMKA 2HZ4A 3CD3A 2HYYA 4IEBA 3RHKA 3DV3A 2IO6A 5L2SA 4LM5A 4JLCA 4KS7A 3RZFA 3SDJA 3PRIA 4IADA 5DE2A 2ITPA 5TT7A 4PDYA 2G2IA 3LFQA 3ZFMA 4D4SA 1KE7A 4P2KA 3DB6A 5AJQA 4M12A 3LJ1A 3UPZA 4O7TA 2IZUA 4CYJA 3RM6A 3LW0A 4JBOA 5DWRA 3COHA 3CQEA 4LMUA 4YSMA 1PYEA 3I6WA 3ORKA 1OGUA 3OUNB 4Z3VA 2DQ7X 3H0YA 1KE6A 4CFVA 2XMYA 4ITHA 1RW8A 4YTHA 4BI0A 5HOAA 2DUVA 2FA2A 2PVFA 4BBFA 4I5HA 2FYSA 2WQOA 2WTWA 2HK5A 4R8QA 1YXVA 1V0PA 1GOLA 1UU3A 2A27A 4XLIA 3NUAA 1BI8A 3PG1A 1XH6A 3EN5A 2VTRA 4JT3A 5F4NA 1WCCA 5I9WA 1RQQA 2KULA 4YP8A 1YOMA 1L3RE 4C36A 4FTKA 3OY3A 4DFZE 5J1VA 3GC7A 3VUHA 4AE9A 3MIYA 5F1ZA 4TZRA 4F1MA 2QU5A 5CF8A 3DB8A 2E9VA 1QPEA 4OTDA 3OMVA 4PP9A 3RGFA 3PXKA 2A2AA 3GOKA 3RZBA 3CP9A 4DG3E 1Q8TA 1PXNA 4N4SA 4C4FA 4EHGA 4JX7A 2Y7JA 2VD5A 4C38A 1PF8A 4CT2A 2YA9A 1YI4A 2VTSA 5LVOA 4CRSA 4ZS4A 4J97A 4O7ZA 3IDPA 4X2FA 5I4NA 3BEAA 3FV8A 3QC4A 5KMKA 2OH0E 3LQ5A 5M06A 2QOHA 3CKXA 5CEIA 4FZ6A 4EOIA 3EL7A 4GYGA 1V1KA 3HRCA 2O0UA 4JBQA 5HG7A 5DI1A 3R21A 3NNUA 3SC1A 3VHKA 4FG8A 3A7FA 4FKUA 3WF6A 4O22A 1XH9A 3ANQA 3RKBA 5A4QA 3BLRA 4CSVA 4N0SA 3PYYA 5BNJA 3C0GA 2ZVAA 5AAFA 2OFUA 2BVAA 5GNKA 4C34A 5EHYA 4DEHA 1Z57A 4WHZA 3V5TA 3UIBA 3JS2A 4KBCA 5TOZA 4ASZA 4AZWA 1M2PA 3DJ5A 5EFQA 1MRVA 4YHFA 3QKKA 1JWHA 4DT8A 4PPBA 3E3BX 3KN6A 4RX5A 4C2WA 5IF1A 2JIUA 3MA6A 4YLJA 4GK2A 2W06A 5LCJA 2W1HA 1TQIA 4MD8E 3C50A 2W0JA 3OD6X 4XMOA 3ZSIA 3KEXA 4CT1A 1PKGA 1YI6A 2C3LA 5J9LA 2WU7A 4U44A 3KRLA 4XOYA 4FT3A 4QMQA 2VNWA 3FUPA 5IMXA 1SNUA 4E4MA 5IQHA 5AUVA 1ZLTA 3UDBA 3MBLA 4J52A 4LFIA 2F2UA 4F7JA 2BDJA 2YIQA 3D83A 4BGQA 5B2MA 4W4VA 3VJOA 3GBZA 3GT8A 4LGGA 3LCDA 2BPMA 3RWQA 4CG8A 5ANDA 4YJQA 5CF5A 2B1PA 2XCKA 4FSTA 4M67A 4TRLA 5CF4A 5ICPA 1M7NA 3L9NA 4H3QA 5HI2A 1BMKA 5IQGA 3P0MA 4M8TA 5KMJA 4WO5A 2W05A 1UWJA 2QONA 4IANA 5HG9A 5DR2A 1LP4A 5F9EA 3G2FA 4NJ3A 4NM0A 3FEGA 1OKYA 2C6MA 3NYXA 3ORXA 1FVRA 4OTQA 3QQGA 2GTMA 2YAKA 4UN0C 1OL6A 5KKRC 4ZMFA 2EU9A 2BTRA 3BYMA 3QC9A 5IUHA 2GQSA 2X6DA 5IQDA 2OW3A 4EQMA 2I0YA 4JDIA 3RVGA 2WOTA 2C4GA 3C7QA 4NCTA 3BBTB 4ZSJA 5E92A 2OJJA 5A6OA 2HENA 2JKKA 4DGOA 3VS2A 4KRCA 4TYJA 2VU3A 4Z7GA 5C1QB 4CGAA 3CQUA 4L44A 3ZBFA 1H1SA 4K1BA 4KRDA 3P9JA 2YLEA 4G3EA 4XHKB 5CU3A 4FSMA 4XCUA 3E62A 3QTXA 3FBVA 2WTJA 3VHEA 4ARKA 4BZOA 4D1ZA 4P5ZA 4D1SA 3QYZA 5JEBA 4XP3A 3A4OX 3HP5A 2YEXA 4RIYA 1JNKA 4FT7A 5A4LA 5E8VA 3DBDA 3LFDA 5D11A 2BAKA 4BDJA 4I6FA 1NXKA 3QKMA 3G9NA 3GP0A 4UY9A 4ZZOA 1QL6A 1IRKA 3I0QA 1U4DA 2XIZA 2OJFE 3UO6A 3HAMA 4OTGA 4J96A 3SVVA 3O23A 4QTBA 2QKRA 3GB2A 2VWBA 4NFNA 5KBRA 4R5SA 1WBOA 3TTJA 4U3ZA 4HNFA 3B2TA 3G33A 4YPSA 5CALA 2I0EA 3B8QA 4FV9A 4RQKA 3OW4A 5L2IA 3D5XA 4HVGA 1YXTA 2UW6A 3OT8A 5CEKA 2J0MB 3R2BA 4D55A 3PTGA 3MI9A 2OIQA 3JPVA 4CQEA 1ZYSA 2G2FA 4F63A 4BCNA 5HKMA 5K9IA 2IG7A 5JQ5A 4YJPA 2FSTX 4UBAA 3TUBA 2IWIA 3V3VA 3G0EA 3ZZEA 4TN6A 4ALVA 3AC8A 4QQ5A 4R3CA 3A7GA 3QTWA 4WRSA 5AIKA 5JMSA 4KS8A 5CTPA 2H96A 2ITNA 3LFBA 4A07A 2W1GA 2IVSA 3W8LA 4HPTE 5CANA 5G6VA 4JJRA 2JC6A 2JAVA 4ID7A 5LMBA 4PUZA 4KBAA 2WMXA 3EZRA 2XK3A 4H3PA 3SV0A 5EDRA 4A9UA 4C7TA 5B0XA 3F82A 3LCOA 5DPVA 3II5A 4FT0A 2I7QA 3E8DA 2YDJA 5HG5A 1ZY4A 3WOWA 3T9IA 4TYHA 3AC4A 4QQJA 4GG7A 4F7NA 3TV7A 2W1IA 4YJUA 4BR3A 3VO3A 3UZPA 5FWKK 3MFSA 1EH4A 1WBTA 3O2MA 4G2FA 4IH8A 4QP2A 4EONA 3DZOA 1Q8ZA 3G0FA 3QTZA 4QPAA 4L9IA 1Z5MA 3QZGA 3I79A 3T8OA 5ACBC 4TWPA 2WMTA 4RVLA 2I6LA 4XNEA 4BCFA 2GFCA 3NMUF 5IDNA 2YCQA 4RBLA 5AP5A 3TIZA 5HX6A 3JVRA 1FMOE 2XA4A 2XF0A 3RTPA 3L1SA 4QTEA 4R6VA 5K5NA 1K9AA 3RK5A 5KUPA 3HMPA 1U59A 3KA0A 4MWHA 2GMXA 4BZNA 2VTIA 4LRJA 2R3IA 4MNEB 5DR9A 4UALA 5IPJA 4ANBA 3LCKA 3RI1A 4L6QA 5DGZA 4U97A 1IG1A 1H00A 2WO6A 4C4GA 4ACDA 2OZAB 4U80A 2YDIA 4BCPA 3PE2A 5EQPA 3DBQA 2DYLA 1URCA 2UUEA 3PDTA 5BYYA 4O2PA 2E2BA 4OTIA 4YLLA 1GNGA 3AC5A 4IAYA 3NCZA 4RC4A 4NM5A 3N4TA 5E8WA 5JGDA 3NEWA 2Z60A 3GU4A 3DBCA 3DOGA 4NSTA 4DE4A 2OU7A 2Z7RA 5BVNA 5FP5A 3RNIA 1H1QA 3IOKA 4UZDA 1GZOA 2NP8A 5CEOA 4CVAA 3D2KA 3VUKA 4XV3A 4CFUA 4GS6A 2CLXA 4K33A 3RHXA 5J7BA 4L42A 4FIHA 4DFNA 3SOAA 2B54A 2GS6A 5D12A 3U4WA 1YDTE 2VGOA 4L43A 1TVOA 4YTCA 1WVXA 1Y8YA 1YI3A 4ACGA 3KKVA 3UTOA 4JL9A 3NUSA 5EI8A 3R8ZA 4EORA 3ZLXA 3AC1A 1J3HA 4RC3A 2W9FB 3C0HA 3B8RA 4UYAA 2RFNA 1XWSA 3QTQA 4A7CA 1UVRA 4ZLOA 2J50A 5A54A 3BI6A 2YJSA 1VEBA 3GVUA 2WTVA 3KF7A 4Q5HA 2PMNX 5IQIA 3ZLWA 4DEEA 2XIXA 1AQ1A 3VRYA 4AZTA 4UWYA 4EWHA 4F6WA 3SLSA 2NO3A 3EFLA 4AAAA 4O7LA 4EZ5A 2W4KA 4WBBB 4LYNA 3Q53A 1CMKE 2FSOX 3H10A 2OH4A 1B6CB 4ZLYA 3PRFA 4ERKA 1MRYA 4NL0A 3IK3A 3KGAA 4GYIA 5A46A 1FOTA 4NEUA 5JSMA 1NVSA 2WELA 4FV3A 1JPAA 3WILA 4NFMA 5L4QA 5ETIA 3Q4CA 2OO8X 4D9UA 4UV0A 1FQ1B 5JRSA 4W9WA 4DH1A 4NZWB 5A4CA 2QOBA 4RJ7A 2XNGA 3UG2A 4EUTA 1WBWA 4U81A 4FI1A 1PXJA 3IKAA 4MF1A 2C6OA 2ITVA 3BBWA 5CLPA 2X81A 3O50A 2PUNA 3Q3BA 2ZB0A 5IA2A 3MIAA 4RIXA 1YXUA 4DEBA 2CGUA 3V04A 3AD4A 1H26A 2BDWA 3LXLA 3VUIA 5DR6A 3TZMA 3CSVA 3A2CA 4UX9A 2VTJA 2V0DA 3ORZA 2PSQA 4MHAA 4NJDA 3SD0A 5KBQA 1SVEA 2RG5A 2V55A 4MXCA 4EH8A 3O51A 5M4UA 4DEAA 3C4CA 3F9NA 3ZC5A 3R2YA 3UP7A 3VS0A 5AUYA 3Q9YA 4FTJA 5HVKA 5EW3A 3ORNA 4AE6A 2UW7A 4BDBA 2QLQA 2LAVA 4QMTA 1YKRA 3FC1X 3L8PA 3WIGA 1R1WA 3KXHA 4APPA 2C6IA 3TDVA 4BBEA 1Y91A 4BY9E 5A3XA 3R83A 2BALA 4U7ZA 4BB4A 3O8PA 2WNTA 2QOCA 3F6XA 3KCFA 4JVGA 2GQGA 3MPAA 5KO1A 3RK9A 4HCTA 3Q4ZA 3LLAA 2B53A 2F4JA 5KMLA 4AW5A 3H0ZA 5AV0A 4ZZMA 3MY0A 5IG1A 2PYWA 3W10A 4BYJA 4ZJVA 4OR5A 5AIRA 4BFMA 5FDPA 4BCOA 2QQ7A 1XQZA 4FYNA 4USDA 5AR3A 4MQ2A 4FKOA 1Q62A 3IDBA 1OBDA 4O1PA 4C3PA 2GU8A 3KRRA 5L8JA 3MYGA 1H8FA 5IA3A 1UKHA 4FV8A 4FVPA 1U54B 2BUJA 4ZAUA 3DT1A 2OXYA 4GJ3A 4HVDA 3Q2JA 4QYYA 4AA0A 2GPHA 1VR2A 1U46A 5AADA 4DTAA 3LAUA 5FQDC 2OICA 1ZZLA 3O0GA 4EH6A 3GCSA 1J7IA 1QPJA 4ITIA 5HLNA 2OI4X 4LGDA 3OHTA 5BVEA 5ANIA 3VS6A 1BKXA 3BWJA 4TPTA 4BIDA 4IAZA 2UZBA 3ZSGA 3MESA 5CXHA 2BHHA 2C3KA 4GCJA 4F08A 4IHPA 4PTCA 5CS6A 5IH6A 5E9EA 5HHWA 3H9FA 1AGWA 4BYIA 2XKCA 3MTLA 4I4EA 3BLHA 3LM5A 2R4BA 1LPUA 3B2WA 3FMLA 4RFYA 2UZTA 2C0TA 5AUWA 4CKRA 4TY1A 4XLVA 4YLKA 5EDPA 4YC8A 3HLLA 4JAJA 4QQTA 3DK3A 3S1HA 3EOCA 3NDMA 3SG9A 2EXMA 3FI8A 2H8HA 2Y6OA 3F61A 3LFEA 3TG1A 3JY0A 5CEPA 2J5EA 2VWWA 4AG8A 5BYZA 4PNKA 2ITOA 1PXIA 5EK7A 3BX5A 2QOIA 4AA4A 2VTOA 5TKDA 1ZWSA 4AN9A 4XV1A 3LOKA 5F95A 5HIDA 4JX3A 2A4LA 3GC0A 4NYEA 4O1OA 4I0RA 2C1AA 2J0JA 4MXOA 4QQCA 2C6KA 3F3VA 5M55A 4M3QA 4C8BA 4IAIA 2PU8A 3HA6A 3SW7A 4NH1A 1GY3A 4GV1A 5FEDA 3FL4A 3ZS5A 3PPJA 4IMYA 2HY81 4AW0A 4M69B 4ZY6A 4CEGA 2YM3A 1ZARA 3R7GA 4EHVA 5G1XA 4WNMA 3QTSA 2PWLA 4F99A 3ZC6A 1UV5A 4I3ZA 2PZIA 4QP6A 4PTGA 4EK3A 5ACKA 4HVIA 2V22A 2ZV9A 3CR0A 4IFGA 5FP6A 5C03A 5DIAA 5AA9A 2GFSA 4BVUA 1NA7A 1LEZA 5AWMA 5M09A 5J9ZA 4FV1A 2QLUA 3ORIA 5IUGA 2JLDA 2QOOA 2Y6MA 3DU8A 4RX8A 4EHZA 1XKKA 3NVKI 2ETMA 4W8EA 2OK1A 2WFYA 4XH6A 5CENA 2C69A 3DDPA 3MH3A 3QQKA 3P7AA 4O0TA 3ZUTA 1J1BA 4FNWA 4NTTA 1KE9A 3R63A 3UODA 3VUDA 4ZOGA 2PULA 3CPBA 4K9YA 3R8PA 3GXLA 4TNDA 4YZBA 2QHNA 3E93A 4O27B 2WIHA 3BEGA 3MPMA 4F4PA 4E1ZA 2E9PA 4UMPA 4CLJA 5CSPA 5K0XA 3BHTA 3W2PA 3PPZA 4EK4A 3SG8A 4O0VA 4FSUA 4M7IA 5HVYA 1LUFA 5CU6A 2Q0NA 5M4FA 4XV2A 2R3QA 3OY1A 5FXRA 3TUDA 4DFLA 2WTIA 3MVMA 3KULB 3QZHA 1MQBA 1FBNA 4YGAA 3COKA 4RZVA 4K6ZA 1WBSA 4KSQA 3U55A 1H08A 5IEVA 4FKRA 1GZ8A 2J9MA 2WMVA 2OWBA 3UGCA 4EC8A 4G6NA 2HCKA 2J4ZA 5KMOA 1RJBA 2E9UA 3FQSA 4IIRA 2PTKA 4QPSA 5HE0A 1GJOA 4DTBA 4ACCA 4QMOA 3UIUA 3HRFA 2GNGA 5EKNA 2CN8A 4D2TA 2UV2A 3VS7A 5AP6A 2QI8A 4EZ3A 4MX9A 1VZOA 4IB1A 5L2WA 4IFCA 3VBQA 5I9ZA 4JR7A 4FE2A 2R9SA 1O6LA 4FMQA 3PVUA 4QTCA 2YWPA 4BDEA 4ZK5A 4CKIA 1VYZA 4UMTA 2IW8A 4BHNA 1PY5A 1V0BA 1GIIA 4AWIA 2BRBA 3K3JA 2YIXA 5JQ8A 2CDZA 3KVXA 2X2KA 1CTPE 4IVCA 4TWCA 4DGGA 3ID6C 3OCTA 1REJA 2J0KA 3OC1A 5HNIX 3VF8A 2OJGA 4C35A 1P2AA 1XH5A 3K54A 4IZAA 2HELA 2EXCX 3NYOA 3DY7A 4NU1A 2WXVA 4MTAA 2R5TA 3COIA 2J2IB 3Q60A 4FKTA 3QQHA 5IQBA 3IG7A 3VW6A 3DNEA 4JOAA 4ANSA 4B6LA 4I0TA 3TNQB 4AXAA 4F7SA 5FUTA 3P4KA 4DAWA 4EQUA 4ANMA 3ZBXA 2ZAZA 3WF8A 2VWUA 3R7EA 2BR1A 4ZTMA 2ZOQA 4EJNA 3CTJA 4FZDB 3DJ7A 2VTQA 2GSFA 3A7HA 3IPHA 1W83A 3NX8A 4C59A 1JSTA 5FRIA 2CGVA 3K5UA 3PXRA 3AT4A 3MTFA 3U6IA 1WFCA 1H24A 2BHEA 3JY9A 2B0QA 4FIJA 3EN7A 3FXZA 3P23A 4D2VA 3NYNA 3QTRA 4MBJA 4RWJA 1KE8A 4WUNA 3NUNA 3N51A 1PMEA 3PJ3A 1L8TA 3HL7A 2O8YA 5CI6A 4GRBA 4BGHA 3OXZA 3ZM4A 4EH4A 4RRVA 1Q97A 3MVHA 1PRYA 5DH3A 5H8EA 3I5NA 3OCGA 4JQEA 1ZXEA 3ZOSA 1YHVA 2Z8CA 4X2KA 3HA8A 4YO6A 3PVWA 5E90A 4N57A 5CSHA 4EI4A 2JKQA 4IDVA 3UNZA 3NIZA 5BVDA 4LRKA 4QYFA 4N6ZA 3AMYA 5LQFA 3LQ3A 4HOKA 2X9FA 1JKTA 3TT0A 3AT3A 4OLIA 1FPUA 3C4ZA 4QYHA 2VN9A 2PE2A 4IX5A 4U9AA 4O7WA 3HMMA 3ZM9A 2GTNA 3FMMA 3GNIB 1BL7A 3FJQE 4B99A 4RJ4A 2WQEA 4TWOA 2ITXA 2QC6A 4LV5A 3MVJA 4FSQA 1YWRA 4IBMA 5I9UA 1OI9A 4U0IA 1OPJA 4AN2A 5HE3A 2BFXA 5CAPA 1YXXA 2CNUA 1S9JA 4U43A 2P55A 3W1FA 4BDIA 1OIRA 4BI1A 4AOTA 1P4FA 2XKFA 2ZV7A 1CM8A 1O6YA 2ETRA 3IOPA 3O7LD 4D1XA 4RA4A 2QR8A 1GZKA 4K8AA 5M44A 1E1XA 3ZXTA 2R3LA 1OIUA 2BRHA 2XK9A 2XH5A 4X2GA 2R0IA 3TJCA 4B7TA 4HJOA 2VO0A 1XH4A 3EN9A 4RPVA 3PIYA 3GCPA 3ZLYA 3ZUUA 4E7WA 3HV7A 5M4CA 2C5YA 4P90A 3LFCA 3SXRA 3M2WA 3QX4A 4HZRA 5CU4A 3Q04A 5DN3A 4ACMA 4HZSA 4E6DA 4ZMEA 4FSNA 3QYWA 3R71A 4IZ7A 3LQ8A 5IH4A 1F3MC 2WQMA 4PPCA 3HAVA 4YZNA 1F5QA 4OBOA 3P08A 5CSWA 3QL8A 3Q5ZA 4BKJA 4PMSA 5CU2A 3TKIA 3H9OA 4DFYA 2C6TA 4WIHA 3EQIA 5I9YA 1H07A 5DG5A 5GJFA 2ITYA 5A4EA 3ETAA 3OZ6A 3FQEA 1DAYA 4FGRA 3MY5A 5HNGA 5KHWA 2JIIA 4YZDA 1WBPA 3LVPA 4BDCA 3THBA 1CKJA 3ZDUA 4IAKA 1FINA 2X7FA 3BCEA 3F2RA 3R30A 3RAKA 3JXWA 5AAEA 2ERKA 3DA6A 4CFMA 1UU8A 3RPYA 2ITQA 4L67A 4BGGA 4FV5A 5J5TA 4BDGA 4EJ7A 2Z2WA 5H9BA 5CVGA 3ERKA 3PVGA 2V62A 4FIFA 4PX6A 4YNOA 4GUEA 3WIKA 4FEUA 3NNVA 4FBXA 3ZONA 2XK6A 1H0VA 3OCSA 4FSWA 1YRPA 3FMEA 5E7RA 2JFLA 3F5PA 3W33A 1JKKA 2VO6A 2VO7A 4FA2A 3FPMA 5J7HA 4O21A 3QQLA 4FC0A 2ZB1A 3V51A 2VNYA 3O8UA 4JIKA 4QNAA 3LFNA 3V5PA 5HG8A 4G3DA 4GJ2A 4BTFA 1M52A 5JN2A 4IM0A 2HWOA 4KA3A 4BCQA 1P14A 4E4LA 4S2ZA 3MN3A 3BU5A 3DAJA 1NVQA 4M13A 4IC7A 3FE3A 4RG0A 5FXSA 3FY2A 3I7CA 3LCSA 2PVKA 3D5WA 4I93A 4RX7A 4HYHA 5CNNA 3KXZA 5HBHA 1S9IA 3EQBA 2VZ6A 4MYGA 4Q9SA 3R7YA 1WBNA 4RWKA 4DC2A 5EI2A 4EHEA 3Q52A 4UMRA 4Z7HA 4GT3A 1J7UA 2PMIA 3BGQA 4W9XA 4Z16A 4MAOA 4AS0A 5AV3A 3QLFA 4PMPA 4C4JA 2VUWA 2NPQA 3IDCA 3EMGA 4JRNA 4Y72A 5ANJA 4U41A 3R7VA 4E5BA 3WARA 1OMWA 2BDFA 4FTLA 2PE0A 4BCHA 4Q2AA 2JAMA 2CPKE 3BYSA 3ZH8A 4MNEA 2QOLA 5DEYA 4B0GA 3UO4A 3KB7A 3LXKA 5DFPA 5CT0A 2XK8A 5KX8A 5L2TA 5EM8A 4TYIA 2BKKA 3ALOA 1CKPA 3ORMA 4GIHA 4JG8A 4JAIA 2QG7A 1GAGA 1IR3A 1M14A 3M1SA 4JRVA 4ANQA 3FMDA 5CY3A 1NT2A 2WEVA 2YM5A 4PL4A 3UPXA 3VJNA 4U45A 4EH7A 4FEXA 4BCGA 3TCPA 4W4WA 3PIZA 3SXFA 5IQCA 3HV4A 4J8NA 2RFSA 2W1FA 5FBOA 3AQVA 3RCDA 4L8MA 3SRVB 4LOPA 4EUUA 4F65A 4O82A 4RLKA 3G90X 2X8EA 3OW3A 2C5NA 3FKLA 3GU5A 3OXTA 2J6MA 4ZXTA 1QPDA 4WA9A 4QMLA 4V0GA 2XJ2A 2O64A 1WVWA 4M68A 3ZYAA 3L8VA 4ZP5A 4O83A 2P3GX 3EYGA 4R7BA 4FIGA 3EKKA 4FV2A 2QNJA 3DXQA 2Q0BA 1CKIA 2OXXA 3D7TB 4S34A 3WBLA 4YHTA 3C51A 5TE0A 4GFMA 3KMMA 4L3JA 5CX9A 3ZMMA 4GMYA 3ORPA 3MA3A 3AD6A 3POZA 4FKWA 3VS3A 2BZJA 4CG9A 4YMJA 1SVGA 5DT3A 4OUCA 5IZFA 4IE9A 4YZ9A 4E6AA 2YN8A 3FZSA 2XIRA 5AP3A 4NW6A 3VAPA 3ZU7A 4AA5A 4B8LA 5AA8A 3UIMA 4MVFA 5M08A 2HWPA 3TTIA 4DF3A 3E88A 4IJ9A 1TKIA 3IONA 4YUQA 2GHMA 3LM0A 3TNHA 2GS2A 3CQWA 2FSLX 3VBXA 1UU7A 3LMIA 1BLXA 2HY0A 3JUHA 3OCBA 1Q24A 3VULA 4EOKA 4FEVA 3R00A 3KMWA 2BRGA 4IACA 3GC8A 5AR5A 4QTAA 4D4VA 3IW4A 3ZEWA 4NW5A 2XKEA 4BF2A 5I0BA 2R2PA 4XG8A 4LMNA 3ZRLA 4LGHA 4AACA 4G9CA 2X7GA 4GUBA 3BKBA 3KVWA 4WG3A 5JFWA 1FVTA 4U5JA 3MJ1A 5E91A 3UJGA 3UOJA 5H3QA 2EB2A 4UXLA 3N4UA 3DFAA 4FKSA 3U9CA 4FKPA 4K0YA 3F5GA 2E9OA 2XM8A 2F9GA 3O71A 3R7OA 4DA5A 4E3CA 4AGUA 4H39A 2VTLA 2XIKA 2I1MA 2V7OA 1OIQA 3EFWA 4K11A 1E1VA 3DDQA 5HLWA 1I44A 4E5AX 4UYNA 4USFA 3FZTA 4N70A 3FQHA 4QMXA 5BUIA 3TV6A 3CGOA 4G16A 3LJ2A 1ERKA 5KMMA 5K5XA 1XH8A 4RMZA 4RJ3A 3W2RA 2ITWA 2PE1A 5FM2A 4ZSLA 1ZRZA 1O9UA 4IAFA 4OTFA 5AUUA 3VC4A 4FZ7A 2C5XA 2CKOA 3WF9A 2ZDTA 5EQYA 4DH7A 2GNFA 3T3UA 2X8DA 3EFJA 4UMQA 3R1NA 2VAGA 3ROCA 1OVEA 3R1YA 4TWNA 3GFWA 3UNJA 5BQ0A 5IU2A 1IAJA 5IQFA 1U5RA 1E9HA 1H0WA 4NTSA 3KMUA 3QCYA 4XRJA 1M2RA 3I4BA 1PHKA 3QD2B 3ZRKA 3EWHA 3ANRA 4MXAA 4YNEA 4D58A 4DEGA 1OKVA 3ACKA 1SNXA 2YDKA 4G9RA 1ZAOA 3NW7A 1Y8GA 3A61A 3QU0A 4J7BA 3OWJA 4JBVA 1Y57A 3F5UA 1U54A 3R01A 1VYWA 4AW2A 3ZO1A 3KF4A 4XYFA 4D0WA 4PTEA 2IW9A 3ULZA 4BTMA 5CWZA 4CMUA 2IZSA 1IA9A 4HGTA 4QMUA 2W9ZB 4YJSA 4FL3A 5IEXA 4AZFA 3HV5A 4EOLA 3NUUA 4QYGA 3A62A 3BELA 3PA4A 3R04A 4LL0A 3CPCA 5DBXA 5AMNA 2VRXA 3ZSHA 4EOJA 5CF6A 4KIKA 2FSMX 3IGGA 3PJ8A 1W8CA 3F7WA 1UNLA 3T3VA 2QHMA 4RQVA 3R02A 3E8CA 5L8KA 4P7EA 4MWIA 3ITZA 1WZYA 3DJ6A 2W1CA 4G34A 4C57A 1ZYDA 3KU2A 4QTDA 4AU8A 2UW4A 3MWUA 3QTUA 4ENXA 1J1CA 2FVDA 3F66A 1OM1A 3HX4A 4ZS0A 3E92A 4MXXA 4O7NA 3T9TA 4FNXA 5EG3A 2CN5A 4RJ5A 3TZ7A 3AOXA 3JR1A 2B9FA 4FG7A 2FB8A 4YBJA 5I3OA 3R9RA 4BTKA 3E5AA 4RIWB 3VBYA 4KAOA 2XRUA 1Q5KA 2P0CA 2YLFA 3FSKA 3ZRMA 3CD8A 3NLBA 4WNOA 4R1VA 5JFXA 2CNVA 2YM4A 4K18A 4PMTA 4PL3A 4OTPA 5EW8A 3WI6A 4TW9A 1UKIA 4R3RA 3F88A 3UC3A 2W5AA 1JSUA 5CNOA 2PVNA 3TI1A 3NPCA 3VUGA 4U3YA 4XG7A 3N9XA 4FTMA 4YJNA 2YITA 4AT4A 4EH9A 3PXQA 3U4UA 3WZKA 3A8WA 4PQNA 2ZDUA 3QX2A 4YPDA 3PJ1A 5JZJA 2XKDA 2QVSE 4JQ8A 5GZ8A 3TUCA 3E87A 1R0EA 3QA8A 4IZ5A 4MEDA 4J53A 4IX6A 5BPYA 3ODYX 2XVDA 5AP1A 4EEVA 2IVVA 4X2JA 2B9IA 3WE8A 4DGMA 4FEWA 2BTSA 2XIYA 4FV4A 2Z02A 2AC3A 5CZHA 2H6DA 3R6XA 4D5KA 4Q5EA 5AP0A 4V05A 4U6RA 4KKHA 2QR7A 1OECA 3M11A 5FD2A 2VTPA 3GFEA 4FTTA 5E8XA 4BRXA 1STCE 3NW5A 5HZNA 2VWXA 4Y5QA 4QD6A 1ZOEA 4C2VA 4L3PA 4U42A 5E1EA 3ZLSA 4NKSA 4AZEA 4DGLC 4BIEA 5HORA 2UW8A 3U8WA 2JDVA 4DN5A 1I09A 1ZOHA 3PXZA 2O2UA 2QG5A 3R1SA 3WE4A 3CCNA 5CQUA 5B2LA 1XHAA 2WIPA 2UW5A 3F7ZA 5AUXA 3PJ2A 4Y5HA 4UEUA 3ENHA 1ZMWA 4F9AA 4ASXA 4C62A 4DTKA 1XJDA 4BC6A 1TQPA 3VIDA 4MNFA 4F0IA 4TXCA 5K0KA 5LMKC 4IDTA 5EYKA 2C6DA 3NGAA 4BKZA 4DHFA 1Q8YA 5C4KA 3F2AA 5LMKA 3NNXA 1H01A 5J87A 1XR1A 2EXEA 3A60A 2WU6A 4AN3A 1YWNA 3DKGA 3MH1A 2WMRA 3FAAA 3BQRA 1F0QA 1Q41A 3ENMA 3VRZA 5GZAA 2JBOA 2JD5A 5EI6A 1DM2A 3CY2A 1UNHA 2CKQA 3FI2A 4HGSA 4IM2A 4WG4A 2BCJA 5BMSA 4RIYB 4W8DA 4G31A 2YM7A 5LVMA 3V5LA 4WBOA 3CY3A 3BYUA 4QPMA 4LOOA 4X3JA 3OTUA 5EHOA 2UW3A 2G15A 4PNIA 4BDAA 5HEZA 1A48A 1KUTA 2E9NA 4YHJA 2XNOA 3RPOA 3I6UA 4EK5A 4JG7A 5D7VA 3CJFA 3R9OA 2Y4PA 4J8MA 3BE9A 3BHYA 3I0OA 1B39A 2R7BA 1Q3WA 2BROA 3EQGA 4O91A 5E8ZA 4BCKA 4D4YA 2R3FA 3C1XA 4FZFB 4OBPA 3DBFA 4I21A 3Q6UA 2B52A 3C5UA 4FIIA 5DT4A 3LJ0A 2F7XE 3RBWA 4IWQA 2JBPA 4QP1A 3ORLA 4RT7A 4U79A 4O84A 3NAXA 3BV3A 4XP2A 1YOJA 3PWDA 2JDTA 4QYEA 3IQ7A 5EKOA 3UVRA 3R28A 2YCFA 4O0UA 3WZUA 1GIJA 4QMNA 1Z9XA 1JAMA 2IVTA 2XCHA 4OAVB 3NUYA 4UWCA 4CKJA 4G3FA 3HVCA 5DT0A 4FODA 3ACJA 4G5PA 3CJGA 4ZTQA 4IXPA 2A19B 2XK7A 4G3GA 4DG0E 1JKLA 3CEKA 4TYHB 3K5VA 1CDKA 2XYUA 3MVLA 2WTKB 3AXWA 4FV6A 4O7SA 4DCAA 4ZTSA 1Q61A 2UZEA 3NS9A 3EYHA 2RGPA 4IB5A 3FXXA 4O0YA 5AUZA 4CMOA 1XO2B 2B9HA 4CCBA 5HIEA 4TT7A 4N6YA 4DH3A 2W99B 3VS5A 3RK7A 4E20A 4FSRA 3CXWA 4ZEGA 3C4XA 3G5DA 3QQUA 1QCFA 3A4PA 2XNBA 3V6RA 1FVVA 4BCJA 5HBJA 2W5HA 2GS7A 4IX3A 2PUPA 1PXOA 3RPRA 4GG5A 3UG1A 3KRJA 4ENYA 3QXPA 4YBKA 5JK3A 3KREA 4W4XA 2OIBA 4O2ZA 3C4WA 5DA3A 3V5WA 3Q4TA 5ANOA 4G3CA 3LXPA 4CMTA 4F6SA 5DYJA 1KOAA 3QHRA 5FXQA 2PK9A 4JDKA 4RGJA 3VS4A 3S0OA 2UW0A 1H25A 3DKCA 2ZMDA 4KSPA 4RVKA 5A4TA 4MH7A 4I6QA 4BTJA 3HMIA 3F69A 2XP2A 5HE1A 4WSYA 3PY0A 4DLJA 5FEQA 4BWPA 4KKGA 4S30A 3UVPA 3VN9A 4D2WA 4AP7A 2HZ0A 5IMEA 4EQCA 3R7IA 4RA5A 4X6RA 5KE0A 4PMMA 3UOLA 2WQNA 3PLAE 4IZYA 5FEEA 2QKWB 3BGPA 1MUOA 5HU3A 3HKOA 5HBEA 1ZYJA 4XS2A 2X4ZA 4DLIA 4KBKA 5FBNC 3NAYA 3UMWA 3MB6A 3VWAA 4ZSGA 3VUMA 4ZLZA 4O0WA 2I0VA 2BFYA 2RL5A 3EKNA 4KABA 5BYLA 4NM7A 4D2RA 4FV0A 4S33A 3DXPA 1H1WA 2WMBA 3VUTA 2ITZA 5L2QA 5C9CA 2RSVA 4FL2A 3BLQA 4QMYA 4YJVA 5HNBA 3GU7A 2XBJA 1YWVA 3GI3A 5LVPA 2CHLA 4FR4A 3R8VA 3EH9A 2XNMA 1OKZA 2V5QA 3BPRA 5E8UA 3GENA 5BVWA 3L9PA 2FO0A 5HTBA 5J9YA 4H05A 5M51A 4PRJA 5A6NA 3D0EA 1OKWA 4GK3A 4QO9A 3HGKA 3AC2A 3MDYA 2VWZA 3NUPA 1P5EA 3TKHA 4E6QA 3MS9A 3AT2A 5M4IA 4ANLA 4CXAA 3HECA 4QMPA 3H3CA 4GH2A 3WZEA 5AR7A 5IA1A 4RIXB 4DT9A 1SZMA 5LXMA 2YFXA 4E8AA 4GT4A 3DLZA 3VBVA 5I3RA 3VNTA 4D4RA 4DFXE 5D41A 3QQFA 3L8XA 2C0IA 3HZTA 4RFZA 3RWPA 2R3JA 3KFAA 3W32A 4FUYA 5IQEA 4GVAA 3BU6A 5DLSA 2GNJA 3I1AA 1OBGA 2EUFB 2J51A 4ASEA 3U54A 4AOJA 4MD9E 5D10A 3P7CA 3OWKA 5L3AA 5L6WL 2BAJA 4IVBA 4DEDA 4L46A 2ITUA 2PVHA 3C4EA 3EIDA 5CVHA 4C3RA 4Q9ZA 2X6EA 4HYUA 2R3PA 2W7XA 3FLSA 2VWVA 4IM3A 5AV4A 4QMMA 2IZRA 3GU6A 5DVRA 1JSVA 5EYMA 3WZDA 3DAEA 3D2IA 4ASDA 4I4FA 5D1JA 4MF0A 3QBNA 2YZAA 3BV2A 4MD7E 3HEGA 3QRUA 1MP8A 3C4FA 3OT3A 3Q2MA 2R3KA 2I0HA 4CYIA 3FI3A 3HV6A 5KZ0A 4F7LA 3TDWA 2FUMA 2WZJA 4M0YA 4C3FA 3TM0A 5KZIA 2G9XA 2W96B 3TN8A 4NUSA 3EQRA 2PUUA 3DQXA 4FNZA 5LCKA 4YZCA 2YWVA 2UVZA 2SRCA 4OT5A 3QQJA 3F2NA 4H1MA 5ANGA 1DI8A 5JKGA 3A99A 3FXWA 2HXLA 4XP0A 5JZNA 3WZJA 3FMJA 5TF9A 4IJPA 3V8TA 1R0PA 3FLNC 4CFNA 4R77A 4WNPA 4A9YA 3RJCA 4XG9A 5AP7A 1OUYA 4MBLA 3MFUA 4B4LA 3G51A 3IW6A 3KXGA 3REPA 3G9LX 1OL5A 3NCGA 3FZPA 3DFCB 4MQ1A 3PP0A 3CE3A 1PXLA 4G1WA 4CQGA 2YERA 5AP2A 3SX9A 3DLSA 4DYMA 5AEPA 3VS1A 2RKUA 4RIOA 4R7IA 3PZHA 3DNDA 3R8UA 4EOMA 2C30A 3BYOA 3DBEA 5HICA 3Q6WA 1ATPE 3PP1A 2UZOA 4FT5A 4IB3A 3S00A 3TACA 2J0LA 3EN4A 4BDFA 4NWMA 3RP9A 2QO7A 2Y9QA 3OUKA 4YURA 4Y73A 4V04A 1SVHA 4XBRA 3BU3A 4AGDA 4F9WA 3PSDA 4WG5A 3LMHA 3OEZA 2WMAA 5A14A 4JS8A 2EWAA 2VO3A 5AV2A 5IQAA 4PDPA 3N4VA 2OFVA 4I6BA 3OS3A 2Z7SA 4NIFB 4DITA 5K4JA 1W84A 4I0SA 3HUBA 1KV2A 4KNBA 4CD0A 2ZJWA 2RFDA 4XX9A 1IA8A 1H1PA 1OL2A 2J0IA 3QFVA 3OP5A 4GL9A 4MK0A 3PWYA 4C61A 4O81A 2XS0A 2UZWE 1SM2A 3QLGA 2WGJA 2XYNA 3O7LB 5E8TA 5I9XA 3R1QA 5HIBA 4FKLA 3OBJA 5CEQA 3QRIA 4G17A 2C1BA 3PY1A 4EYJA 2YIRA 2VTTA 3LZBA 3SAYA 3EQPA 1PMVA 5HTIA 4XRLA 1PKDA 5BUJA 2PMLX 3ZO4A 3SKCA 4GKHA 3P79A 2R7IA 4F1OA 4RC2A 4FTRA 2WMWA 5HE2A 5KHXA 2W1EA 4RWIA 4FKJA 4XV9A 2FH9A 4DG2E 5GJGA 2X2LA 3R9HA 4BN1A 4IQ6A 1AD5A 1W82A 4I6HA 4I5CA 1CSNA 4I5MA 4OTHA 2REIA 2BILB 5EHLA 5J5SA 4WRGA 2IJMA 2P2IA 3TXOA 3HUCA 4M0ZA 1JLUE 5E1SA 1Q99A 5HCYA 4X2NA 2PMOX 4XG3A 4XG2A 4HVSA 2UZUE 3KY2A 3E8NA 5CI7A 5AX9A 5AP4A 5ETCA 4A9SA 3U87A 4HPUE 2YIWA 4L01A 3LXNA 2WKMA 4A06A 3TKUA 5L6OA 1OIYA 3QD0A 2C5VA 4FIEA 3H4JA 3HDMA 3IW5A 3K3IA 4AT3A 4EZ7A 3R73A 5CVFA 4HW7A 2GNHA 1R39A 2G1TA 3L9MA 4QP9A 4FOBA 3FL5A 2JITA 2Y4IB 3FKNA 4FTCA 1DI9A 5B7VA 4YJRA 4QMVA 3PXFA 4P4CA 3V6SA 2C47A 2VGPA 3PY3A 3FZRA 4FK3A 1REKA 3KCKA 4C4HA 3HV3A 5CZIA 4I24A 3S2PA 2VX1A 2CGWA 3IECA 1PXKA 2A1AB 2UZVA 2VTAA 2R0UA
chains in the Genus database with same CATH superfamily
5AR4A 4QMWA 2P33A 1B38A 1OL7A 3D4QA 4WD5A 2UW9A 4I92A 3ODZX 3LPBA 1KV1A 4RVTA 3PZEA 3ZXZA 5L6PA 5JT2A 3JVSA 4EH2A 1PYXA 5KNJA 4HYSA 3ROYA 4ORKA 4YZMA 3DAKA 3UE4A 4BICA 3GOPA 4F64A 3E7OA 2NNWB 3CTQA 2ZV8A 3L8SA 4X3FB 5EH0A 2UVYA 5GHVA 4AF3A 1SYKA 3BZ3A 4FTAA 4I5PA 1V0OA 3BQCA 4F1TA 3R9NA 3O17A 3NW6A 2HAKA 3U51A 2XB7A 4CRLA 4F9BA 3FMHA 1KWPA 4BZDA 4D2SA 2OZAA 3GUBA 5DHJA 5J1WA 5EM7A 4OTWA 4GK4A 4RIWA 3VVHA 1K2PA 1YHWA 4ZTHA 1O6KA 2HZIA 4LUEA 5KCVA 3QCSA 4FSZA 2AUHA 4E93A 4FTOA 5CSXA 3GU8A 3AMBA 5BX0A 4WKQA 4AZSA 3LE6A 3VBWA 3TZ8A 2C3IB 4JDHA 3EB0A 2PVJA 4CTCA 4PY1A 2BRNA 5BVKA 2Z7QA 4BDHA 1OB3A 2F7ZE 3QCQA 3W2QA 2PHKA 4PL5A 2YAAA 4CFWA 2Q83A 3ALNA 2XAOA 2QU6A 2CMWA 3FLQA 4K2RA 2CLQA 5H2UA 2VWIA 4Y83A 2XBAA 2Y8OA 4S31A 3UVQA 3OF0A 4FSYA 4PF4A 4A9TA 5CAQA 2W5BA 5LWMA 2ZMCA 4C33A 3KRXA 5GIPE 4JI9A 4LRMA 3DK7A 2Z7LA 4MXZA 4X21A 4DHIB 3RPSA 3POOA 2PVMA 4KKEA 3GQIA 2IN6A 4L53A 3CKWA 3KXMA 4M66A 3QWJA 3IS5A 5AR8A 3RALA 3D14A 2XNNA 3I5ZA 4WNKA 3RCJA 2CSNA 3QKLA 5H8GA 2PUIA 3Q9XA 3V5QA 2XUUA 3I60A 1K3AA 3E63A 2H9VA 5LVNA 4X0MA 4Y8DA 3VF9A 4WOVA 5CXZA 2RFEA 5FTQA 2ZM3A 5AM6A 2B55A 3DCVA 4JR3A 3NWWA 5AAGA 4B8MA 2JKOA 4I23A 3HNGA 3OROA 1IAHA 4ALUA 2PZ5A 4ANOA 2XEZA 4NCTC 3TJDA 3UIXA 2WTCA 3S95A 4YSJA 2HXQA 1NW1A 2DS1A 4OTRA 4A9RA 4AXCA 1PXPA 4DDGA 5J79A 1Q4LA 3PJCA 3FMNA 3PIXA 5FTOA 4XJ0A 4FTIA 3EQFA 5AM7A 1RE8A 1YDSE 3WYYA 3CLYA 2CKPA 1WAKA 3EHAA 3CIKA 2OZOA 3QCXA 3EJ1A 3TWJA 4CFXA 2GHLA 3AD5A 3DK6A 4ALWA 4BBMA 4MCVA 2GDOA 4EWQA 3I81A 3QUDA 2G2HA 1PMUA 2UZDA 4OT6A 4FK6A 3F3WA 2QOFA 4WUAA 4AFJA 2HZNA 3BRBA 4FNYA 4IVDA 4M14A 5IA0A 4CFFA 2QO2A 3LLTA 2GQRA 1W2CA 3MY1A 3OG7A 4O0XA 2YCRA 4OW8A 2VX3A 4ZTLA 1Q8UA 4I1ZA 2WAJA 3FSFA 4DCEA 4QP4A 5K4IA 1BI7A 4FT9A 3UYSA 1LR4A 4F9YA 2C0OA 3TL8A 3LFSA 4FTUA 4FYOA 1W0XC 4E5WA 3SA0A 5E4HA 2HW7A 4IC8A 4PDSA 2VWYA 5CSVA 1PJKA 2NRYA 1H1RA 4IVAA 5C27A 3UYTA 4C4IA 5M53A 1QMZA 3OOMA 4ERWA 4NM3A 2QOKA 4BDDA 5GZ9A 4I20A 3COMA 3G15A 3FHIA 1Y6AA 4IAAA 3CC6A 5I9VA 4XG4A 4HVHA 4EKKA 3LFFA 3DXNA 4HNIA 4GFGA 2JEDA 3KQ7A 3RAWA 4L00A 3FWQA 2H34A 4RLLA 4TYGA 3P78A 4ONAA 3LIJA 4G5JA 4YJTA 4ZJJA 4E26A 4UZHA 5HO6A 2CKEA 2UVXA 4YJOA 4R7HA 2JFMA 4R3PA 5CT7A 4FKGA 3QZIA 4U8ZA 4O7RA 4J95A 4O0SA 2OG8A 2YACA 4LL5A 4O7YA 4KIOA 5I5ZA 3O96A 1A9UA 2WTKC 4QP7A 4MXYA 3F5XA 3KK8A 5EOBA 2OKRA 1M2QA 3A7JA 5FTGA 3CGFA 3GCQA 2W1ZA 4HGLA 3ZCLA 1ND4A 4OGRA 1BX6A 3BWFA 3C13A 2RIOA 3FI4A 4GW8A 2J90A 5HX8A 4OAUC 1MRUA 2W4JA 4IB0A 4KINA 3TIYA 4FG9A 5A9UA 4CV8A 3D5VA 4BCIA 1U5QA 3EQHA 4ZTRA 5IA5A 3VBTA 4L3LA 2PZRA 2ITTA 4DINA 4YTFA 4EH3A 3Q5IA 3PXYA 3GQLA 3W2OA 4LV8A 5IISA 2X1NA 4K77A 4O0RA 1OZ1A 1ZY5A 4TNBA 5LMAA 4FZAB 3S4QA 4YO4A 4YR8A 1ST4A 1T46A 2RF9A 4JXFA 1UNGA 2C3JA 4C02A 4ITJA 2KTYA 4QMZA 2XZSA 4MBIA 1G5SA 3QRTA 4Y95A 5EYDA 4BDKA 5CU0A 5JRQA 5BUEA 3BHUA 2GNIA 2XALA 3NRMA 2OJ9A 5FDXA 3UMXA 5ITAA 2WQBA 5HLPA 4E4XA 2JDOA 4M69A 5BVOA 4JMQA 3MJ2A 1NVRA 3FLZA 4CLIA 3EQDA 5BMMA 3RPVA 3RAHA 1ZYLA 3UC4A 3E3PA 2XEYA 3QD3A 2WOUA 5IEYA 4E6CA 2WHBA 2VTHA 3C0IA 3W8QA 1ZMVA 2IZTA 2XJ0A 2B4SB 2O5KA 3Q32A 5CYIA 2A0CX 5DRDA 5C8MA 4BCMA 5JGBA 3FMKA 3A7IA 4NKAA 4LG4A 4RJ6A 4V01A 2CNQA 2I40A 3R8MA 5H8BA 1W2DA 3PLSA 1APME 4FKQA 3D5UA 4MKCA 4AGCA 4V0GB 5ETAA 5F94A 5L8LA 2X8IA 3DZQA 2EB3A 3DPKA 3FZOA 3HMOA 3RMFA 4M15A 3R9DA 3V8WA 4KB8A 2WB8A 3VQUA 3MH2A 4BL1A 3P1AA 4LQMA 4F9CA 3QHWA 2ZV2A 3BHHA 3VQHA 5HD7A 3UQFA 3UQGA 4F0GA 3LKMA 2RG6A 2YIYA 3W2SA 3TYKA 2W1DA 4JBPA 3Q96A 3ZUVA 2VTNA 4C37A 2J5FA 2R3RA 1H4LA 2YM6A 5KKRB 4X7QA 1VLRA 4FEQA 4F70A 3DKFA 3NVMB 3EZVA 2WMUA 3FZ1A 1YW2A 3NYVA 3PSCA 4F09A 3Q9WA 3KULA 4ZZNA 1RDQE 2J7TA 4GU6A 2BKZA 3R22A 4H36A 5T6KA 2OBJA 3QXOA 4O38A 5T68A 2EVAA 4R1YA 4AOIA 4AX8A 4TYEA 4M84A 4EH5A 3E64A 3P5KA 2R3NA 4CZTA 2BMCA 1KOBA 5J95A 5T3QA 5LVLA 1PMNA 2CGXA 3PFQA 4FKVA 3D7ZA 1WVYA 3QTIA 4ZJIA 3FPQA 4C58A 1YDRE 5DEWA 4ZSAA 3W16A 5DOSA 3ELJA 4M97A 2GNLA 4L68A 3IGOA 3F3TA 1LEWA 2QODA 4TL0A 2F7EE 3MGYA 4DH8A 1G8AA 1FGIA 5GIOE 1OL1A 4EYMA 3FLWA 3SGCA 4FX3A 4I41A 2WMSA 4J99A 5ETFA 5IDPA 3KXNA 4PV0A 2CCHA 5M07A 1OUKA 3A8XA 2OJIA 1YOLA 5B2KA 4O86A 4HCVA 1YXSA 4R5YA 1H27A 2XNPA 4S32A 3EL8A 2YJRA 4AQCA 3AGMA 3PUPA 5JGAA 4J71A 3E8EA 1J91A 2X9EA 4AUAA 3PPKA 2BZIB 4HGEA 2QD9A 1IASA 4OBQA 5ANKA 2XANA 1W7HA 1SMHA 4GVJA 4CCUA 3ORTA 4X6QC 3TEIA 4D0XA 1R3CA 3G6HA 2VTMA 3O8TA 3UZRA 2HW6A 4BHZA 2OLCA 3RNYA 2YABA 5CEMA 3WF7A 1UU9A 3I7BA 3Q9ZA 4KWPA 5FM3A 3TNPC 3M42A 4GEOA 3QRJA 4APCA 4H58A 2ETKA 3FHRA 3BYVA 4I94A 4WSQA 1ZOGA 2YISA 3W2CA 4CZUA 4EC9A 2PPQA 2QURA 1Y6BA 4JIAA 3HP2A 3W55A 4DEIA 2IPXA 3ZHPC 4AZVA 5EOLA 3QZFA 4FTQA 5K3YA 4TKSA 3GGFA 4FUXA 3ZFXA 5JFVA 1GZNA 4PPAA 1Q8WA 5FG8A 3UOKA 3MSSA 1GIHA 1UWHA 3QGYA 4J98A 3SXSA 3MPTA 3BGZA 3QWKA 1M7QA 3GCUA 4G6LA 2R3MA 4QP3A 3TZ9A 2WD1A 5CAUA 4I22A 4KUJA 4AGWA 2VX0A 4KIKB 2XARA 4USEA 1FMKA 1XBCA 3P7BA 2X0GA 1M17A 4O96A 4KIPA 3V8SA 3NIEA 2VV9A 2ERZE 4G6OA 4BWKA 2B7AA 3RAIA 4QRCA 5IH5A 2UZLA 3KXXA 2QCSA 1DAWA 3C9WA 1OPLA 3D94A 3D9VA 3K2LA 4UB7A 1JKSA 4NT4A 5D9HA 3V5JA 5HTCA 3QRKA 4R78A 3U9NA 4CV9A 3H9RA 4JNWA 4RWLA 3ZDIA 4BWXA 2ZM4A 3QAME 4TTHB 4QT1A 4ZTNA 2YM8A 2HOGA 3SQQA 4EOOA 4P5QA 2ACXA 2PY3A 3P86A 4II5A 5AV1A 1PW2A 3ZEPA 3KN5A 2R64A 3R8LA 3TNWA 3KL8A 1YVJA 2R3HA 3H30A 5CAOA 4GIIA 1TQMA 3LMGA 5IA4A 4NIFA 5AUTA 4EOQA 4D2PA 3OVVA 5LWNA 1OITA 2Y0AA 4EK6A 5DMZA 4L52A 4CZYB 4A4LA 4E73A 4FOCA 4IX4A 2IW6A 4O6EA 4HCUA 1G3NA 3HYHA 2BRMA 2JDRA 3FYKX 5TO8A 4CTBA 3L9LA 3MB7A 3U6HA 4FF8A 2PVYA 4FVRA 3KC3A 3RM7A 4FTNA 3KRWA 3IW8A 4FVQA 4GFOA 2BIYA 5C4LA 4PP7A 2JKMA 3OWLA 2XK4A 2CCIA 4GSBA 2OSCA 4JG6A 3QUPA 4EKLA 1JQHA 2C5OA 3ZZWA 4DH5A 4ANNA 3UBDA 2JIVA 5IKWA 1BUHA 5DNRA 2X39A 4RJ8A 3TV4A 3VW8A 3EFKA 2UZNA 2FGIA 2JDSA 2X4FA 3UDTA 5LARA 4JDJA 3R0TA 2AC5A 1J7LA 4IWOA 3MFRA 2G01A 4FKIA 5LJJA 5TR6A 2YCSA 4AW1A 4O7VA 2ESMA 2X2MA 2W4OA 2CJMA 3AKJA 2LGCA 4D28A 3AC3A 4RSSA 2BZHB 4FGBA 4ZY4A 3IO7A 3RINA 4C4EA 4YTIA 4NK9A 4PDOA 4RVMA 1XBAA 4WT6A 3OFMA 5CASA 2O3PA 3FKOA 4IWPA 4UWBA 4YC6A 4LI5A 2XJ1A 3ZO2A 1OPKA 1QPCA 2IVUA 4EOPA 2XM9A 4L7SA 4Y46A 1HCLA 1ZZ2A 1DS5A 2Y4IC 3G6GA 5D7AA 4B9DA 5LOHA 3NUXA 4BIBA 4Z9LA 4J1RA 4QNYA 5CAVA 3ATTA 4QMSA 3OEFX 4H3BA 3QA0A 3WF5A 1X8BA 5HQ0A 1T45A 2XNEA 2QO9A 3LHJA 3BIZA 3NSZA 3PE1A 5F20A 3U6JA 1P4OA 5BV3A 1HCKA 3UO5A 2JGZA 1KE5A 3SHEA 2PZYA 3GC9A 5EDQA 1FGKA 1MQ4A 4QP8A 5HESA 2W17A 1XBBA 3ML1A 3NNWA 1WBVA 3QALE 3AG9A 5E8SA 4A4XA 4QOXA 3LCTA 3R7UA 2P2HA 3PVBA 5EW9A 4ZIMA 1W98A 1UA2A 1KSWA 5DRBA 3FDNA 5C8NA 3OXIA 4D5HA 4F6UA 4RFMA 5JFSA 4X3FC 4EBWA 4DBNA 3KK9A 3DQWA 3PA3A 2R3GA 4X3FA 5EQEA 3C5IA 1YQJA 2WTDA 3MH0A 3ATSA 3S3IA 3SW4A 3HMNA 4AT5A 3FYJX 3MW1A 4XOZA 5GJDA 2WEIA 2BAQA 3PA5A 5HD4A 1R78A 5HVJA 3UQCA 4Y85A 1PXMA 2C6LA 3FLYA 1IEPA 5GINE 2WMQA 3JYAA 5C8KA 3UZTA 2R3OA 3TNIA 5E8YA 2OGVA 3UNKA 4LUDA 2C6EA 3Q4UA 3HRBA 4EL9A 3CS9A 2QOQA 4L7FA 4CNHA 2X0OA 4C0TA 3DGKA 3MFTA 4QDVA 2X7OA 3GEQA 4Z55A 3E7VA 5EM6A 1URWA 2AYPA 5M56A 3UP2A 1G8JA 2ZYBA 3SRVA 3QGWA 3DKOA 4KD1A 4O6LA 3EN6A 5HU9A 5M57A 4D9TA 2BIKB 2GHGA 2HIWA 2XRWA 3DTWA 3FC2A 5HCZA 2WPAA 3OBGA 3F3UA 4IWDA 1HOWA 4F0FA 4EK8A 5HGIA 2ZFYA 5CQWA 1YHSA 1JVPP 2O63A 2PVRA 3AGLA 5HCXA 3ZTXA 3NR9A 2XAMA 4H1JA 5HO8A 4DGNA 4PWNA 1JOWB 4EBVA 2ONLC 5ANEA 3OWPA 3ZO3A 3MV5A 1G8SA 3CBLA 1JBPE 4GT5A 2GCDA 3NZ0A 2ONLA 3D7TA 3EQCA 3QF9A 3ULIA 5BVFA 5AFVA 3SOCA 5EYCA 4XBUA 4GKIA 2YZLA 2OXDA 2F2CB 2ZM1A 5EM5A 4ZY5A 4UMUA 2O65A 3AMAA 3ET7A 4DBXA 4ACHA 4BKYA 5FLFA 3IW7A 5FGKA 5C26A 3BHVA 3PSBA 4UXQA 5AR2A 5KMNA 4DFUA 1H28A 1ZMUA 2F57A 2OF2A 3V01A 3LFAA 4LOQA 5AX3A 3GCVA 2PZPA 2V7AA 1ZYCA 4HYIA 4LV7A 3QD4A 3CTHA 2P4IA 4FL1A 4YC3A 2PVLA 4A4OA 2DWBA 2BZKB 2OF4A 3DTCA 2OIDA 3OOGA 4XEYA 4XUFA 5C01A 5HO7A 4IW0A 5JH6A 2NRUA 4BI2A 3PG3A 4YU2A 3WYXA 4ZSEA 1NY3A 3UOHA 2F49A 1BL6A 4XG6A 5IUIA 1A06A 3ZFYA 3DS6A 4RX9A 4KIQA 3OTVA 4W4YA 4GU9A 2B9JA 5KMIA 4FV7A 2C68A 3D15A 1Q3DA 4FICA 4E4NA 4RZWA 4JQ7A 3F3ZA 4U40A 2PL0A 4EOSA 1BYGA 1VJYA 3QUEA 1XH7A 4DFBA 2YHVA 5J8IA 3W18A 3FY0A 3BE2A 3HDNA 4L45A 4AFEA 4MUQA 1WMKA 2HZ4A 3CD3A 2HYYA 4IEBA 3RHKA 3DV3A 2IO6A 5L2SA 4LM5A 4JLCA 4KS7A 3RZFA 3SDJA 3PRIA 4IADA 5DE2A 2ITPA 5TT7A 4PDYA 2G2IA 3LFQA 3ZFMA 4D4SA 1KE7A 4P2KA 3DB6A 5AJQA 4M12A 3LJ1A 3UPZA 4O7TA 2IZUA 4CYJA 3RM6A 3LW0A 4JBOA 5DWRA 3W0OA 3COHA 3W0MA 3CQEA 4LMUA 4YSMA 1PYEA 3I6WA 3ORKA 1OGUA 3OUNB 4Z3VA 2DQ7X 3H0YA 1KE6A 4CFVA 2XMYA 4ITHA 1RW8A 4YTHA 4BI0A 5HOAA 2DUVA 2FA2A 2PVFA 4BBFA 4I5HA 2FYSA 2WQOA 2WTWA 2HK5A 4R8QA 1YXVA 1V0PA 1GOLA 1UU3A 2A27A 4XLIA 3NUAA 1BI8A 3PG1A 1XH6A 3EN5A 2VTRA 4JT3A 5F4NA 1WCCA 5I9WA 1RQQA 2KULA 2X0QA 4YP8A 1YOMA 1L3RE 4C36A 4FTKA 3OY3A 4DFZE 5J1VA 3BLAA 3GC7A 3VUHA 4AE9A 3MIYA 5F1ZA 4TZRA 4F1MA 2QU5A 5CF8A 3DB8A 2E9VA 1QPEA 4OTDA 3OMVA 4PP9A 3RGFA 3PXKA 2A2AA 3GOKA 3RZBA 3CP9A 4DG3E 1Q8TA 1PXNA 4N4SA 4C4FA 4EHGA 3W0SA 4JX7A 2Y7JA 2VD5A 4C38A 1PF8A 4CT2A 2YA9A 1YI4A 2VTSA 5LVOA 4CRSA 4ZS4A 4J97A 4O7ZA 3IDPA 4X2FA 5I4NA 3BEAA 3FV8A 3QC4A 5KMKA 2OH0E 3LQ5A 5M06A 2QOHA 3CKXA 5CEIA 4FZ6A 4EOIA 3EL7A 4GYGA 1V1KA 3HRCA 2O0UA 4JBQA 5HG7A 5DI1A 3R21A 3NNUA 1XMLA 3SC1A 3VHKA 4FG8A 3A7FA 4FKUA 3WF6A 4O22A 1XH9A 3ANQA 3RKBA 5A4QA 3BLRA 4CSVA 4N0SA 3PYYA 5BNJA 3C0GA 2ZVAA 4F78A 5AAFA 2OFUA 2BVAA 5GNKA 4AXDA 4C34A 5EHYA 4DEHA 1Z57A 4WHZA 3V5TA 3UIBA 3JS2A 4KBCA 5TOZA 4ASZA 4AZWA 1M2PA 3DJ5A 5EFQA 1MRVA 4YHFA 3QKKA 1JWHA 4DT8A 3PFYA 4PPBA 3E3BX 3KN6A 4RX5A 4C2WA 5IF1A 2JIUA 3MA6A 4YLJA 4GK2A 2W06A 5LCJA 2W1HA 1TQIA 4MD8E 3C50A 2W0JA 3OD6X 3BL7A 4XMOA 3ZSIA 3KEXA 4CT1A 1PKGA 1YI6A 2C3LA 5J9LA 2WU7A 4U44A 3KRLA 4XOYA 4FT3A 4QMQA 2VNWA 3FUPA 5IMXA 1SNUA 4E4MA 5IQHA 5AUVA 1ZLTA 3UDBA 3MBLA 4J52A 4LFIA 2F2UA 4F7JA 2BDJA 2YIQA 3D83A 4BGQA 5B2MA 4W4VA 3VJOA 3GBZA 3GT8A 4LGGA 3LCDA 2BPMA 3RWQA 4CG8A 5ANDA 4YJQA 5CF5A 2B1PA 2XCKA 4FSTA 4M67A 4TRLA 5CF4A 5ICPA 1M7NA 3L9NA 4H3QA 5HI2A 1BMKA 2IF8A 5IQGA 3P0MA 4M8TA 5KMJA 4WO5A 2W05A 1UWJA 2QONA 4IANA 5HG9A 5DR2A 1LP4A 5F9EA 3G2FA 4NJ3A 4NM0A 3FEGA 1OKYA 2C6MA 3NYXA 3ORXA 3NFGB 1FVRA 4OTQA 3QQGA 2GTMA 2YAKA 4UN0C 1OL6A 5KKRC 4ZMFA 4O4FA 2EU9A 2BTRA 3BYMA 3QC9A 5IUHA 2GQSA 2X6DA 5IQDA 2OW3A 4EQMA 2I0YA 4JDIA 3RVGA 2WOTA 2C4GA 3C7QA 4NCTA 3BBTB 4ZSJA 5E92A 2OJJA 5A6OA 2HENA 2JKKA 4DGOA 3VS2A 4KRCA 4TYJA 2VU3A 4Z7GA 5C1QB 4CGAA 3CQUA 4L44A 3ZBFA 1H1SA 4K1BA 4KRDA 3P9JA 2YLEA 4G3EA 4XHKB 5CU3A 4FSMA 4XCUA 3E62A 3QTXA 4DHJA 3FBVA 2WTJA 3VHEA 4ARKA 4BZOA 4D1ZA 4P5ZA 4D1SA 4FJVA 3QYZA 5JEBA 4XP3A 3A4OX 3HP5A 2YEXA 4RIYA 1JNKA 4FT7A 5A4LA 5E8VA 3DBDA 3LFDA 5D11A 2BAKA 4BDJA 4I6FA 1NXKA 3QKMA 3G9NA 3GP0A 4UY9A 4ZZOA 1QL6A 1IRKA 3I0QA 1U4DA 2XIZA 2OJFE 3UO6A 3HAMA 4OTGA 4J96A 3SVVA 3O23A 4QTBA 2QKRA 3GB2A 2VWBA 4NFNA 5KBRA 4R5SA 1WBOA 3TTJA 4U3ZA 4HNFA 3B2TA 3G33A 4YPSA 5CALA 2I0EA 3BL9A 3B8QA 4FV9A 4RQKA 3OW4A 5L2IA 3D5XA 4HVGA 1YXTA 2UW6A 3OT8A 5CEKA 2J0MB 3R2BA 4D55A 3PTGA 3MI9A 2OIQA 3JPVA 4CQEA 1ZYSA 2G2FA 4F63A 4BCNA 5HKMA 5K9IA 2IG7A 5JQ5A 4YJPA 2FSTX 4UBAA 3TUBA 2IWIA 3V3VA 3G0EA 3ZZEA 4TN6A 4ALVA 3AC8A 4QQ5A 4R3CA 3A7GA 3QTWA 4WRSA 5AIKA 5JMSA 4KS8A 5CTPA 2H96A 2ITNA 3LFBA 4A07A 2W1GA 2IVSA 3W8LA 4HPTE 5CANA 5G6VA 4JJRA 2JC6A 2JAVA 4ID7A 5LMBA 4PUZA 4KBAA 2WMXA 3EZRA 2XK3A 4H3PA 3SV0A 5EDRA 4A9UA 4C7TA 5B0XA 3F82A 3LCOA 5DPVA 3II5A 4FT0A 2I7QA 3E8DA 2YDJA 5HG5A 1ZY4A 3WOWA 3T9IA 4TYHA 3AC4A 4QQJA 4GG7A 4F7NA 3TV7A 2W1IA 4YJUA 3UDSA 4BR3A 3VO3A 1W2FA 3UZPA 5FWKK 3MFSA 1EH4A 1WBTA 3O2MA 4G2FA 4IH8A 4QP2A 4EONA 3DZOA 1Q8ZA 3G0FA 3QTZA 4QPAA 4L9IA 1Z5MA 3QZGA 3I79A 3T8OA 5ACBC 4TWPA 2WMTA 4RVLA 2I6LA 4XNEA 4BCFA 2GFCA 3NMUF 5IDNA 2YCQA 4RBLA 5AP5A 3TIZA 5HX6A 3W0QA 3JVRA 3PUFC 1FMOE 2XA4A 2XF0A 3RTPA 3L1SA 4QTEA 4R6VA 5K5NA 1K9AA 3RK5A 5KUPA 3HMPA 1U59A 3KA0A 4MWHA 2GMXA 4BZNA 2VTIA 4LRJA 2R3IA 4MNEB 5DR9A 4UALA 5IPJA 4ANBA 3LCKA 3RI1A 4L6QA 5DGZA 4U97A 1IG1A 1H00A 2WO6A 4C4GA 4ACDA 2OZAB 4U80A 2YDIA 4BCPA 3PE2A 5EQPA 3DBQA 2DYLA 1URCA 2UUEA 3PDTA 5BYYA 4O2PA 2E2BA 4OTIA 4YLLA 1GNGA 3AC5A 4IAYA 3NCZA 4RC4A 4NM5A 3N4TA 5E8WA 5JGDA 3NEWA 2Z60A 3GU4A 3DBCA 3DOGA 4NSTA 4DE4A 2OU7A 2Z7RA 5BVNA 5FP5A 3RNIA 1H1QA 3IOKA 4UZDA 1GZOA 2NP8A 5CEOA 4CVAA 3D2KA 3VUKA 4XV3A 4CFUA 4GS6A 2CLXA 4K33A 3RHXA 5J7BA 4L42A 4FIHA 4DFNA 3SOAA 2B54A 2GS6A 5D12A 3U4WA 1YDTE 2VGOA 4L43A 1TVOA 4YTCA 1WVXA 1Y8YA 1YI3A 4ACGA 3KKVA 3UTOA 4JL9A 3NUSA 5EI8A 3R8ZA 4EORA 3ZLXA 3AC1A 1J3HA 4RC3A 2W9FB 3C0HA 3B8RA 4UYAA 2RFNA 1XWSA 3QTQA 4A7CA 1UVRA 4ZLOA 2J50A 5A54A 3BI6A 2YJSA 1VEBA 3GVUA 2WTVA 3KF7A 4Q5HA 2PMNX 5IQIA 3ZLWA 4DEEA 2XIXA 1AQ1A 3VRYA 4AZTA 4UWYA 4EWHA 4F6WA 3SLSA 2NO3A 3EFLA 4AAAA 4O7LA 4EZ5A 2W4KA 4WBBB 4LYNA 3Q53A 1CMKE 2FSOX 3H10A 2OH4A 1B6CB 4ZLYA 3PRFA 4ERKA 1MRYA 4NL0A 3IK3A 3KGAA 4GYIA 5A46A 1FOTA 4NEUA 5JSMA 1NVSA 2WELA 4FV3A 1JPAA 3WILA 4NFMA 5L4QA 5ETIA 3Q4CA 2OO8X 4D9UA 4UV0A 1FQ1B 5JRSA 4W9WA 4DH1A 4NZWB 5A4CA 2QOBA 4RJ7A 2XNGA 3UG2A 4EUTA 1WBWA 4U81A 4FI1A 1PXJA 3IKAA 4MF1A 2C6OA 2ITVA 3BBWA 5CLPA 2X81A 3O50A 2PUNA 3Q3BA 2ZB0A 5IA2A 3MIAA 4RIXA 1YXUA 4DEBA 2CGUA 3V04A 3AD4A 1H26A 2BDWA 3LXLA 3VUIA 5DR6A 3TZMA 3CSVA 3A2CA 4UX9A 2VTJA 2V0DA 3ORZA 2PSQA 4MHAA 4NJDA 3SD0A 5KBQA 1SVEA 2RG5A 2V55A 4MXCA 4EH8A 3O51A 5M4UA 4DEAA 3C4CA 3F9NA 3ZC5A 3R2YA 3UP7A 3VS0A 5AUYA 3Q9YA 4FTJA 5HVKA 5EW3A 3ORNA 4AE6A 2UW7A 4BDBA 2QLQA 2LAVA 4QMTA 1YKRA 3FC1X 3L8PA 3WIGA 1R1WA 3KXHA 4APPA 2C6IA 3TDVA 4BBEA 2A98A 1Y91A 4BY9E 5A3XA 3R83A 2BALA 4U7ZA 4BB4A 3O8PA 2WNTA 2QOCA 3F6XA 3KCFA 4JVGA 2GQGA 3MPAA 5KO1A 3RK9A 4HCTA 3Q4ZA 3LLAA 2B53A 2F4JA 5KMLA 4AW5A 3H0ZA 5AV0A 4ZZMA 3MY0A 5IG1A 2PYWA 3W10A 4BYJA 4ZJVA 4OR5A 5AIRA 4BFMA 5FDPA 4BCOA 2QQ7A 1XQZA 4FYNA 4USDA 5AR3A 4MQ2A 4FKOA 1Q62A 3IDBA 1OBDA 4O1PA 4C3PA 2GU8A 3KRRA 5L8JA 3MYGA 1H8FA 5IA3A 1UKHA 4FV8A 4FVPA 1U54B 2BUJA 4ZAUA 3DT1A 2OXYA 4GJ3A 4HVDA 3Q2JA