2Q0BA

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic e565a mutation responsible for pfeiffer syndrome
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
298
structure length
280
Chain Sequence
LPEDPKWEFPRDKLTLGKPLGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVAYASKGNLREYLRARRPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
publication title A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 280
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2q0bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2q0bA01
2UZOA 3VC4A 4B0GA 3GC7A 3R9NA 4PNKA 2ITZA 5KKRB 1H1WA 4QQJA 4BZOA 1TQPA 3OMVA 3KRJA 3C4FA 4YMJA 3FZSA 4HVIA 3KXNA 3DXPA 4YC3A 3KVXA 3P1AA 4YJQA 2PE1A 3CGOA 4CTBA 4OAVB 5C26A 4AT4A 2OICA 5LJJA 4BIBA 4DH3A 3SKCA 3E87A 3QZIA 3EFWA 3GFWA 2W5HA 3Q4CA 5J79A 1PMVA 3AD5A 1R0EA 4DEGA 3FL4A 4D2WA 3AC8A 4GJ3A 3BE9A 4YZCA 3S1HA 4DFLA 5ANJA 3H10A 3NYOA 4Y85A 2E9UA 4YLLA 3CJFA 4IWDA 4W9XA 2IVVA 5JN2A 4HGEA 4E6DA 2CGVA 2Y4PA 3E3BX 4F9YA 3D2IA 4KKEA 2IVUA 3U51A 1RJBA 4ACHA 4L53A 2PZRA 4M14A 4OGRA 4KWPA 3R21A 4W4YA 5DR6A 5M55A 2WHBA 1PJKA 2UW3A 3EH9A 3A8WA 3O51A 4GT4A 4Q9ZA 1MRUA 4QTAA 3QD0A 2GNGA 3FXXA 4EORA 5AV4A 4JAIA 3COMA 3R1SA 5J1WA 2RL5A 3GI3A 4ZOGA 4ZK5A 4YURA 2GTMA 3OBGA 4QMZA 4TYGA 4IB3A 3BYVA 4FL1A 4C59A 3LKMA 2IWIA 5DPVA 3DY7A 4OBQA 4YZMA 3C5UA 2WD1A 4L01A 3WZKA 3V8WA 4O1OA 4DCAA 2Q0BA 3UZPA 4E4MA 4IFGA 1IEPA 2ERKA 3OY3A 3R7OA 2ETKA 3TTJA 2C0IA 2XF0A 2C6OA 1PMUA 1I09A 4G6NA 2QVSE 4IEBA 4ARKA 5KE0A 4DFBA 3MVHA 1SYKA 4L3LA 4PQNA 5B7VA 5M4FA 3KVWA 3B2TA 3ZSHA 4AW1A 2XS0A 4DGNA 4XNEA 3EQCA 1KE9A 2IO6A 5EM7A 4IM0A 1ZMVA 3PP0A 3U6JA 4AN2A 4FKPA 4EBWA 2RFEA 3FQEA 3OOMA 2PULA 4MD7E 3UNZA 4A7CA 5EM5A 4AWIA 4CSVA 4G9RA 1DAYA 4ALUA 4AZEA 3FMEA 5T68A 3S0OA 2KTYA 5L3AA 3EL8A 2F57A 4FEXA 2OZAB 2VO3A 4D4SA 4R78A 4GFOA 5EQPA 4WNMA 4IX4A 1PW2A 4WIHA 1FPUA 2FA2A 3MN3A 2W1HA 4HYIA 3QKLA 3THBA 4D1XA 4FX3A 5LMKA 1W83A 2P33A 2J90A 5FDXA 3S3IA 4FV2A 3HA6A 1YWVA 1XHAA 2VV9A 2Y8OA 3PY1A 3DA6A 4ANBA 3FLQA 3MFRA 4IE9A 4E5AX 4IHPA 1OKZA 5FRIA 4AOJA 4BGHA 1OB3A 4FT7A 4BDDA 1UNLA 4J99A 4A07A 2WOUA 4EOQA 4NTSA 4Z7GA 3BCEA 2V55A 2YDJA 3JUHA 2YAKA 3LHJA 4G3CA 3PJCA 4IJ9A 5EHLA 4AXAA 4ASEA 4O6LA 1NVQA 1SNXA 1STCE 3RPYA 4CVAA 2VTTA 3UQCA 2XJ1A 2CN5A 5AA8A 3DK6A 4BVUA 2YCRA 4TWCA 4H58A 3FI4A 4FBXA 4ZMFA 3NW7A 1H01A 4MD8E 1M2QA 2CCIA 5IMXA 5HU9A 3GC8A 3REPA 4XH6A 2WQOA 4UXLA 3TWJA 3DBEA 4W8DA 2XYUA 2QKRA 3R63A 2XCKA 4X6QC 3UVPA 4F65A 3BGPA 2PTKA 3FQSA 4C37A 4JR3A 2R7IA 3RAWA 3U9NA 4CRSA 1OMWA 4QMTA 3TZ8A 3EJ1A 4QTBA 3ZTXA 3PWYA 4UMTA 3W2OA 4ZTMA 2VWWA 2JDTA 3QF9A 4I5MA 5CEPA 1XH6A 2Z7QA 2WIPA 4TY1A 4CKRA 4BC6A 4PTCA 4M3QA 3QRKA 4QMLA 3LCDA 4EOKA 1KUTA 4FKVA 2ITYA 4F9WA 4ZZOA 5D1JA 4F7NA 4BDIA 4RJ3A 3B2WA 3O8UA 3PIXA 4HGLA 4OTPA 4TWNA 3D83A 4OTIA 4HVDA 3W16A 4EK8A 2O5KA 3GCSA 3LQ8A 5AP3A 4UN0C 3V5TA 4KINA 4YO6A 1WVXA 4DT8A 4IANA 4C2VA 4NH1A 1KE5A 2B9FA 5AV1A 2WMSA 4X6RA 3JYAA 3EZVA 3TNHA 4TYHB 4D28A 4JBVA 2Y9QA 4NW6A 4JT3A 1NY3A 4QYHA 2QG5A 2BFXA 4CXAA 4HZSA 4WRGA 4YC6A 4TL0A 4O0RA 1Q8WA 1PXNA 3BHUA 1WBWA 4XBRA 3WE8A 2YM7A 4FV5A 5DGZA 2WTVA 4GV1A 1YXUA 5HCXA 3E92A 4TXCA 2R4BA 2UZEA 4C62A 1G8SA 4FTCA 2CPKE 3DNEA 1XO2B 3G5DA 3LVPA 2Z2WA 4RVTA 4HW7A 2FYSA 3C0HA 2VTMA 3MWUA 2C5OA 5J8IA 3AXWA 4FEQA 5C8MA 4BCFA 4UMUA 3MB7A 3NCGA 3LLTA 5EYCA 4WSQA 5JQ8A 3D5XA 5EOBA 4FZ6A 4TNDA 4DH1A 3S00A 3NDMA 2HY0A 4IB5A 3U4WA 2YFXA 2BRBA 4DEAA 3MTLA 2GDOA 1YDSE 5HG9A 4AACA 5LWNA 2C6TA 4HVGA 4HVSA 4YLKA 4Y83A 4BF2A 4EH7A 3AC5A 4L7FA 3OF0A 4F99A 1SM2A 3N4TA 3O96A 4CZUA 4DG0E 2W1DA 3DT1A 4UYAA 3GOKA 3E63A 3MFUA 3A7GA 3NYNA 3MB6A 3MVJA 4FV0A 4ASDA 4EC8A 2JDSA 2PVLA 3ORPA 3WF9A 4FKSA 2XIKA 2BDFA 2R0IA 2X7OA 2RKUA 5C03A 3ZZEA 5IH6A 1U5RA 3BEAA 3Q2MA 4O21A 2W4OA 3BYUA 3F5PA 3FYJX 1WBTA 4C3RA 5IQEA 2YWPA 5EW9A 4EHZA 4YTIA 4G31A 2PHKA 4TNBA 3CCNA 3HRCA 4H3BA 3V5LA 4O84A 4FV1A 1JAMA 2UW5A 4P2KA 3GU4A 2VTLA 4MVFA 1YXXA 4L46A 3OC1A 4EOLA 4N0SA 1XH4A 4XOZA 2PMIA 2O63A 4IAAA 5EDPA 4CD0A 5CWZA 4PX6A 3ZOSA 5IQBA 4EWQA 3SAYA 4IQ6A 4NW5A 2RIOA 2ZOQA 1HCKA 3OCGA 5AM6A 3TT0A 4LI5A 3NAXA 3D7TA 2YIRA 4G6LA 3VUHA 4GVAA 2CKQA 2FVDA 4L8MA 5H2UA 4OTWA 4XV1A 5EDRA 3NUXA 3CXWA 3TV4A 3UP2A 2I0YA 4BCKA 5A3XA 4FA2A 3R9RA 2A19B 2YAAA 2XNNA 3ZBFA 4ZS4A 2YM6A 5FGKA 2NO3A 4UY9A 3R9OA 4A9TA 3F3UA 4EUTA 5IDNA 5LCJA 3OCSA 1SZMA 4ERKA 3LFNA 3V8TA 4BTJA 5IQDA 2HZIA 2VNWA 2AC5A 4QPSA 3DDQA 5JFSA 4LGDA 3PYYA 1K2PA 1GZKA 2AUHA 1GOLA 2LAVA 2NRUA 2NPQA 1ZYDA 3BLHA 3CLYA 5IQCA 5FM3A 2I0EA 2XKFA 3ZO4A 2WB8A 4BDCA 2C6LA 3E93A 3F3WA 3QQGA 4BDHA 1KOBA 4O7RA 3KY2A 5K4JA 2CN8A 4IVBA 5CS6A 5AUVA 2YCFA 4FIEA 1GZOA 3FHRA 2VX3A 3GVUA 4BBMA 1JLUE 3ORKA 2ZJWA 3R1NA 4FIFA 4DC2A 5FTQA 3CSVA 4JLCA 4CFFA 2V5QA 4I21A 3LJ2A 5L6OA 3H30A 3WYXA 4FGBA 5ANOA 5BQ0A 5FP6A 2VWZA 2OJIA 5JEBA 4EK6A 1TQMA 2BTSA 2J2IB 2BFYA 3CC6A 5T3QA 1FVRA 3RK5A 3ZLSA 2YLFA 3GGFA 3QQLA 2YJSA 5HICA 3AGMA 1QPJA 4RIXA 3PPKA 5F20A 2W4KA 3DZQA 2C6IA 4HYUA 4NEUA 4D0WA 5LWMA 3SG9A 4BGGA 4AS0A 1GJOA 1GAGA 4H36A 3F7ZA 5FG8A 2UZUE 3ET7A 4U97A 4A4OA 5ACBC 2QODA 4C58A 4M66A 4U0IA 2VZ6A 4A4XA 4QP4A 2IVSA 1J7UA 5AX3A 4X3FC 3ZLYA 3AG9A 2OH4A 4QP9A 3NVKI 2HWPA 3V5QA 1RW8A 4IJPA 1CM8A 3OWLA 5CEQA 4EJNA 1ZOHA 1MQ4A 4GW8A 2HXLA 2JBOA 4EQUA 3QQFA 5IQIA 3UZRA 1OVEA 4DGGA 4NK9A 4JX7A 4P4CA 2JKQA 4YPSA 4CZYB 2WMBA 4D2SA 4GFGA 3D9VA 5I9WA 5IISA 2UVZA 3N51A 4CFVA 3TNIA 3OEZA 2ZV9A 3HMMA 3EIDA 4JG7A 5JZNA 4AZTA 1XBCA 2OWBA 4IX3A 4YBKA 4FSUA 1Q5KA 3ORTA 4AAAA 3BRBA 3K3JA 5GJDA 4BDAA 4L42A 4QMYA 2IW8A 4IDTA 5BMMA 4BDKA 4IM3A 5KMLA 5KCVA 3RKBA 3CE3A 3ZC6A 1IA8A 4JDHA 4QMXA 4FTTA 4DHFA 2W96B 3QYZA 5AA9A 4XV2A 4Y73A 3R73A 2W9FB 5J95A 1MQBA 2C3JA 2OI4X 2XNPA 4DG2E 4XOYA 4F7LA 3VRYA 4O82A 3QQUA 4P90A 5EYDA 4U81A 3R7YA 5BYYA 4GYIA 1KV2A 2GU8A 4FIIA 1V0BA 4FYOA 5T6KA 5L2WA 4DFUA 2YCQA 2EB3A 3NRMA 4DCEA 2OGVA 3M1SA 4FT5A 3EKKA 5HO6A 2GTNA 1AGWA 4FTJA 4CFXA 4BDGA 5DHJA 4D2PA 4YJRA 4K18A 2YIXA 3LMHA 1PF8A 3AMYA 3NS9A 1IAHA 3V01A 5I9UA 1IG1A 4IX5A 3VUIA 4LRJA 3KA0A 4BGQA 5TF9A 4QPAA 1FGKA 3NZ0A 5A4EA 3QA0A 4NFMA 2OIBA 3MSSA 3F5XA 5HBEA 5FXQA 4CGAA 1CKJA 3ZO3A 2QO9A 4KIPA 4HGSA 2R3RA 1OECA 2X8EA 2X2LA 5IA1A 3DBDA 5FEEA 2XK8A 3ZSIA 3EN5A 5GNKA 4QD6A 4AZVA 1P5EA 3OT3A 5I3RA 2GS7A 3ETAA 2PSQA 3NAYA 2BZHB 3CGFA 4EBVA 5J7BA 5LXMA 2HZ0A 5H8EA 4ZLZA 2Z60A 3MJ2A 3Q4TA 3P86A 4WO5A 3TNQB 3KU2A 4YNOA 3C7QA 5EHYA 5ACKA 3VS3A 5A4LA 3C0IA 4S34A 2ACXA 2X2KA 4IWPA 4XJ0A 5AR4A 5C9CA 3EFKA 3ZCLA 4CFNA 3SOCA 1IR3A 2FGIA 2JAMA 3CY2A 1FVTA 3ACKA 4LUDA 3AMBA 4CRLA 1M14A 5ETAA 2YACA 3LM5A 4NU1A 1BL6A 5LVOA 1J91A 3MDYA 4JDIA 1WBPA 4MXXA 4D1SA 5KZ0A 4AN3A 4LL5A 2YJRA 4BDJA 3QZHA 3W1FA 3PP1A 4FZFB 5CNNA 3U8WA 4UMQA 5EM8A 3BLRA 3WOWA 5C8NA 2CKOA 3GEQA 2Y4IC 4LOPA 2CKPA 5BNJA 3I0OA 5BUJA 1Q97A 3NX8A 4FTNA 4NSTA 4KD1A 1QPDA 5F95A 4FKWA 4B9DA 3WZUA 4C4IA 3E8EA 5M08A 2XJ0A 3SLSA 4I3ZA 2UW4A 4I6HA 3WF6A 2XIXA 4GS6A 4J8NA 1CDKA 3KQ7A 2BKKA 3KMWA 3QHRA 4K6ZA 4ITHA 1XBAA 3QD3A 4YSMA 3H9FA 3BBWA 3F2RA 1M2PA 2PMNX 5GZ8A 3GFEA 3P78A 2YM4A 5E4HA 4EH2A 1P4OA 4LV8A 3O8TA 4MBJA 4C34A 3HZTA 4WRSA 2W5AA 1R78A 3BV3A 3HV6A 2R3QA 3KCFA 3ORXA 4NKAA 3WF7A 4BCQA 4EYJA 1YW2A 3IONA 4DEDA 5CAPA 3R7EA 3TCPA 5DIAA 2C68A 3O7LD 3D7TB 1Y6AA 2X9EA 3F88A 5HIDA 1PKGA 4UBAA 3V6SA 3OUKA 4FG8A 2YABA 3MBLA 1XQZA 1ZYJA 3OOGA 1KE7A 2UZDA 1ZXEA 4ALVA 3A60A 4EWHA 5IQFA 5CNOA 1OUKA 1YI6A 4WBBB 4YZ9A 3M42A 2P4IA 3RZBA 3TIYA 3EZRA 4QP3A 3R9HA 4JBQA 4O86A 3OTVA 1B39A 5AIKA 5AAGA 3L9PA 5DT3A 4B99A 4ZXTA 5IQHA 1H0WA 5E1EA 4HYSA 4IZ7A 3NUSA 1XH7A 4ZTQA 1BYGA 4K33A 4WUAA 3M11A 2YM5A 1KSWA 4O27B 4F6WA 4WG4A 3LZBA 1FGIA 2HK5A 4I5CA 2CGWA 1PHKA 3WILA 4EOSA 2HZNA 3UIUA 2C3IB 1U59A 3QHWA 4O2ZA 4S2ZA 5HE3A 3ORIA 3R02A 3HECA 3MJ1A 4J1RA 4X7QA 4FZAB 5D10A 3TNWA 5CSHA 5AUYA 3HVCA 4YZDA 3ORMA 3K54A 3FC2A 5F94A 4MQ2A 2WXVA 4WUNA 1R3CA 3FPQA 4LOQA 5CQUA 4F4PA 1TVOA 2BALA 2C6MA 2YDIA 2V7OA 4J8MA 4XP3A 3VW8A 2IW6A 3IGGA 3VUTA 2J9MA 3FWQA 2DQ7X 4PNIA 2RFSA 2XB7A 3CQEA 2JAVA 4FSNA 1M2RA 1H25A 4JS8A 3E62A 4FEVA 1XH9A 4YR8A 2OXXA 2ETMA 3R22A 5E8ZA 5HLPA 4FKQA 5JGAA 3ROYA 4RIXB 4CG9A 4E5BA 3RP9A 2B55A 3A61A 3FV8A 3QGYA 2XP2A 3UC4A 3ZS5A 3O0GA 5JRSA 1W8CA 5C4KA 3SGCA 3QX2A 1WFCA 4TZRA 5M4UA 2XKEA 4YZBA 5HBJA 3I5ZA 4BY9E 2JC6A 2OJFE 3Q5ZA 5H8BA 4EOMA 2GFCA 3FXWA 5AP6A 3TIZA 3BPRA 4EZ7A 4XG9A 3VF9A 1WCCA 4D4YA 5J9YA 3I79A 2YN8A 3HMNA 3T8OA 3LLAA 3DU8A 3PXKA 4TYHA 4BKZA 1Q3WA 1YQJA 2WMAA 5KMNA 1XBBA 5FEQA 5DEYA 4RZWA 4U6RA 4R1YA 4FNYA 5DN3A 4EH8A 5IEYA 1Y91A 1GZNA 4V05A 4IB0A 4L3JA 3RWPA 4D2TA 3FKOA 4ZLOA 5GIPE 5LMBA 2OJJA 3QLFA 3BHVA 5CT0A 4NWMA 4EEVA 4KBKA 3DK7A 4ACDA 1DI9A 4M12A 3C1XA 3DKFA 4FKGA 4ITJA 4QP8A 5ITAA 5EK7A 3P79A 1NVSA 2B54A 3F3ZA 4GU6A 2BAQA 5DFPA 1JSTA 4EI4A 3CP9A 4B8MA 2RSVA 4HNFA 4ZJIA 2C5VA 1H26A 3P7BA 4GU9A 4LYNA 3BU6A 4TYJA 4R1VA 1V0OA 4FI1A 5CZIA 2BKZA 3EL7A 3FI2A 5EDQA 5EKOA 4PDPA 5H8GA 3PY3A 4Q2AA 3VS1A 5HOAA 5JGDA 2WMQA 1ZARA 2WMVA 4JRVA 2CDZA 3QKMA 4F6SA 4OTGA 5FXSA 3ZRLA 5I9VA 2BZKB 3UVRA 4YJUA 4CQEA 5AFVA 4E6QA 3ZLWA 3R30A 2YDKA 3R8UA 3T3VA 4AE9A 3F7WA 4GMYA 4O0UA 3OXZA 3IW5A 2PMOX 3RTPA 3HA8A 3NUPA 3L8XA 1CTPE 1UU3A 4UV0A 5HESA 1H1PA 2E9NA 1R0PA 1APME 4NFNA 4EKKA 4ANNA 1RQQA 1ZMWA 2EXMA 1LEWA 3FMJA 4OT6A 3TL8A 4JIAA 3VULA 2GQRA 2JEDA 4I1ZA 3C9WA 4RC3A 4AW0A 4H1MA 1H1QA 3W10A 5LVMA 3QYWA 2VUWA 4RIYB 2WOTA 4EQCA 3NNUA 4WNOA 1JBPE 1YHWA 3FE3A 4FTRA 5CF6A 1UU9A 3FKLA 3ORLA 5HG8A 4EH4A 1UWHA 4I0RA 2IVTA 3ACJA 3NUNA 5L4QA 3MH3A 3QL8A 2ZB1A 4Y95A 4FEWA 3NW6A 4FR4A 3FL5A 5IF1A 3IOPA 2HZ4A 2R3PA 2YHVA 4AGUA 3ZH8A 2CKEA 4MTAA 4R3CA 5IA2A 3AD4A 3DTWA 3QUPA 4EOOA 3HV3A 3JVSA 4ID7A 3ZBXA 2PYWA 3FLZA 3FY2A 1I44A 4O2PA 2W9ZB 1JSUA 1GNGA 2JIUA 3KN5A 3W18A 3SG8A 4B8LA 4UX9A 4ZMEA 4S31A 3VBXA 1F0QA 5A9UA 5HU3A 1R1WA 4APPA 3ZUVA 3LQ5A 5J87A 4BB4A 4JNWA 2VWXA 5IA0A 3TNPC 4UWBA 1KE6A 3CJGA 3AC4A 4GCJA 3EMGA 2JFMA 3R28A 4K2RA 3VJOA 3I81A 4C4FA 5HD7A 3NWWA 3UO5A 3FEGA 3DPKA 1ZYSA 5ANEA 4HNIA 2HW7A 2YERA 4FSWA 4PV0A 2BRGA 4TTHB 3TTIA 2QOIA 3PUPA 5J5TA 4UYNA 2IZSA 4IH8A 2VTRA 5DVRA 1YDTE 4DFZE 2WZJA 2XRUA 4AA5A 4GH2A 1HCLA 5K4IA 5KZIA 4G5PA 2XM9A 3U55A 4Y72A 1PY5A 2QKWB 3FZ1A 4MEDA 4ZTRA 5CVHA 3UNKA 4FT9A 1OUYA 5M06A 1BI7A 2B9JA 3V5JA 3BQRA 1Y6BA 3POOA 4GFMA 3BEGA 3EHAA 4J98A 2BPMA 4D5HA 4FV6A 4NT4A 3QAME 3AC1A 2QURA 4FVRA 5CI7A 3WF8A 4TWOA 4K1BA 5EG3A 3ZUTA 4W8EA 4XYFA 2XZSA 2PK9A 3O71A 5TE0A 3U87A 4D4VA 2C3KA 2X8IA 3PY0A 4ZSEA 3VHEA 5C8KA 4FV3A 3DXQA 5HO7A 3ID6C 1PRYA 1UNHA 2YM3A 4QQ5A 5IG1A 3EQRA 4FSYA 5CASA 2ITNA 3LCTA 1J7IA 5L6WL 1GIHA 4NCTC 1VYZA 5BPYA 3AT3A 3QQHA 4YNEA 4O0XA 3SW7A 2NNWB 4MCVA 3HEGA 2EU9A 4IZYA 2I7QA 4A4LA 4AGCA 3CPCA 4JQ7A 3FMDA 4BI2A 5HLNA 4MD9E 1OZ1A 4YJOA 4LM5A 4X21A 3H4JA 1Q99A 3B8QA 3EFLA 3KF7A 2OG8A 5IMEA 5CAVA 5EHOA 2O8YA 4PF4A 4NKSA 5CENA 4IZAA 5JRQA 5IQGA 2P2HA 2G2FA 4BICA 3VN9A 2R3HA 4I0SA 5BVNA 2WTWA 5TO8A 4PMSA 4D5KA 3OZ6A 3H9RA 4R6VA 5AV3A 3K3IA 4IAYA 2YISA 3KK8A 5JGBA 3EWHA 4M67A 4U41A 1ZLTA 2W17A 4KIKA 4JIKA 4S30A 2J4ZA 2R3GA 2ZMCA 4RX8A 3BQCA 5EW3A 4AW5A 5A6OA 2VRXA 2ZAZA 3LFCA 2XNBA 2UZTA 4Y8DA 3GBZA 1OKWA 4YZNA 3RMFA 3PA3A 4AGWA 4CYJA 5FP5A 2YIYA 4G34A 2UW7A 2XH5A 3M2WA 5AEPA 2PUPA 4I23A 3A7FA 3QUEA 1NW1A 4MAOA 4GKHA 4DTBA 4LG4A 2VN9A 4BZDA 3JVRA 3UYSA 3DCVA 3ZMMA 2JITA 3KB7A 3LJ1A 1DM2A 4JX3A 4W9WA 3UODA 2XNMA 3CD8A 3BYSA 3WBLA 2JLDA 4F1OA 2YIWA 2F7ZE 4J97A 3L9NA 1NVRA 4HCVA 2XBAA 2VTPA 4I4FA 4XEYA 5HNBA 5HX8A 3E7VA 4CLJA 1RE8A 5AMNA 3VBYA 3EN9A 2QO2A 3GCUA 3OEFX 4FK6A 5BYZA 3IW8A 4IAKA 3PVGA 5HE1A 2WFYA 1WBVA 4NTTA 4NM7A 4IAIA 3V6RA 1M17A 3RCDA 3MH0A 4G2FA 3QGWA 4F9BA 2BTRA 3E8NA 4NIFA 5CVFA 3WZDA 5FLFA 3U6HA 3PSCA 4AA4A 4KUJA 4RJ6A 4DGLC 4GG5A 1BUHA 2UZVA 4MXAA 4OTDA 3PVWA 5HNIX 5JH6A 4ORKA 2OXDA 3FMHA 3UO4A 4BL1A 2C6EA 2W05A 4FG7A 4RFMA 4AFEA 5CQWA 3AQVA 4U8ZA 1Q62A 5AADA 3DKCA 3MESA 3OUNB 4R5YA 2GMXA 2JIIA 3A62A 4AF3A 1Q4LA 5A54A 2HXQA 4G6OA 4TN6A 4EK3A 3QZGA 5HQ0A 4QNYA 2WU7A 2VTNA 4RC2A 4EHEA 3PIYA 4QT1A 4XG8A 4AZFA 3HNGA 4E4LA 3F2NA 5L2SA 3GP0A 4I24A 3SX9A 4P5QA 5EM6A 3AMAA 4QYFA 5AR5A 2FSOX 4NM3A 3UG2A 3VBVA 1OBDA 5F4NA 3FI8A 4E93A 3AT2A 3UBDA 4PL3A 4LFIA 4UB7A 3VIDA 3CPBA 4DBNA 2F7XE 4FTAA 2ITVA 4I4EA 4KIOA 5FBNC 4I92A 3RBWA 3FAAA 2WQBA 2ESMA 3PA4A 2WMWA 1G3NA 5GJGA 1ZZ2A 4RIOA 2ZV8A 4U45A 5ETIA 5HKMA 1XH5A 2XEZA 1DAWA 4QP2A 3KRWA 3OP5A 3SW4A 3OROA 2HELA 3N9XA 3VVHA 5EYKA 4O7VA 3UIBA 3JS2A 4BDFA 2Y6OA 3Q3BA 4KKHA 3UOHA 3CKXA 4FSZA 3ZO2A 4RJ5A 5LVLA 4YTFA 2EXEA 4N6YA 5J7HA 1KV1A 2O3PA 2R3NA 5E7RA 3W2QA 5AWMA 3D2KA 4BIDA 3EN4A 5HZNA 4F0IA 1FVVA 1H0VA 5CU4A 3LCSA 4O81A 2PZ5A 3PE1A 2QOBA 5D7AA 5IU2A 5GIOE 2C1BA 2WMRA 3EQHA 3OW3A 4B6LA 2PVYA 4D55A 4GK3A 3FZOA 2P3GX 1VYWA 4XX9A 2QCSA 5KMKA 4H3PA 1OPKA 3CIKA 3OG7A 3CR0A 2EB2A 4JQEA 2BRMA 3VUGA 4GSBA 3I0QA 3V5PA 5CALA 5IH4A 3PXFA 4IVAA 2LGCA 3IKAA 1GIIA 2IG7A 4FF8A 5DLSA 3G0EA 1SMHA 3ALOA 4GYGA 3FLWA 3IG7A 3TDVA 4YU2A 2X2MA 5KO1A 4KBAA 1CKPA 3C4CA 2GFSA 5AP1A 2X39A 4RQKA 4ALWA 4BCIA 3E7OA 3Q2JA 2G2HA 3RK7A 1WBOA 3ZC5A 4GVJA 4F64A 1Z5MA 4ANLA 2F2CB 1OIRA 4C38A 1OIYA 1BI8A 4XRLA 3V8SA 1RDQE 3A7JA 5IQAA 2GQGA 3OY1A 4M84A 2PUUA 3OW4A 3F2AA 3ORZA 4FT3A 2W1FA 3QU0A 4IWOA 4ANQA 3VS7A 5A4TA 3BGQA 2J51A 2VTOA 1M52A 3FPMA 3Q5IA 3QWKA 5DE2A 5TKDA 4MKCA 1LPUA 3W32A 2ZDUA 3WARA 4AZSA 4BWXA 4DAWA 2FB8A 2JFLA 5I9ZA 4C4GA 4ENXA 5HTIA 3LXKA 3HV4A 4MYGA 3VAPA 2I6LA 4E4XA 5GZAA 2O64A 3O2MA 4Z7HA 5K5XA 2BIKB 2R7BA 4FV9A 1YXSA 3MIAA 5LMAA 2X0GA 3H3CA 4I6FA 3V5WA 2DWBA 3NUAA 5DR2A 3IQ7A 3VQHA 3VW6A 3S4QA 4KB8A 2OFUA 3F69A 4N4SA 4D2RA 2WTDA 5CSPA 3NSZA 1QCFA 4A9UA 2HY81 3F66A 3ZSGA 3W2PA 5K9IA 4GUBA 1OKYA 5A14A 4FKLA 4UXQA 4Y46A 4YO4A 3QTXA 2JKOA 5FD2A 4MQ1A 3WZJA 4I20A 5CLPA 3N4VA 3GCVA 3CEKA 4XG6A 1B38A 5CU0A 3PZEA 2QNJA 2WTIA 3P9JA 3HV5A 4C02A 2Q0NA 4RA5A 3I7BA 4FSMA 1WMKA 2G2IA 4JVGA 1SVHA 3G9LX 3O50A 4QQCA 4RMZA 2OKRA 3PXRA 3VO3A 4RVMA 4U43A 3ULIA 4RZVA 2OXYA 5CF5A 2VTAA 2VTQA 2CLQA 4JXFA 4A9RA 3NR9A 1PXLA 4F1TA 3G6HA 3PSBA 3I4BA 2HW6A 4E6AA 5FTGA 3SV0A 4E7WA 1YOLA 3KRRA 2VAGA 4IVDA 5C01A 3CBLA 3G6GA 5HVYA 1LEZA 1YOJA 4WOVA 4ZP5A 4IADA 3PSDA 1CSNA 2RGPA 3QTUA 2IW9A 1LP4A 4KRCA 4BIEA 1ERKA 4RJ7A 5HIEA 4QRCA 4EH9A 4BFMA 4FK3A 4XCUA 3FBVA 3MH1A 4FSQA 4IAFA 4AP7A 4QP7A 2OH0E 2BZIB 3F5GA 2QLQA 5JFVA 3LFDA 3SOAA 1E1VA 4JRNA 5EKNA 4FE2A 3E8CA 3ZM4A 2IZTA 2XIYA 4IM2A 4KIKB 3R8VA 4RWKA 2CCHA 3ODYX 4DFXE 3SC1A 3CY3A 4Y5HA 5A4CA 4GIIA 1WVWA 4W4VA 4B7TA 5BUIA 4X3JA 4O7LA 2QC6A 4Q5HA 4BR3A 2PVMA 2OIDA 3BZ3A 5AUTA 3F3TA 3RAIA 2WTJA 3R71A 3ERKA 4TYIA 1ZY5A 3QQKA 2ETRA 4X3FA 2R3FA 2WTCA 4IDVA 2UVYA 4KA3A 5EI8A 2XNOA 4EK4A 2HENA 3LIJA 4NM5A 1VZOA 3OT8A 3UO6A 3GT8A 4ACMA 1WBNA 1BL7A 1PXOA 4EH3A 4PDYA 4RT7A 3KCKA 5HI2A 4O0VA 4JDJA 3IGOA 2WKMA 3PXQA 4QOXA 2RG5A 2GNHA 4RIYA 5AP4A 2RFNA 3QTZA 3JY9A 1SVEA 2QQ7A 3L9MA 1H27A 4CZTA 5HVKA 3KK9A 2CHLA 3BGZA 2FUMA 4NIFB 4DG3E 4F6UA 4GT3A 3MY5A 4XP0A 3HKOA 2CNQA 2ZB0A 3W8LA 4CMUA 4A9YA 2BZJA 4WG5A 1PMNA 2H96A 3AT4A 3C4WA 5E9EA 4YJSA 2PUIA 2OW3A 3PZHA 2PUNA 4PY1A 4XV9A 2JDOA 3DB8A 4GG7A 5AJQA 3IPHA 3MTFA 3DK3A 3MPTA 3HX4A 5IA5A 4UZDA 5BVKA 3KRLA 4U9AA 4F09A 2ITWA 3NLBA 2H6DA 4QP1A 2QOKA 4C57A 4CT2A 5AAEA 1OBGA 4RBLA 3UZTA 4YHJA 3ZDUA 4ACCA 5AM7A 4D0XA 4QMOA 2JIVA 4RJ4A 2QU5A 4L6QA 4L9IA 1GZ8A 2JD5A 4A06A 5DT4A 2HOGA 4F7JA 2VO0A 3IDBA 4FTUA 4KIQA 4M15A 4C8BA 3PXZA 4FTLA 4KSPA 5CEIA 4ZZMA 5HORA 1YOMA 4IB1A 3O17A 4ZY6A 4FEUA 3DTCA 4I94A 5I5ZA 3NGAA 2YITA 2ONLC 4LOOA 1W84A 2R3KA 4PL4A 3L8VA 3N4UA 5CANA 2WEIA 4GRBA 4MWHA 2PWLA 3EOCA 3COHA 3UMXA 3ULZA 2WQEA 3Q9XA 4IXPA 4R3RA 5JFXA 2BRNA 4LRMA 4OAUC 4RRVA 2A1AB 5LCKA 4GK2A 3ORNA 4CFUA 3DDPA 4O7SA 3DQWA 2XJ2A 4EQMA 4TWPA 4HZRA 4PWNA 4I41A 4USEA 4CFMA 3RNYA 4LMUA 2WMTA 5KMMA 3C4ZA 4GUEA 4I6BA 5CF8A 2W0JA 4QMQA 2V7AA 4ZJVA 3TV7A 2NP8A 4E20A 2X7GA 3FY0A 4MWIA 2R3OA 2F4JA 3OXTA 2FSLX 3OCBA 2ZV2A 1U46A 4P7EA 4YUQA 5BYLA 4U5JA 4DFYA 1E1XA 5BVOA 4USDA 3QWJA 1SVGA 3CQWA 5CXHA 3Q9YA 3SDJA 5E1SA 3VS6A 2B9IA 2O0UA 5CEMA 4ZS0A 2WIHA 3QCSA 4RIWA 3RI1A 4R7BA 3D5VA 3G51A 3R7IA 4JJRA 4G1WA 1OM1A 3BHYA 4RSSA 4I6QA 4QPMA 4FIHA 3VRZA 1U4DA 3GQLA 4ZEGA 3PDTA 4YHTA 3JPVA 2YM8A 1BX6A 2E2BA 2OJGA 3A7IA 2PZYA 2GCDA 3R9DA 3AOXA 2P0CA 4FUXA 2FSMX 4FKOA 4HVHA 3VNTA 3PRFA 4PPBA 2J0IA 4LRKA 4N70A 2XEYA 5BX0A 4CT1A 4O7WA 4TPTA 3R8LA 4WG3A 3V04A 2PVFA 4MHAA 3QXPA 5LVNA 3R6XA 2SRCA 3PIZA 4XUFA 2W06A 5M09A 2QOCA 3L1SA 3PJ1A 2Z02A 5GINE 1KOAA 4YC8A 3KKVA 5AUUA 3RVGA 5HTCA 4L52A 4TKSA 2J5FA 2JKKA 1FINA 5FBOA 3VQUA 2UZBA 2ZDTA 3BLQA 4M0ZA 5AP5A 3W8QA 4BCMA 3ZEPA 4RWIA 3A99A 2VGOA 4I93A 3LMIA 3P23A 4WNKA 4PTEA 2ZVAA 2E9OA 3PE2A 2C30A 3IW6A 3QX4A 4F0FA 2WNTA 5DI1A 3SHEA 3P7AA 3W2CA 2W1CA 2JKMA 3KXZA 3PXYA 2IJMA 4U3YA 2G15A 3G90X 5G6VA 4L3PA 2WMUA 2J7TA 4XBUA 2IPXA 1H24A 5DR9A 4JOAA 4L7SA 4YJNA 3TZ9A 4WSYA 4HPUE 3DAJA 3DLZA 4AW2A 2XCHA 2R64A 2VTIA 1Q3DA 2J0LA 2C6KA 2UZNA 4FSRA 3R2YA 4IC7A 3GUBA 3UMWA 2QI8A 3V3VA 5LOHA 3NUUA 3QKKA 3BIZA 3SRVA 2C1AA 4HCTA 3P0MA 2UW0A 3DV3A 3NIZA 5K5NA 4LQMA 5HO8A 3BV2A 2PU8A 2XNGA 3IO7A 2REIA 4FKIA 5CX9A 4ASZA 4EK5A 3UYTA 3JY0A 5KNJA 3RGFA 1G5SA 4C36A 3KFAA 1J3HA 4G17A 2EVAA 3TJDA 4QYGA 3FZRA 4O0SA 3WYYA 3D0EA 4BN1A 4TYEA 2BCJA 4OW8A 1UKHA 2XIZA 1S9JA 3KRXA 2I40A 4AU8A 3C4XA 2ZYBA 3B8RA 3DB6A 1FMKA 2AYPA 4FOBA 5HEZA 3TACA 1KE8A 2GS2A 3R1YA 2VTJA 3OCTA 4O91A 3FHIA 1OPLA 1P14A 5KHXA 5DEWA 4ZAUA 4YGAA 3KXHA 4R7IA 1ZMUA 1PXIA 3FZPA 4FODA 4M97A 4MBIA 4AN9A 2QOOA 3D94A 3U9CA 3U54A 2ZM1A 4FV7A 4X3FB 4IFCA 4TRLA 5L6PA 3Q52A 3UP7A 2OF4A 3BE2A 3P5KA 5IA4A 1ZYLA 2UVXA 2X4FA 4ANMA 2XK6A 4BWPA 4BYJA 1Y8YA 4ENYA 3HUBA 2CNUA 2GNFA 1HOWA 3UE4A 4C7TA 1YWRA 4O1PA 2ZMDA 3QTRA 4QYEA 4EKLA 3SXSA 2GHMA 2C3LA 1JWHA 4DLIA 4OBPA 5L8LA 3ZHPC 2BROA 3W2RA 4C4HA 2YIQA 3D7ZA 3LPBA 3W2SA 4RWJA 3VWAA 4E6CA 5H9BA 4D2VA 3T9IA 1VR2A 4FL3A 5A46A 3FKNA 1Q41A 4RX7A 2QOFA 3AC2A 4S32A 3POZA 5AP0A 4EONA 5B2LA 3I7CA 3AC3A 3QCXA 4BTKA 4DT9A 4MBLA 3KXGA 1DI8A 4K77A 2XA4A 3V51A 4LGHA 3QCYA 3BWJA 4I5HA 1FOTA 3IW7A 5C4LA 5F1ZA 3DNDA 4YJPA 2QOLA 3MPMA 3NNXA 4II5A 4W4WA 4FVQA 3GB2A 4F9CA 4K0YA 3R7VA 3HMOA 3BU3A 2FH9A 2BHEA 2W1GA 3Q4ZA 2OSCA 4RVKA 5AR3A 4FT0A 4DH8A 2I0VA 3UPZA 4OTQA 2Z7SA 4YSJA 3Q53A 2G9XA 3WE4A 4QMWA 2PMLX 1X8BA 2HCKA 3MFSA 3SXFA 2WPAA 3WI6A 4AFJA 1JKSA 4E3CA 2QONA 4NUSA 3JXWA 3RZFA 2XIRA 3PVBA 2C0OA 1URWA 3HGKA 4O7YA 4TW9A 4ZLYA 3RINA 4HJOA 5C1QB 4FV8A 2UW6A 3P4KA 1U54A 5ANGA 4C4JA 3UOLA 5DT0A 2QU6A 5HCZA 5K0XA 3UIMA 4PP9A 5I4NA 4DITA 2ERZE 3GU6A 3MA3A 3OS3A 1UNGA 4WBOA 2C4GA 3DQXA 2DS1A 4GIHA 4DGMA 4X2NA 2FSTX 5C27A 1YXTA 4FKUA 3GU5A 3VS0A 4L67A 5LMKC 2PVRA 2ITOA 4BHZA 5IEXA 5KMIA 3COKA 1URCA 4ZSJA 5EFQA 4XS2A 4YJVA 1EH4A 5E8VA 4CCBA 2Z7LA 5L2IA 2XK7A 2PPQA 2VGPA 4MF0A 3OBJA 3R7UA 4H39A 4AGDA 5M57A 3IDCA 3BBTB 5DNRA 3O8PA 1UV5A 3VBQA 4D4RA 1ND4A 4LL0A 3PWDA 1Y8GA 3PJ2A 3Q9ZA 2QHMA 1G8AA 1CMKE 4FG9A 4R3PA 2GHLA 2VX0A 1AD5A 1Q8TA 3KF4A 5L8JA 1F3MC 3TKHA 5HHWA 4QMPA 2EXCX 3LCKA 4RIWB 2WO6A 3UOJA 4H05A 4DN5A 4OT5A 4XG2A 3LFBA 4O22A 4IW0A 2QD9A 1B6CB 4M69A 4PUZA 5CI6A 5CTPA 4O7TA 2UV2A 4L00A 2Y4IB 3P7CA 4WHZA 3QRTA 5FXRA 2YZAA 4C2WA 4RA4A 3TG1A 1J1BA 3ZU7A 4M0YA 2UW9A 4X0MA 3H0YA 4KSQA 5EYMA 3FDNA 2C0TA 2X6DA 3KGAA 4EOIA 4ANSA 4S33A 4GK4A 3UPXA 4U3ZA 1OIQA 1YRPA 4RX5A 4G9CA 3MA6A 4RJ8A 2OLCA 3DFAA 4MH7A 5AUWA 3OWKA 3D15A 1H00A 2W1EA 2P2IA 4GT5A 1JPAA 2X1NA 4R7HA 5EI6A 5M4IA 3DJ7A 2F2UA 3QRJA 2GS6A 3QTIA 4ONAA 1Q61A 4DEEA 3HAMA 4O7NA 4RFYA 1XWSA 4EHGA 3S95A 3TZ7A 2VWIA 2PE0A 4JBPA 4ANOA 3R8MA 1Z57A 5IUIA 4RX9A 4E73A 5HG5A 3WIGA 3EFJA 3ANRA 5M07A 4FV4A 4BKYA 4PMTA 2WAJA 2BDWA 4NCTA 1ZY4A 2WQMA 3QA8A 3EKNA 3C4EA 3MV5A 4F0GA 5F9EA 3MGYA 4KS7A 4AA0A 2EWAA 3DXNA 5CU3A 4Z9LA 3AGLA 2OF2A 1ZOGA 4MXZA 2CLXA 1OI9A 2J0JA 2WU6A 3QD2B 2ITXA 3PVUA 5AUXA 2H8HA 5E90A 4V0GA 4DINA 1MP8A 1TQIA 5TOZA 2OZOA 2W99B 1H1RA 1P4FA 3DZOA 4DEBA 3JR1A 5CAUA 3TV6A 3FSFA 3PLAE 2QG7A 2W1IA 2JDRA 3K5UA 3DS6A 4QTDA 3SRVB 4R77A 3F3VA 4XV3A 3ZYAA 4C3FA 5JT2A 3ZXTA 4FNZA 2A0CX 5B0XA 3ODZX 2ITQA 4H1JA 1H28A 3NMUF 5CT7A 4PDOA 5DRDA 3UOKA 2PVHA 3WZEA 3DFCB 2WGJA 2VWUA 5H3QA 4MX9A 3H0ZA 2VWVA 4HYHA 4LUEA 5DBXA 5KUPA 4MF1A 5LARA 3O7LB 2VO6A 5E8TA 2ZM4A 3G9NA 4IX6A 3RHKA 1VEBA 3ATTA 5D7VA 2QOQA 3GQIA 2WMXA 4DFNA 3FMKA 2XRWA 5J5SA 3KREA 1OL6A 5HE0A 3VS5A 4BYIA 4AX8A 2R3IA 3UGCA 3EQFA 3VF8A 2XNEA 5HD4A 4FUYA 3VBTA 2B1PA 3ALNA 2E9VA 2OK1A 2F49A 2CGXA 3CQUA 2BRHA 3EQBA 4OTFA 3BELA 5AR2A 4QMVA 5HIBA 4KABA 1MRVA 3ELJA 2ZM3A 4CNHA 1BLXA 5DMZA 4OTHA 3Q96A 3HDMA 5AV0A 5FWKK 3WF5A 4USFA 2JDVA 4G16A 3IK3A 1VJYA 3QC4A 2VO7A 1Y57A 3F5UA 4WNPA 4F7SA 3UDBA 3FZTA 3Q6WA 4YBJA 4DTAA 2UW8A 3NPCA 4K8AA 3CD3A 3DKOA 4L43A 3DAEA 2P55A 4BBFA 4C0TA 5FUTA 4LGGA 4F70A 4D1ZA 4U44A 4EOJA 1UU7A 4JBOA 4ZZNA 3TM0A 2HIWA 4V01A 4BCGA 2C6DA 4GL9A 1YKRA 3FUPA 3QTWA 3GU8A 2QR7A 3OWJA 5AAFA 3ZFYA 5FDPA 4RLLA 4J96A 3R8ZA 3KC3A 5DG5A 4UALA 3ZEWA 3TUDA 1V0PA 3BX5A 4A9SA 3Q60A 2VTHA 5CU6A 2G01A 3QFVA 4FTOA 3C5IA 4H3QA 3ZUUA 4XG3A 4AOIA 4BCOA 4UWCA 4O0WA 3ENMA 3FMMA 3HL7A 1ATPE 3ROCA 4C35A 2I0HA 2YA9A 4KKGA 3GXLA 4NJDA 4ZSAA 3EQDA 1YI3A 3I60A 1UA2A 3MY1A 4AT3A 3HMPA 3HYHA 5JSMA 5FQDC 3A4PA 2GSFA 2Y0AA 4JQ8A 3NYXA 3TI1A 4L44A 3VHKA 2C69A 4O0YA 3COIA 2BUJA 3HV7A 5TR6A 3D5UA 5CXZA 2F7EE 3EQIA 3R8PA 2C5XA 4O96A 4ERWA 2R2PA 2C5YA 5HLWA 2G1TA 4XLIA 3NVMB 3IW4A 4FYNA 4HCUA 3SD0A 3W55A 4FZ7A 5HX6A 2J50A 1ZYCA 3CTJA 3UQGA 2HWOA 3EYHA 3TKUA 3RCJA 1PXPA 3KULA 4AOTA 4EH5A 2BHHA 2PVJA 3OFMA 5J9LA 4FMQA 4D58A 2WTKC 1NA7A 4MNEA 3EN7A 1ZRZA 3WIKA 5BVDA 1PXKA 3HLLA 4KS8A 3RPSA 5CU2A 1U54B 2V0DA 3BU5A 3P08A 5GJFA 3ZLXA 4B4LA 4KAOA 5E8SA 4X2GA 2B53A 4AE6A 3BHTA 2UZLA 3MY0A 3IS5A 4BRXA 4FVPA 4MXOA 4CKIA 4DLJA 3FXZA 4OBOA 3BYMA 5L8KA 4IMYA 5HE2A 4F9AA 2W7XA 4NYEA 3GC0A 3E5AA 5E8XA 3FC1X 1IAJA 3SQQA 3QCQA 3EN6A 3MFTA 1H07A 2IZRA 4CCUA 4RFZA 5B2MA 5JFWA 3Q4UA 3BKBA 4WA9A 5BMSA 4X2KA 3AD6A 1OITA 3KL8A 3L8SA 2XYNA 3UJGA 4YTHA 2PY3A 2XK9A 3UG1A 5M56A 2HYYA 1W7HA 3VUMA 3FI3A 3RPOA 3F6XA 5KMJA 4DH5A 4G5JA 2B7AA 4J95A 3U4UA 3ZO1A 3ZZWA 4E8AA 4BDEA 1QPCA 5CF4A 3BI6A 5J9ZA 3QQJA 4XG7A 4YP8A 1UU8A 4FSTA 4PRJA 4RPVA 4XP2A 3LXLA 4AUAA 1QPEA 4ZY5A 1FMOE 3A8XA 3I6WA 5KX8A 4L68A 1O6LA 4BHNA 4FZDB 1JSVA 5KBQA 4FICA 3R1QA 3R01A 2ITPA 4CG8A 1IRKA 1O6YA 4M69B 5ANIA 4G3FA 3HRBA 3RJCA 4YJTA 4C33A 4D9UA 3PJ3A 1BMKA 3E64A 4O7ZA 5FM2A 4MXCA 4Z3VA 4QMUA 2ITTA 2IZUA 4DEIA 2YEXA 4EUUA 2DUVA 2GPHA 3TUBA 5E8WA 3R0TA 1Q8UA 3QTQA 5DH3A 2BMCA 5CVGA 2WELA 2BVAA 2C5NA 2J0KA 3OTUA 5AIRA 3SXRA 4JI9A 2BIYA 5CAQA 3I1AA 3ANQA 5I9XA 4ZY4A 3FQHA 5CSVA 2F9GA 4HGTA 4X2FA 3UTOA 4W4XA 4BI1A 2X6EA 1O6KA 2E9PA 5M4CA 3NCZA 5AR8A 4YLJA 2UZWE 3Q9WA 2YLEA 3DKGA 1JQHA 4FOCA 4CMTA 3RALA 1JOWB 1T45A 5CYIA 2BR1A 1LR4A 3R83A 3MW1A 4IC8A 2XM8A 3GENA 5I3OA 1ZAOA 5HCYA 5AP2A 4M8TA 2X4ZA 1Q8ZA 2PE2A 1WBSA 2XBJA 4QMSA 3HDNA 3DLSA 1UVRA 3LFQA 3NIEA 4XMOA 5JMSA 4BZNA 3H9OA 2XUUA 1KWPA 2XKCA 4R5SA 4U7ZA 4MXYA 3VUKA 5IZFA 5TT7A 4DYMA 1WAKA 5AV2A 4L45A 1JNKA 3UIXA 4EJ7A 1A06A 5DA3A 2Z7RA 4YHFA 3EQGA 1J7LA 5KKRC 4AT5A 1F5QA 3ZFXA 3TZMA 2PZIA 3GCPA 4I22A 4PDSA 2GNJA 4AQCA 3IDPA 3HP5A 5I9YA 4V0GB 1K3AA 3ZFMA 4C4EA 2A2AA 4EC9A 3LFSA 4ZTSA 5DWRA 1XH8A 3G15A 1GIJA 3GU7A 4DEHA 4WKQA 3QC9A 2JBPA 4ZIMA 1V1KA 3R7GA 5L2QA 5IA3A 4RC4A 4D9TA 4UMPA 1H08A 4FNXA 4RLKA 4PTGA 2PZPA 4ZSGA 3I5NA 3ZRMA 2A27A 1H8FA 2EUFB 3HAVA 4KRDA 1YI4A 4QTCA 4GJ2A 4PMPA 3HMIA 4IACA 4CQGA 4BTMA 3BWFA 4AZWA 5EOLA 3F9NA 3IECA 5A6NA 2Y7JA 1NXKA 3O23A 5HNGA 5CEKA 5KMOA 3RPRA 1Z9XA 2OBJA 4FTIA 1FBNA 1YHSA 3KN6A 3LW0A 4FNWA 3F82A 4IAZA 4ASXA 5LQFA 1XJDA 3RAHA 1WVYA 2R9SA 1H1SA 2WEVA 4O6EA 4CFWA 4LV5A 5ICPA 2RF9A 5G1XA 4OR5A 5JZJA 3I6UA 3DGKA 5FEDA 1JKKA 4RG0A 2UUEA 5FTOA 2Q83A 4FKTA 3OD6X 2JGZA 2X9FA 3MS9A 2H34A 4FTMA 2R0UA 3QBNA 4NJ3A 3VJNA 4BBEA 4C61A 3SA0A 1UKIA 3VBWA 4U40A 3CTQA 4ITIA 5AUZA 3VS2A 4HOKA 3IOKA 4JG6A 4UMRA 3EYGA 3VS4A 1OPJA 2NRYA 4Q9SA 2H9VA 2XKDA 3GOPA 1DS5A 1LUFA 3QRIA 4UWYA 3T3UA 4FL2A 4BCNA 3LE6A 1W98A 5D9HA 3UC3A 3FMLA 5HBHA 5IPJA 4ZTNA 5CEOA 4ZSLA 1H4LA 3DAKA 3NNVA 2XK4A 3QZFA 1FQ1B 2VTSA 4JDKA 4C3PA 1OIUA 5DOSA 1IA9A 2YCSA 5K0KA 4I5PA 2V22A 2B0QA 3PPZA 3C50A 3QD4A 2B9HA 4J53A 3RNIA 3A7HA 3ENHA 3LFEA 3DJ6A 4XRJA 3RHXA 4PP7A 3FLSA 2VX1A 2VWBA 4QNAA 5K3YA 5HTBA 4EH6A 5HG7A 3D5WA 3W33A 4G3DA 2QOHA 3PRIA 4IIRA 4EZ3A 4IBMA 4ZTHA 3RAKA 4Z55A 3CS9A 3EB0A 2OFVA 5AX9A 4O0TA 4QYYA 3T9TA 2HAKA 2RG6A 2RFDA 3NW5A 4NM0A 3MYGA 4FKRA 3ZM9A 1K9AA 3RPVA 1MUOA 3E3PA 3MI9A 1L8TA 1L3RE 4R8QA 2O65A 2ZV7A 2QR8A 3HUCA 3G0FA 1Q24A 4JL9A 4IZ5A 4E26A 4KNBA 1OL1A 4FTQA 3L9LA 5HGIA 4AG8A 4BTFA 1QMZA 2GQSA 3LMGA 3TEIA 3TKIA 3QXOA 4BCHA 5CZHA 4ACGA 4NL0A 4G3GA 3MPAA 1M7QA 4IWQA 4EL9A 4M68A 3FLYA 3OXIA 1OL5A 3KULB 5ANKA 2ONLA 3OWPA 4J52A 4EZ5A 3PTGA 4ZJJA 3QRUA 4UZHA 2XK3A 2GNLA 4MNEB 4OUCA 2OZAA 1JKLA 2XVDA 4RGJA 5D11A 4XG4A 5BVFA 1OKVA 2X81A 3LXPA 4QMNA 5IUGA 4LMNA 5GHVA 3UNJA 1XKKA 4F63A 4QTEA 1QL6A 3NUYA 4BDBA 2VU3A 3RWQA 3PG3A 1YVJA 3RK9A 2PVKA 3QLGA 3FJQE 2FO0A 4N57A 1GY3A 5M44A 4Q5EA 4CV8A 4FTKA 1IASA 3HP2A 3KMUA 2CSNA 4U42A 4Y5QA 4U79A 2VNYA 5E8YA 5JKGA 5IH5A 3E88A 3LQ3A 4YPDA 5KBRA 5E8UA 3UVQA 5EQEA 1PMEA 4OLIA 4K9YA 5AP7A 5IEVA 4CTCA 1P2AA 3LFFA 1W82A 3Q32A 3TN8A 4BI0A 4E4NA 4E5WA 5HVJA 3D4QA 3DBFA 3SVVA 2O2UA 3C13A 4V04A 3CTHA 1JKTA 3TDWA 3HRFA 3C0GA 2B52A 1OL2A 3RM6A 2CJMA 1REKA 4M7IA 4G3EA 5E91A 4U80A 2C47A 1W0XC 3LXNA 4UEUA 1E9HA 5I0BA 2OIQA 5EQYA 4WD5A 2XMYA 3LAUA 4QQTA 1PXJA 5EH0A 4BCPA 4Z16A 4FGRA 1OL7A 5D41A 3A2CA 2W5BA 2R3JA 3GNIB 5CAOA 3ATSA 4DE4A 4DA5A 5DYJA 1R39A 3VUDA 2WTKB 5L2TA 4I0TA 2BILB 4EYMA 1Q8YA 3EQPA 5AR7A 1NT2A 5IKWA 2A4LA 2Z8CA 3MVLA 1O9UA 3Q04A 4PPCA 4IVCA 2QLUA 3G33A 1S9IA 4OTRA 4K11A 3FSKA 3MH2A 3QTSA 4KBCA 2PVNA 4CKJA 3K2LA 3PG1A 5J1VA 2B4SB 1M7NA 2Y6MA 3ZDIA 1PYXA 2GNIA 4X2JA 3FYKX 3S2PA 4EOPA 3PPJA 2R3LA 2ITUA 2YZLA 3BHHA 4FIJA 4YTCA 1CKIA 4PL5A 5ETFA 2J0MB 1BKXA 3BYOA 2BDJA 4JG8A 4CMOA 3LCOA 5EI2A 2J6MA 3DOGA 5JQ5A 4RQVA 2YWVA 1UWJA 4QO9A 3F61A 3G2FA 3K5VA 5JK3A 4QMMA 3E8DA 2J5EA 1ZWSA 1YXVA 2AC3A 1REJA 4HPTE 3KMMA 4P5ZA 4DH7A 5M51A 1AQ1A 5DRBA 5EW8A 3KXXA 4N6ZA 4WT6A 3GC9A 3PA5A 1U5QA 4BCJA 4FC0A 4J7BA 2CNVA 4DTKA 4CEGA 2X8DA 5ETCA 1MRYA 2W1ZA 4FIGA 5IUHA 4RVLA 5GZ9A 4DBXA 3PJ8A 3R00A 2CGUA 2WQNA 4J71A 3DBQA 4M13A 3OHTA 3UQFA 4APCA 2DYLA 1PXMA 1PKDA 3C51A 4XLVA 5BUEA 3DBCA 1J1CA 5IDPA 1SNUA 1ZOEA 3KEXA 5CY3A 3ZRKA 4O83A 1JVPP 2CMWA 1OGUA 2OJ9A 3D14A 5BVWA 1WZYA 4PMMA 2KULA 3NNWA 4ZTLA 3TJCA 5ANDA 4CV9A 3NEWA 3LJ0A 1XR1A 2V62A 3LM0A 2I1MA 2VD5A 3DJ5A 3MVMA 4NZWB 3CKWA 3KXMA 1PYEA 3II5A 3L8PA 3OVVA 4TT7A 2GHGA 4MNFA 3TXOA 3MIYA 5CSWA 4DF3A 4QP6A 5LVPA 4E1ZA 4GEOA 1YWNA 2BAJA 4O38A 4PPAA 2OU7A 3RM7A 5A4QA 3ZONA 3A4OX 3NYVA 4MK0A 4F08A 2BAKA 1T46A 3PLSA 4FKJA 5E92A 3ZXZA 2PL0A 1A9UA 3GCQA 4RWLA 3U6IA 2X7FA 1TKIA 3FMNA 4DGOA 2VWYA 4JAJA 4BWKA 5CSXA 4CYIA 1A48A 5B2KA 2IN6A 4EHVA 3Q6UA 2W4JA 5BVEA 4CLIA 3ITZA 3R2BA 5D12A 2R3MA 3QALE 4GKIA 4BKJA 3QUDA 1YDRE 4F1MA 3TUCA 4XHKB 1YHVA 3FLNC 2R5TA 5KHWA 3LFAA 3R04A 1ZZLA 3PFQA 5M53A 2QHNA 4JR7A 2QO7A 3LOKA 2OO8X
chains in the Genus database with same CATH superfamily
2UZOA 3VC4A 4B0GA 3GC7A 3R9NA 4PNKA 2ITZA 5KKRB 1H1WA 4QQJA 4BZOA 1TQPA 3OMVA 3KRJA 3C4FA 4YMJA 3FZSA 4HVIA 3KXNA 3DXPA 4YC3A 3KVXA 3P1AA 4YJQA 2PE1A 3CGOA 4CTBA 4OAVB 5C26A 4AT4A 2OICA 5LJJA 4BIBA 4DH3A 3SKCA 3E87A 3QZIA 3EFWA 3GFWA 2W5HA 3Q4CA 5J79A 1PMVA 3AD5A 1R0EA 4DEGA 3FL4A 4D2WA 3AC8A 4GJ3A 3BE9A 4YZCA 3S1HA 4DFLA 5ANJA 3H10A 3NYOA 4AQKA 4Y85A 2E9UA 4YLLA 3CJFA 4IWDA 4W9XA 2IVVA 5JN2A 4HGEA 4E6DA 2CGVA 2Y4PA 3E3BX 4F9YA 3D2IA 4KKEA 2IVUA 3U51A 1RJBA 4ACHA 4L53A 2PZRA 4M14A 4OGRA 4KWPA 3R21A 4W4YA 5DR6A 5M55A 2WHBA 1PJKA 2UW3A 3EH9A 3A8WA 3O51A 4GT4A 4Q9ZA 1MRUA 4QTAA 3QD0A 2GNGA 3FXXA 4EORA 5AV4A 4JAIA 3COMA 3R1SA 5J1WA 2RL5A 3GI3A 4ZOGA 4ZK5A 4YURA 2GTMA 3OBGA 4QMZA 4TYGA 4IB3A 3BYVA 4FL1A 4C59A 3LKMA 2IWIA 5DPVA 3DY7A 4OBQA 4YZMA 3C5UA 2WD1A 4L01A 3WZKA 3V8WA 4O1OA 4DCAA 2Q0BA 3UZPA 4E4MA 4IFGA 1IEPA 2ERKA 3OY3A 3R7OA 2ETKA 3TTJA 2C0IA 2XF0A 2C6OA 1PMUA 1I09A 4G6NA 2QVSE 4IEBA 4ARKA 5KE0A 4DFBA 3MVHA 1SYKA 4L3LA 4PQNA 5B7VA 5M4FA 3KVWA 3B2TA 3ZSHA 4AW1A 2XS0A 4DGNA 4XNEA 3EQCA 1KE9A 2IO6A 5EM7A 4IM0A 1ZMVA 3PP0A 3U6JA 4AN2A 4FKPA 4EBWA 2RFEA 3FQEA 3OOMA 2PULA 4MD7E 3UNZA 4A7CA 5EM5A 4AWIA 4CSVA 4G9RA 1DAYA 4ALUA 4AZEA 3FMEA 5T68A 3S0OA 2KTYA 4QEBA 5L3AA 3EL8A 2F57A 4FEXA 2OZAB 2VO3A 4D4SA 4R78A 4GFOA 5EQPA 4WNMA 4IX4A 1PW2A 4WIHA 1FPUA 2FA2A 3MN3A 2W1HA 4HYIA 3QKLA 3THBA 4D1XA 4FX3A 5LMKA 1W83A 2P33A 2J90A 5FDXA 3S3IA 4FV2A 3HA6A 1YWVA 1XHAA 2VV9A 2Y8OA 3PY1A 3DA6A 4ANBA 3FLQA 3MFRA 4IE9A 4E5AX 4IHPA 1OKZA 5FRIA 4AOJA 4BGHA 1OB3A 4FT7A 4BDDA 1UNLA 4J99A 4A07A 2WOUA 4EOQA 4NTSA 4Z7GA 3BCEA 2V55A 2YDJA 3JUHA 2YAKA 3LHJA 4G3CA 3PJCA 4IJ9A 5EHLA 4AXAA 4ASEA 4O6LA 1NVQA 1SNXA 1STCE 3RPYA 4CVAA 2VTTA 3UQCA 2XJ1A 2CN5A 5AA8A 3DK6A 4BVUA 2YCRA 4TWCA 4H58A 3FI4A 4FBXA 4ZMFA 3NW7A 1H01A 4MD8E 1M2QA 2CCIA 5IMXA 5HU9A 3GC8A 3REPA 4XH6A 2WQOA 4MUQA 4UXLA 3TWJA 3DBEA 4W8DA 2XYUA 2QKRA 3R63A 2XCKA 4X6QC 3UVPA 4F65A 3BGPA 2PTKA 3FQSA 4C37A 4JR3A 2R7IA 3RAWA 3U9NA 4CRSA 1OMWA 4QMTA 3TZ8A 3EJ1A 4QTBA 3ZTXA 3PWYA 4UMTA 3W2OA 4ZTMA 2VWWA 2JDTA 3QF9A 4I5MA 5CEPA 1XH6A 2Z7QA 2WIPA 4TY1A 4CKRA 4BC6A 4PTCA 4M3QA 3QRKA 4QMLA 3LCDA 2AQXA 4EOKA 4FKVA 1KUTA 2ITYA 4F9WA 4ZZOA 5D1JA 4F7NA 4BDIA 4RJ3A 3B2WA 3O8UA 3PIXA 4HGLA 4OTPA 4TWNA 3D83A 4OTIA 4HVDA 3W16A 4EK8A 2O5KA 3GCSA 3LQ8A 5AP3A 4UN0C 3V5TA 4KINA 4YO6A 1WVXA 4DT8A 4IANA 4C2VA 4NH1A 1KE5A 2B9FA 5AV1A 2WMSA 4X6RA 3JYAA 3EZVA 3TNHA 4TYHB 4D28A 4JBVA 2Y9QA 4NW6A 4JT3A 1NY3A 4QYHA 2QG5A 2BFXA 4CXAA 4HZSA 4WRGA 4YC6A 4TL0A 4O0RA 1Q8WA 1PXNA 3BHUA 1WBWA 4XBRA 3WE8A 2YM7A 4FV5A 5DGZA 2WTVA 4GV1A 1YXUA 5HCXA 3E92A 4TXCA 2R4BA 2UZEA 4C62A 1G8SA 4FTCA 2CPKE 3DNEA 1XO2B 3G5DA 3LVPA 2Z2WA 4RVTA 4HW7A 2FYSA 3C0HA 2VTMA 3MWUA 2C5OA 5J8IA 3AXWA 4FEQA 5C8MA 4BCFA 4UMUA 4F78A 3MB7A 3NCGA 3LLTA 5EYCA 3TYKA 4WSQA 5JQ8A 3D5XA 5EOBA 4FZ6A 4TNDA 4DH1A 3S00A 3NDMA 2HY0A 4IB5A 3U4WA 2YFXA 2BRBA 4DEAA 3MTLA 2GDOA 1YDSE 5HG9A 4AACA 5LWNA 2C6TA 4HVGA 4HVSA 4YLKA 4Y83A 4BF2A 4EH7A 3AC5A 4L7FA 3OF0A 4F99A 1SM2A 3N4TA 3O96A 4CZUA 4DG0E 2W1DA 3DT1A 4UYAA 3GOKA 3E63A 3MFUA 3A7GA 3NYNA 3MB6A 3MVJA 4FV0A 4ASDA 4EC8A 2JDSA 2PVLA 3ORPA 3WF9A 4FKSA 2XIKA 2BDFA 2R0IA 2X7OA 2RKUA 5C03A 3ZZEA 5IH6A 1U5RA 3BEAA 3Q2MA 4O21A 2W4OA 3BYUA 3F5PA 3FYJX 1WBTA 4O4EA 4C3RA 5IQEA 2YWPA 5EW9A 4EHZA 4YTIA 4G31A 2PHKA 4TNBA 3CCNA 3HRCA 4H3BA 3V5LA 4O84A 4FV1A 1JAMA 2UW5A 4P2KA 3GU4A 2VTLA 4MVFA 1YXXA 4L46A 3OC1A 4EOLA 4N0SA 1XH4A 4XOZA 2PMIA 2O63A 4IAAA 5EDPA 4CD0A 2IEWA 5CWZA 4PX6A 3ZOSA 5IQBA 4EWQA 3SAYA 4IQ6A 4NW5A 2RIOA 2ZOQA 1HCKA 3OCGA 5AM6A 3TT0A 4LI5A 3NAXA 3D7TA 2YIRA 4G6LA 3VUHA 4GVAA 2CKQA 2FVDA 4L8MA 5H2UA 4OTWA 4XV1A 5EDRA 3NUXA 3CXWA 3TV4A 3UP2A 2I0YA 4BCKA 5A3XA 4FA2A 3R9RA 2A19B 2YAAA 2XNNA 3ZBFA 4ZS4A 2YM6A 5FGKA 2NO3A 4UY9A 3R9OA 4A9TA 2XALA 3F3UA 4EUTA 5IDNA 5LCJA 3OCSA 1SZMA 4ERKA 3LFNA 3V8TA 4BTJA 5IQDA 2HZIA 2VNWA 2AC5A 4QPSA 3DDQA 5JFSA 4LGDA 3PYYA 1K2PA 1GZKA 2AUHA 1GOLA 2LAVA 2NRUA 2NPQA 1ZYDA 3BLHA 3CLYA 5IQCA 5FM3A 2X0PA 2I0EA 2XKFA 3ZO4A 2WB8A 4BDCA 2C6LA 3E93A 3F3WA 3QQGA 4BDHA 1KOBA 4O7RA 3KY2A 5K4JA 2CN8A 4IVBA 5CS6A 5AUVA 2YCFA 4FIEA 1GZOA 3FHRA 2VX3A 3GVUA 4BBMA 1JLUE 3ORKA 2ZJWA 3R1NA 4FIFA 4DC2A 5FTQA 3CSVA 4JLCA 4CFFA 2V5QA 4I21A 3W0NA 3LJ2A 5L6OA 3H30A 3WYXA 4FGBA 5ANOA 5BQ0A 5FP6A 2VWZA 2OJIA 5JEBA 4EK6A 1TQMA 2BTSA 2J2IB 2BFYA 3CC6A 5T3QA 1FVRA 3RK5A 3ZLSA 2YLFA 3GGFA 3QQLA 2YJSA 5HICA 3AGMA 1QPJA 4RIXA 3PPKA 5F20A 2W4KA 3DZQA 2C6IA 4HYUA 4NEUA 4D0WA 5LWMA 3SG9A 4BGGA 4AS0A 1GJOA 1GAGA 4H36A 3F7ZA 5FG8A 2UZUE 3ET7A 4U97A 4A4OA 5ACBC 2QODA 4C58A 4M66A 4U0IA 2VZ6A 4A4XA 4QP4A 2IVSA 1J7UA 5AX3A 4X3FC 3ZLYA 3AG9A 2OH4A 4QP9A 3NVKI 2HWPA 3V5QA 1RW8A 4IJPA 1CM8A 3OWLA 5CEQA 4EJNA 1ZOHA 1MQ4A 4GW8A 2HXLA 2JBOA 4EQUA 3QQFA 5IQIA 3UZRA 1OVEA 4DGGA 4NK9A 4JX7A 4P4CA 2JKQA 4YPSA 4CZYB 2WMBA 4D2SA 4GFGA 4DDGA 3D9VA 5I9WA 5IISA 2UVZA 3N51A 4CFVA 3TNIA 3OEZA 2ZV9A 3HMMA 3EIDA 4JG7A 5JZNA 4AZTA 1XBCA 2OWBA 4IX3A 4YBKA 4FSUA 1Q5KA 3ORTA 4AAAA 3BRBA 3K3JA 5GJDA 4BDAA 4L42A 4QMYA 2IW8A 4IDTA 5BMMA 4BDKA 4IM3A 5KMLA 5KCVA 3RKBA 3CE3A 3ZC6A 1IA8A 4JDHA 4QMXA 4FTTA 4DHFA 2W96B 3QYZA 5AA9A 4XV2A 4Y73A 3R73A 2W9FB 5J95A 1MQBA 2C3JA 2OI4X 2XNPA 4DG2E 4XOYA 4F7LA 3VRYA 4O82A 3QQUA 4P90A 5EYDA 4U81A 3R7YA 5BYYA 4GYIA 1KV2A 2GU8A 4FIIA 1V0BA 4FYOA 5T6KA 5L2WA 4DFUA 2YCQA 2EB3A 3NRMA 4DCEA 2OGVA 3M1SA 4FT5A 3EKKA 5HO6A 2GTNA 1AGWA 4FTJA 4CFXA 4BDGA 5DHJA 4D2PA 4YJRA 4K18A 2YIXA 3LMHA 1PF8A 3AMYA 3NS9A 1IAHA 3V01A 5I9UA 1IG1A 4IX5A 3VUIA 4LRJA 3KA0A 4BGQA 5TF9A 4QPAA 1FGKA 3NZ0A 5A4EA 3QA0A 4NFMA 2OIBA 3MSSA 3F5XA 5HBEA 4O4DA 5FXQA 4CGAA 1CKJA 3ZO3A 2QO9A 4KIPA 4HGSA 2R3RA 1OECA 2X8EA 2X0OA 2X2LA 5BV3A 5IA1A 3DBDA 5FEEA 2XK8A 3ZSIA 3EN5A 5GNKA 4QD6A 4AZVA 1P5EA 3OT3A 5I3RA 2GS7A 3ETAA 2PSQA 3NAYA 2BZHB 3CGFA 4EBVA 5J7BA 5LXMA 2HZ0A 5H8EA 4ZLZA 2Z60A 3MJ2A 3Q4TA 2XARA 3P86A 4WO5A 3TNQB 3KU2A 4YNOA 3C7QA 5EHYA 5ACKA 3VS3A 5A4LA 3C0IA 4S34A 2ACXA 2X2KA 4IWPA 4XJ0A 5AR4A 5C9CA 3EFKA 3ZCLA 4CFNA 3SOCA 1IR3A 2FGIA 2JAMA 3CY2A 1FVTA 3ACKA 4LUDA 3AMBA 4CRLA 1M14A 5ETAA 2YACA 3LM5A 4NU1A 1BL6A 5LVOA 1J91A 3MDYA 4JDIA 1XMMA 1WBPA 4MXXA 4D1SA 5KZ0A 4AN3A 4LL5A 2YJRA 4BDJA 3QZHA 3W1FA 3PP1A 4FZFB 5CNNA 3U8WA 4UMQA 5EM8A 3BLRA 3WOWA 5C8NA 2CKOA 4QDVA 3GEQA 2Y4IC 4LOPA 2CKPA 5BNJA 3I0OA 5BUJA 1Q97A 3NX8A 4FTNA 4NSTA 4KD1A 1QPDA 5F95A 4FKWA 4B9DA 3WZUA 4C4IA 3E8EA 5M08A 2XJ0A 3SLSA 4I3ZA 2UW4A 4I6HA 3WF6A 2XIXA 4GS6A 4J8NA 1CDKA 3KQ7A 2BKKA 3KMWA 3VONA 3QHRA 4K6ZA 4ITHA 1XBAA 3QD3A 4YSMA 3H9FA 3BBWA 3F2RA 1M2PA 2PMNX 5GZ8A 3GFEA 3P78A 2YM4A 5E4HA 4EH2A 1P4OA 4LV8A 3O8TA 4MBJA 4C34A 3HZTA 4WRSA 2W5AA 1R78A 3BV3A 3HV6A 2R3QA 3KCFA 3ORXA 4NKAA 3WF7A 4BCQA 4EYJA 1YW2A 3IONA 4DEDA 5CAPA 3R7EA 3TCPA 5DIAA 2C68A 3O7LD 3D7TB 1Y6AA 2X9EA 3F88A 5HIDA 1PKGA 4UBAA 3V6SA 3OUKA 4FG8A 2YABA 3MBLA 1XQZA 1ZYJA 3OOGA 1KE7A 2UZDA 1ZXEA 4ALVA 3A60A 4EWHA 5IQFA 5CNOA 1OUKA 1YI6A 4WBBB 4YZ9A 3M42A 2P4IA 3RZBA 3TIYA 3EZRA 4QP3A 4AXEA 3R9HA 4JBQA 4O86A 3OTVA 1B39A 5AIKA 5AAGA 3L9PA 5DT3A 4B99A 4ZXTA 5IQHA 1H0WA 5E1EA 4HYSA 4IZ7A 3NUSA 1XH7A 4ZTQA 1BYGA 4K33A 4WUAA 3M11A 2YM5A 1KSWA 4O27B 4F6WA 4WG4A 3LZBA 1FGIA 2HK5A 4I5CA 2CGWA 1PHKA 3WILA 4EOSA 2HZNA 3UIUA 2C3IB 1U59A 3QHWA 4O2ZA 4S2ZA 5HE3A 3ORIA 3R02A 3HECA 3MJ1A 1ST0A 4AXDA 4J1RA 4X7QA 4FZAB 5D10A 3TNWA 5CSHA 5AUYA 3HVCA 4YZDA 3ORMA 3K54A 3FC2A 5F94A 4MQ2A 2WXVA 4WUNA 1R3CA 3FPQA 4LOQA 5CQUA 4F4PA 1TVOA 2BALA 2C6MA 2YDIA 2V7OA 4J8MA 4XP3A 3VW8A 2IW6A 3IGGA 3VUTA 1XMLA 2J9MA 3FWQA 2DQ7X 4PNIA 2RFSA 2XB7A 3CQEA 2JAVA 4FSNA 1M2RA 1H25A 4JS8A 3E62A 4FEVA 1XH9A 4YR8A 2OXXA 2ETMA 3R22A 5E8ZA 5HLPA 4FKQA 5JGAA 3ROYA 4RIXB 4CG9A 4E5BA 3RP9A 2B55A 3A61A 3FV8A 3QGYA 2XP2A 3UC4A 3ZS5A 3O0GA 5JRSA 1W8CA 5C4KA 3SGCA 3QX2A 1WFCA 4TZRA 5M4UA 2XKEA 4YZBA 5HBJA 3I5ZA 4BY9E 2JC6A 2OJFE 3Q5ZA 5H8BA 4EOMA 2GFCA 3FXWA 5AP6A 3TIZA 3BPRA 4EZ7A 4XG9A 3VF9A 1WCCA 4D4YA 5J9YA 3I79A 2YN8A 3HMNA 3T8OA 3LLAA 3DU8A 3PXKA 4TYHA 4BKZA 1Q3WA 1YQJA 2WMAA 5KMNA 1XBBA 5FEQA 5DEYA 4RZWA 4U6RA 4R1YA 4FNYA 5DN3A 4EH8A 5IEYA 1Y91A 1GZNA 4V05A 4IB0A 4L3JA 3RWPA 4D2TA 3FKOA 4ZLOA 5GIPE 5LMBA 2OJJA 3QLFA 3BHVA 5CT0A 4NWMA 4EEVA 4KBKA 3DK7A 4ACDA 1DI9A 4M12A 3C1XA 3DKFA 4FKGA 4ITJA 4QP8A 5ITAA 5EK7A 3P79A 1NVSA 2B54A 3F3ZA 4GU6A 2BAQA 5DFPA 1JSTA 4EI4A 3CP9A 4B8MA 2RSVA 4HNFA 4ZJIA 2C5VA 1H26A 3P7BA 4GU9A 4LYNA 3BU6A 4TYJA 4R1VA 1V0OA 4FI1A 5CZIA 2BKZA 3EL7A 3FI2A 5EDQA 5EKOA 4PDPA 5H8GA 3PY3A 4Q2AA 3VS1A 5HOAA 5JGDA 2WMQA 1ZARA 2WMVA 4JRVA 2CDZA 3QKMA 4F6SA 4OTGA 5FXSA 3ZRLA 5I9VA 2BZKB 3UVRA 4YJUA 4CQEA 5AFVA 4E6QA 3ZLWA 3R30A 2YDKA 3R8UA 3T3VA 4AE9A 3F7WA 4GMYA 4O0UA 3OXZA 3IW5A 2PMOX 3RTPA 3HA8A 3NUPA 2IF8A 3L8XA 1CTPE 1UU3A 4UV0A 5HESA 1H1PA 2E9NA 1R0PA 1APME 4NFNA 4EKKA 4ANNA 1RQQA 1ZMWA 2EXMA 1LEWA 3FMJA 4OT6A 3TL8A 4JIAA 3VULA 2GQRA 2JEDA 4I1ZA 3C9WA 4RC3A 4AW0A 4H1MA 1H1QA 3W10A 5LVMA 3QYWA 2VUWA 4RIYB 2WOTA 4EQCA 3NNUA 4WNOA 1JBPE 1YHWA 3FE3A 4FTRA 5CF6A 1UU9A 3FKLA 3ORLA 5HG8A 4EH4A 1UWHA 4I0RA 2IVTA 3ACJA 3NUNA 5L4QA 3MH3A 3QL8A 2ZB1A 4Y95A 4FEWA 3NW6A 4FR4A 3FL5A 5IF1A 3IOPA 2HZ4A 2R3PA 2YHVA 4AGUA 3ZH8A 2CKEA 4MTAA 4R3CA 5IA2A 3AD4A 3DTWA 3QUPA 4EOOA 3HV3A 3JVSA 4ID7A 3ZBXA 2PYWA 3FLZA 3FY2A 1I44A 4O2PA 2W9ZB 1JSUA 1GNGA 2JIUA 3KN5A 3W18A 3SG8A 4B8LA 4UX9A 4ZMEA 4S31A 3VBXA 1F0QA 5A9UA 5HU3A 1R1WA 4APPA 3ZUVA 3LQ5A 5J87A 4BB4A 4JNWA 2VWXA 5IA0A 3TNPC 4UWBA 1KE6A 3CJGA 3AC4A 4GCJA 3EMGA 2JFMA 3R28A 4K2RA 3VJOA 3I81A 4C4FA 5HD7A 3W0PA 3NWWA 3UO5A 3FEGA 3DPKA 1ZYSA 5ANEA 4HNIA 2HW7A 2YERA 4FSWA 4PV0A 2BRGA 4TTHB 3TTIA 2QOIA 3PUPA 5J5TA 4UYNA 2IZSA 3UDZA 4IH8A 2VTRA 5DVRA 1YDTE 1TZDA 4DFZE 2WZJA 2XRUA 4AA5A 4GH2A 1HCLA 5K4IA 5KZIA 4G5PA 2XM9A 3U55A 4Y72A 1PY5A 2QKWB 3FZ1A 4MEDA 4ZTRA 5CVHA 3UNKA 4FT9A 1OUYA 2XAOA 1BI7A 2B9JA 5M06A 3V5JA 3BQRA 1Y6BA 3POOA 4GFMA 3BEGA 3EHAA 4J98A 2BPMA 4D5HA 4FV6A 4NT4A 3QAME 3AC1A 2QURA 4FVRA 5CI7A 3WF8A 4TWOA 4K1BA 5EG3A 3ZUTA 4W8EA 4XYFA 2XZSA 2PK9A 3O71A 5TE0A 3U87A 4D4VA 2C3KA 2X8IA 3PY0A 4ZSEA 3VHEA 5C8KA 4FV3A 3DXQA 5HO7A 3ID6C 1PRYA 1UNHA 2YM3A 4QQ5A 5IG1A 3EQRA 4FSYA 5CASA 2ITNA 3LCTA 1J7IA 5L6WL 1GIHA 4NCTC 1VYZA 5BPYA 3AT3A 3QQHA 4YNEA 4O0XA 3SW7A 2NNWB 4MCVA 3HEGA 2EU9A 4IZYA 2I7QA 4A4LA 4AGCA 3CPCA 4JQ7A 3FMDA 4BI2A 5HLNA 4AAYA 4MD9E 1OZ1A 4YJOA 4LM5A 4X21A 3H4JA 1Q99A 4FJVA 3B8QA 3EFLA 3KF7A 2OG8A 5IMEA 5CAVA 5EHOA 2O8YA 4PF4A 4NKSA 5CENA 4IZAA 5JRQA 5IQGA 2P2HA 2G2FA 4BICA 3VN9A 2R3HA 4I0SA 5BVNA 2WTWA 5TO8A 4PMSA 4D5KA 3OZ6A 3H9RA 4R6VA 2X0QA 5AV3A 3K3IA 4IAYA 2YISA 3KK8A 5JGBA 3EWHA 4M67A 4U41A 1ZLTA 2W17A 4KIKA 4JIKA 4S30A 2J4ZA 2R3GA 2ZMCA 4RX8A 3BQCA 5EW3A 4AW5A 5A6OA 3W0RA 2VRXA 2ZAZA 3LFCA 2XNBA 2UZTA 4Y8DA 3GBZA 1OKWA 4YZNA 3RMFA 3PA3A 4AGWA 4CYJA 5FP5A 2YIYA 4G34A 2UW7A 2XH5A 3M2WA 5AEPA 2PUPA 4I23A 3A7FA 3QUEA 1NW1A 4MAOA 4GKHA 4DTBA 4LG4A 2VN9A 4BZDA 3JVRA 3UYSA 3DCVA 3ZMMA 4I6LA 2JITA 3KB7A 3LJ1A 1DM2A 4JX3A 4W9WA 3UODA 2XNMA 3CD8A 3BYSA 3WBLA 2JLDA 4F1OA 2YIWA 2F7ZE 4J97A 3L9NA 1NVRA 4HCVA 2XBAA 2VTPA 4I4FA 4XEYA 5HNBA 5HX8A 3E7VA 4CLJA 1RE8A 5AMNA 3VBYA 3EN9A 2QO2A 3GCUA 3OEFX 4FK6A 5BYZA 3IW8A 4IAKA 3PVGA 5HE1A 2WFYA 1WBVA 4NTTA 4NM7A 4IAIA 3V6RA 3O5AA 1M17A 3RCDA 3MH0A 4G2FA 3QGWA 4F9BA 2BTRA 3E8NA 4NIFA 5CVFA 3WZDA 5FLFA 3U6HA 3PSCA 4AA4A 4KUJA 4RJ6A 4DGLC 4GG5A 1BUHA 2UZVA 4MXAA 4OTDA 3PVWA 5HNIX 5JH6A 4ORKA 2OXDA 3FMHA 3UO4A 4BL1A 2C6EA 2W05A 4FG7A 4RFMA 4AFEA 5CQWA 3AQVA 4U8ZA 1Q62A 5AADA 3DKCA 3MESA 3OUNB 4R5YA 2GMXA 2JIIA 3A62A 4AF3A 1Q4LA 5A54A 2HXQA 4G6OA 4TN6A 4EK3A 3QZGA 5HQ0A 4QNYA 2WU7A 2VTNA 4RC2A 4EHEA 3PIYA 4QT1A 4XG8A 4AZFA 3HNGA 4E4LA 3F2NA 4O4FA 5L2SA 3GP0A 4I24A 3SX9A 4P5QA 5EM6A 3AMAA 4QYFA 5AR5A 2FSOX 4NM3A 3UG2A 3VBVA 1OBDA 5F4NA 3FI8A 4E93A 3AT2A 3UBDA 4PL3A 4LFIA 4UB7A 3VIDA 3CPBA 4DBNA 2F7XE 4FTAA 2ITVA 4I4EA 4KIOA 5FBNC 4I92A 3RBWA 3FAAA 2WQBA 2ESMA 3PA4A 2WMWA 1G3NA 5GJGA 1ZZ2A 4RIOA 2ZV8A 4U45A 5ETIA 5HKMA 1XH5A 2XEZA 1DAWA 4QP2A 3KRWA 3OP5A 3SW4A 3OROA 2HELA 3N9XA 3VVHA 5EYKA 4O7VA 3UIBA 3JS2A 4BDFA 2Y6OA 3Q3BA 4KKHA 3UOHA 3CKXA 4FSZA 3ZO2A 4RJ5A 5LVLA 4YTFA 2EXEA 4N6YA 5J7HA 1KV1A 2O3PA 2R3NA 5E7RA 3W2QA 5AWMA 3D2KA 4BIDA 3EN4A 5HZNA 4F0IA 1FVVA 1H0VA 5CU4A 3LCSA 4O81A 2PZ5A 3PE1A 2QOBA 5D7AA 5IU2A 5GIOE 2C1BA 2WMRA 3EQHA 3OW3A 4B6LA 2PVYA 4D55A 4GK3A 3P5JC 3FZOA 2P3GX 1VYWA 4XX9A 2QCSA 5KMKA 4H3PA 1OPKA 3CIKA 3OG7A 3CR0A 2EB2A 4JQEA 2BRMA 3VUGA 4GSBA 3I0QA 3V5PA 5CALA 5IH4A 3PXFA 4IVAA 2LGCA 3IKAA 1GIIA 2IG7A 4FF8A 5DLSA 3G0EA 1SMHA 3ALOA 4GYGA 3FLWA 3IG7A 3TDVA 4YU2A 2X2MA 5KO1A 4KBAA 1CKPA 3C4CA 2GFSA 5AP1A 2X39A 4RQKA 4ALWA 4BCIA 3E7OA 3Q2JA 2G2HA 3RK7A 1WBOA 3ZC5A 4GVJA 4F64A 1Z5MA 4ANLA 2F2CB 1OIRA 4C38A 1OIYA 1BI8A 4XRLA 3V8SA 1RDQE 3A7JA 5IQAA 2GQGA 3OY1A 4M84A 2PUUA 3OW4A 3F2AA 3ORZA 4FT3A 2W1FA 3QU0A 4IWOA 4ANQA 3VS7A 5A4TA 3BGQA 2J51A 2VTOA 1M52A 3FPMA 3Q5IA 3QWKA 5DE2A 5TKDA 4MKCA 1LPUA 3W32A 2ZDUA 3WARA 4AZSA 4BWXA 4DAWA 2FB8A 2JFLA 5I9ZA 4C4GA 4ENXA 5HTIA 3LXKA 3HV4A 4MYGA 3VAPA 2I6LA 4E4XA 5GZAA 2O64A 3O2MA 4Z7HA 5K5XA 2BIKB 2R7BA 4FV9A 1YXSA 3MIAA 5LMAA 2X0GA 3H3CA 4I6FA 3V5WA 2DWBA 3NUAA 5DR2A 3IQ7A 3VQHA 3VW6A 3S4QA 4KB8A 2OFUA 3F69A 4N4SA 4D2RA 2WTDA 5CSPA 3NSZA 1QCFA 4A9UA 2HY81 3F66A 3ZSGA 3W2PA 5K9IA 4GUBA 1OKYA 5A14A 4FKLA 4UXQA 4Y46A 4YO4A 3QTXA 2JKOA 5FD2A 4MQ1A 3WZJA 4I20A 5CLPA 3N4VA 3GCVA 3CEKA 4XG6A 1B38A 5CU0A 3PZEA 2QNJA 2WTIA 3P9JA 3HV5A 4C02A 2Q0NA 4RA5A 1VLRA 4LV7A 3I7BA 4FSMA 1WMKA 2G2IA 4JVGA 1SVHA 3G9LX 3O50A 4QQCA 4RMZA 2OKRA 3PXRA 3VO3A 4RVMA 4U43A 3ULIA 4RZVA 2OXYA 5CF5A 2VTAA 2VTQA 2CLQA 4JXFA 4A9RA 3NR9A 1PXLA 4F1TA 3G6HA 3PSBA 3PFYA 3I4BA 2HW6A 4E6AA 5FTGA 3SV0A 4E7WA 1YOLA 3KRRA 2VAGA 4IVDA 5C01A 3CBLA 3G6GA 5HVYA 1LEZA 1YOJA 4WOVA 4ZP5A 4IADA 3PSDA 1CSNA