2Q0BA

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic e565a mutation responsible for pfeiffer syndrome
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
298
structure length
280
Chain Sequence
b'LPEDPKWEFPRDKLTLGKPLGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVAYASKGNLREYLRARRPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 280
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2q0bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2q0bA01
2CN8A 4O27B 4RC3A 3A7IA 2H6DA 4EOQA 5J9LA 3SKCA 5D41A 4YBJA 2BFXA 4H39A 5JKGA 2Z02A 3A62A 5DA3A 2CLXA 5CU0A 3LFEA 4QRCA 2OIQA 3QU0A 2FSMX 2GTNA 5FEDA 1UWJA 4MBIA 4M3QA 3VF8A 4WSYA 5FM2A 3R7YA 4HNIA 4FG9A 4X6QC 3EYGA 4AW5A 4U7ZA 4CCBA 4LUEA 4WHZA 3QLFA 1BI8A 2WOTA 2OWBA 1UU7A 5AUXA 4M97A 3Q4CA 4M7IA 4FSUA 4FTUA 4MNFA 5HNBA 2BZJA 4MNEA 4O7WA 1BL6A 4G17A 5J7HA 3VC4A 3R9HA 2FGIA 2FSTX 2OJGA 3FQEA 4YLKA 4CLIA 1WBWA 4MKCA 5LXMA 5CU6A 3L8PA 3N51A 2YIRA 3FSFA 2W1HA 3BZ3A 3UOLA 4X3JA 2R4BA 4HCVA 2ZMCA 3O8UA 1YWNA 3IGGA 3NIZA 4NTTA 3EQDA 3P79A 3SA0A 3TM0A 3LPBA 5A9UA 3ORKA 3ORXA 4TW9A 1Y91A 4IQ6A 5EHOA 2CSNA 4AZTA 1TVOA 3DBDA 3LFQA 3DKCA 3CTQA 5CNNA 4Z9LA 3C4CA 4BCNA 4BDDA 1UU8A 2JBPA 3PXKA 5CTPA 1KSWA 4AA4A 2C47A 3O17A 4M0ZA 3LXPA 3CSVA 3GXLA 3CXWA 5H2UA 2OXDA 3FYJX 1BUHA 3OMVA 3KCFA 4GK2A 3R7OA 3B8RA 5HI2A 1T46A 5F95A 3ZSHA 5KZ0A 5CI6A 1E1XA 5KE0A 1LPUA 4C8BA 4ZJVA 5HZNA 4XV9A 5J95A 5KX8A 4BI1A 1A06A 1QCFA 5GJFA 3LJ2A 3ODYX 4BL1A 3CKXA 4AS0A 4DHFA 4BCKA 4UN0C 2YN8A 4FV4A 3DPKA 3NNWA 5GJDA 3S2PA 2R3IA 4EH5A 1FVRA 3ELJA 3QX4A 4ZSGA 3FZSA 2A27A 3I4BA 3CP9A 1NXKA 3FYKX 4IJ9A 4RIOA 3A2CA 1YWVA 2C1AA 4MYGA 4PPCA 3EYHA 5J1VA 5IUIA 4QQTA 2PVHA 2Y4IB 3BLQA 3TZ9A 1UNGA 2P2IA 1ZXEA 2WXVA 3O23A 3RCDA 5ANGA 1OKZA 2PHKA 1VZOA 2C0OA 2YCSA 3DBFA 3Q9ZA 4XRLA 3WARA 3DZQA 3H0ZA 4EZ7A 2WU6A 3TDWA 5ETAA 2X8EA 4USFA 3IDCA 4WBOA 3B2TA 5CF5A 3QHRA 2PU8A 4S34A 4F0IA 1XR1A 3NZ0A 4FICA 2W1IA 4B99A 2Y4PA 3LFFA 1TQIA 3VS7A 3QQHA 3LFNA 1PRYA 2RFNA 3E8CA 3DXPA 2XK9A 4IHPA 4HYHA 3UG1A 3OY1A 3RWQA 4MXOA 1XBCA 2EWAA 2P55A 4HJOA 4MTAA 2JKMA 2B9IA 4PTGA 4HPUE 4WNPA 2R3JA 1REJA 2C1BA 1OVEA 3DDQA 3DOGA 3MH3A 3QALE 1K2PA 1XH7A 3DA6A 1F0QA 4FSYA 1S9JA 4QP7A 5JFXA 4FKTA 1Y8YA 4I20A 4YP8A 4WBBB 4U40A 2VO6A 4NUSA 3T8OA 3VS4A 5FM3A 3KF7A 4BCOA 1FINA 4RRVA 4CKJA 3H0YA 3NR9A 5I3OA 1SMHA 2XF0A 3KMWA 1JKKA 2PMOX 2WTKB 4LRMA 4IDVA 1ZY5A 4PL4A 4BC6A 4BGQA 5I9YA 3RJCA 3D5VA 4UZDA 2ZM1A 3IW4A 2X6EA 3KXHA 3GENA 5AJQA 5JEBA 3DLSA 5E1SA 3DKFA 2UZDA 1VYWA 4KSPA 2IZRA 2F7XE 4FT5A 4GKHA 2ACXA 3QYWA 5M57A 5IQGA 2UW6A 4JLCA 1ZYDA 3O7LB 5HG5A 2GFCA 3LM5A 1Y6BA 2PE2A 3ZSIA 5JQ8A 3ANRA 3C50A 1U54B 2R7IA 3ZO4A 1Q4LA 4FTAA 3DLZA 1KWPA 3GBZA 3OTUA 4JR7A 1WBPA 3MFSA 3FLYA 4D2TA 4DG2E 4ZMEA 2VD5A 1T45A 4AG8A 2QR7A 5FDXA 2WIHA 2WMRA 3BI6A 4BRXA 1IAHA 3DZOA 2XK7A 2O0UA 3WZUA 5HESA 4YJUA 4D1XA 2B54A 5L2IA 5DOSA 3R1NA 1JKTA 1OL5A 3GGFA 4M0YA 1Q8YA 4BI0A 4ASDA 4O38A 4K1BA 4E73A 5JH6A 4ZTRA 1QL6A 3AOXA 4O1PA 2WIPA 4QO9A 4EOLA 3ZTXA 1OPJA 3Q3BA 5IG1A 4ZJJA 2PZPA 4G9RA 4RIXB 3ORNA 4BWXA 1MRVA 3RZFA 4HCTA 1GJOA 1OUYA 4DGLC 3EZVA 5HE2A 4FT9A 3W8QA 5E8YA 1LP4A 2OJJA 3LMHA 1F5QA 4AAAA 1CMKE 2XK6A 3AGLA 4FVRA 3TKUA 3TEIA 4F7NA 4N6ZA 4YGAA 1V0OA 4L7FA 1JOWB 4EK8A 5AM7A 4ZY4A 1LR4A 3II5A 3RI1A 4L42A 4YLJA 2UZNA 2UW5A 2V55A 5EM8A 5K3YA 5CALA 5M4CA 4O7ZA 1P4FA 2NP8A 3LFDA 1PXMA 4GG5A 4ZXTA 4ALWA 4ZAUA 1OKWA 3HX4A 4K18A 3ET7A 4U79A 1JQHA 3U6HA 2Q0BA 4L45A 1V0BA 3ZXTA 4KS8A 4IBMA 5IDNA 4WUAA 4G6OA 3KGAA 1KE5A 3AT4A 5CVFA 2JIVA 2WMSA 4I24A 5CQUA 4MK0A 4EUUA 3AQVA 2JC6A 4YZBA 1PXJA 4FX3A 2HCKA 4F63A 5HVYA 3COHA 4XLVA 2EB2A 3CGOA 4IAZA 4RMZA 4BGHA 4D4VA 2J51A 4EOIA 4PDYA 3F82A 2OH4A 1K3AA 4C3FA 3HMMA 3QTQA 3U9CA 2UZBA 4DEEA 4EOJA 5AIRA 3ZO3A 5AUUA 4IMYA 3F2NA 4G5JA 2O64A 2W96B 3RK9A 3I1AA 2YDJA 4L7SA 3ZDIA 4FNXA 1CKIA 5BVEA 2I0YA 1PF8A 1XBBA 3PYYA 4ANSA 4KBKA 3OROA 3VBYA 4RVLA 3U9NA 4IVBA 3MSSA 4O0RA 3HUBA 4Y85A 1S9IA 5ANEA 4EC8A 2CDZA 3WYYA 4D5HA 1DS5A 1H8FA 3ETAA 3O7LD 4I5PA 4KIOA 4O6LA 4DYMA 3O8TA 4WRGA 2ETRA 3AC2A 3PXRA 3QAME 5AR4A 2ZOQA 3BCEA 4R77A 3S0OA 3ZLWA 4WKQA 1M52A 2XK4A 3RZBA 3FEGA 4FV9A 3MFUA 1YOJA 5EYKA 3IK3A 5HIDA 3BYOA 3RAKA 2W99B 2HELA 2YJSA 5DR2A 3KK9A 3AGMA 3S4QA 3FMHA 4RZWA 5EQEA 3G0EA 4V05A 3G0FA 4AGCA 4TYGA 4L46A 4LUDA 5L2WA 4CYJA 3PTGA 2QD9A 4IIRA 3L9MA 3QRKA 4YJPA 4CMTA 3HVCA 4A7CA 3LHJA 3UYTA 4FYOA 2JLDA 4AXAA 1OBDA 1OPKA 2C6LA 2R5TA 2ZJWA 2ZB1A 5H3QA 4DF3A 3M1SA 4YNEA 3WYXA 5HORA 3RAWA 1WBTA 2OJIA 1XWSA 3A4OX 1BLXA 5J5TA 4FI1A 3V5TA 4X2GA 1Z57A 4YJRA 3R00A 3WZEA 1ATPE 4S2ZA 3I6WA 2WKMA 4DBNA 2WMTA 4RJ5A 5M09A 3A7HA 3EQHA 3WILA 2EXEA 3G5DA 3HMPA 2YIQA 1J1BA 5L2QA 5JMSA 2Z7RA 3A7JA 1B6CB 4XG7A 4GEOA 2YWVA 4S32A 3HZTA 3UMWA 3MVJA 3DS6A 5TOZA 4ZSJA 2BDFA 3F69A 2VTNA 2WTCA 4BCHA 4U81A 5L2SA 4LG4A 2RFEA 3GC7A 4MBLA 4C4IA 1YI4A 3HV6A 4IWDA 3PRIA 4FMQA 3T9IA 2C5OA 2IVSA 3OCGA 5CSHA 3ZLSA 5L8LA 3TCPA 4AW2A 4DN5A 1SVHA 4RIWB 4HVDA 5M08A 1PXPA 2JKOA 2VWYA 5BX0A 4K6ZA 2ITYA 2C6IA 4C7TA 4YZMA 3ORLA 2X7OA 1IASA 3JY0A 3DAKA 2B9JA 3C4ZA 2ITQA 3LXNA 3FJQE 3MPAA 3EN5A 4E4MA 5HU9A 3ZEPA 3IDPA 3OBGA 3OXTA 5CZIA 2WQOA 4PV0A 5CY3A 3TUDA 5E8UA 3PVWA 5AX3A 2VN9A 4EONA 2WQEA 3C5UA 5KHXA 2PYWA 4IADA 1U5RA 2PVNA 3EOCA 3BX5A 3EIDA 3GCPA 4R3RA 2WMAA 3WZJA 4Z16A 5CAOA 5KZIA 4BDIA 5CAPA 2XIXA 1DI9A 1A48A 4JL9A 4ACGA 4PL3A 5LCKA 1MP8A 4IX6A 1YDSE 2BRMA 5D12A 3ZONA 4DFXE 1I44A 4RWKA 3RM6A 4QYHA 3F5PA 2IVTA 2GHLA 4QMWA 5FXSA 4AA5A 5KMOA 5KKRC 2HK5A 5LMBA 4J71A 4ALVA 4GFMA 4QP9A 2B0QA 2UVYA 5KMNA 2C5YA 1RDQE 4G1WA 3HMNA 3FMJA 3Q4UA 4LMUA 4A9TA 4M84A 3LXKA 1DI8A 5EI6A 2P4IA 3TI1A 3VIDA 4YTIA 2BROA 3NCGA 4MVFA 3D2IA 5TT7A 3QHWA 3LFBA 2IG7A 1A9UA 3Q32A 4UXLA 3QRJA 2AC3A 2PZIA 3VUIA 1IA9A 4CFXA 5A6NA 3KULB 3NYVA 2XA4A 3PXZA 1UU9A 3VN9A 2XKDA 2OBJA 2J0LA 4O0WA 3EHAA 5EH0A 2R2PA 3W2CA 5A54A 1YWRA 4GVAA 5HCXA 3A7FA 3UPZA 5E9EA 4O2ZA 4RBLA 4CLJA 2YJRA 5DEWA 3ZC5A 4EHVA 4RJ7A 3FLQA 4BDCA 5DWRA 1YDRE 3F5XA 4O81A 3FV8A 4GIIA 3NUNA 1I09A 4OTHA 4O21A 1MUOA 4QTCA 4UYAA 2J7TA 3TV7A 4GU9A 1GZKA 2XM8A 2A1AB 3KF4A 3CE3A 2W06A 3PRFA 3VRYA 2VWVA 3QCSA 4EK6A 1Y8GA 4EHEA 4D1ZA 2XH5A 3I0OA 4HYUA 5EW8A 4AGDA 3EN9A 4NCTA 4QMMA 4O7VA 3F5GA 3UNZA 3CQEA 3E3BX 3RKBA 4DTKA 3EL8A 5M55A 4I21A 3TL8A 3OUNB 3GCUA 3GU6A 4GT4A 2VNYA 4U0IA 3F2AA 4JS8A 5CQWA 4HVIA 4FZ6A 4ARKA 1OZ1A 2EUFB 3TJDA 3G9NA 3KA0A 4L01A 3Q5IA 3N4VA 1UNLA 3A8WA 1FVTA 1U5QA 4L44A 2QODA 3L8SA 4FNZA 3E88A 3NVMB 3G9LX 3QF9A 5LVMA 3PG3A 5JK3A 4FVPA 3F2RA 5ANKA 5GHVA 1H0VA 1JPAA 4BZDA 4AOIA 4EJ7A 4D2RA 2VWBA 3RPSA 4FEQA 2GS2A 4O0YA 2XRWA 1Q62A 3P08A 2QOKA 4CZUA 1K9AA 3RHXA 3UMXA 4UMRA 5CANA 2YZAA 1G3NA 3QD0A 2QKRA 4KIKB 4E4NA 4BY9E 3D5XA 3L1SA 4RFMA 4XX9A 3FDNA 1YRPA 3CR0A 2RFDA 4CTCA 2PVYA 1UKIA 2QLQA 3ORTA 3QZGA 4R7BA 3QCQA 5AR5A 2R3MA 1G5SA 3ZO1A 5IQDA 4X2JA 1YI6A 5IH6A 4M68A 3SW4A 1XH9A 5KMMA 3IG7A 1M2QA 3DDPA 5HLNA 2PMIA 3QQGA 4IEBA 3EQGA 3NX8A 4EYJA 2YCFA 5FEEA 5CSXA 3T3UA 2PVRA 2R3LA 5EKOA 5JGBA 2OIBA 4P90A 1L8TA 3OBJA 3H9RA 4MXZA 4UX9A 3UE4A 3QLGA 3A7GA 2BIKB 1FGKA 4GVJA 4R6VA 5D1JA 4AW1A 2XJ2A 3KN6A 5A4CA 3RNYA 3E8DA 2W4JA 4BWPA 2WHBA 3BYSA 4P5QA 4BCQA 4C4HA 4JG8A 3PVBA 3G15A 3KRWA 2ITOA 2X1NA 2XP2A 4BICA 5HIEA 2LGCA 4PNIA 5BMSA 2WMUA 5CWZA 3CY3A 2XNMA 2QVSE 3EQCA 3P1AA 2AYPA 3GI3A 3MA3A 4G3FA 4A9YA 4QNYA 3DJ5A 1ZYSA 3PPJA 4ANOA 4D2VA 2I0EA 2ZB0A 2R3QA 4BTMA 4MD8E 5ETFA 4QMNA 4O7NA 5LCJA 3A60A 3OF0A 4R78A 4W9XA 1H24A 5EKNA 3EH9A 4FE2A 1SVGA 4F4PA 3JPVA 5AAFA 5BNJA 4UMUA 4WT6A 3ALOA 3QD4A 2BRBA 4ZS4A 2NNWB 4XMOA 4UEUA 1W82A 1R0PA 5HG7A 4J8MA 4N6YA 4EHGA 5FDPA 3QWKA 3RBWA 4XBRA 2VWIA 2QO7A 2Z7LA 2QOIA 3NNVA 2J90A 3VNTA 3VJOA 4H3QA 5CU4A 1H1RA 3C4WA 4FTQA 5LARA 4DBXA 1WBNA 1WFCA 3JY9A 4I1ZA 3H3CA 3PY3A 5CF8A 1QPDA 4D55A 4FF8A 4C4FA 4NKAA 1PMEA 4NM3A 4RA5A 4ACCA 3NUSA 5DPVA 1QMZA 2GS7A 2Q0NA 5DT4A 2W7XA 3V8SA 5CLPA 5EFQA 3FMDA 5M56A 5KMLA 1YOMA 4YTHA 3DB8A 5HBEA 4U97A 3W2RA 3ZFMA 3QQUA 3LMIA 2O65A 3VUGA 4QP8A 4YJQA 3MIYA 3R30A 1ND4A 1WVXA 2QC6A 4GT3A 4NFMA 3V5LA 3JVSA 3M11A 4PPAA 3HP2A 2B9FA 4WNKA 5JT2A 5LVOA 4ZY6A 2PZ5A 4TXCA 3QTUA 3OWPA 1YXVA 3EFWA 3QKMA 4E4LA 5HLPA 3UC3A 3FMKA 4JX3A 4YJVA 3BEAA 4H36A 4JQ7A 1W84A 3Q52A 2PUNA 4F9AA 4L8MA 2XJ1A 4OTRA 2GDOA 3BGPA 2B55A 3DFCB 3NUYA 3HUCA 5DNRA 3UZTA 4BZNA 4DE4A 3BE2A 5IQFA 4R3CA 3RCJA 3BYVA 3B2WA 4JRVA 2YM5A 3EZRA 2X7GA 4GJ2A 4AW0A 3OCBA 2WU7A 5DLSA 3ERKA 2YERA 5F20A 1PXKA 3OP5A 2OJFE 1VYZA 2BUJA 3GT8A 3R8PA 4AA0A 3IKAA 3OOMA 1SNXA 3PSDA 3ZC6A 4AT4A 1WCCA 4GU6A 4O83A 2X6DA 4LYNA 3CIKA 1YXUA 3K3JA 3OUKA 5B0XA 3RHKA 3NLBA 4M69A 1O6YA 4CQGA 4XG2A 3V5QA 2HYYA 4IW0A 4ZIMA 1CDKA 1OM1A 2Y6MA 2FH9A 3O71A 3ZH8A 4F6WA 2WQNA 3C0HA 3VUTA 4Z7HA 5KBRA 1TQPA 2V7OA 5AP7A 4USDA 3SGCA 3H9FA 2X8DA 3D5UA 3LZBA 2XKCA 4GFGA 4GG7A 2YHVA 2ZDTA 4IACA 4OR5A 4O7LA 3KC3A 5IQIA 2CNQA 3EMGA 5A3XA 4HGTA 2XJ0A 2QU5A 3F61A 4PDSA 4FIJA 1ZYLA 3ITZA 2XNNA 2Y8OA 5IKWA 4V0GA 3QGYA 5HKMA 2C6KA 3QZIA 4FSRA 4IB5A 2W9ZB 4J52A 4O0VA 3QUEA 1Q3WA 4IZYA 4QMYA 4FEUA 3VUMA 4G6LA 4QMQA 4GH2A 2FO0A 1E1VA 3BHHA 4UB7A 4E5WA 2VTHA 4LV8A 5TR6A 3ZUTA 2VO3A 5DN3A 3RP9A 4FKRA 5AAGA 2ZV9A 3ZRLA 3OXIA 2PUIA 2E9VA 4JBOA 2ITXA 3ZDUA 4EYMA 2PK9A 3OWJA 4HYSA 4ZSLA 4C35A 5C8NA 2VTIA 3M42A 4I5CA 5CEOA 3VS2A 3VQHA 3VBXA 1E9HA 3IOKA 4MWHA 3VRZA 5A4TA 3EN6A 1Q41A 2FSLX 2PE0A 3SXSA 4IAAA 4CFFA 4OT5A 1M14A 3RNIA 5HCYA 3RPOA 3PY1A 5JGDA 2W17A 3AMAA 4JOAA 4UMTA 4HOKA 1JLUE 4KKEA 5C8KA 4RG0A 2YCQA 4IX3A 3OEFX 4QPSA 4AOTA 2CMWA 3NUPA 4WRSA 2R0IA 4XOYA 4YMJA 5AMNA 4A9SA 5CT7A 5JZNA 4BDBA 5IUGA 4AQCA 1WBSA 1BI7A 2F7EE 4UBAA 4A9RA 2HXQA 4JQEA 4ZTNA 1YXTA 2EVAA 1XKKA 5ANOA 3PSCA 2C3IB 4FSTA 2QQ7A 4C34A 4B7TA 3OC1A 2B4SB 2CKOA 5DT0A 4D5KA 3MY0A 3S3IA 2ITNA 2QURA 4C38A 4GMYA 5FBOA 3KRLA 3O8PA 1W0XC 4LRKA 1UKHA 5BYYA 3OWLA 4FTMA 4J7BA 2WNTA 3MFRA 3FMNA 3ACJA 5H8BA 3DK6A 2IO6A 4G5PA 4AT5A 3UIXA 3QKLA 4EOOA 4IM2A 1OL7A 2VRXA 2IZUA 4QMVA 2WELA 2BRHA 2YISA 5FEQA 4FNWA 1FVVA 1PXNA 3NW6A 1H00A 3JVRA 5FWKK 3ZYAA 4BCIA 5LVPA 4BBFA 3R9OA 2JBOA 5G6VA 3DKGA 2XNGA 5LOHA 2R3KA 4AZWA 4ZP5A 3PJ8A 5LMKA 1BKXA 4KRDA 4C4EA 3R71A 4YJOA 2DUVA 3BU6A 5EDQA 3SRVB 4CZTA 2W1DA 4FV7A 4O82A 3HRCA 4FGRA 4F9CA 3MPMA 4FKWA 1ZYCA 1R0EA 1H08A 3C13A 2RFSA 4X2FA 3S00A 5JFWA 4BF2A 4OTWA 3GP0A 4U5JA 4IVCA 5CEQA 3PVGA 3CD8A 5A14A 2ZV2A 4P5ZA 4J97A 4EOPA 3ZEWA 4QTAA 5IZFA 1V0PA 3VUHA 4CGAA 2G01A 4DGNA 1IRKA 5C9CA 3K5UA 3Q2MA 1PYEA 3EKKA 4D28A 5EHYA 2F9GA 2BAJA 2QO9A 3BIZA 4MD7E 1H25A 2QKWB 3R8MA 3WF5A 3DJ6A 1BYGA 2OFUA 3LLTA 4II5A 2Y7JA 4JXFA 3E8EA 1H1PA 2A4LA 3QXPA 3IW5A 2VWZA 2UW8A 4BCJA 4CXAA 3KMMA 2F7ZE 3MVLA 5FTGA 3IQ7A 4KNBA 3LCDA 4UY9A 4EZ5A 2YM7A 2BRNA 3OOGA 3QCYA 2OSCA 3PY0A 2J9MA 4HZSA 4XH6A 4NL0A 3L9NA 3LMGA 5K0KA 4EORA 3UP7A 4C3PA 4QTDA 4IJPA 5CAQA 5AP3A 4BDFA 3FLWA 3MIAA 5CEIA 3ZOSA 2W05A 4EQMA 3PPKA 4IC7A 3SG9A 4BTKA 3BRBA 4CV8A 5IA1A 5I9VA 4I22A 3PIZA 5K4JA 5E8ZA 4FEVA 4F1OA 1FGIA 2JDTA 5IQAA 3EQRA 4PMSA 2WMBA 5JSMA 3DFAA 2WOUA 5DI1A 4MNEB 5C27A 3SOCA 4R1VA 4NFNA 3PJCA 4Q5HA 1H0WA 4C62A 2XCHA 4JI9A 4ONAA 4WG3A 3FZPA 4YSJA 3GVUA 2B7AA 4OTDA 4ZOGA 5KHWA 3SAYA 4BCMA 2QG5A 3BGQA 2GNFA 4D58A 2QOCA 3UTOA 3QA0A 3TNQB 4C58A 5K4IA 4DLJA 3EFLA 2BCJA 4BBEA 2UZTA 4DC2A 2XEYA 5HLWA 2XMYA 5FBNC 2R3RA 3HKOA 3PJ1A 2UZUE 2GQSA 1VJYA 2C3KA 5FQDC 1SVEA 5GJGA 3TZ8A 3V5WA 3C5IA 5HCZA 3P23A 4X3FA 4AN9A 4EH2A 3W55A 4IFCA 4DT9A 5E92A 4ZSAA 4DINA 4QMPA 3QQLA 2DQ7X 3PE1A 4ANBA 2BHHA 1R39A 1VEBA 4FTNA 4S33A 3HAMA 3BU5A 4P4CA 3DQXA 4CT1A 5IQBA 3HA6A 3FL4A 4FT3A 2OO8X 2UZWE 3UNJA 1ZARA 3EFJA 3W1FA 1JKLA 4FKIA 4XBUA 3ZMMA 4EWQA 2IJMA 3C1XA 3HYHA 1GNGA 2XIZA 3OY3A 4XEYA 5D10A 4ZLOA 2X0GA 4TYEA 4G3CA 3VBVA 3VBQA 3PJ3A 2XRUA 4TYHA 3VHEA 3U6IA 3Q9YA 2R3NA 2BPMA 2R3FA 4L00A 5EHLA 1HOWA 3PFQA 3QC9A 5EM6A 2ESMA 4FKSA 3QWJA 4S31A 3R7IA 2X39A 3VQUA 4ANNA 4UZHA 5EDPA 5FLFA 1OPLA 2UW0A 4D4YA 5HVKA 4CT2A 2GQGA 3QTXA 4E6QA 3N4TA 5J8IA 4XUFA 4RIYA 3HRFA 2F2CB 3OFMA 3JR1A 3A61A 1OITA 4FOCA 4ALUA 2YZLA 4RC4A 4ITHA 4USEA 2BR1A 2JITA 3UQGA 4S30A 4H58A 4H3PA 5KNJA 4NM7A 1BMKA 3AMBA 4YSMA 3LJ1A 2C0TA 5I9UA 4FIHA 4AZFA 1FOTA 2ZVAA 3IONA 4U42A 2CKPA 3FI3A 5TO8A 3WZDA 4ZMFA 3R9DA 2HY81 2EB3A 5DFPA 3C51A 3Q96A 4NCTC 3CPBA 3ALNA 3TJCA 2ETMA 5IDPA 4EK4A 5LWMA 4O7RA 2ITTA 3VS3A 4YC3A 3MH1A 4BCFA 1SM2A 5AX9A 1PJKA 5I0BA 3R22A 2BZIB 3VUKA 4EH3A 4JG7A 2JFMA 5IEVA 3F3VA 2QLUA 4XG3A 4QTEA 3F3WA 5HIBA 3PZHA 1URCA 2VNWA 5A4EA 4FODA 5DH3A 3F3ZA 4EH9A 5E8TA 4NYEA 3NRMA 5I9XA 4CMOA 2OICA 4UV0A 5E8WA 3FZTA 3HP5A 1QPCA 3U87A 1OKYA 1J3HA 4FR4A 3BHTA 2BMCA 5E8SA 3GC9A 4FL3A 4APPA 3OWKA 4IZ7A 3O2MA 4I23A 4MQ2A 4QP2A 4EH7A 5A6OA 2VO0A 4P7EA 4YZNA 5D7AA 2QOFA 4XG9A 4WG5A 1R3CA 4FKGA 1YW2A 1B39A 4GK3A 3PLAE 3HECA 4X7QA 1XJDA 5BUEA 2P3GX 3Q04A 4JNWA 3BLRA 4TKSA 3NMUF 2ONLA 3GC8A 4BDAA 4DFNA 3C7QA 2V7AA 1OIQA 2XIKA 4JAIA 5HEZA 2GTMA 4KABA 4NK9A 4QNAA 3ZSGA 5L6OA 2VU3A 4OUCA 4RQVA 3R8ZA 4O7TA 2PWLA 2ZM3A 3R1QA 3R1SA 3RTPA 3A99A 4PNKA 4D1SA 2UVXA 3RM7A 3GU8A 4BYJA 4NM0A 4JDKA 5EW3A 2UW7A 1X8BA 1LEWA 2PZRA 4JVGA 3QGWA 2ERZE 3QC4A 2I0VA 4L43A 4RC2A 4MXXA 3CJFA 3RK7A 2FYSA 1J1CA 4EBWA 2WFYA 3COIA 3POOA 4UXQA 5AA8A 4XG4A 4K9YA 4C61A 4NM5A 1F3MC 5IISA 3D14A 1Q5KA 5KMIA 2XCKA 2QR8A 3S1HA 2QOOA 3MVMA 5AV4A 2YDIA 3Q4ZA 5CF4A 4HVSA 4IWPA 3QRUA 5CXZA 2DWBA 5M44A 1NVSA 3UVRA 3AC3A 2JEDA 3GCVA 4I4FA 3TXOA 2C69A 1NW1A 5FTQA 1Q97A 4XCUA 3LQ8A 5M51A 2CNVA 1UU3A 3CLYA 4YZDA 3A4PA 5EW9A 2VUWA 1G8AA 2X4FA 4ZTMA 2WPAA 1QPJA 2QI8A 4PQNA 4XHKB 2OXYA 3V51A 3SV0A 5IA0A 5L8KA 4PY1A 2VWWA 3NNXA 3P5KA 3R04A 2JDOA 2O5KA 3BV2A 4OBPA 4KAOA 4IB3A 3TNPC 2FSOX 4FVQA 4M12A 4C3RA 4BDGA 5AV0A 2C0IA 3E87A 4HPTE 4MBJA 4F64A 4Q9ZA 5C4KA 5DRBA 4H05A 3AMYA 1Q8TA 4U9AA 3OTVA 5HO7A 2XNEA 3DTCA 2X2KA 5C1QB 3ORIA 5M4UA 4RWJA 5AM6A 3UOKA 3R1YA 4TN6A 4OAUC 1KOAA 2HIWA 4G9CA 4EH4A 3D7ZA 5AP4A 4YNOA 4E8AA 5F1ZA 3KEXA 4FZDB 3W2OA 4CKIA 3G6HA 4FV5A 4F0GA 3NVKI 1ZMUA 4CMUA 3EFKA 4YR8A 2UZVA 2XM9A 3GUBA 3OEZA 4IM3A 4GV1A 1Q8WA 2IPXA 3G6GA 4YTFA 2X9FA 4XP3A 3AG9A 4GRBA 5FRIA 3D94A 4FKPA 4K2RA 4CCUA 4QYEA 2VX3A 2VTLA 4LV5A 2J0IA 5D7VA 3BKBA 3EQPA 3KVWA 4GK4A 5DT3A 4KB8A 5AV1A 2G15A 4L52A 4OTIA 4CVAA 2XUUA 5CS6A 4AGUA 2UVZA 4L3LA 4O91A 4OT6A 2EXMA 4KA3A 1CKPA 4JX7A 3W2QA 3UOJA 2UUEA 3KKVA 3E93A 3LCTA 1KE7A 4TRLA 4LL0A 4QMSA 5FXRA 2E2BA 2PTKA 2BZHB 1ZWSA 4GUBA 4PTEA 4U8ZA 4C57A 3KXGA 3MGYA 3BQCA 3D7TA 4BWKA 5HTBA 2A2AA 1NT2A 4E5AX 4ZLZA 3BLHA 3FKLA 3CD3A 4YHJA 4DGMA 1GY3A 4MCVA 5CSWA 4DH3A 3V3VA 4J98A 1FBNA 3V6RA 1H26A 3VHKA 1MRUA 4JJRA 5LWNA 5BUJA 4DEBA 4F1MA 1PYXA 2PE1A 2V5QA 2QO2A 1TQMA 5DMZA 4HW7A 4A4OA 1DAYA 4PMMA 5JFSA 4KKGA 4W8DA 3I79A 4FSNA 4FG7A 2XZSA 4C4GA 3PXYA 4H1MA 4J8NA 2C5XA 2WTWA 2W4OA 4M67A 4IXPA 3R83A 2YFXA 4BFMA 1EH4A 5AADA 4DTAA 4I5MA 4C4JA 3R21A 4I3ZA 4CD0A 2XK8A 5L3AA 5BQ0A 2Y0AA 4O0TA 4F99A 4FV8A 4WOVA 3D9VA 3OW4A 4RPVA 4LOQA 1WAKA 3MY5A 2JFLA 2HY0A 1U59A 2YITA 4GIHA 5AV2A 2W1ZA 1XH6A 2HZNA 1OI9A 3QBNA 4FIGA 4TZRA 3ZRMA 3QTRA 3DB6A 4I93A 4XV1A 3ZUVA 2CGWA 4QQJA 5FGKA 4DTBA 4BDHA 3IS5A 3R73A 2GHGA 4IANA 2EU9A 1GZNA 2YLFA 5DBXA 4V01A 1AQ1A 2JIIA 2O2UA 4BYIA 3VS0A 2HAKA 4R7HA 1P4OA 2F57A 5ACBC 4W4YA 3V01A 3P4KA 3PG1A 4FUXA 4WIHA 5DEYA 4XV3A 1MRYA 2IW9A 4I41A 4NIFA 3ZO2A 4FK6A 1P2AA 3SG8A 3IDBA 5CU3A 3GQIA 4APCA 1H1WA 4I0TA 4AZEA 3FPQA 3V5PA 3I81A 5FP6A 5K0XA 3EL7A 5IH5A 3TIYA 4R5YA 3OD6X 3GOPA 3PIYA 4AACA 5HE3A 3QXOA 2PMNX 2WQBA 4FTCA 5B2KA 3SOAA 2HZ0A 4FKQA 3UZPA 4U80A 4C2VA 5L2TA 4EOMA 2R64A 1JSUA 3WF8A 2WAJA 4F9WA 4U43A 2PVFA 3DBEA 2JAVA 3ZBXA 2OH0E 2OFVA 2J5EA 4KS7A 3DGKA 1OIUA 2CN5A 4EEVA 4PUZA 3M2WA 4CG8A 5K9IA 3DXNA 5J7BA 2IVVA 4JIAA 4HNFA 4G16A 2W4KA 1FQ1B 3UO5A 3O96A 3VO3A 2UZOA 3WZKA 5CNOA 3FXZA 4ITIA 1Q99A 2VGPA 5E7RA 4DH1A 4G3DA 2IWIA 4X2KA 5L8JA 3RAHA 2UV2A 5EYMA 5IEYA 2JKQA 4AX8A 4IZ5A 3AT3A 3NS9A 5JN2A 3BGZA 2PUUA 3KCKA 4Y95A 3LLAA 2PVMA 4GKIA 4FTTA 5HBHA 1YI3A 2QOBA 4FIFA 4G31A 3ZM9A 3DBCA 2VX0A 3QRTA 3W18A 2RG6A 3VF9A 1IEPA 3TV6A 5CEPA 4W8EA 3V8WA 4AFJA 4IC8A 3MA6A 3FXWA 4AE9A 3KU2A 3E3PA 3P78A 3WI6A 4A9UA 3CS9A 4N0SA 5J87A 3DK7A 2VTTA 5LMKC 3KY2A 4FTIA 1YOLA 2XIYA 1IA8A 4GT5A 4F7LA 3C4XA 2XBAA 4YU2A 4DFUA 3OVVA 2RG5A 3I0QA 2CKQA 4MXAA 3R2YA 5ANIA 3SX9A 1FMKA 4BHZA 4JBVA 4GJ3A 5HNGA 2B52A 1XO2B 3PSBA 3TTIA 2BZKB 3GFEA 4J95A 4X2NA 2IW6A 2RGPA 2OG8A 5DHJA 4BIDA 3UNKA 4ZY5A 4BDEA 1OMWA 2J4ZA 4FUYA 4A06A 3AT2A 4D4RA 3PP0A 2PULA 4G3EA 4C59A 2QOLA 4YO4A 4FV2A 4YLLA 4E20A 5H9BA 3MV5A 3P9JA 4BB4A 4V04A 3NCZA 3QTSA 4BGGA 4I5HA 5GZAA 4ZK5A 3ACKA 4QMLA 2KTYA 3F3UA 3ORMA 4FGBA 2WZJA 4L3JA 3ZLXA 5HX8A 2IW8A 4IAFA 4ACMA 4F9YA 4CSVA 2XNPA 2E9OA 5L6WL 5ETCA 5CZHA 5DVRA 3U4UA 3IW8A 3K2LA 3HV4A 2C5NA 3FWQA 1XH8A 3C0GA 4YHFA 4ZTSA 4BIBA 4BKJA 5GZ9A 2W0JA 3PA5A 5HBJA 2WGJA 3MN3A 4F7SA 3R7GA 4ANLA 5M4IA 3WOWA 4MHAA 4F9BA 3O51A 5IPJA 4OTPA 3KXMA 3LFAA 3OCSA 2UZLA 2GHMA 3KXNA 4LOPA 3RALA 3WE4A 5E8VA 5EYCA 2R0UA 3QTWA 4FT7A 3BHVA 4XG8A 3OW3A 2X4ZA 3VAPA 3W16A 3WIGA 3COMA 4JDJA 5AA9A 4K77A 3I60A 1O6LA 2X81A 4FKJA 3WIKA 3RVGA 2W1EA 5L4QA 3S95A 4QQCA 5E91A 1Q8ZA 3FZOA 4AZSA 4G3GA 4PMTA 4PP9A 2B1PA 2YAKA 2BTSA 2PY3A 2WO6A 2FB8A 3SVVA 4JBQA 4KSQA 3ZFXA 3PA3A 3BQRA 4RZVA 4M66A 1ZOEA 3ZM4A 2AC5A 4B0GA 5ACKA 4UWCA 2G2IA 2WEIA 3CTJA 4QMZA 3QFVA 2OZOA 5LMAA 4ASXA 5B7VA 1GZOA 4IH8A 4YPDA 3KMUA 4LFIA 4C2WA 3U4WA 4X3FC 4B8LA 4KUJA 4QMXA 5E1EA 3BBTB 2XVDA 4FSWA 2Z7SA 3R8LA 3R8UA 2YWPA 3CEKA 2V22A 4D0WA 3PXQA 2HW6A 3DAJA 3PVUA 5F94A 4GSBA 3ZFYA 2J5FA 3SXRA 2HOGA 1GOLA 2J0JA 1H28A 3Q53A 3VS1A 3R9RA 4FBXA 4NU1A 3W33A 3BV3A 2JDRA 3PXFA 5AAEA 2JDSA 3R0TA 4YJNA 1KUTA 4DA5A 1IG1A 5BVOA 2BALA 3UQFA 4Y5HA 3IOPA 2F2UA 4LGGA 4DITA 4UWYA 5CSVA 4HGLA 4FYNA 3RAIA 4IDTA 3R9NA 4CZYB 3EKNA 4M14A 3V5JA 4AZVA 2GSFA 4QMUA 4HVGA 3H10A 1BX6A 2X2LA 2YA9A 3BE9A 3DK3A 2DS1A 5AP0A 4ZS0A 5J5SA 4CG9A 3R7UA 3BPRA 4L6QA 2I7QA 3DAEA 3OG7A 2R3PA 3H4JA 3I7CA 4AN2A 4IVDA 3BELA 4C02A 4PP7A 4LQMA 4WD5A 3R63A 2GNLA 4JBPA 5KMKA 2VGOA 2CCIA 2GU8A 1PKGA 1M2PA 3PP1A 5J1WA 1PXIA 4AOJA 2NRUA 4OBOA 3GU7A 4O2PA 4GYGA 5HE0A 2Y6OA 4GUEA 1YXSA 3H9OA 3TKIA 2W9FB 2B9HA 2W5AA 3W8LA 3MTFA 4AUAA 4CNHA 2VO7A 3GB2A 3BYUA 3F7ZA 4J99A 4KBCA 4DFBA 5FG8A 4EKKA 5BPYA 2WMWA 3P7AA 4KIQA 3CJGA 4AFEA 1O9UA 4RJ8A 3QKKA 3UJGA 1DAWA 2X9EA 2XYNA 3CC6A 3LCKA 5FTOA 4ZZNA 2VWUA 3NYOA 3Q6UA 2P2HA 3MBLA 5BMMA 1U46A 3BYMA 2G9XA 2JKKA 1ZLTA 4YZCA 2OW3A 3TNWA 3BHUA 3VUDA 5DE2A 1H07A 2CGVA 4FG8A 4D2SA 4XNEA 4F08A 2CPKE 4DT8A 2OZAB 4F1TA 3MW1A 3PPZA 2ZYBA 2JGZA 4WNOA 4ENXA 5AUTA 3CKWA 2QOHA 4KKHA 5KKRB 2O3PA 3G51A 4IM0A 4DG3E 1VR2A 2A19B 4MF1A 5CX9A 5DGZA 4F09A 2VTQA 4PTCA 4NW5A 4BKZA 4FKLA 1PXLA 3ZU7A 3NPCA 4L67A 5HTCA 5AIKA 4BKYA 5HOAA 3C0IA 1UV5A 1ZZ2A 2XNBA 3FLNC 4GL9A 4GW8A 4AN3A 4AU8A 2QG7A 1JNKA 2ONLC 3E92A 2R3OA 1CTPE 4I92A 1RW8A 3LQ3A 4JRNA 4IVAA 4QP6A 4MAOA 1GIJA 3SHEA 1ZYJA 3MPTA 3W2SA 3SW7A 1FPUA 4U45A 4YPSA 5AWMA 2A0CX 4EC9A 4M69B 5JQ5A 4AP7A 4WSQA 4D2WA 2W1GA 3FAAA 4DEDA 1J7IA 1ZOGA 1BL7A 3UDBA 3CY2A 4CV9A 3N4UA 4OTFA 3TT0A 3NUAA 4ORKA 2PL0A 4A4LA 3VVHA 1U54A 3TZMA 4RJ3A 3HV7A 3LAUA 3TWJA 3TTJA 2P0CA 1OL2A 2QNJA 4DFLA 3EB0A 3UOHA 3I7BA 3MWUA 4CFMA 2GNGA 2YM6A 3NW7A 4XV2A 4E3CA 2XYUA 4RWIA 3TIZA 4V0GB 4TY1A 1M7NA 3CQWA 3E64A 4TWCA 3TN8A 5LJJA 4FEXA 2C6OA 5CVHA 4Z7GA 3UIBA 4D9UA 4DH8A 4FSZA 3DY7A 2C3JA 3UQCA 4RFZA 1JKSA 5LQFA 2AUHA 1GAGA 1XH4A 3U51A 2BHEA 1OB3A 2W1CA 3AXWA 4IZAA 3ATSA 2BIYA 2XK3A 4U41A 4Y5QA 4JR3A 3KB7A 4YC6A 2WB8A 4M8TA 4ENYA 4YUQA 4UMQA 5ETIA 4BZOA 4KINA 4RIXA 4CFWA 2QU6A 4F65A 2Z2WA 3F3TA 5I4NA 3UO4A 4FTLA 3L9LA 2XB7A 3PWYA 2ERKA 4TYJA 3FZRA 3LVPA 5AR7A 4ZJIA 3THBA 3LKMA 4RX9A 1WZYA 5B2LA 1W7HA 4XJ0A 4OW8A 4DGOA 3NYNA 4RGJA 3VBTA 3WE8A 2VZ6A 5BVNA 2QOQA 3E62A 2WMXA 5M4FA 2ZAZA 2C6TA 3NNUA 3DKOA 4FK3A 4O0UA 3W10A 1HCKA 4HGEA 2PPQA 5FUTA 3QTZA 4F7JA 2J2IB 4ZSEA 2WMVA 3MB7A 2YIXA 4LM5A 5BVFA 5HO6A 4FL1A 3AD4A 2HZ4A 1G8SA 5M06A 5IA5A 1H27A 4O7SA 5EDRA 4ASEA 2X2MA 4R3PA 5JGAA 5L6PA 1FMOE 4LL5A 2ZM4A 4RLLA 5LVLA 3RK5A 5GIPE 4F70A 3DCVA 2H34A 1RE8A 3F5UA 5E90A 3RINA 3SD0A 4EQUA 5TE0A 3GC0A 5E8XA 4ZEGA 2X8IA 5C03A 3RGFA 4CFVA 3PJ2A 1B38A 3D5WA 3MH0A 4D2PA 4NJDA 3O50A 5DRDA 2NO3A 4ACHA 4R1YA 3MESA 2BFYA 2ZV7A 4TWOA 3FI8A 3FPMA 3IECA 2C6DA 3MH2A 3DJ7A 5EYDA 2QONA 5I9ZA 3GCSA 3N9XA 4ZZMA 5CAVA 1M7QA 3FZ1A 3EN4A 5I9WA 3SQQA 3RMFA 2C4GA 4RA4A 4TL0A 1STCE 2VWXA 5AUZA 3NYXA 3AD6A 5BYZA 3NIEA 1GIIA 5I5ZA 3DU8A 4MWIA 3TDVA 4L68A 2ZV8A 4IE9A 5EM7A 2C68A 3I5NA 1NA7A 4FV0A 3ROCA 3RWPA 4PF4A 1LUFA 4DEAA 5K5XA 1OUKA 2FA2A 4FIEA 4RT7A 4CRSA 4FKUA 5AV3A 3UPXA 4ASZA 3KRJA 4W4WA 4FKOA 4B4LA 1KE6A 4Y72A 3FQSA 4KIPA 4OTGA 1YHWA 3C4FA 3POZA 4D9TA 3E8NA 2RL5A 2WQMA 1YDTE 1WBVA 1PHKA 4IWQA 4RLKA 3TUBA 2GFSA 3FLZA 5ICPA 4EH8A 4FV6A 4IAKA 4QMOA 3L8XA 3Q9WA 4A07A 4ZLYA 3PA4A 5C01A 4EQCA 5HU3A 3PZEA 3ULIA 4FEWA 5LVNA 3UO6A 3DQWA 4I4EA 3TKHA 3IGOA 4QYFA 5GNKA 1NVQA 3HV5A 5EOBA 2G2FA 2ETKA 3LIJA 4EZ3A 4BDJA 3NEWA 5J9YA 4R7IA 4A4XA 1UA2A 2XS0A 3ENMA 4OTQA 4K11A 3P0MA 1URWA 4I0RA 1REKA 5CEKA 2OLCA 5H8EA 3MB6A 2R3GA 3JS2A 2Q83A 4E93A 3U54A 4IB1A 1LEZA 3ZLYA 5CXHA 3NGAA 3KK8A 2CJMA 3QZFA 5G1XA 1GIHA 4I0SA 4JG6A 5GINE 2I40A 4B6LA 3EQFA 3ID6C 4TPTA 1P14A 1ZY4A 3ZZWA 3P7CA 4FTOA 3BEGA 4C0TA 4K0YA 3HL7A 1SYKA 4O1OA 5FXQA 2O8YA 5IUHA 4OAVB 4HVHA 5EI8A 2UW9A 3CQUA 2OXXA 3PIXA 5CENA 3DT1A 3FY0A 4GS6A 4G6NA 4BDKA 5HO8A 3WF9A 2OF2A 4RIWA 3SLSA 4FKVA 3KXZA 4WG4A 1OIYA 4DCEA 2NRYA 2VTPA 1R78A 4PDOA 3ZCLA 4C33A 4PDPA 4RVMA 3PWDA 1ZRZA 4TNBA 1KV1A 2CGXA 2HW7A 4CYIA 1XHAA 4BBMA 4EHZA 3E63A 4U44A 4W4XA 3R8VA 3FUPA 4H1JA 2PVLA 2J6MA 4X3FB 4ZTQA 2BAQA 3MDYA 1H1QA 3ZUUA 4IFGA 2IN6A 2HZIA 3HRBA 5T3QA 3Q2JA 2LAVA 4E5BA 5AUYA 1P5EA 4MEDA 5AP5A 4DFYA 4FTKA 1Y6AA 4ZTLA 4BTFA 2W1FA 5AUVA 3FHIA 5KUPA 3V04A 3OT3A 1UNHA 4G34A 2X7FA 2UW3A 2Z7QA 4KD1A 1V1KA 5CASA 4KBAA 1IAJA 5CT0A 5H8GA 4O84A 4F0FA 4MQ1A 3C9WA 4OLIA 4XRJA 5J9ZA 2XKFA 2WTIA 4TYHB 4RQKA 3EWHA 3R7EA 3UBDA 2CNUA 4PL5A 2YM3A 3BU3A 3LCOA 3MVHA 4CRLA 2H8HA 4YO6A 3KXXA 3MJ2A 1OKVA 1WVWA 2EXCX 3QL8A 4EWHA 2BDJA 3KULA 3LFCA 4GYIA 4L53A 4EH6A 1PMNA 2R7BA 4FNYA 4NKSA 3KN5A 5CAUA 2VTRA 3IW6A 3LFSA 4RIYB 4YJSA 4HYIA 5KO1A 3HV3A 3U55A 4OBQA 4RVKA 5EOLA 4XS2A 3MYGA 4HCUA 4P2KA 4NW6A 1Z9XA 1APME 1ZOHA 2J0KA 4YZ9A 4Y8DA 3D2KA 3G2FA 4XP2A 3UG2A 5IQHA 4RJ6A 4O86A 3VJNA 5GIOE 5KBQA 4E1ZA 4QP1A 1HCLA 2CLQA 2HWOA 2ITPA 3F9NA 3IPHA 4DG0E 2C3LA 4NH1A 5HE1A 1SNUA 4UYNA 1AGWA 3OHTA 5BVDA 4C37A 2BKKA 4JIKA 4EJNA 4O7YA 2OF4A 5AFVA 2GNJA 4E6CA 5F9EA 5BVWA 5EQYA 4FIIA 2OI4X 3D15A 3RPRA 3D0EA 5IU2A 3COKA 4R8QA 2BRGA 3L9PA 4CFNA 3H30A 3W32A 3PUPA 2H96A 5E4HA 4TWPA 4ID7A 1M17A 1RQQA 3FBVA 4I6FA 2OJ9A 1JAMA 2VTOA 4IX5A 4JDIA 5ANJA 2RSVA 4FZ7A 5HVJA 3FQHA 3HEGA 3LW0A 3QQKA 4Y46A 3UVPA 2BTRA 4QTBA 4WO5A 5AR8A 3ODZX 3PLSA 5CEMA 4TYIA 4LRJA 5HICA 4N4SA 2YM8A 5ITAA 2GNIA 2H9VA 2Y9QA 1R1WA 4BCPA 4DFZE 4I6QA 4PMPA 3DTWA 3D83A 3KRRA 3DV3A 3EJ1A 1OECA 3R02A 1UWHA 2ZDUA 3QUPA 1KE8A 2XEZA 4FZFB 4Q9SA 2YACA 4GFOA 4LOOA 4FOBA 4XOZA 4M15A 4KIKA 2BILB 4AWIA 3CBLA 4QT1A 4MX9A 2VTMA 2HXLA 5CSPA 5HD7A 5IA2A 3LOKA 4WUNA 2GPHA 2GMXA 1JBPE 2E9NA 3K54A 4H3BA 2SRCA 3LQ5A 4NSTA 2RIOA 2FVDA 1NVRA 4TT7A 2F4JA 2ITVA 2G1TA 2YIYA 2Z8CA 3OS3A 2VTAA 3V6SA 5ANDA 3LE6A 4Q2AA 5AEPA 5TKDA 4NTSA 3GU4A 3OCTA 4I94A 1WBOA 1OIRA 4NZWB 4Q5EA 4O22A 3WF6A 3OZ6A 4DLIA 2C6EA 2YEXA 1ZAOA 2W5BA 2WMQA 3GFWA 2XBJA 3VS5A 4HGSA 4XG6A 4ANQA 2PZYA 3QCXA 4F6UA 1PXOA 4R5SA 5FP5A 3GCQA 5HG8A 3QX2A 3AC4A 5JZJA 3G33A 3F7WA 3MJ1A 4LMNA 4FV3A 2HENA 2IVUA 4FV1A 1Q3DA 4OGRA 4DH7A 3OT8A 4DH5A 3OXZA 1CSNA 4ACDA 5JFVA 4QD6A 3CTHA 3QA8A 5AP6A 1L3RE 4YBKA 3ZZEA 3GU5A 2Z60A 1JVPP 5IQEA 2YCRA 3A8XA 4YHTA 5T6KA 5C4LA 4QYGA 1XH5A 2HWPA 3Q5ZA 5IH4A 3FSKA 4E6DA 3E7VA 4ERKA 3TUCA 2YLEA 4XLIA 2PUPA 3Q6WA 4WA9A 3VWAA 3IW7A 3T9TA 3Q9XA 1QPEA 4UALA 1Q8UA 4DEGA 4EL9A 4CTBA 4KRCA 3NUXA 1ZMWA 5C26A 3K5VA 5BVKA 1XQZA 1OL6A 3HMIA 3FXXA 2B53A 4JAJA 3MFTA 2WTDA 1AD5A 3QQJA 4LI5A 2Y4IC 4RSSA 5CI7A 4DEIA 4E26A 2I0HA 5IA3A 2GS6A 1PY5A 5HNIX 4Z55A 1J7LA 4YJTA 3ATTA 4M13A 4EK3A 4J1RA 3KRXA 3GNIB 4U3YA 2VV9A 5GZ8A 4L3PA 3FLSA 4NT4A 2IZSA 2PVJA 3HLLA 4NWMA 4RX7A 4JQ8A 3JXWA 4WNMA 5EI2A 2PMLX 4BCGA 4W9WA 4UMPA 5HX6A 3JUHA 3PE2A 4E7WA 5JRSA 1U4DA 3UODA 2C5VA 3NW5A 4E6AA 3DNEA 4I6BA 3FI2A 4F6SA 5J79A 5EQPA 5IA4A 4QOXA 3R2BA 4ZZOA 3FC1X 3Q60A 4YC8A 5HGIA 2E9PA 3HGKA 3U8WA 3NSZA 1NY3A 3TG1A 4FTJA 2YM4A 3CCNA 2VTSA 1PMVA 1YHVA 2ITZA 3CGFA 3FE3A 5DG5A 1XBAA 2OGVA 4IX4A 4MXCA 5EG3A 4EK5A 2JD5A 3LM0A 3DNDA 2UZEA 2WTKC 5BYLA 5IQCA 3D7TB 1WMKA 4X0MA 4D0XA 3QQFA 5A46A 1JSVA 2WTVA 3FMLA 5M53A 3R28A 5IMXA 4U3ZA 5HTIA 4GCJA 4RWLA 4Y83A 5M07A 2VX1A 1Q24A 3LJ0A 4QPAA 2REIA 2C6MA 2R3HA 4LGHA 3UIUA 3ANQA 2DYLA 4CFUA 3FKOA 4EBVA 3LCSA 3FKNA 4EKLA 3ULZA 3QTIA 2WEVA 4O0SA 2J50A 3QYZA 4TTHB 3O0GA 4QYYA 3SC1A 1DM2A 3UC4A 5DYJA 2IZTA 4NEUA 3UGCA 4FT0A 5CU2A 3KREA 3ZRKA 3P7BA 2I1MA 4CQEA 3TACA 5KMJA 3VULA 3ZBFA 1Q61A 2C30A 3QUDA 3C4EA 4W4VA 5AR3A 3BWJA 3F6XA 1KE9A 2VTJA 3MS9A 4EI4A 3UIMA 1KV2A 1YQJA 3BWFA 5A4QA 5HQ0A 1YHSA 4RFYA 3NAXA 3I5ZA 4XP0A 1M2RA 1J91A 4AE6A 2WD1A 4AGWA 4DAWA 2G2HA 3B8QA 1MQBA 3KVXA 2YDKA 4FL2A 5BUIA 4RX5A 2I6LA 3GOKA 2YIWA 1W98A 4N57A 4AF3A 4B9DA 4BN1A 4PX6A 3QRIA 3KFAA 3LXLA 1YVJA 4O96A 1ERKA 3QZHA 2R9SA 5B2MA 2ITWA 5TF9A 3AC1A 3HA8A 2BAKA 5DIAA 4QMTA 5T68A 4X6RA 4UWBA 4FC0A 4PRJA 4NIFB 3DBQA 1WVYA 3TNHA 3UZRA 4O0XA 4QQ5A 3V8TA 3QD3A 4RVTA 4IWOA 1UVRA 3ORPA 5AR2A 3W2PA 5HD4A 2CHLA 2OIDA 4FSMA 2YAAA 4IAYA 3VBWA 1H01A 2BVAA 2CGUA 3PDTA 2F49A 1OL1A 4BIEA 3Q4TA 4BHNA 1PKDA 2PVKA 1OGUA 2QHNA 1W83A 3HDNA 3EN7A 4RJ4A 5HHWA 4QP4A 4FZAB 1CKJA 2P33A 3P86A 4JDHA 4KWPA 4QP3A 2BKZA 3ENHA 5K5NA 3AD5A 4DEHA 4DGGA 3CPCA 3FL5A 4E4XA 1TKIA 4ERWA 3F88A 3WF7A 2CCHA 3D4QA 2GCDA 2QCSA 4JT3A 5D11A 3VW6A 3AC8A 4PWNA 4FA2A 2V62A 3SDJA 4XYFA 3RPYA 5EM5A 4N70A 2JDVA 1CM8A 3ZHPC 3L8VA 3DXQA 3FY2A 2ITUA 3EQIA 5F4NA 3ORZA 3GEQA 4CKRA 2OU7A 3BHYA 4ZTHA 2ZMDA 5IF1A 3HNGA 5DR6A 3GQLA 5CF6A 1W8CA 3TNIA 4BI2A 5CYIA 4FTRA 2RKUA 3FMEA 3ZS5A 2JAMA 4D4SA 2WTJA 1KOBA 1Z5MA 4K33A 2OZAA 2V0DA 4J96A 2PSQA 5A4LA 1YXXA 3NAYA 4TWNA 1OBGA 3HMOA 2YABA 2W5HA 3IO7A 4EOKA 3NDMA 3UVQA 3REPA 3KL8A 2JIUA 3WBLA 5EK7A 5AP1A 3TZ7A 4O6EA 5CVGA 3F66A 3G90X 3TV4A 2GQRA 2GNHA 3ZXZA 2O63A 4BVUA 1PW2A 2BDWA 4DCAA 3NWWA 4BTJA 4YURA 2OK1A 5D9HA 3MTLA 3R7VA 4U6RA 3ROYA 3FMMA 1H1SA 5C8MA 3UYSA 2NPQA 4IAIA 4HZRA 3VS6A 4MXYA 1MQ4A 3KQ7A 1H4LA 5AP2A 4BR3A 1IR3A 5HG9A 1RJBA 4MF0A 3QD2B 5FD2A 3AC5A 3EQBA 4EOSA 4Z3VA 5AUWA 4TNDA 2QHMA 1JWHA 2VAGA 3R01A 4J53A 1Y57A 2KULA 4Y73A 2FUMA 3SXFA 4L9IA 3UP2A 5DR9A 2CKEA 1SZMA 4I6HA 1J7UA 4QPMA 1YKRA 3FI4A 1ZZLA 3FHRA 3NUUA 4K8AA 3SRVA 2E9UA 1JSTA 3BBWA 3T3VA 4G2FA 4YTCA 5I3RA 1GZ8A 4FSQA 4ITJA 3VW8A 5KCVA 4C36A 1O6KA 3I6UA 4RX8A 3HDMA 5IMEA 3JYAA 2J0MB 4ANMA 4PPBA 1ZMVA 4MH7A 2OKRA 2XKEA 2XNOA 2RF9A 3R6XA 4IB0A 5JRQA 3U6JA 4CEGA 3MI9A 3HAVA 4NJ3A 3E7OA 3RPVA 5IEXA 3E5AA 4LGDA 4MD9E 4EUTA 3MY1A 1PMUA 4B8MA 4X21A 4AT3A 3K3IA 2XIRA 2UW4A 3FC2A
chains in the Genus database with same CATH superfamily
2CN8A 4O27B 4RC3A 3A7IA 2H6DA 4EOQA 5J9LA 3SKCA 5D41A 4YBJA 2BFXA 4H39A 5JKGA 2Z02A 3A62A 5DA3A 2CLXA 5CU0A 3LFEA 4QRCA 2OIQA 3QU0A 2FSMX 2GTNA 5FEDA 1UWJA 4MBIA 4M3QA 3VF8A 4WSYA 5FM2A 3R7YA 4HNIA 4FG9A 4X6QC 3EYGA 4AW5A 4U7ZA 4CCBA 4LUEA 4WHZA 3QLFA 1BI8A 2WOTA 2OWBA 1UU7A 5AUXA 4M97A 3Q4CA 4M7IA 4FSUA 4FTUA 4MNFA 5HNBA 2BZJA 4MNEA 4O7WA 1BL6A 4G17A 5J7HA 3VC4A 3R9HA 2FGIA 2FSTX 2OJGA 3FQEA 4YLKA 4CLIA 1WBWA 4MKCA 5LXMA 5CU6A 3L8PA 3N51A 2YIRA 3FSFA 2W1HA 3BZ3A 3UOLA 4X3JA 2R4BA 4HCVA 2ZMCA 3O8UA 1YWNA 3IGGA 3NIZA 4NTTA 3EQDA 3P79A 3SA0A 3TM0A 3LPBA 5A9UA 3ORKA 3ORXA 4TW9A 1Y91A 4IQ6A 5EHOA 2CSNA 4AZTA 1TVOA 3DBDA 3LFQA 3DKCA 3CTQA 5CNNA 4Z9LA 3C4CA 4BCNA 4BDDA 1UU8A 2JBPA 3PXKA 5CTPA 1KSWA 4AA4A 2C47A 3O17A 4M0ZA 3O5AA 3LXPA 3CSVA 3GXLA 3CXWA 5H2UA 2OXDA 3FYJX 1BUHA 3OMVA 3KCFA 4GK2A 3R7OA 3B8RA 5HI2A 1T46A 5F95A 3ZSHA 5KZ0A 5CI6A 1E1XA 5KE0A 1LPUA 4C8BA 4ZJVA 5HZNA 4XV9A 5J95A 5KX8A 4BI1A 1A06A 1QCFA 4FRFA 5GJFA 3LJ2A 3ODYX 4BL1A 3CKXA 4AS0A 4DHFA 4BCKA 4UN0C 2YN8A 4FV4A 3DPKA 3NNWA 5GJDA 3S2PA 2R3IA 4EH5A 1FVRA 3ELJA 3QX4A 4ZSGA 3FZSA 2A27A 3I4BA 3CP9A 1NXKA 3FYKX 4IJ9A 4RIOA 3A2CA 1YWVA 2C1AA 4MYGA 4PPCA 3EYHA 5J1VA 5IUIA 4QQTA 2PVHA 2Y4IB 3BLQA 3TZ9A 1UNGA 2P2IA 1ZXEA 2WXVA 3O23A 3RCDA 5ANGA 1OKZA 2PHKA 1VZOA 2C0OA 2YCSA 3DBFA 3Q9ZA 4XRLA 3WARA 3DZQA 3H0ZA 4EZ7A 2WU6A 3TDWA 5ETAA 2X8EA 4USFA 3IDCA 4WBOA 3B2TA 5CF5A 3QHRA 2PU8A 4S34A 4F0IA 1XR1A 3NZ0A 4FICA 2W1IA 4B99A 2Y4PA 3LFFA 1TQIA 3VS7A 3QQHA 3LFNA 1PRYA 2RFNA 3E8CA 3DXPA 2XK9A 4IHPA 4HYHA 3UG1A 3OY1A 3RWQA 4MXOA 1XBCA 2EWAA 2P55A 4HJOA 4MTAA 2JKMA 2B9IA 4PTGA 4HPUE 4WNPA 2R3JA 1REJA 2C1BA 1OVEA 3DDQA 3DOGA 3MH3A 3QALE 1K2PA 1XH7A 3DA6A 1F0QA 4FSYA 1S9JA 4QP7A 5JFXA 4FKTA 1Y8YA 4I20A 4YP8A 4WBBB 4U40A 2VO6A 4NUSA 3T8OA 3VS4A 5FM3A 3KF7A 4BCOA 1FINA 4RRVA 4CKJA 3H0YA 3NR9A 5I3OA 1SMHA 2XF0A 3KMWA 1JKKA 2PMOX 2WTKB 4LRMA 4IDVA 1ZY5A 4PL4A 4BC6A 4BGQA 5I9YA 3RJCA 3D5VA 4UZDA 2XALA 2ZM1A 3IW4A 2X6EA 3KXHA 3GENA 5AJQA 5JEBA 3DLSA 5E1SA 3DKFA 2UZDA 1VYWA 4KSPA 2IZRA 2F7XE 4FT5A 4GKHA 2ACXA 3QYWA 2IEWA 5M57A 5IQGA 2UW6A 4JLCA 1ZYDA 3O7LB 5HG5A 2GFCA 3LM5A 4QDVA 1Y6BA 2PE2A 3ZSIA 4DDIA 5JQ8A 3ANRA 3C50A 1U54B 2R7IA 3ZO4A 1Q4LA 4FTAA 3DLZA 1KWPA 3GBZA 3OTUA 4JR7A 1WBPA 3MFSA 3FLYA 4D2TA 4DG2E 4ZMEA 2VD5A 5ANJA 1T45A 4AG8A 2QR7A 5FDXA 2WIHA 2WMRA 3BI6A 4BRXA 1IAHA 3DZOA 2XK7A 2O0UA 3WZUA 5HESA 4YJUA 4D1XA 2B54A 5L2IA 5DOSA 2A98A 3R1NA 1JKTA 1OL5A 3GGFA 4M0YA 1Q8YA 4BI0A 4ASDA 4O38A 4K1BA 4E73A 5JH6A 4ZTRA 1QL6A 3AOXA 4O1PA 2WIPA 4QO9A 4EOLA 3ZTXA 1OPJA 3Q3BA 5IG1A 4ZJJA 2PZPA 4G9RA 4RIXB 3ORNA 4BWXA 1MRVA 3RZFA 4HCTA 1GJOA 1OUYA 4DGLC 3EZVA 5HE2A 4FT9A 3W8QA 5E8YA 1LP4A 2OJJA 3LMHA 1F5QA 4AAAA 1CMKE 2XK6A 3AGLA 4FVRA 3TKUA 3TEIA 4F7NA 4N6ZA 4YGAA 1V0OA 4L7FA 1JOWB 4EK8A 5AM7A 4ZY4A 1LR4A 3II5A 3RI1A 4L42A 4YLJA 2UZNA 2UW5A 2V55A 5EM8A 5K3YA 5CALA 5M4CA 4O7ZA 1P4FA 2NP8A 3LFDA 1PXMA 4GG5A 4ZXTA 4ALWA 4ZAUA 1OKWA 3HX4A 4K18A 3ET7A 4U79A 1JQHA 3U6HA 2Q0BA 4L45A 1V0BA 3ZXTA 4KS8A 4IBMA 5IDNA 4WUAA 4G6OA 3KGAA 1KE5A 3AT4A 5CVFA 2JIVA 2WMSA 4I24A 5CQUA 4MK0A 4EUUA 3AQVA 2JC6A 4YZBA 1PXJA 4FX3A 2HCKA 4F63A 5HVYA 3COHA 4XLVA 2EB2A 3CGOA 4IAZA 4RMZA 4BGHA 4D4VA 2J51A 4EOIA 4PDYA 3F82A 2OH4A 1K3AA 4C3FA 3HMMA 3QTQA 3U9CA 2UZBA 4DEEA 4EOJA 5AIRA 3ZO3A 5AUUA 4IMYA 3F2NA 4G5JA 2O64A 2W96B 3RK9A 3I1AA 2YDJA 4L7SA 3ZDIA 4FNXA 1CKIA 5BVEA 2I0YA 1PF8A 1XBBA 3PYYA 4ANSA 5M06A 4KBKA 3OROA 3VBYA 4RVLA 3U9NA 4IVBA 3MSSA 4O0RA 3HUBA 4Y85A 1S9IA 5ANEA 4EC8A 2CDZA 3WYYA 4D5HA 1DS5A 1H8FA 3ETAA 3O7LD 4I5PA 4KIOA 4O6LA 4DYMA 3O8TA 4WRGA 2ETRA 3AC2A 3VONA 3PXRA 3QAME 5AR4A 2ZOQA 3BCEA 4R77A 3S0OA 4FJVA 3ZLWA 4WKQA 1M52A 2XK4A 3RZBA 3FEGA 4FV9A 3MFUA 1YOJA 5EYKA 3IK3A 5HIDA 3BYOA 3RAKA 2W99B 2HELA 2YJSA 5DR2A 3KK9A 3AGMA 3S4QA 3FMHA 4RZWA 5EQEA 3G0EA 4V05A 3G0FA 4AGCA 4TYGA 4L46A 4LUDA 5L2WA 4CYJA 3PTGA 2QD9A 4IIRA 3L9MA 3QRKA 4YJPA 4CMTA 3HVCA 4A7CA 3LHJA 3UYTA 4FYOA 2JLDA 4AXAA 1OBDA 3W0NA 1OPKA 2C6LA 2R5TA 2ZJWA 2ZB1A 5H3QA 4DF3A 5BV3A 3M1SA 4YNEA 3WYXA 5HORA 3RAWA 1WBTA 2OJIA 1XWSA 3A4OX 1BLXA 5J5TA 4FI1A 3V5TA 4X2GA 1Z57A 4YJRA 3R00A 3WZEA 1ATPE 4S2ZA 3I6WA 2WKMA 4DBNA 2WMTA 4RJ5A 5M09A 3A7HA 3EQHA 3WILA 2EXEA 3G5DA 3HMPA 2YIQA 1J1BA 5L2QA 5JMSA 2Z7RA 3A7JA 1B6CB 4XG7A 4GEOA 2YWVA 4S32A 3HZTA 3UMWA 3MVJA 3DS6A 5TOZA 4ZSJA 2BDFA 3F69A 2VTNA 2WTCA 4BCHA 4U81A 5L2SA 4LG4A 2RFEA 3GC7A 4MBLA 4C4IA 1YI4A 3HV6A 4IWDA 3PRIA 4FMQA 3T9IA 2C5OA 2IVSA 3OCGA 5CSHA 3ZLSA 5L8LA 3TCPA 4AW2A 4DN5A 1SVHA 4RIWB 4HVDA 5M08A 1PXPA 2JKOA 1ST4A 2VWYA 5BX0A 4K6ZA 2ITYA 2C6IA 4C7TA 4YZMA 3ORLA 2XAMA 2X7OA 1IASA 3JY0A 3DAKA 2B9JA 3C4ZA 2ITQA 3LXNA 3FJQE 3MPAA 3EN5A 4E4MA 5HU9A 3ZEPA 3IDPA 3OBGA 3OXTA 5CZIA 2WQOA 4PV0A 5CY3A 3TUDA 5E8UA 3PVWA 5AX3A 2VN9A 4EONA 2WQEA 3C5UA 5KHXA 2PYWA 4IADA 1U5RA 2PVNA 3EOCA 3BX5A 3EIDA 3GCPA 4R3RA 2WMAA 3WZJA 4Z16A 5CAOA 5KZIA 4BDIA 5CAPA 2XIXA 1DI9A 1A48A 4JL9A 4ACGA 4PL3A 5LCKA 1MP8A 4IX6A 1YDSE 2BRMA 5D12A 3ZONA 4DFXE 1I44A 4RWKA 3RM6A 4QYHA 3F5PA 2IVTA 2GHLA 4QMWA 5FXSA 4AA5A 5KMOA 5KKRC 2HK5A 5LMBA 4J71A 4ALVA 4GFMA 4QP9A 2B0QA 2UVYA 5KMNA 2C5YA 1RDQE 4G1WA 3HMNA 3FMJA 3Q4UA 4LMUA 4A9TA 4M84A 3LXKA 1DI8A 5EI6A 2P4IA 3TI1A 3VIDA 4YTIA 2BROA 3NCGA 2X0OA 4MVFA 3D2IA 5TT7A 3QHWA 3LFBA 2IG7A 1A9UA 3Q32A 4UXLA 3QRJA 2AC3A 2PZIA 3VUIA 1IA9A 4CFXA 5A6NA 3KULB 3NYVA 2XA4A 3PXZA 1UU9A 3VN9A 2XKDA 2OBJA 2J0LA 4O0WA 3EHAA 5EH0A 2R2PA 3W2CA 5A54A 1YWRA 4GVAA 5HCXA 3A7FA 3UPZA 5E9EA 4O2ZA 4RBLA 4CLJA 2YJRA 5DEWA 3ZC5A 4EHVA 4RJ7A 3FLQA 4BDCA 5DWRA 1YDRE 3F5XA 4O81A 3FV8A 4GIIA 3NUNA 1I09A 4OTHA 4O21A 1MUOA 4QTCA 4UYAA 2J7TA 3TV7A 4GU9A 1GZKA 2XM8A 2A1AB 3KF4A 3CE3A 2W06A 3PRFA 3VRYA 2VWVA 3QCSA 4EK6A 1Y8GA 4EHEA 4D1ZA 2XH5A 3I0OA 4HYUA 5EW8A 4AGDA 3EN9A 4NCTA 4QMMA 4O7VA 3F5GA 3UNZA 3CQEA 3E3BX 3RKBA 4DTKA 3EL8A 5M55A 4I21A 3TL8A 3OUNB 3GCUA 3GU6A 4GT4A 2VNYA 4U0IA 3F2AA 4JS8A 5CQWA 4HVIA 4FZ6A 4ARKA 1OZ1A 2EUFB 3TJDA 3G9NA 3KA0A 4L01A 3Q5IA 3N4VA 1UNLA 3A8WA 1FVTA 1U5QA 4L44A 2QODA 3L8SA 4FNZA 3NFFB 3E88A 3NVMB 3G9LX 3QF9A 5LVMA 3PG3A 5JK3A 4FVPA 3F2RA 5ANKA 5GHVA 1H0VA 1JPAA 4BZDA 4AOIA 4EJ7A 2X0PA 4D2RA 2VWBA 3RPSA 4FEQA 2GS2A 4O0YA 2XRWA 1Q62A 3P08A 2QOKA 4CZUA 1K9AA 3RHXA 3UMXA 4UMRA 5CANA 2YZAA 1G3NA 3QD0A 2QKRA 2AEGA 4KIKB 4E4NA 1TFFA 4BY9E 3D5XA 3L1SA 4RFMA 4XX9A 3FDNA 1YRPA 3CR0A 2RFDA 4CTCA 2PVYA 1UKIA 2QLQA 3ORTA 3QZGA 4R7BA 3QCQA 5AR5A 4DDGA 2R3MA 1G5SA 3ZO1A 5IQDA 4X2JA 1YI6A 5IH6A 4M68A 3SW4A 1XH9A 5KMMA 3IG7A 1M2QA 3DDPA 5HLNA 2PMIA 3TYKA 3QQGA 4IEBA 3EQGA 3NX8A 4EYJA 2YCFA 5FEEA 5CSXA 3T3UA 2PVRA 2R3LA 5EKOA 5JGBA 4AAYA 2OIBA 4P90A 1L8TA 3OBJA 3H9RA 4MXZA 4UX9A 3UE4A 3QLGA 3A7GA 2BIKB 1FGKA 4GVJA 4R6VA 5D1JA 4AW1A 2XJ2A 3KN6A 5A4CA 3RNYA 3E8DA 1OGYA 2W4JA 3ML1A 4BWPA 2WHBA 3BYSA 4P5QA 4BCQA 4C4HA 4JG8A 3PVBA 3G15A 3KRWA 2ITOA 2X1NA 2XP2A 4BICA 5HIEA 2LGCA 4PNIA 5BMSA 2WMUA 5CWZA 3CY3A 2XNMA 2QVSE 3EQCA 3P1AA 4LV7A 2AYPA 3GI3A 3MA3A 4G3FA 4A9YA 4QNYA 3DJ5A 1ZYSA 3PPJA 4ANOA 4D2VA 2I0EA 2ZB0A 2R3QA 4BTMA 4MD8E 5ETFA 4QMNA 4O7NA 5LCJA 3A60A 3OF0A 4R78A 4W9XA 1H24A 5EKNA 3EH9A 4FE2A 1SVGA 4F4PA 3JPVA 5AAFA 5BNJA 4UMUA 4WT6A 3ALOA 3QD4A 2BRBA 4ZS4A 2NNWB 4XMOA 4UEUA 1W82A 1R0PA 5HG7A 4J8MA 4N6YA 4EHGA 5FDPA 3QWKA 3RBWA 4XBRA 2VWIA 2QO7A 2Z7LA 2QOIA 3NNVA 2J90A 3VNTA 3VJOA 4H3QA 5CU4A 1H1RA 3C4WA 4FTQA 5LARA 4DBXA 1WBNA 1WFCA 3JY9A 4I1ZA 3H3CA 3PY3A 5CF8A 1QPDA 4D55A 4FF8A 4C4FA 4NKAA 1PMEA 4NM3A 4RA5A 4ACCA 3NUSA 5DPVA 1QMZA 2GS7A 2Q0NA 5DT4A 2W7XA 3V8SA 5CLPA 5EFQA 3FMDA 5M56A 5KMLA 1YOMA 4YTHA 3DB8A 5HBEA 4U97A 3W2RA 3ZFMA 3QQUA 3LMIA 2O65A 3VUGA 4QP8A 4YJQA 3MIYA 3R30A 1ND4A 1WVXA 2QC6A 4GT3A 4NFMA 3V5LA 3JVSA 3M11A 4PPAA 3HP2A 2B9FA 4WNKA 5JT2A 5LVOA 4ZY6A 2PZ5A 4TXCA 3QTUA 3OWPA 1YXVA 3EFWA 3QKMA 4E4LA 5HLPA 3UC3A 3FMKA 4JX3A 4YJVA 3BEAA 4H36A 4JQ7A 1W84A 3Q52A 2PUNA 4F9AA 4L8MA 2XJ1A 4OTRA 2GDOA 3BGPA 2B55A 3DFCB 3NUYA 3HUCA 5DNRA 3UZTA 4BZNA 4DE4A 3BE2A 5IQFA 4R3CA 3RCJA 3BYVA 3B2WA 4JRVA 2YM5A 3EZRA 2X7GA 4GJ2A 4AW0A 3OCBA 2WU7A 5DLSA 3ERKA 2YERA 5F20A 1PXKA 3OP5A 2OJFE 1VYZA 2BUJA 3GT8A 3R8PA 4AA0A 3IKAA 3OOMA 1SNXA 3PSDA 3ZC6A 4AT4A 1WCCA 4GU6A 4O83A 2X6DA 4LYNA 3CIKA 1YXUA 3K3JA 3OUKA 5B0XA 3RHKA 3NLBA 4M69A 1O6YA 4CQGA 4XG2A 3V5QA 2HYYA 4IW0A 4ZIMA 1CDKA 1OM1A 2Y6MA 2FH9A 3O71A 3ZH8A 4F6WA 2WQNA 3C0HA 3VUTA 4Z7HA 5KBRA 1TQPA 2V7OA 5AP7A 4USDA 3SGCA 3H9FA 2X8DA 3D5UA 3LZBA 2XKCA 4GFGA 4GG7A 2YHVA 2ZDTA 4IACA 4OR5A 4O7LA 3KC3A 5IQIA 2CNQA 3EMGA 5A3XA 4HGTA 2XJ0A 2QU5A 3F61A 4PDSA 4FIJA 1ZYLA 3ITZA 2XNNA 2Y8OA 5IKWA 4V0GA 3QGYA 5HKMA 2C6KA 3QZIA 4FSRA 4IB5A 2W9ZB 4J52A 4O0VA 3QUEA 1Q3WA 4IZYA 4QMYA 4FEUA 3VUMA 4G6LA 4QMQA 4GH2A 2FO0A 1E1VA 3BHHA 4UB7A 4E5WA 2VTHA 4LV8A 5TR6A 3ZUTA 2VO3A 5DN3A 3RP9A 4FKRA 5AAGA 2ZV9A 3ZRLA 3OXIA 2PUIA 2E9VA 4JBOA 2ITXA 3ZDUA 4EYMA 2PK9A 3OWJA 4HYSA 4ZSLA 4C35A 5C8NA 2VTIA 3M42A 4I5CA 5CEOA 3VS2A 3VQHA 3VBXA 1E9HA 3IOKA 4MWHA 3VRZA 5A4TA 3EN6A 1Q41A 2FSLX 2PE0A 3SXSA 4IAAA 4CFFA 4OT5A 1M14A 4O4FA 3RNIA 5HCYA 3RPOA 3PY1A 5JGDA 2W17A 3AMAA 4JOAA 4UMTA 4HOKA 1JLUE 4KKEA 5C8KA 4RG0A 2YCQA 4IX3A 3OEFX 4QPSA 4AOTA 2CMWA 3NUPA 4WRSA 2R0IA 4XOYA 4YMJA 5AMNA 4A9SA 5CT7A 5JZNA 4BDBA 5IUGA 4AQCA 1WBSA 1BI7A 2F7EE 4UBAA 4A9RA 2HXQA 4JQEA 4ZTNA 1YXTA 2EVAA 1XKKA 5ANOA 3PSCA 4O4DA 2C3IB 4FSTA 2QQ7A 4C34A 4B7TA 3OC1A 2B4SB 2CKOA 5DT0A 4D5KA 3MY0A 3S3IA 2ITNA 2QURA 4C38A 4GMYA 5FBOA 3KRLA 3O8PA 1W0XC 4LRKA 1UKHA 5BYYA 3OWLA 4FTMA 4J7BA 2WNTA 3MFRA 3FMNA 3ACJA 5H8BA 3DK6A 2IO6A 4G5PA 4AT5A 3UIXA 3QKLA 4EOOA 4IM2A 1OL7A 2VRXA 2IZUA 4QMVA 2WELA 2BRHA 2YISA 5FEQA 4FNWA 1FVVA 1PXNA 3NW6A 1H00A 3JVRA 5FWKK 3ZYAA 4BCIA 5LVPA 4BBFA 3R9OA 2JBOA 5G6VA 3DKGA 2XNGA 5LOHA 2R3KA 4AZWA 4ZP5A 3PJ8A 5LMKA 1BKXA 4KRDA 4C4EA 3R71A 4YJOA 2DUVA 3BU6A 5EDQA 3SRVB 4CZTA 2W1DA 4FV7A 4O82A 3HRCA 4FGRA 4F9CA 3MPMA 4FKWA 1ZYCA 1R0EA 1H08A 3C13A 2RFSA 4X2FA 3S00A 5JFWA 4BF2A 4OTWA 3GP0A 4U5JA 4IVCA 5CEQA 3PVGA 3CD8A 5A14A 2ZV2A 4P5ZA 4J97A 4EOPA 3ZEWA 4QTAA 5IZFA 1V0PA 3VUHA 4CGAA 2G01A 4DGNA 1IRKA 5C9CA 3K5UA 3Q2MA 1PYEA 3EKKA 4D28A 5EHYA 2F9GA 2BAJA 2QO9A 3BIZA 4MD7E 1H25A 2QKWB 3R8MA 3WF5A 3DJ6A 1BYGA 2OFUA 3LLTA 3W0QA 4II5A 2Y7JA 4JXFA 3E8EA 1H1PA 2A4LA 3QXPA 3IW5A 2VWZA 2UW8A 4BCJA 4AQKA 4CXAA 3KMMA 2F7ZE 3MVLA 5FTGA 3IQ7A 4KNBA 3LCDA 4UY9A 4EZ5A 2YM7A 2BRNA 3OOGA 3QCYA 2OSCA 3PY0A 2J9MA 4HZSA 4XH6A 4NL0A 3L9NA 3LMGA 5K0KA 4EORA 3UP7A 4C3PA 4QTDA 4IJPA 5CAQA 5AP3A 4BDFA 3FLWA 3MIAA 5CEIA 3ZOSA 2W05A 4EQMA 3PPKA 4IC7A 3SG9A 4BTKA 3BRBA 4CV8A 5IA1A 5I9VA 4I22A 3PIZA 5K4JA 5E8ZA 2ZFYA 4FEVA 4F1OA 1FGIA 2JDTA 5IQAA 3EQRA 4PMSA 2WMBA 5JSMA 3DFAA 2WOUA 5DI1A 4MNEB 5C27A 3SOCA 4R1VA 4NFNA 3PJCA 4Q5HA 1H0WA 4C62A 2XCHA 1TZDA 4JI9A 4ONAA 4WG3A 3FZPA 4YSJA 3GVUA 2B7AA 4OTDA 4ZOGA 5KHWA 3SAYA 4BCMA 1G8KA 2QG5A 3BGQA 2GNFA 4D58A 2QOCA 3UTOA 3BL7A 3QA0A 3TNQB 4C58A 5K4IA 4DLJA 3EFLA 2BCJA 4BBEA 2UZTA 4DC2A 2XEYA 5HLWA 2XMYA 4I6LA 5FBNC 2R3RA 3HKOA 3PJ1A 2UZUE 2GQSA 1VJYA 2C3KA 5FQDC 1SVEA 5GJGA 3TZ8A 3V5WA 3C5IA 1XMLA 5HCZA 3P23A 4X3FA 4AN9A 4EH2A 3W55A 4IFCA 4DT9A 5E92A 4ZSAA 4DINA 4QMPA 3QQLA 2DQ7X 3PE1A 4ANBA 4BJJA 2BHHA 1R39A 1VEBA 4FTNA 4S33A 3HAMA 3BU5A 4P4CA 3DQXA 4CT1A 5IQBA 3HA6A 3FL4A 4FT3A 2OO8X 2UZWE 3UNJA 1ZARA 3EFJA 3W1FA 1JKLA 4FKIA 4AXCA 4XBUA 3ZMMA 4EWQA 2XANA 2IJMA 3C1XA 3HYHA 1GNGA 4QDEA 2XIZA 3OY3A 4XEYA 5D10A 4ZLOA 2X0GA 4TYEA 4G3CA 3VBVA 3VBQA 3PJ3A 2XRUA 4TYHA 3VHEA 3U6IA 3Q9YA 2R3NA 2BPMA 2R3FA 4L00A 5EHLA 1HOWA 3PFQA 3QC9A 5EM6A 2ESMA 4FKSA 3QWJA 4S31A 3R7IA 2X39A 3VQUA 4ANNA 4UZHA 5EDPA 5FLFA 1OPLA 2UW0A 4D4YA 5HVKA 4CT2A 2GQGA 3QTXA 4E6QA 1ST0A 3N4TA 5J8IA 4XUFA 4RIYA 3HRFA 2F2CB 3OFMA 3JR1A 3A61A 1OITA 4FOCA 4ALUA 2YZLA 4RC4A 4ITHA 4USEA 2BR1A 2JITA 3UQGA 4S30A 4H58A 4H3PA 5KNJA 4NM7A 1BMKA 3AMBA 4YSMA 3LJ1A 2C0TA 5I9UA 4FIHA 4AZFA 1FOTA 2ZVAA 3IONA 4U42A 2CKPA 3FI3A 5TO8A 3WZDA 4ZMFA 3R9DA 2HY81 2EB3A 5DFPA 3C51A 3Q96A 4NCTC 3CPBA 3ALNA 3TJCA 2ETMA 5IDPA 4EK4A 5LWMA 4O7RA 2ITTA 3VS3A 4YC3A 3MH1A 4BCFA 1SM2A 5AX9A 1PJKA 5I0BA 3R22A 2BZIB 3VUKA 4EH3A 4JG7A 2JFMA 5IEVA 3F3VA 2QLUA 4XG3A 4QTEA 3F3WA 5HIBA 3PZHA 1URCA 2VNWA 5A4EA 4FODA 5DH3A 3F3ZA 4EH9A 5E8TA 4NYEA 3NRMA 5I9XA 4CMOA 2OICA 4UV0A 5E8WA 3FZTA 3HP5A 1QPCA 3U87A 1OKYA 1J3HA 4FR4A 3BHTA 2BMCA 5E8SA 3GC9A 4FL3A 4APPA 3OWKA 4IZ7A 3O2MA 4I23A 4MQ2A 4QP2A 4EH7A 5A6OA 2VO0A 4P7EA 4YZNA 5D7AA 2QOFA 4XG9A 4WG5A 1R3CA 4FKGA 1YW2A 1B39A 4GK3A 3PLAE 3HECA 4X7QA 1XJDA 5BUEA 2NYAA 2P3GX 3Q04A 4JNWA 3BLRA 4TKSA 3NMUF 2ONLA 3GC8A 4BDAA 4DFNA 3C7QA 2V7AA 1OIQA 2XIKA 4JAIA 5HEZA 2GTMA 4KABA 4NK9A 4QNAA 3ZSGA 5L6OA 2VU3A 4OUCA 4RQVA 3R8ZA 4O7TA 2PWLA 2ZM3A 3R1QA 3R1SA 3RTPA 3A99A 4PNKA 4D1SA 2UVXA 3RM7A 3GU8A 4BYJA 4NM0A 4JDKA 5EW3A 2UW7A 1X8BA 1LEWA 2PZRA 4JVGA 3QGWA 2ERZE 3QC4A 2I0VA 4L43A 4RC2A 4MXXA 3CJFA 3RK7A 2FYSA 1J1CA 4EBWA 2WFYA 3COIA 3POOA 4UXQA 5AA8A 4XG4A 4K9YA 4C61A 4NM5A 1F3MC 5IISA 3D14A 1Q5KA 5KMIA 2XCKA 2QR8A 3S1HA 2QOOA 3MVMA 5AV4A 2YDIA 3Q4ZA 5CF4A 4HVSA 4IWPA 3QRUA 5CXZA 2DWBA 5M44A 3BLAA 1NVSA 3UVRA 3AC3A 2JEDA 3GCVA 4I4FA 3TXOA 2C69A 1NW1A 5FTQA 1Q97A 4XCUA 3LQ8A 5M51A 2CNVA 1UU3A 3CLYA 4YZDA 3A4PA 5EW9A 2VUWA 1G8AA 2X4FA 4ZTMA 2WPAA 1QPJA 2QI8A 4PQNA 4XHKB 2OXYA 3V51A 4AXEA 3SV0A 4O4EA 5IA0A 5L8KA 4PY1A 2VWWA 3NNXA 3W0MA 3P5KA 3R04A 2JDOA 2O5KA 3BV2A 4OBPA 4KAOA 4IB3A 3TNPC 2FSOX 4FVQA 4M12A 4C3RA 4BDGA 5AV0A 2C0IA 3E87A 4HPTE 4MBJA 4F64A 4Q9ZA 5C4KA 5DRBA 4H05A 3AMYA 1Q8TA 4U9AA 3OTVA 5HO7A 2XNEA 3DTCA 2X2KA 5C1QB 3ORIA 5M4UA 4RWJA 5AM6A 3UOKA 3R1YA 4TN6A 4OAUC 1KOAA 2HIWA 4G9CA 4EH4A 3D7ZA 5AP4A 4YNOA 4E8AA 5F1ZA 3KEXA 4FZDB 3W2OA 4CKIA 3G6HA 4FV5A 4F0GA 3NVKI 3PFYA 1ZMUA 4CMUA 3EFKA 4YR8A 2UZVA 2XM9A 3GUBA 3OEZA 4IM3A 4GV1A 1Q8WA 2IPXA 3G6GA 4YTFA <