2Q0BA

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic e565a mutation responsible for pfeiffer syndrome
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
298
structure length
280
Chain Sequence
LPEDPKWEFPRDKLTLGKPLGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVAYASKGNLREYLRARRPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibroblast growth factor receptor 2
publication title A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 280
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2q0bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2q0bA01
2C6TA 4FTRA 4FVRA 4Y5QA 3HX4A 1H4LA 1MQ4A 2UW7A 3NR9A 1XQZA 2UW8A 5AP0A 4CRSA 2CCHA 2J90A 3AD6A 3ORTA 5EQEA 5IQAA 1OKWA 5CI6A 2R3PA 3HYHA 4LYNA 4G34A 4R3PA 4XUFA 4FUXA 3VS3A 5IH4A 3UOJA 2YAAA 3A61A 2B55A 3VBVA 2Z02A 3O96A 4NTTA 4RQVA 1GZ8A 4WUAA 2HELA 4BTKA 3NUAA 5EFQA 4BCQA 3COHA 3C4CA 2YIQA 1JNKA 3SGCA 3JY9A 2J5FA 2E9VA 5CU4A 2FSLX 4ZY6A 3TNHA 2O5KA 5FTOA 2R2PA 2GNHA 4Q5EA 1NVSA 2VWIA 2Z7QA 5KMIA 4JLCA 3NNVA 3QZFA 3VF9A 3WF8A 4LUEA 3R7YA 4DEHA 3QTRA 4ZZMA 5EKNA 5CAPA 4JDIA 4U45A 3PXFA 1H01A 1L8TA 4EHVA 2IW9A 3PLAE 1OL2A 2VTRA 4LRMA 2FVDA 4FZAB 4E73A 5HU3A 3U6IA 3I1AA 4MQ1A 1FPUA 4O7RA 4YU2A 2R3QA 1M14A 3IPHA 2V0DA 4C33A 2C6OA 4RVMA 1OB3A 2XNEA 3BYOA 4ASDA 3QZGA 5M4CA 3NGAA 4FNXA 4IM0A 2RL5A 4DHFA 2BFYA 4HVSA 3FZSA 3I79A 5AEPA 2EWAA 3AT3A 2GFSA 3E88A 2B52A 3RPOA 3EL7A 4RVLA 4JXFA 2XA4A 3LJ1A 5A4TA 5HTCA 3MIYA 4XG3A 2OF4A 4PX6A 2WU7A 4IIRA 3E8NA 5BVWA 3MPMA 2V7OA 2QR8A 4ZMEA 1SMHA 5B2MA 3MH3A 5EW3A 4R8QA 2E9PA 2PVHA 4R7HA 4Y73A 2A1AB 3EFJA 3MH0A 3TIYA 3QCSA 4QMOA 2ITVA 3BU3A 3L8PA 1M7NA 4L46A 2BDJA 3MS9A 1URCA 3PG1A 4F0IA 3HA6A 3F7ZA 4EC9A 4ASXA 3BYSA 3EKKA 4BCHA 5G6VA 2GCDA 2QC6A 1T46A 4PP9A 3S3IA 1ZOHA 4NK9A 5AIRA 3UBDA 1FMKA 4JQEA 3SW7A 4AOJA 5EQPA 4RC2A 5ANKA 3W1FA 5EYMA 3GCSA 3T9TA 1ZRZA 3AGLA 4I6FA 1YOJA 3FZTA 3G9LX 4RIWB 2R3JA 5HLNA 5J1WA 3RWQA 5CF8A 3DTWA 2OJFE 3QAME 5F95A 3A8WA 2Q83A 4KABA 2JKMA 5KMLA 3O17A 4WHZA 5HD7A 4P2KA 4RVKA 2GNIA 4RMZA 3KL8A 1R39A 4ANLA 3NWWA 3ZFMA 2VTMA 3QFVA 2BPMA 4ZEGA 3C51A 3EIDA 3HA8A 3LXLA 4H58A 1QPJA 3L1SA 2WMVA 2GU8A 2QODA 5I9WA 4YLJA 4XLIA 1WBVA 3O8PA 4G9RA 4IB1A 3L9NA 4IZAA 3QD4A 4GT4A 3RHXA 4G5PA 4FTIA 4D28A 4XJ0A 2VWWA 3A2CA 1RW8A 5AUTA 2BDFA 3QCXA 3LCSA 4RWLA 2WQBA 4AT5A 2RG6A 3KVWA 4N57A 4IX6A 3OBGA 4A06A 2RFDA 2XKFA 2YHVA 4R3RA 2WFYA 4EH3A 1ZXEA 3VRYA 4R1YA 2P33A 3D14A 3NNWA 5BVEA 3QALE 4D2PA 1TVOA 4I41A 1BI8A 1U54A 4MNEB 4F1OA 5J9ZA 2REIA 4IQ6A 5J9LA 4J8NA 4QTEA 3PIXA 1R78A 4M14A 3ZOSA 2DQ7X 2H96A 4JNWA 5IA2A 2HOGA 4A9RA 4TL0A 3PPKA 2Z7SA 1VEBA 4QPSA 4XV2A 4C7TA 4F1MA 4YTIA 2PVRA 5AA8A 3RP9A 4K8AA 3NUYA 4N6ZA 3SRVA 3OT3A 2F2UA 4IEBA 4MXOA 2PULA 3EQIA 3R1NA 3NYNA 3TDVA 3ZRMA 4FIIA 2PUUA 5FQDC 3PA3A 3C4XA 1REKA 2KULA 4V05A 4CZYB 2J0KA 4KRDA 3P7AA 3EYGA 2YA9A 3R7GA 4WO5A 1UNLA 3ORIA 1ZYDA 2PMOX 2I0EA 2XUUA 4EONA 3R9NA 4WBBB 3UO6A 4AW1A 4PPCA 3NPCA 4O22A 5KUPA 2JBOA 4BHZA 3A8XA 4NTSA 3ATSA 4BI2A 4W9XA 4HCVA 4IC8A 1PMUA 5EHYA 5TT7A 3UOLA 1PXIA 2QQ7A 1NA7A 5AR3A 5D12A 2B9IA 4DTKA 3VC4A 4C8BA 4EEVA 3FV8A 4JAIA 5DWRA 4A7CA 4B8MA 5A54A 5IG1A 4BGQA 1BI7A 1XH4A 2R3LA 3D0EA 2QLQA 3OTUA 4F09A 5HORA 5B0XA 4L42A 4L7SA 1LEZA 3IDPA 4M97A 5IEYA 3C0HA 3QRJA 4GU6A 3WZJA 4XG7A 1O6YA 4EQUA 3ZONA 2YZLA 4RLKA 5EI2A 2RFSA 4FK6A 4MBJA 5E92A 5E1EA 4AN9A 1DAWA 3KB7A 4DLJA 4E6QA 2WZJA 2GS6A 3P79A 3FAAA 4PDPA 3COMA 3DBQA 4HOKA 4BCNA 2F7EE 3KRLA 4MD9E 1WZYA 4QP3A 3EWHA 3PJ1A 4R7IA 3F5UA 1KV2A 4I93A 1FBNA 3OXZA 1XR1A 2YCSA 3QCYA 5CQUA 2YEXA 4U6RA 3ZLYA 5I0BA 2UZBA 3U54A 4OTFA 3GEQA 3MJ1A 2OFUA 1UA2A 4Z16A 1CM8A 2UW0A 1XH8A 3H0YA 1Q3WA 2R0UA 3UJGA 4O0SA 3FDNA 1W98A 2BRGA 3KQ7A 5BVFA 4MBIA 3FQHA 3HV6A 3HUCA 3V5WA 3A99A 4NIFA 4AZTA 3PIYA 3ZZWA 4M84A 1A06A 2C6IA 2CMWA 4MF0A 3PFQA 4D1ZA 4DH5A 2YDJA 4UEUA 3I7CA 2I0YA 3ZLXA 3SC1A 4FOCA 3Q2MA 4H05A 4GG7A 1O6LA 4C02A 4DGNA 3QA8A 2WQNA 3F3TA 3HV4A 4FIJA 4I23A 5CLPA 4OR5A 2YWVA 3SKCA 2ZV9A 4FEUA 3D5VA 4FIHA 3TNQB 3QA0A 5IA5A 4TY1A 2RIOA 4HPTE 4OT6A 3MI9A 3PXRA 4QMSA 3KXZA 1PY5A 4A9UA 3TWJA 2UZTA 4OBOA 4I1ZA 2JDOA 3ULIA 2R64A 2VTOA 5HTIA 2XNGA 2FO0A 4LL0A 1Q4LA 1YDSE 3G9NA 2XYUA 3NZ0A 3CXWA 3PY3A 3H4JA 4FKPA 3CGFA 2QKWB 4RX7A 2ZV8A 2YIWA 3F82A 4G31A 2QOQA 4XBUA 5B7VA 3RJCA 3HP5A 4JG7A 4BCGA 1P4FA 2EXCX 3PSBA 2YM5A 4EJ7A 4S31A 4ZJJA 1R1WA 3ZS5A 4DTBA 1H08A 2BALA 3RI1A 4YR8A 2QOOA 4F7JA 2PZPA 2VO0A 3FQEA 2ZDUA 2XK8A 3OD6X 4YJNA 4E3CA 2ETMA 4EUUA 4BF2A 5J9YA 3TEIA 4KIKB 2R7IA 5HQ0A 4MVFA 5CEMA 3BU5A 4FNZA 3FI2A 4I6BA 2X7FA 4NJDA 3AC1A 3RK7A 3QTWA 4FV1A 4O7TA 3B2WA 3FMDA 4M7IA 4PL3A 1YHVA 3LCTA 2ITTA 3LKMA 4YLLA 3K3IA 5CU6A 4GK3A 3DK7A 1OIQA 3ZUVA 2R3GA 4UB7A 4MXCA 3ULZA 2PMIA 5CALA 4DGLC 3EHAA 4AFEA 1G8SA 2OXDA 3ZO4A 2ACXA 4NFMA 2YLFA 3AC3A 3Q9XA 3HL7A 4GJ3A 4QMZA 4DH1A 4QD6A 4DFBA 5HNIX 5BVKA 1U46A 3QTXA 3WE8A 2BZJA 1YXUA 2Z60A 3FQSA 3POOA 5FD2A 3TKUA 3PTGA 2OFVA 2W5AA 2H34A 2VZ6A 4QPAA 4DFZE 1OIUA 2P0CA 2WEIA 4HGSA 2YJRA 3NNUA 4QMWA 4AW2A 1RQQA 3R04A 4M0ZA 3QLGA 5KZ0A 1YHSA 3WI6A 3KULA 3E63A 2QCSA 2NRYA 4GKHA 2IVTA 2R5TA 1Q62A 2W99B 1FVVA 3FL5A 4WSYA 1G8AA 4CKRA 4C4FA 2WEVA 3WYXA 3FI3A 4RJ7A 2W7XA 3NAXA 4ZTMA 5ACBC 3P78A 4X21A 2XB7A 5DRBA 4DEDA 4IWQA 2Y4PA 1LUFA 1PXKA 4ANQA 4BGGA 5H8BA 1S9JA 5CVGA 3ET7A 1XKKA 4CG8A 4BWXA 4L53A 4EHGA 3DXNA 2HIWA 4JT3A 1RDQE 3PVWA 3PSCA 1YDRE 5IA0A 4S2ZA 2V22A 4FK3A 4BTMA 3MB7A 4L52A 4HYSA 5A4EA 5BUJA 3FLNC 4FKOA 3LFEA 2C69A 4CT1A 2NNWB 5T6KA 2ITPA 4EOLA 2CGWA 3F5GA 5J95A 3O23A 2E9NA 2J0MB 3V5TA 4BDCA 3Q6WA 3P7CA 4XEYA 3BGZA 4XHKB 4YTHA 5DFPA 1FOTA 2PUPA 1W8CA 3UG2A 5JZNA 4EQMA 4Y83A 2JD5A 2R3RA 2F57A 1JKLA 3CPCA 2XJ1A 3PUPA 4YSJA 2HW7A 4KINA 3PWDA 5J8IA 2J4ZA 4RBLA 5IUHA 2XJ2A 1V0BA 3EZRA 4QMUA 5DIAA 3Q3BA 5LMBA 4R7BA 1XH6A 2PVFA 3F2AA 5DOSA 4QTBA 3MB6A 4RC4A 5EM6A 3ZLSA 4AZEA 5AIKA 3OXIA 4GFMA 5A4QA 4QOXA 2OH0E 5EOLA 2PVJA 4GVJA 4DC2A 3SG9A 3Q4CA 5CAOA 1XH5A 5M06A 4O96A 2WTKB 3ALNA 2C1AA 3QL8A 2YM8A 2J0JA 5KMKA 4YTFA 2OJ9A 3DZQA 2ZMCA 3FC1X 4B4LA 3HAMA 4FEXA 2QOCA 1OI9A 3AD4A 2O63A 3D94A 2CLXA 3NS9A 4KAOA 4WRSA 4E5BA 2WO6A 5HGIA 2QVSE 1BL7A 3U9CA 4ZTQA 2GQSA 4AGDA 5A46A 5AADA 5DEWA 2GFCA 4WBOA 2X7GA 3NSZA 2C3IB 3KN6A 2OSCA 3FKNA 4WNPA 3ERKA 3VO3A 4Z9LA 1WBWA 5HKMA 1U4DA 2ETRA 2Q0NA 2HY0A 4GYGA 4J96A 4Z7HA 1MRUA 5BMSA 3E8CA 2Y8OA 4AA4A 4IAFA 3TG1A 4HCUA 5M51A 4O7SA 2BHEA 3S0OA 1BYGA 2Y4IB 1YVJA 3I81A 3QQUA 4L00A 4ZSGA 3ROCA 3OS3A 3ANQA 2ONLA 3BV3A 3FXWA 5EQYA 2OH4A 4S33A 5BNJA 3PE1A 3R7UA 4X2GA 4FNWA 3LQ3A 4EJNA 1UVRA 4RA4A 4YBJA 5A4CA 3BLRA 4RWKA 4Q2AA 2PVLA 3ZO3A 3HP2A 5K4IA 5M57A 3TNIA 3V6SA 4JBQA 2W1GA 4ZAUA 1OL5A 4LQMA 3VUDA 3R8LA 3VJOA 4IX5A 3FY2A 3Q60A 4KSQA 3QTZA 4M66A 3P08A 2F7ZE 4MD7E 3QD0A 4MD8E 1Y8GA 5EDPA 4K9YA 5F9EA 4LMUA 3F3VA 4M15A 2JAVA 3QTSA 4FKTA 4K2RA 2YM3A 4GG5A 4FL1A 4UBAA 5BUEA 5I3RA 5LCJA 2FA2A 5HE0A 3LQ5A 5IQIA 1ZZ2A 5HX8A 5L6PA 3IW7A 3IGOA 4BDKA 3OOGA 3IECA 3NW5A 4L01A 2XM8A 3EJ1A 1PYEA 3ACJA 2VTHA 2BKZA 3GCPA 5C9CA 4DEIA 5KMNA 1OUKA 3DTCA 3MN3A 5L2QA 2FSOX 3VJNA 4C2WA 2QI8A 3FZRA 4D4YA 4EH7A 1OZ1A 1WBSA 4UWYA 2IW6A 4V04A 5CVFA 4RX8A 2C0IA 2RFNA 3GP0A 4JR7A 4MXAA 4UXQA 4I3ZA 3OCGA 1WBTA 5AFVA 3I6UA 4IAIA 1F3MC 1TQMA 3ZCLA 4L3JA 2XK4A 3KFAA 4B9DA 1Q24A 2F7XE 4J71A 4J7BA 1OPJA 1I09A 4F9YA 5GNKA 5A6NA 3UQCA 1OKZA 4IADA 2HWPA 1F0QA 1XH7A 4RGJA 4U42A 5IPJA 3FLZA 3SXFA 3MGYA 5AUXA 4XNEA 4Z3VA 4PPAA 3MY5A 3TZ8A 3ODZX 1YI6A 1OL6A 3GCUA 2F4JA 3BE9A 3GC7A 4NCTC 4YZNA 5HICA 3UO5A 1BKXA 2GQRA 3LMHA 4FVPA 4ACCA 3ZLWA 3DBDA 2Z7LA 1HCLA 3VBTA 4CMOA 3EQRA 5LVLA 4Y72A 3FMEA 4EH4A 1YI4A 3R2YA 3QF9A 5DR2A 3L8VA 2QU5A 3C50A 1GY3A 3JUHA 3R7VA 2WTJA 3ZC5A 5KKRB 2CN8A 3PXKA 4JDKA 3G2FA 5AA9A 5FLFA 3OW4A 2XF0A 3SAYA 4ARKA 5GHVA 4C58A 4RJ3A 5JFXA 4ERKA 2IZSA 2PVYA 1K9AA 5KKRC 2IZUA 4FV9A 3RPRA 4NT4A 2ZV2A 2C6DA 2RGPA 3GT8A 3NUPA 2JKOA 4FTLA 4AGUA 4F9WA 2AYPA 1NVQA 3TJDA 3OW3A 1V0OA 1RE8A 3T3VA 4MF1A 1DI8A 5HZNA 4YHFA 2W0JA 1ERKA 3GCVA 4YJQA 4BKYA 5JK3A 2EB3A 1SYKA 2JIIA 3D7TA 3QTUA 1PXLA 5IA3A 4FV6A 4FKUA 2IW8A 3UZTA 4EBVA 3HRCA 2YAKA 4ZOGA 2VO6A 4KIPA 4AZSA 2YCFA 2FH9A 3LCOA 4RIYB 3ZHPC 4ENXA 1KE7A 2ITWA 2IZTA 3Q32A 4QO9A 4UWCA 3FPQA 4MKCA 4O0XA 1KE8A 3W2QA 5C8NA 4FGBA 4QQ5A 2I40A 3OT8A 4LM5A 3PRFA 4TYEA 3KXXA 3S00A 3R8UA 5HNBA 3M1SA 3KXNA 4NU1A 4YJUA 4MAOA 4C4HA 3CE3A 3KGAA 4ITJA 5ETCA 5IDPA 3U87A 3UIXA 3E62A 4O82A 2CDZA 2X8DA 2B0QA 4AF3A 3AMBA 4IDTA 4I0SA 2JIVA 4FG8A 4X2FA 5D41A 2Y0AA 5CS6A 1ZOEA 2C3JA 2Z8CA 4U80A 3DBEA 3GOKA 3C5UA 4HGLA 3R7EA 1ZYCA 1ZY5A 1ZYSA 5HIDA 4BR3A 2WTDA 3FI4A 5FP6A 4PMMA 3PPJA 3UPXA 3W18A 3ODYX 2V7AA 3R9OA 4CFXA 4CFWA 3A7GA 1OBGA 2BFXA 2ITXA 5C8MA 3QXOA 2GDOA 5DPVA 5E8TA 3HAVA 3C9WA 3IO7A 2XP2A 2Z2WA 5J87A 4ALVA 3HNGA 4NCTA 5HEZA 3VS2A 2XKDA 3R73A 4D5HA 4I24A 3NYOA 3ORPA 4KB8A 5HE3A 5AAGA 2GNFA 3UTOA 4MHAA 3B8RA 1S9IA 4ZTRA 5K0KA 2W1IA 4TTHB 5L2IA 4MWHA 2ZM4A 3UG1A 4EWQA 4D4SA 2C1BA 2YDKA 3RM6A 3KXMA 4L67A 3TDWA 3OTVA 4FSZA 2I1MA 4RFMA 4PUZA 2E9UA 4BDDA 1YI3A 3R7IA 1K3AA 3VHEA 4FV5A 3MY1A 2C6EA 2SRCA 4EHEA 3ZO2A 4CLJA 4KWPA 4GFOA 2J51A 4F63A 4C0TA 2XNMA 4LV8A 4C2VA 2CGXA 3ENHA 3F5XA 2VNWA 1UU7A 3AG9A 4TWPA 4XP2A 4ZSJA 4E6CA 3UC4A 3MSSA 4J1RA 3W33A 4DTAA 1MP8A 5FM3A 3ROYA 4HJOA 4E7WA 1DM2A 5CQWA 4IHPA 5KHWA 3BLHA 4I4EA 4EORA 3GU8A 3N4TA 2VX3A 4QP4A 4R5YA 3WE4A 4BDFA 4OTIA 3BIZA 2VTNA 3EOCA 4ID7A 2UV2A 4QMXA 4RFYA 5FEEA 4AN2A 3T8OA 2BCJA 4CEGA 4J98A 4EOMA 2OWBA 4AOTA 4I22A 3OBJA 4BRXA 4IJPA 3MH1A 4ANBA 3V5JA 4JBOA 1WBNA 2BILB 4FI1A 3T9IA 1GIIA 3U9NA 3QZHA 4RJ6A 4FG7A 5CEPA 3UNKA 4FYNA 4APPA 4DLIA 5CTPA 4I5HA 3IGGA 3PZEA 5AP1A 4TYHB 4EH6A 5LCKA 2C5YA 2WMSA 4IDVA 5JGBA 4I94A 4C62A 4DEAA 4D0WA 5KO1A 1FGKA 2HY81 3AQVA 2G15A 2XIXA 4FT5A 4FTUA 2WTCA 5CSXA 4DH7A 4NM0A 5ICPA 5LMKC 5LVNA 1XO2B 3PA4A 3SVVA 4ZTLA 4O7WA 4S32A 3SA0A 1BLXA 3NIEA 2X9EA 4EOSA 5IQHA 4HYIA 5E8WA 4FUYA 4YTCA 2Y9QA 3BBTB 4R77A 1H1QA 1WCCA 4ITIA 4W4WA 3PP1A 2QOKA 3SXSA 2OO8X 2X81A 3DFAA 1OIYA 1A9UA 2H6DA 1NXKA 1MRYA 2JDRA 3HECA 3LHJA 3TV6A 3TTJA 5IMXA 4GYIA 3MYGA 4OAUC 4XV9A 2ERKA 2JDSA 4CCBA 4EH9A 1MUOA 3R0TA 4ASZA 3RZFA 5EW9A 3EN4A 3Q9ZA 3Q2JA 2BIYA 4M8TA 3EFKA 4EH8A 3CKWA 3HZTA 5DVRA 2E2BA 3LJ0A 3MDYA 2QR7A 4RZWA 1SVGA 2RG5A 2W1ZA 5DHJA 4QYEA 4DCEA 4DFYA 4WSQA 2CKPA 4DGGA 4RIWA 4FZDB 4QTDA 2WQMA 4O0WA 2C6LA 3WF7A 2ZDTA 5C8KA 5I9XA 4DCAA 3R21A 3OCSA 4BDBA 3I7BA 1Q3DA 2YCRA 3IQ7A 4PQNA 4QMLA 3ORNA 5FBOA 4HNIA 3C7QA 3I6WA 4XYFA 5EK7A 2VWXA 2PZ5A 5AV1A 4ZS4A 3VS4A 4LOOA 2PZIA 3R8ZA 4O91A 4BIDA 4PF4A 4BBMA 5C4LA 3O71A 4MXXA 3E8DA 3CJFA 2JBPA 2XKCA 3LM0A 4OBQA 2J2IB 3FY0A 2GTNA 4NFNA 4U3YA 2IWIA 3R71A 3LOKA 1YXSA 3W2CA 4V0GB 5E90A 4O21A 5CSWA 2YZAA 4YPSA 1H07A 3HMMA 1OBDA 4CYIA 3SV0A 2UZWE 3BWFA 5EW8A 5K5NA 4HCTA 3ACKA 4TWCA 2RKUA 5CWZA 3N4UA 4L9IA 5E8VA 3ZM9A 3HKOA 4U3ZA 1VR2A 3QX2A 2VWUA 2JFMA 3JY0A 2R3MA 4MNEA 3H9RA 5JT2A 3UIMA 3HMPA 3GENA 5EH0A 4N4SA 5HESA 4NUSA 3TNPC 3LFNA 3ZSIA 5AM6A 1JSUA 4ANNA 4F6SA 4FTJA 3KKVA 1JSVA 5KBRA 4AZWA 3CTQA 3C5IA 1ZYJA 3PVBA 3R2BA 3S95A 4I5MA 5LMAA 4E4MA 2CNUA 5LMKA 2UUEA 3VWAA 3UQGA 2WMTA 4O27B 4AE6A 4FE2A 3NMUF 4BFMA 3COKA 2JGZA 2ESMA 2CGUA 2UZLA 4CKIA 4C59A 5EYKA 3TV4A 1VYZA 3ZRLA 3CCNA 4ASEA 2E9OA 4GKIA 1URWA 4ZLZA 5TOZA 4WA9A 4CYJA 5KBQA 2OI4X 4IWPA 2QO9A 5DR9A 3BHVA 1YKRA 1YDTE 5EHOA 5IMEA 2R3KA 3VS0A 1IA8A 5ETAA 2ZM3A 3PG3A 2VN9A 4FICA 4O0RA 3L9PA 1YW2A 5CVHA 5DYJA 3R63A 4IM3A 4PNIA 4BDHA 4BDAA 1JKSA 3FYKX 5GINE 3PA5A 1UV5A 3HV5A 2X2MA 3II5A 3DJ7A 5T3QA 1WBPA 4EK8A 5L2WA 3KRJA 4GT3A 4KS7A 3UZPA 2XRWA 4U5JA 2UZVA 3F2RA 4CVAA 4CG9A 2XEZA 4AWIA 3ZFXA 4JDJA 4JL9A 3NUNA 4JI9A 4FTCA 3QD2B 4IW0A 4GIHA 3PJCA 1PKDA 1Q5KA 2OIDA 4OTDA 2C5XA 5IA4A 1H25A 2XM9A 1NW1A 3QLFA 4G3EA 3EQDA 4WT6A 1KE6A 4FEQA 5ANEA 4BWKA 1J7UA 5GZ8A 4IMYA 5JFVA 2W17A 5HE2A 5FTQA 3FXZA 2GPHA 2LGCA 3MBLA 5AR5A 5I9UA 3G0FA 3RMFA 3PPZA 3K5VA 4FX3A 3VUMA 4BC6A 4OLIA 3TZ7A 3MVMA 5IISA 2CKOA 2IVVA 3EN6A 4D4RA 4UN0C 5J7BA 3E7VA 4BCKA 2XK6A 1Y8YA 2VGPA 2DS1A 4J52A 4O6LA 4AZVA 3CQEA 3OFMA 2AC3A 5HI2A 3MESA 3DV3A 2PPQA 1OPKA 4UX9A 2PSQA 3FMLA 3QHWA 4QMNA 3BU6A 4HVIA 4DT9A 4U43A 4A4OA 5CF5A 4ACGA 4KRCA 3VBQA 5LVPA 4NW6A 2C0OA 2IN6A 2PY3A 5CNOA 4JQ8A 5G1XA 3S4QA 2ITNA 4RA5A 1Q97A 1XBAA 5IU2A 5CZHA 2AC5A 3OC1A 3RKBA 5AWMA 2XIKA 4U97A 4YJTA 4BCMA 3L9MA 3WYYA 1M7QA 4ZTNA 4AGCA 5KX8A 2QU6A 4JOAA 2HENA 2ZJWA 3TZ9A 4DG0E 5KZIA 3VS6A 4JQ7A 4F9BA 5HVYA 4TWNA 3DAEA 4XP3A 4QT1A 1YWNA 4EUTA 1UKHA 5IQFA 2ZV7A 1H0VA 4HW7A 3GC8A 4L8MA 2UZOA 2VX0A 2FGIA 4LI5A 4WRGA 3RTPA 2ZVAA 3DT1A 4HZRA 3W32A 3PY0A 1ZARA 4W4XA 2P2HA 1SVEA 1Q8YA 3PJ8A 2R3IA 3CJGA 4G5JA 4PRJA 5T68A 3UO4A 4CD0A 4PNKA 5K0XA 2FUMA 1V0PA 4QYYA 3FWQA 4KUJA 2X4ZA 5F1ZA 4IFGA 4P90A 3ZUTA 4ALUA 2B53A 5C27A 4F6UA 1NT2A 5HVJA 5AJQA 2HK5A 3WBLA 1PW2A 3RCDA 3RPYA 3HV3A 4KIKA 3FXXA 4G6NA 2H9VA 1W82A 4TN6A 4F7NA 5EM5A 2B9HA 3VN9A 1KE9A 4JBVA 4O0YA 4O7LA 3GUBA 2UZNA 4GMYA 3RINA 5E8YA 4BCIA 4D2SA 4DFXE 4EOKA 3RGFA 4C36A 5EM8A 3VAPA 4S34A 5AP7A 2WTKC 2YM7A 3UMXA 1L3RE 3DCVA 4E26A 4UMUA 1ZY4A 3TV7A 4BICA 3TL8A 3P23A 3G0EA 3EQHA 3Q9WA 2VAGA 4E1ZA 5A4LA 4U79A 4FEVA 1Q8ZA 1Q99A 3MH2A 2PZRA 3F3ZA 3VF8A 2I0VA 3BEAA 5HOAA 5IUGA 1STCE 4GT5A 2B7AA 4XMOA 5HU9A 4FV8A 3H0ZA 4A9TA 2C30A 2W4OA 2YM4A 1JSTA 4RJ4A 4UZDA 3PDTA 1OMWA 5HG8A 1FGIA 4EZ7A 4S30A 3R9RA 4QYGA 1PHKA 4TNBA 2W1HA 2XIRA 3FMKA 2ZB0A 2BR1A 5ETIA 3DOGA 4KKGA 3MW1A 2YM6A 3QQHA 4KSPA 5DEYA 1QCFA 2Y4IC 3P7BA 2BTSA 5GJDA 3KEXA 5E8ZA 5C1QB 4Y5HA 1IR3A 1WBOA 3F7WA 3F9NA 3GXLA 4P7EA 2IPXA 5DBXA 2XVDA 2Y6MA 1V1KA 3H10A 5CY3A 3SLSA 5IQDA 3PP0A 5ANDA 3E64A 3UVQA 1APME 3OCTA 1Y6BA 3MFTA 3R9HA 2QG7A 4PDYA 2PE2A 4ACHA 4GRBA 2QKRA 4TRLA 3GFEA 4YNOA 4G16A 5ANGA 5TF9A 4DE4A 2X6EA 3QTQA 3VBYA 5ACKA 5FUTA 4FZFB 4FF8A 4GS6A 3RHKA 4RIXB 3JS2A 4TYGA 3IKAA 3RPVA 3N51A 3VS7A 2HZ4A 2EB2A 3QQFA 4RWJA 2XCKA 3ORLA 2VWVA 3WF9A 4K1BA 4XOYA 1GJOA 3W8QA 1Q8UA 5BUIA 3FLSA 2ONLC 2BRMA 3UP2A 1PJKA 3VUHA 4CZUA 2UZUE 2YIYA 4ZMFA 3DA6A 3R22A 2G2FA 4PTEA 4AW5A 2XNOA 3TTIA 5CEOA 4U9AA 1SZMA 4FKLA 1JBPE 4GUBA 3BYVA 5E8UA 5BMMA 5IZFA 2X8EA 2VGOA 3O51A 4DH3A 2VTJA 4GK2A 5CASA 5K3YA 4F64A 3RM7A 3K5UA 2W1CA 3TNWA 3G6HA 2G9XA 4TPTA 4XG2A 4U81A 4E4NA 2OIQA 4NW5A 2ZOQA 3A7FA 4IAAA 4Y8DA 3W2PA 3ZBXA 5B2LA 4BCFA 3BX5A 2C68A 3CPBA 5LOHA 1IG1A 5E8XA 2VRXA 5M55A 4QP2A 4LUDA 4AT4A 4U8ZA 2PHKA 1VJYA 1SNUA 3AC2A 5HVKA 3BWJA 4R6VA 3DBCA 1P2AA 5ITAA 4KIOA 3LMGA 3Q4UA 4FKSA 4KBAA 1J1BA 4O2PA 5F20A 5AUWA 4L45A 4C4IA 5EKOA 1QL6A 2X2KA 2OJIA 4FG9A 2CHLA 3KK8A 3B2TA 3LCKA 1M2QA 2XH5A 3PLSA 2WXVA 3ZXTA 4CFVA 3GVUA 4JDHA 2HXQA 3CD3A 3JPVA 3KMMA 4QQJA 4A4LA 4AA0A 5EYCA 3V04A 4XBRA 2B54A 4BL1A 4GIIA 4CMTA 3E5AA 3FMNA 3OOMA 3ENMA 4USFA 3WF5A 3OROA 2VV9A 2OZAB 5FXSA 2WOUA 2QOLA 3KVXA 3ETAA 5JSMA 2GMXA 3MY0A 3FC2A 3OMVA 3DXPA 2RF9A 2NPQA 4X0MA 1ZOGA 3RNYA 5HTBA 5EG3A 2OXYA 3DLZA 3CIKA 2EXEA 3QKKA 4YUQA 3CGOA 5LVMA 1H8FA 3NRMA 5FM2A 4AT3A 3V8WA 5HO6A 4NYEA 3POZA 3A60A 4OTQA 2JEDA 2QOBA 4K77A 3TN8A 4ERWA 4WG4A 5IH5A 4CGAA 3JYAA 3A7HA 4FSWA 2EXMA 4FSUA 4OW8A 4YPDA 3U6JA 3EN7A 4QP6A 4AXAA 5FDPA 5IQCA 4MXZA 4JBPA 2UW5A 4NWMA 4YP8A 2YLEA 2HCKA 1E9HA 3Q5ZA 1Q61A 4X3FB 4B7TA 2R0IA 2F2CB 4O7NA 2YJSA 3BE2A 3DKGA 3H3CA 4NSTA 2WMRA 1M2RA 3EFLA 4UMPA 4O81A 3FZPA 3GQLA 3ZH8A 4AG8A 4L3LA 2JFLA 3VW8A 5AM7A 5DGZA 4KIQA 5FP5A 3FBVA 3IW8A 3WZEA 4O1PA 2WD1A 3SHEA 5AR2A 4AUAA 4IBMA 5AV4A 3WZUA 3D2IA 3UGCA 2GQGA 3JXWA 3I0QA 3MA3A 5FBNC 4FBXA 4LL5A 3V5PA 3NVKI 5I3OA 1OM1A 4DGMA 3AOXA 2UW9A 3DLSA 1ATPE 4FSQA 3VUKA 3ZO1A 3R8VA 2PVNA 4YC6A 5D11A 5HLWA 3K2LA 2BAJA 4K11A 2VTPA 2WELA 3WIGA 1JVPP 2HAKA 4ANMA 3IK3A 4W8DA 1PMNA 4QMYA 3V5LA 4C3RA 3R01A 2VTQA 3VRZA 4HYHA 5DT0A 1QMZA 3ANRA 5DI1A 4BIBA 4QMTA 4DITA 4ZY5A 3O7LB 4UALA 4RWIA 2A0CX 2WKMA 2HZNA 4GEOA 5I9ZA 4E6AA 2W4JA 3WZDA 4N70A 3W8LA 3VHKA 3SDJA 3W16A 4ZK5A 3U6HA 3SD0A 3WIKA 4X6RA 5JN2A 3MV5A 4H1MA 3HDNA 5AV0A 3UMWA 4FOBA 3UNJA 4CT2A 3TUBA 3AGMA 4PL4A 5H8GA 1X8BA 1JKKA 3HV7A 2W5HA 2O2UA 4CKJA 3NVMB 4ZTSA 1H24A 4D58A 4IX4A 5E4HA 2QLUA 4YO4A 3PXZA 3TIZA 5M4FA 1LEWA 4J95A 3BCEA 4TT7A 4PDSA 2B9FA 2QHNA 4HPUE 5K9IA 2VNYA 1IASA 2QG5A 3V5QA 5J7HA 3ZBFA 2WMXA 3DDQA 3U51A 2OICA 5E8SA 3DDPA 3LQ8A 4I5PA 3FHRA 3QWKA 1ND4A 2W96B 3E7OA 2P4IA 4DFUA 3PJ2A 4RZVA 4AU8A 4HVDA 5CU2A 4FTOA 2YERA 5EI6A 3THBA 3CS9A 1YHWA 4WUNA 4BI1A 1XJDA 5GZAA 3GU7A 2XK3A 2X39A 1YOLA 4LOPA 4KBCA 4M12A 3OWPA 4YGAA 2ZYBA 5DRDA 4EK5A 3HMIA 4C57A 2C6MA 4BGHA 5CYIA 4I5CA 1TQPA 1I44A 3V6RA 3LCDA 1CKJA 3TZMA 4RIYA 4BWPA 3M2WA 2YABA 4GV1A 3LXPA 3BGPA 3QRIA 4Z55A 2B1PA 3G5DA 5H9BA 4UZHA 3QUEA 4Y46A 4Q5HA 3N4VA 3GOPA 3KA0A 4HZSA 3O2MA 4AA5A 3CR0A 2UZDA 2GS7A 3AC5A 1WVYA 3QBNA 2VWYA 3QYWA 4JJRA 4KBKA 5HE1A 4RX5A 5K4JA 4UXLA 3ZM4A 3NYVA 4M69B 4JVGA 4ANOA 3EQCA 4FV2A 5M44A 1FQ1B 4K6ZA 4H39A 2VTLA 3BLQA 3CY2A 4MNFA 5JZJA 5CZIA 3WARA 5DR6A 2V62A 4XRJA 3TJCA 1J7IA 5JRSA 1H0WA 2BMCA 2YIXA 4FKJA 5CXHA 5KCVA 3F6XA 1SNXA 3QKLA 2B9JA 1ZYLA 2BIKB 2QONA 3E92A 3QTIA 3AD5A 3FZ1A 3G33A 4YLKA 3DFCB 2EVAA 4K33A 3QYZA 4RJ8A 5JH6A 3HMOA 2YDIA 2XNBA 2VWZA 5DN3A 3LAUA 3FKOA 5AX3A 2EU9A 4ZS0A 4NZWB 4BY9E 3EN9A 4FKGA 5HBJA 4TXCA 4N6YA 5HCZA 3S1HA 2YITA 4J8MA 1HCKA 4Y85A 4UYNA 4EBWA 5L8JA 1Z5MA 2DWBA 3BHTA 5KHXA 3U8WA 3DJ6A 3TKIA 2H8HA 3GC9A 4FZ6A 2NRUA 2ITYA 1Q8WA 4O38A 2VO7A 3LIJA 5TKDA 3ZYAA 3F88A 4RSSA 4D1SA 2CNQA 3ORXA 5HG9A 2HWOA 4FMQA 4BZOA 3OEFX 2XK7A 1GIJA 1PXMA 3IOKA 4D9UA 3KK9A 5IDNA 1H27A 1PMEA 4EC8A 2Y6OA 3PSDA 2CGVA 3HGKA 3FZOA 4IAZA 1W84A 4YBKA 4BTFA 4ZZNA 1OL1A 3M11A 5D7AA 3D83A 2Z7RA 4FNYA 4NKSA 4P5ZA 2CLQA 3FSFA 3KXHA 2WAJA 3H9OA 5ANOA 3ZRKA 1IAJA 1CMKE 3F3UA 3OWLA 4F08A 4EOQA 2ERZE 3RVGA 5AUUA 4PL5A 4BCJA 3PVUA 4ITHA 4EI4A 2R3HA 1M17A 3FE3A 5A9UA 1WAKA 2R3FA 3HLLA 1NVRA 3PXYA 4IVBA 5L6WL 3D9VA 2WTVA 4IB5A 3RAKA 3E3BX 1O9UA 2J0IA 2C3LA 1ZMUA 3EN5A 5DE2A 1CSNA 3P86A 4BZNA 5M56A 2I0HA 4ZXTA 3CLYA 3C1XA 3PYYA 2UVZA 3R8PA 4QP7A 4ONAA 4B99A 5GJGA 2GHGA 4LGDA 4CQEA 3UE4A 2WOTA 4ACMA 4F9CA 5CU0A 2GHLA 4IZ7A 4CRLA 3GNIB 5H3QA 1YRPA 4TYHA 2G2HA 2W4KA 2CN5A 2BAQA 3I5NA 5CF4A 3ITZA 3D7ZA 1ZMVA 1M52A 4CSVA 5IUIA 5FEDA 3UIUA 4G3GA 4U44A 5C01A 2PU8A 3PXQA 4MTAA 5M4UA 4FR4A 4BN1A 4C35A 2QD9A 4QPMA 3QD3A 4JX7A 1JAMA 3NNXA 3I4BA 5AP2A 3UC3A 5IQBA 1AGWA 3KRRA 4AQCA 1PYXA 3P9JA 1TKIA 4GJ2A 4BIEA 3BRBA 3KREA 1XHAA 1UNHA 2WIHA 2OU7A 5M07A 1JQHA 3DAKA 3FMMA 4FV3A 3MVJA 4C4EA 2HW6A 5M53A 3R6XA 2VX1A 5BYYA 2WQOA 3QQKA 4E20A 3GU5A 3FLQA 4G3FA 1OUYA 3Q96A 4OBPA 4PY1A 4K18A 4E6DA 5J5SA 3OY1A 4BZDA 2BROA 4EWHA 3VIDA 2C6KA 5EHLA 4M67A 5M08A 4G17A 3ORZA 4DEGA 2LAVA 2IO6A 4ZSEA 2V55A 3IG7A 4HGTA 4LFIA 5CXZA 2RFEA 1O6KA 4D2WA 5C26A 4YZDA 4EZ3A 1DI9A 1H1RA 2CPKE 2XKEA 4O6EA 4YZBA 4M68A 4CV8A 3Q6UA 4PMPA 3EMGA 5CI7A 4I0TA 1XWSA 4XS2A 3SX9A 4ORKA 5AUVA 2XIZA 4KD1A 1OITA 3KC3A 3OHTA 4IC7A 5CSHA 4F0GA 2WNTA 4XV1A 4YO6A 5D7VA 4DYMA 3W10A 2JLDA 3WF6A 4M3QA 2OIBA 4EHZA 4I21A 5DT3A 2ZMDA 1B38A 4C34A 1NY3A 3TI1A 3DKFA 4ZSAA 5KMOA 5CEKA 1YWRA 5HD4A 4V0GA 4CCUA 3SXRA 3P0MA 1REJA 3Q52A 1TQIA 4FT3A 3I5ZA 3VQUA 4DEEA 3A7JA 3DBFA 3NX8A 5AV3A 1DAYA 4YMJA 5BQ0A 3UIBA 3NW6A 1GZOA 2Q0BA 2UW3A 3PE2A 4R1VA 4Y95A 3V8SA 4EOPA 3RAHA 5AP6A 2XNPA 4LRKA 2CKQA 4R5SA 3DAJA 3P4KA 1IRKA 2WTWA 2OGVA 4DH8A 3BQRA 1GAGA 4NM5A 4DF3A 2A2AA 2OJJA 1RJBA 3VUGA 4DFLA 2P55A 5B2KA 3EQGA 3BGQA 2J7TA 4LMNA 4I0RA 4DINA 4EK6A 1WVXA 4GFGA 1FMOE 4LGHA 4RQKA 1BX6A 4FIGA 4JX3A 4QMMA 2QURA 2J5EA 3MFUA 4XCUA 3ORKA 3KRWA 3OUKA 3AT4A 4FKQA 4RX9A 4JRVA 4KKHA 5HO7A 5JGDA 3IOPA 4E8AA 3C4FA 3H9FA 4I92A 3OZ6A 3QC9A 4BYIA 3VBXA 4G2FA 4MCVA 4EYMA 5CANA 4MWIA 4IM2A 4FEWA 4FT0A 5L2SA 5TO8A 3VBWA 4FV4A 4W8EA 5E91A 3L9LA 3OG7A 4B6LA 2QOIA 4CQGA 3W2RA 4AAAA 1QPCA 1CDKA 4DN5A 4F1TA 2WTIA 2P3GX 2WMBA 4D1XA 4NH1A 3TCPA 2WMAA 4ALWA 5HG7A 3E8EA 4LRJA 3UNZA 3DK6A 4F65A 1KE5A 4H1JA 1PKGA 3QUPA 4ZJIA 3R7OA 2CJMA 4WOVA 4DT8A 3AT2A 2WU6A 4QMPA 1ZMWA 4XH6A 4I6QA 3C4WA 2JIUA 5BVNA 4O83A 4DBNA 1WMKA 2HZ0A 5H8EA 4JAJA 4WD5A 5FRIA 5IQGA 4YZCA 3MIAA 4UWBA 5JQ5A 4FTQA 2JC6A 5CX9A 4UV0A 5LARA 4R78A 2W9FB 5AR4A 3UOKA 1BL6A 3DNEA 4F9AA 5LVOA 3PRIA 1GZNA 1Z57A 2JKKA 2OXXA 3F69A 3GCQA 4JRNA 4YHJA 3TKHA 1GNGA 3FSKA 4KS8A 3RAWA 2XS0A 2PUNA 1KWPA 3O0GA 2WB8A 1WVWA 2QHMA 2QO7A 4X2KA 4F7SA 1PMVA 3F61A 4ZZOA 1A48A 1K2PA 1YXTA 2ITOA 2WMQA 2G2IA 3NEWA 3QGYA 4NM3A 3UP7A 2OBJA 5FXRA 3D15A 1BUHA 4G6OA 3LMIA 4D2VA 2XBJA 3FUPA 4Q9SA 1U5QA 3ZEPA 4CMUA 3JR1A 2VWBA 1YWVA 1M2PA 3A4PA 5GZ9A 3KXGA 3S2PA 3BYMA 5CT7A 3DS6A 5AP5A 2PL0A 3GU4A 4YC3A 3MFSA 3SOAA 4EKKA 3NLBA 4CV9A 4CFNA 4XOZA 4BTJA 5DLSA 2I6LA 4XP0A 4EK3A 3NIZA 3IW4A 4JIKA 4IAKA 2CSNA 2BHHA 4OTPA 3GGFA 3OWJA 3BHHA 1JWHA 4GL9A 4OAVB 4FTTA 4IZ5A 4G3CA 3U4UA 5LWMA 2O65A 2ZM1A 3QRUA 2YCQA 5GIPE 2XK9A 4FL2A 4PMTA 3ZSHA 2HZIA 1KOBA 2UW4A 4TYJA 1U54B 2IJMA 5AMNA 1UU8A 2PUIA 4XG8A 2A27A 3C0GA 4HYUA 5FG8A 3A7IA 4I6HA 5HCYA 3WILA 4ACDA 4QMVA 3CY3A 2FB8A 4O1OA 2HYYA 1UKIA 3GB2A 2PMNX 3GU6A 4O2ZA 4G6LA 1W83A 4FODA 4QQCA 4EH2A 4L6QA 4O0UA 1ZLTA 3UOHA 4QYHA 4TZRA 5BYZA 3O7LD 1KSWA 1Y91A 3SRVB 2UZEA 5BX0A 1BMKA 3KMWA 3EQPA 3NUUA 5FDXA 4MXYA 2GNLA 2WHBA 4IVCA 4MEDA 4YHTA 1YXXA 3BEGA 4GH2A 3UPZA 3GI3A 2WQEA 1PXNA 3QCQA 4PP7A 4L43A 1OKYA 5JQ8A 4ZTHA 5HIBA 5I5ZA 2QNJA 3CC6A 3AMAA 3EQBA 1YQJA 3QUDA 1R0PA 4AE9A 3FKLA 4W9WA 1W0XC 4CXAA 3UODA 1VYWA 2X2LA 3B8QA 2OG8A 4H36A 4M13A 4X2NA 3RZBA 4X3JA 3VS5A 4D2RA 4ZLYA 3DY7A 5LWNA 2CCIA 3VUIA 4U0IA 4RT7A 2VD5A 4ZLOA 2R4BA 4P5QA 5BVDA 5I9YA 3OY3A 3LLTA 2ZAZA 3KU2A 4X2JA 3FMHA 4IACA 3Q9YA 2W06A 3OWKA 2FSMX 1UU9A 3DB6A 4YJOA 5EM7A 2X7OA 2XCHA 3FPMA 4L68A 4FV7A 2WPAA 4DAWA 4WG5A 2A19B 3DNDA 1J7LA 1PXPA 4DA5A 1SM2A 4CFFA 4YZ9A 1JPAA 1JLUE 3VW6A 1G3NA 4JG8A 1FVRA 4XG4A 1J91A 5IKWA 4BYJA 4TYIA 3UVRA 4EK4A 4L44A 3RNIA 1OIRA 3CBLA 3IW6A 4RVTA 4FSNA 1GOLA 5J5TA 4NKAA 1OL7A 4O7VA 5BVOA 4JS8A 4A9YA 4FTAA 3BHUA 4DG3E 4K0YA 5HX6A 5DA3A 3DXQA 2NP8A 4O7ZA 2GSFA 4EOOA 3VULA 4U40A 3NYXA 3R8MA 4WNOA 5C4KA 1PXOA 4FVQA 1KV1A 3DZOA 2IVUA 2VTAA 3ZEWA 2J6MA 4AN3A 4CLIA 5FTGA 1P4OA 4FSYA 2EUFB 2G1TA 1Y57A 4NL0A 2W9ZB 4XG6A 4I20A 3SOCA 3DB8A 1ZZLA 5AR7A 4X3FC 3PVGA 1PRYA 3AMYA 4NIFB 5AUYA 4DBXA 5CENA 3BPRA 4RIXA 2GNJA 3EH9A 3LFBA 5ETFA 4U7ZA 3ZMMA 2W1DA 3PWYA 4H3QA 1LP4A 1Q41A 2VO3A 4QMQA 1P14A 3MTFA 1W7HA 3QX4A 4C38A 4D0XA 4C4GA 5L8LA 5M4IA 5IEXA 3JVRA 4MQ2A 4FIFA 4I4FA 5AV2A 3DK3A 4EKLA 3EFWA 4HGEA 5CAVA 5HCXA 4AACA 3OP5A 4IX3A 4B0GA 1QPEA 3DQWA 3REPA 4IZYA 4BI0A 3OUNB 2J50A 2C4GA 2RSVA 2F49A 3LW0A 3R30A 5DG5A 3LVPA 2WIPA 4BDJA 3R1SA 4KNBA 3GFWA 3FLWA 2OKRA 3QC4A 1KUTA 4UY9A 5CEQA 1WFCA 2C3KA 4GSBA 1U59A 2B4SB 4KA3A 3RALA 2VTTA 5E1SA 4GUEA 3LFFA 1HOWA 5F4NA 4HVHA 3UYSA 4FL3A 5D10A 5D9HA 2OK1A 5HBEA 2O8YA 3LFSA 4F4PA 1OECA 4D2TA 5CF6A 3E93A 4TWOA 4QNAA 3PY1A 2PMLX 3RBWA 3CEKA 5HO8A 3HRFA 3DQXA 5GIOE 3H30A 4F0FA 3NUXA 4LV5A 2OLCA 4Q9ZA 5DMZA 4IH8A 1H1PA 5L3AA 2WGJA 3EYHA 3R83A 4B8LA 3EKNA 2ETKA 2V5QA 4FT7A 4PMSA 4YNEA 1U5RA 2OZAA 4E4LA 2XBAA 2J9MA 2OZOA 2YN8A 5AUZA 4TW9A 4D4VA 4FSTA 2OJGA 4G1WA 4BB4A 3MJ2A 1H1SA 3GBZA 1H26A 3T3UA 2BZKB 1J3HA 4PTGA 3KCFA 1YXVA 2NO3A 4A07A 4M0YA 3DPKA 1GIHA 5ANJA 1UWHA 3QRTA 3ID6C 3FJQE 3DU8A 3LLAA 3LPBA 3SW4A 2XEYA 3KULB 3MFRA 4MX9A 1T45A 4AOIA 4IB3A 3V01A 3D5WA 4F7LA 4X3FA 5FWKK 3R00A 2XJ0A 4QP8A 4IE9A 5BPYA 2PWLA 3U55A 4FZ7A 4FTMA 4PWNA 3VNTA 3MVHA 4A9SA 1MRVA 2X1NA 2XYNA 3D2KA 5CNNA 4EOIA 4DGOA 5IA1A 3MA6A 3TT0A 3N9XA 3KMUA 3V3VA 4AX8A 2QOFA 1AD5A 3CTHA 1EH4A 4CZTA 3IW5A 2F9GA 3AC4A 2O3PA 4HVGA 1OGUA 1QPDA 4YJPA 1SVHA 3BELA 2XZSA 1CKPA 4FTNA 3QU0A 2W05A 1ZWSA 4W4VA 1UU3A 3NUSA 3QZIA 5L8KA 4RC3A 4L7FA 3BQCA 3CSVA 3FEGA 2P2IA 3FYJX 4PPBA 3MPAA 3RWPA 3BKBA 3JVSA 2GTMA 4BDIA 4E93A 1JOWB 4MK0A 3F5PA 4O0VA 5C03A 4BDEA 4FA2A 4TKSA 2I7QA 3Q4TA 4FIEA 4QYFA 4C61A 3IONA 2YIRA 3DKOA 4DFNA 4GK4A 2BVAA 4G9CA 2DYLA 5CU3A 3W55A 3LFAA 5H2UA 3CP9A 3QQJA 3IDBA 4FSRA 4J53A 4OTRA 4J97A 5KE0A 3O8TA 4H3PA 5CSPA 5JFSA 4PTCA 4TNDA 4USEA 2GHMA 3ATTA 3BI6A 3P5KA 4UMQA 4QTAA 3ELJA 2PTKA 3FI8A 3SQQA 4XX9A 1B39A 1UNGA 3QXPA 4FTKA 4FT9A 4IANA 5I4NA 3MVLA 1XBBA 4FKVA 4WNMA 1JKTA 4CFMA 3QGWA 3NCGA 3C4ZA 4RFZA 4O7YA 2X8IA 5HLPA 3VQHA 5JFWA 5ANIA 3W2OA 4BKZA 4C3FA 4X7QA 2C5VA 3MTLA 4D55A 3LJ2A 5FXQA 3WOWA 1UWJA 4MYGA 4XRLA 5DH3A 3IS5A 3G15A 4GU9A 4H3BA 4F6WA 2YISA 4ANSA 5CAUA 3KRXA 2BZHB 2UVYA 4FKWA 4L3PA 2BRNA 4CNHA 3LZBA 1E1VA 1VZOA 2YWPA 3R9DA 3Q04A 3F2NA 3C0IA 2GS2A 3LFQA 3DKCA 3FLYA 4LOQA 2WMUA 4WNKA 3NW7A 3GC0A 3ZSGA 3NDMA 3Q53A 5TR6A 3KCKA 5KMJA 2X6DA 2O0UA 2PZYA 5IEVA 3UQFA 2XMYA 3OF0A 2W5BA 4XG9A 2ITZA 2FSTX 4RPVA 2JAMA 5HHWA 5AR8A 3RCJA 4W4YA 3VUTA 3F66A 4UYAA 1XBCA 4YSMA 1H1WA 3E87A 1Q8TA 5JKGA 4V01A 2Y7JA 5LJJA 3KY2A 1B6CB 5AX9A 3PJ3A 2QOHA 4OTWA 4AS0A 4IFCA 2PYWA 4JG6A 4LGGA 1OVEA 2JITA 2XNNA 3IDCA 4O86A 2BKKA 3ZDIA 3G51A 5E7RA 4USDA 3LM5A 4IWOA 3NCZA 3AXWA 3C13A 5F94A 3ZUUA 1Y6AA 3ZDUA 1AQ1A 3EB0A 2YACA 4MH7A 3RK5A 3TXOA 4FSMA 4MBLA 5FGKA 3A4OX 4ZIMA 3EZVA 4M69A 5EYDA 4AP7A 3TUDA 4IXPA 3LFDA 5A6OA 4J99A 2ITQA 4OTGA 4U41A 5AAEA 5EI8A 3QKMA 4ZP5A 4EL9A 4EYJA 3RPSA 4BBFA 2PVKA 4PV0A 5HNGA 2VTSA 2IG7A 1MQBA 2JDVA 3HEGA 4QRCA 3D4QA 4XV3A 3L8SA 2A4LA 2BTRA 4JIAA 1E1XA 5AP3A 3U4WA 3LXNA 2C47A 3BBWA 2OW3A 5CEIA 3W2SA 2YFXA 5AAFA 4WKQA 2PK9A 5TE0A 2CKEA 4D9TA 4X6QC 4NEUA 5GJFA 1YOMA 4N0SA 3TACA 3FHIA 3FL4A 1LR4A 2X0GA 2VU3A 4A4XA 3ZTXA 2KTYA 1H00A 4G3DA 2PE0A 3GQIA 2IZRA 4CTBA 3BYUA 1LPUA 3I60A 5HIEA 4D5KA 1F5QA 2OF2A 3G6GA 3HRBA 3LFCA 1G5SA 5J79A 4F70A 4WIHA 4AW0A 4AZFA 2QO2A 1GZKA 3R28A 4BCOA 2R3NA 4PDOA 2HXLA 2BDWA 3CKXA 4UMTA 4DG2E 4II5A 4BCPA 2XIYA 4IB0A 4DEBA 3O8UA 2WMWA 3E3PA 3Q4ZA 3ZC6A 1KOAA 4NM7A 4BHNA 3G90X 1R3CA 4FKRA 3UVPA 5EOBA 5E9EA 2J0LA 5IQEA 3QRKA 4AFJA 3ORMA 3C4EA 4OGRA 4KKEA 3Q5IA 5LXMA 1PF8A 3EL8A 2XRUA 2CNVA 3OEZA 4FC0A 2BAKA 1FINA 2PVMA 3M42A 3QWJA 3UDBA 5IF1A 5L2TA 1OKVA 4FGRA 3OXTA 4OT5A 4APCA 5LQFA 2GNGA 4YC8A 2X9FA 1J1CA 3PZHA 4FYOA 3PIZA 3EQFA 3UYTA 2R7BA 4YURA 3TUCA 3MPTA 4IVDA 3V51A 4YJVA 4UMRA 3CQWA 3HUBA 3R1YA 4BBEA 1CTPE 3OCBA 4Z7GA 2C0TA 4EZ5A 3ZU7A 3VS1A 4EQCA 5JEBA 1IEPA 3LXKA 2JKQA 4C4JA 3RAIA 4ENYA 3CD8A 4R3CA 2W1FA 4BKJA 3NAYA 3OVVA 2VUWA 4EH5A 5I9VA 3D7TB 5M09A 1P5EA 4OUCA 3KF4A 4GW8A 2W1EA 3BHYA 2VTIA 3K3JA 4RJ5A 5FEQA 3V8TA 3ZXZA 3HVCA 4YJSA 1FVTA 1IA9A 1IAHA 3TM0A 2FYSA 5CT0A 3KF7A 5A3XA 5K5XA 3MWUA 3ZZEA 5L6OA 3F3WA 2C5NA 3HMNA 3DJ5A 4ZJVA 5L4QA 5JRQA 4RIOA 4GVAA 4E4XA 4IVAA 3D5UA 2DUVA 3COIA 5CAQA 3A62A 3HDMA 4IAYA 5A14A 3ALOA 5CSVA 2R3OA 3O50A 4FV0A 3DGKA 5JGAA 5JMSA 4YJRA 4RLLA 4QTCA 4IWDA 4QQTA 4ZY4A 1OPLA 3AC8A 5IH6A 5KNJA 4O84A 2G01A 2ZB1A 4NJ3A 2BZIB 3K54A 4IJ9A 3D5XA 4F99A 5HBHA 3VVHA 4RRVA 4YZMA 4QNYA 4GCJA 4CFUA 1H28A 2BRBA 4EOJA 4LG4A 3BZ3A 2UVXA 5EDRA 2UW6A 4AGWA 5AP4A 4P4CA 4RG0A 5D1JA 1R0EA 2R9SA 3L8XA 2X4FA 3QQLA 2IVSA 3BV2A 3FMJA 5J1VA 5KMMA 1Z9XA 4QP9A 4ZSLA 5EDQA 2O64A 1ZAOA 2PE1A 4XLVA 5DT4A 3QHRA 5HG5A 4C37A 2C5OA 3UZRA 3RK9A 4JR3A 5DNRA 2BUJA 2BRHA 3CTJA 4HNFA 3R02A 2ITUA 4OTHA 3I0OA 3P1AA 4BVUA 3R1QA 4C3PA 4CTCA 2JDTA 4WG3A 4QP1A 3CQUA 4BDGA 1PXJA 4E5AX 1DS5A 3SG8A 4FKIA 3LE6A 5BYLA 3ZFYA 1CKIA 3WZKA 2AUHA 3QQGA 4E5WA 4O0TA 3KN5A 1XH9A
chains in the Genus database with same CATH superfamily
2C6TA 4FTRA 4FVRA 4Y5QA 3HX4A 1H4LA 1MQ4A 2UW7A 3NR9A 1XQZA 2UW8A 5AP0A 4CRSA 2CCHA 2J90A 3AD6A 3ORTA 5EQEA 5IQAA 1OKWA 5CI6A 2R3PA 3HYHA 4LYNA 4G34A 4R3PA 4XUFA 4FUXA 3VS3A 5IH4A 3UOJA 2YAAA 3A61A 2B55A 3VBVA 2Z02A 3O96A 4NTTA 4RQVA 1GZ8A 4WUAA 2HELA 4BTKA 3NUAA 5EFQA 4BCQA 3COHA 3C4CA 2YIQA 1JNKA 3SGCA 3JY9A 2J5FA 2E9VA 5CU4A 2FSLX 4ZY6A 3TNHA 2O5KA 5FTOA 2R2PA 2GNHA 4Q5EA 1NVSA 2VWIA 2Z7QA 5KMIA 4JLCA 3NNVA 3QZFA 3VF9A 3WF8A 4LUEA 3R7YA 4DEHA 3QTRA 4ZZMA 5EKNA 5CAPA 2A98A 4JDIA 4U45A 3PXFA 1H01A 1L8TA 4EHVA 2IW9A 3PLAE 1OL2A 2VTRA 4LRMA 2FVDA 4FZAB 4E73A 5HU3A 3U6IA 3I1AA 4MQ1A 1FPUA 4O7RA 4YU2A 2R3QA 1M14A 3IPHA 2V0DA 4C33A 2C6OA 4RVMA 1OB3A 2XNEA 3BYOA 4ASDA 3QZGA 5M4CA 3NGAA 4FNXA 4IM0A 2RL5A 4DHFA 2BFYA 4HVSA 3FZSA 3I79A 5AEPA 2EWAA 3AT3A 2GFSA 3E88A 2B52A 3RPOA 3EL7A 4RVLA 4JXFA 2XA4A 3LJ1A 5A4TA 5HTCA 3MIYA 4XG3A 2OF4A 4PX6A 2WU7A 4IIRA 3E8NA 5BVWA 3MPMA 4DHIB 2V7OA 2QR8A 4ZMEA 1SMHA 5B2MA 3MH3A 5EW3A 4R8QA 2E9PA 2PVHA 4R7HA 4Y73A 2A1AB 3EFJA 3MH0A 3TIYA 3QCSA 4QMOA 2ITVA 3BU3A 3L8PA 1M7NA 4L46A 2BDJA 3MS9A 1URCA 3PG1A 4F0IA 3HA6A 3F7ZA 4EC9A 4ASXA 3O5AA 3BYSA 3EKKA 4BCHA 5G6VA 2GCDA 2QC6A 1T46A 4PP9A 3S3IA 1ZOHA 4NK9A 5AIRA 3UBDA 1FMKA 4JQEA 3SW7A 4AOJA 5EQPA 4RC2A 5ANKA 3W1FA 5EYMA 3GCSA 3T9TA 1ZRZA 3AGLA 4I6FA 1YOJA 3FZTA 3G9LX 4RIWB 2R3JA 5HLNA 5J1WA 3RWQA 5CF8A 3DTWA 2OJFE 3QAME 5F95A 3A8WA 2Q83A 4KABA 2JKMA 5KMLA 3O17A 4WHZA 5HD7A 4P2KA 4RVKA 2GNIA 4RMZA 3KL8A 1R39A 4ANLA 3NWWA 3ZFMA 2VTMA 3QFVA 2BPMA 4ZEGA 3C51A 3EIDA 3HA8A 3LXLA 4H58A 1QPJA 3L1SA 2WMVA 2GU8A 2QODA 5BV3A 5I9WA 4YLJA 4XLIA 1WBVA 3O8PA 4G9RA 4IB1A 3L9NA 4IZAA 3QD4A 4GT4A 3RHXA 4G5PA 4FTIA 4D28A 4XJ0A 2VWWA 3A2CA 1RW8A 5AUTA 2BDFA 3QCXA 3LCSA 4RWLA 2WQBA 4AT5A 2RG6A 3KVWA 4N57A 4IX6A 3OBGA 4A06A 2RFDA 2XKFA 2YHVA 4R3RA 2WFYA 4EH3A 1ZXEA 3VRYA 4R1YA 2P33A 3D14A 3NNWA 5BVEA 3QALE 4D2PA 1TVOA 4I41A 1BI8A 1U54A 4MNEB 4F1OA 5J9ZA 2REIA 4IQ6A 5J9LA 4J8NA 4QTEA 3PIXA 1R78A 4M14A 3ZOSA 2DQ7X 2H96A 4JNWA 5IA2A 2HOGA 4A9RA 4TL0A 3PPKA 2Z7SA 1VEBA 4QPSA 4XV2A 4C7TA 4F1MA 4YTIA 2PVRA 5AA8A 3RP9A 4K8AA 3NUYA 4N6ZA 3SRVA 3OT3A 2F2UA 4IEBA 4MXOA 2PULA 3EQIA 3R1NA 3NYNA 3TDVA 3ZRMA 4FIIA 2PUUA 5FQDC 3PA3A 3C4XA 1REKA 2KULA 4V05A 4CZYB 2J0KA 4KRDA 3P7AA 3EYGA 2YA9A 3R7GA 4WO5A 1UNLA 3ORIA 1ZYDA 2PMOX 2I0EA 2XUUA 3P5JC 4EONA 3R9NA 4WBBB 3UO6A 4AW1A 4PPCA 3NPCA 4O22A 5KUPA 2JBOA 4BHZA 3A8XA 4NTSA 3ATSA 4BI2A 4W9XA 4HCVA 4IC8A 1PMUA 5EHYA 5TT7A 3UOLA 1PXIA 2QQ7A 1NA7A 5AR3A 5D12A 2B9IA 4DTKA 3VC4A 4C8BA 4EEVA 3FV8A 4JAIA 5DWRA 4A7CA 4B8MA 5A54A 5IG1A 4BGQA 1BI7A 1XH4A 2R3LA 3D0EA 2NYAA 2QLQA 3OTUA 4F09A 5HORA 5B0XA 4L42A 4L7SA 1LEZA 3IDPA 4M97A 5IEYA 3C0HA 3QRJA 4GU6A 3WZJA 4XG7A 1O6YA 4EQUA 3ZONA 2YZLA 4RLKA 5EI2A 2RFSA 4FK6A 4MBJA 5E92A 5E1EA 4AN9A 1DAWA 3KB7A 4DLJA 4E6QA 2WZJA 2GS6A 3P79A 3FAAA 4PDPA 3TMOA 3COMA 3DBQA 4HOKA 4BCNA 2F7EE 3KRLA 4MD9E 1WZYA 4QP3A 3EWHA 3PJ1A 4R7IA 3F5UA 1KV2A 4I93A 1FBNA 3OXZA 1XR1A 2YCSA 3QCYA 5CQUA 2YEXA 4U6RA 3ZLYA 5I0BA 2UZBA 3U54A 4OTFA 3GEQA 3MJ1A 2OFUA 1UA2A 4Z16A 1CM8A 2UW0A 1XH8A 3H0YA 1Q3WA 2R0UA 3UJGA 4O0SA 3FDNA 1W98A 2BRGA 3KQ7A 5BVFA 4MBIA 3FQHA 3HV6A 3HUCA 3V5WA 3A99A 4NIFA 4AZTA 3PIYA 3ZZWA 4M84A 1A06A 2C6IA 2CMWA 4MF0A 3PFQA 4D1ZA 4DH5A 2YDJA 4UEUA 3I7CA 2I0YA 3ZLXA 3SC1A 4FOCA 3Q2MA 4H05A 4GG7A 1O6LA 4C02A 4DGNA 3QA8A 2WQNA 3F3TA 3HV4A 4FIJA 4I23A 5CLPA 4OR5A 2YWVA 3SKCA 2ZV9A 4FEUA 3D5VA 4FIHA 3TNQB 3QA0A 5IA5A 4TY1A 2RIOA 4HPTE 4OT6A 3MI9A 3PXRA 4QMSA 3KXZA 1PY5A 4A9UA 3TWJA 2UZTA 4OBOA 4I1ZA 2JDOA 3ULIA 2R64A 2VTOA 5HTIA 2XNGA 2FO0A 4LL0A 1Q4LA 1YDSE 3G9NA 2XYUA 3NZ0A 3CXWA 3PY3A 3H4JA 4FKPA 3CGFA 2QKWB 4RX7A 2ZV8A 2YIWA 3F82A 4G31A 2QOQA 4XBUA 5B7VA 3RJCA 3HP5A 4JG7A 4BCGA 1W2DA 1P4FA 2EXCX 3PSBA 2YM5A 4EJ7A 4S31A 4ZJJA 1R1WA 3ZS5A 4DTBA 1H08A 2BALA 3RI1A 4YR8A 2QOOA 4F7JA 2PZPA 2VO0A 3FQEA 2ZDUA 2XK8A 3OD6X 4YJNA 4E3CA 3UDZA 2ETMA 4EUUA 4BF2A 5J9YA 3TEIA 4KIKB 2R7IA 5HQ0A 4MVFA 5CEMA 3BU5A 4FNZA 3FI2A 4I6BA 2X7FA 4NJDA 3AC1A 3RK7A 3QTWA 4FV1A 4O7TA 3B2WA 3FMDA 4M7IA 4PL3A 1YHVA 3LCTA 2ITTA 3LKMA 4YLLA 3K3IA 5CU6A 4GK3A 3DK7A 1OIQA 3ZUVA 2R3GA 4UB7A 4MXCA 3ULZA 2PMIA 5CALA 4DGLC 3EHAA 4AFEA 1G8SA 2OXDA 3ZO4A 2ACXA 4NFMA 2YLFA 3AC3A 3Q9XA 3HL7A 4GJ3A 4QMZA 4DH1A 4QD6A 4DFBA 5HNIX 5BVKA 1U46A 3QTXA 3WE8A 2BZJA 1YXUA 2Z60A 3FQSA 3POOA 5FD2A 3TKUA 3PTGA 2OFVA 2W5AA 2H34A 2VZ6A 4QPAA 4DFZE 1OIUA 2P0CA 2WEIA 4HGSA 2YJRA 3NNUA 4QMWA 4AW2A 1RQQA 3R04A 4M0ZA 3QLGA 5KZ0A 1YHSA 3WI6A 3KULA 3E63A 2QCSA 2NRYA 4GKHA 2IVTA 2R5TA 1Q62A 2W99B 1FVVA 3FL5A 4WSYA 1G8AA 4CKRA 4C4FA 2WEVA 3WYXA 3FI3A 4RJ7A 2W7XA 3NAXA 4ZTMA 5ACBC 3P78A 4X21A 2XB7A 5DRBA 4DEDA 4IWQA 2Y4PA 3W0PA 1LUFA 1PXKA 4ANQA 4BGGA 5H8BA 1S9JA 5CVGA 3ET7A 1XKKA 4CG8A 4BWXA 4L53A 4EHGA 2AQXA 2HIWA 3DXNA 4JT3A 1RDQE 3PVWA 3PSCA 1YDRE 5IA0A 4S2ZA 2V22A 4FK3A 4BTMA 3MB7A 4L52A 4HYSA 5A4EA 5BUJA 3FLNC 4FKOA 3LFEA 2C69A 4CT1A 2NNWB 5T6KA 2ITPA 4EOLA 2CGWA 3F5GA 5J95A 3O23A 2E9NA 2J0MB 3V5TA 4BDCA 2XAMA 3Q6WA 3P7CA 4XEYA 3BGZA 4XHKB 4YTHA 5DFPA 1FOTA 2PUPA 1W8CA 3UG2A 5JZNA 4EQMA 4Y83A 2JD5A 2R3RA 2F57A 1JKLA 3CPCA 2XJ1A 3PUPA 4YSJA 2HW7A 4KINA 3PWDA 5J8IA 2J4ZA 4RBLA 5IUHA 2XJ2A 1V0BA 3EZRA 4QMUA 5DIAA 3Q3BA 5LMBA 4R7BA 1XH6A 2PVFA 3F2AA 5DOSA 4QTBA 3MB6A 4RC4A 5EM6A 3ZLSA 4AZEA 5AIKA 3OXIA 4GFMA 5A4QA 4QOXA 2OH0E 5EOLA 2PVJA 4GVJA 4DC2A 4QEBA 3Q4CA 5CAOA 3SG9A 1XH5A 5M06A 4O96A 2WTKB 3ALNA 2C1AA 3QL8A 2YM8A 2J0JA 5KMKA 4YTFA 2OJ9A 3DZQA 2ZMCA 3FC1X 4B4LA 3HAMA 4FEXA 2QOCA 1OI9A 3AD4A 2O63A 3D94A 2CLXA 3NS9A 4KAOA 4WRSA 4E5BA 2WO6A 5HGIA 2QVSE 1BL7A 3U9CA 4ZTQA 2GQSA 4AGDA 5A46A 5AADA 5DEWA 2GFCA 4WBOA 2X7GA 3NSZA 2C3IB 3KN6A 2OSCA 3FKNA 4WNPA 3ERKA 3VO3A 4Z9LA 1WBWA 5HKMA 1U4DA 2ETRA 2Q0NA 2HY0A 4GYGA 4J96A 4Z7HA 1MRUA 5BMSA 3E8CA 2Y8OA 4AA4A 4IAFA 3TG1A 4HCUA 5M51A 4O7SA 2BHEA 3S0OA 1BYGA 2Y4IB 1YVJA 3I81A 3QQUA 4L00A 4ZSGA 3ROCA 3OS3A 3ANQA 2ONLA 3BV3A 3FXWA 5EQYA 2OH4A 4S33A 5BNJA 3PE1A 3R7UA 4X2GA 4FNWA 3LQ3A 4EJNA 1UVRA 4RA4A 4YBJA 5A4CA 3BLRA 4RWKA 4Q2AA 2PVLA 3ZO3A 3HP2A 5K4IA 5M57A 3TNIA 3V6SA 4JBQA 2W1GA 4ZAUA 1OL5A 4LQMA 3VUDA 3R8LA 3VJOA 4IX5A 3FY2A 3Q60A 4KSQA 3QTZA 4M66A 3P08A 2F7ZE 4MD7E 3QD0A 4MD8E 1Y8GA 5EDPA 4K9YA 5F9EA 4LMUA 3F3VA 4M15A 2JAVA 3QTSA 4FKTA 4K2RA 2YM3A 4GG5A 4I6LA 4FL1A 4UBAA 5BUEA 5I3RA 5LCJA 2FA2A 5HE0A 3LQ5A 5IQIA 1ZZ2A 5HX8A 5L6PA 3IW7A 2X0OA 3IGOA 4BDKA 3OOGA 3IECA 3NW5A 4L01A 2XM8A 3EJ1A 1PYEA 3ACJA 2VTHA 2BKZA 3GCPA 5C9CA 4DEIA 5KMNA 1OUKA 3DTCA 3MN3A 5L2QA 2FSOX 3VJNA 4C2WA 2QI8A 3FZRA 4D4YA 4EH7A 1OZ1A 1WBSA 4UWYA 2IW6A 4V04A 5CVFA 4RX8A 2C0IA 2RFNA 3GP0A 4JR7A 4MXAA 4UXQA 4I3ZA 3OCGA 1WBTA 5AFVA 3I6UA 4IAIA 1F3MC 1TQMA 3ZCLA 4DHJA 4L3JA 2XK4A 3KFAA 4B9DA 1Q24A 2F7XE 4J71A 4J7BA 1OPJA 1I09A 4F9YA 5GNKA 5A6NA 3UQCA 1OKZA 4IADA 2HWPA 3W0SA 1F0QA 1XH7A 4RGJA 4U42A 5IPJA 3FLZA 3SXFA 3MGYA 4AQKA 5AUXA 4XNEA 4Z3VA 4PPAA 3MY5A 3TZ8A 3ODZX 1YI6A 1OL6A 3GCUA 2F4JA 3BE9A 3GC7A 4NCTC 4YZNA 5HICA 3UO5A 1BKXA 2GQRA 3LMHA 3PFYA 4FVPA 4ACCA 3ZLWA 3DBDA 2AEGA 2Z7LA 1HCLA 3VBTA 4CMOA 3EQRA 5LVLA 4Y72A 3FMEA 4EH4A 1YI4A 3R2YA 3QF9A 5DR2A 3L8VA 2QU5A 3C50A 1GY3A 3JUHA 3R7VA 2WTJA 3ZC5A 5KKRB 2CN8A 3PXKA 4JDKA 3G2FA 5AA9A 5FLFA 3OW4A 2XF0A 3SAYA 4ARKA 5GHVA 4C58A 4RJ3A 5JFXA 4ERKA 2IZSA 2PVYA 1K9AA 5KKRC 2IZUA 4FV9A 3RPRA 4NT4A 2ZV2A 2C6DA 2RGPA 3GT8A 3NUPA 2JKOA 4FTLA 4AGUA 4F9WA 2AYPA 1NVQA 4F78A 3TJDA 3OW3A 1V0OA 1RE8A 3T3VA 4MF1A 1DI8A 5HZNA 4YHFA 2W0JA 1ERKA 3GCVA 4YJQA 4BKYA 5JK3A 2EB3A 1SYKA 2JIIA 3D7TA 3QTUA 1PXLA 5IA3A 4FV6A 4FKUA 2IW8A 3UZTA 4EBVA 3HRCA 2YAKA 4ZOGA 2VO6A 4KIPA 4AZSA 2YCFA 2FH9A 3LCOA 4RIYB 3ZHPC 4ENXA 1KE7A 2ITWA 2IZTA 3Q32A 4QO9A 4UWCA 3FPQA 4MKCA 4O0XA 1KE8A 3W2QA 5C8NA 4FGBA 4QQ5A 2I40A 2XANA 3OT8A 4LM5A 3PRFA 4TYEA 3KXXA 3S00A 3R8UA 5HNBA 3M1SA 3KXNA 4NU1A 4YJUA 4MAOA 4C4HA 3CE3A 3KGAA 4ITJA 5ETCA 5IDPA 3U87A 3UIXA 3E62A 4O82A 2CDZA 2X8DA 2B0QA 4AF3A 3AMBA 4IDTA 1VLRA 4I0SA 2JIVA 4FG8A 4X2FA 5D41A 2Y0AA 5CS6A 1ZOEA 2C3JA 2Z8CA 4U80A 3DBEA 3GOKA 1ST4A 3C5UA 4HGLA 3R7EA 1ZYCA 1ZY5A 1ZYSA 5HIDA 4BR3A 2WTDA 3FI4A 5FP6A 4PMMA 3PPJA 3UPXA 3W18A 3ODYX 2V7AA 3R9OA 4CFXA 4CFWA 4MUQA 3A7GA 1OBGA 2BFXA 2ITXA 5C8MA 3QXOA 2GDOA 5DPVA 5E8TA 3HAVA 3C9WA 3IO7A 2XP2A 2Z2WA 5J87A 4ALVA 3HNGA 4AAYA 4NCTA 5HEZA 3VS2A 2XKDA 3R73A 4D5HA 4I24A 3NYOA 3ORPA 4KB8A 5HE3A 5AAGA 2GNFA 3UTOA 4MHAA 3B8RA 1S9IA 4ZTRA 5K0KA 2W1IA 4TTHB 5L2IA 4MWHA 2ZM4A 3UG1A 4EWQA 4D4SA 2C1BA 2YDKA 3RM6A 3KXMA 4L67A 3TDWA 3OTVA 4FSZA 2I1MA 4RFMA 4PUZA 2E9UA 4BDDA 1YI3A 3R7IA 1K3AA 3VHEA 4FV5A 3MY1A 4FJVA 2C6EA 2SRCA 2IEWA 4EHEA 3ZO2A 4CLJA 4KWPA 4GFOA 2J51A 4F63A 4C0TA 2XNMA 4LV8A 4C2VA 2CGXA 3ENHA 3F5XA 2VNWA 1UU7A 3AG9A 4TWPA 4XP2A 4ZSJA 4E6CA 3UC4A 3MSSA 4J1RA 3W33A 4DTAA 1MP8A 5FM3A 3ROYA 4HJOA 4E7WA 1DM2A 5CQWA 4IHPA 5KHWA 3BLHA 4I4EA 4EORA 3GU8A 3N4TA 2VX3A 4QP4A 4R5YA 3WE4A 4BDFA 4OTIA 3BIZA 2VTNA 3EOCA 4ID7A 2UV2A 4QMXA 4RFYA 5FEEA 4AN2A 3T8OA 2BCJA 4CEGA 4J98A 4EOMA 2OWBA 4AOTA 4I22A 3OBJA 4BRXA 4IJPA 3MH1A 4ANBA 3V5JA 4JBOA 1WBNA 2BILB 4FI1A 3T9IA 1GIIA 3U9NA 3QZHA 4RJ6A 4FG7A 5CEPA 3UNKA 4FYNA 4APPA 4DLIA 5CTPA 4I5HA 3IGGA 3PZEA 5AP1A 4TYHB 4EH6A 5LCKA 2C5YA 2WMSA 4IDVA 5JGBA 4I94A 4C62A 4DEAA 4D0WA 5KO1A 1FGKA 2HY81 3AQVA 2G15A 2XIXA 4FT5A 4FTUA 2WTCA 5CSXA 4DH7A 4NM0A 5ICPA 5LMKC 5LVNA 1XO2B 3PA4A 3SVVA 4ZTLA 4O7WA 4S32A 3SA0A 1BLXA 3NIEA 2X9EA 4EOSA 5IQHA 4HYIA 5E8WA 4FUYA 4YTCA 2Y9QA 3BBTB 4R77A 1H1QA 1WCCA 4ITIA 4W4WA 3PP1A 2QOKA 3SXSA 2OO8X 2X81A 3DFAA 1OIYA 1A9UA 2H6DA 1NXKA 1MRYA 2JDRA 3HECA 3LHJA 3TV6A 3TTJA 5IMXA 4GYIA 3MYGA 4OAUC 4XV9A 2ERKA 2JDSA 4CCBA 4EH9A 1MUOA 3R0TA 4ASZA 3RZFA 5EW9A 3EN4A 3Q9ZA 3Q2JA 2BIYA 4M8TA 3EFKA 4EH8A 3CKWA 3HZTA 5DVRA 3AKJA 2E2BA 3LJ0A 3MDYA 2QR7A 4RZWA 1SVGA 2RG5A 2W1ZA 5DHJA 4QYEA 4DCEA 4DFYA 4WSQA 2CKPA 4DGGA 4RIWA 4FZDB 4QTDA 2WQMA 4O0WA 2C6LA 3WF7A 2ZDTA 5C8KA 5I9XA 4DCAA 3R21A 3OCSA 4BDBA 3I7BA 1Q3DA 2YCRA 3IQ7A 4PQNA 4QMLA 3ORNA 5FBOA 4HNIA 3C7QA 3I6WA 4XYFA 5EK7A 2VWXA 2PZ5A 5AV1A 4ZS4A 3VS4A 4LOOA 2PZIA 3R8ZA 4O91A 4BIDA 4PF4A 4BBMA 5C4LA 3O71A 4MXXA 3E8DA 3CJFA 2JBPA 2XKCA 3LM0A 4OBQA 2J2IB 3FY0A 2GTNA 4NFNA 4U3YA 2IWIA 3R71A 3LOKA 1YXSA 3W2CA 4V0GB 5E90A 4O21A 5CSWA 2YZAA 4YPSA 1H07A 3HMMA 1OBDA 4CYIA 3SV0A 2UZWE 3BWFA 5EW8A 4AXDA 5K5NA 4HCTA 3ACKA 4TWCA 2RKUA 5CWZA 3N4UA 4L9IA 5E8VA 3ZM9A 3HKOA 4U3ZA 1VR2A 3QX2A 2VWUA 2JFMA 3JY0A 2R3MA 4MNEA 3H9RA 5JT2A 3UIMA 3HMPA 3GENA 5EH0A 4N4SA 5HESA 4NUSA 3TNPC 3LFNA 3ZSIA 5AM6A 1JSUA 4ANNA 4F6SA 4FTJA 3KKVA 1JSVA 5KBRA 4AZWA 3CTQA 3C5IA 1ZYJA 3PVBA 3R2BA 3S95A 3BL7A 4I5MA 5LMAA 4E4MA 2CNUA 5LMKA 2UUEA 3VWAA 2IF8A 3UQGA 2WMTA 4O27B 4AE6A 4FE2A 3W0QA 3NMUF 4BFMA 4O4BB 3COKA 2JGZA 2ESMA 2CGUA 2UZLA 4CKIA 4C59A 5EYKA 3TV4A 1VYZA 3ZRLA 3CCNA 4ASEA 2E9OA 4GKIA 1URWA 4ZLZA 5TOZA 4WA9A 4CYJA 5KBQA 2OI4X 4IWPA 2QO9A 5DR9A 3BHVA 1YKRA 1YDTE 5EHOA 5IMEA 2R3KA 3VS0A 1IA8A 5ETAA 2ZM3A 3PG3A 2VN9A 4FICA 4O0RA 3L9PA 1YW2A 5CVHA 1W2CA 5DYJA 3R63A 4IM3A 4PNIA 4BDHA 4BDAA 1JKSA 3FYKX 5GINE 3PA5A 1UV5A 3HV5A 2X2MA 3II5A 3DJ7A 5T3QA 1WBPA 4EK8A 5L2WA 3KRJA 4GT3A 4KS7A 3UZPA 2XRWA 4U5JA 2UZVA 3F2RA 4CVAA 4CG9A 2XEZA 4AWIA 3ZFXA 4JDJA 4JL9A 3NUNA 4JI9A 4FTCA 3QD2B 4IW0A 4GIHA 3PJCA 1PKDA 1Q5KA 2OIDA 4OTDA 2C5XA 5IA4A 1H25A 2XM9A 1NW1A 3QLFA 4FRFA 4G3EA 3EQDA 4WT6A 1KE6A 4FEQA 5ANEA 4BWKA 1J7UA 5GZ8A 4IMYA 5JFVA 2W17A 5HE2A 5FTQA 3FXZA 2GPHA 2LGCA 3MBLA 5AR5A 5I9UA 3G0FA 3RMFA 3PPZA 3K5VA 4FX3A 3VUMA 4BC6A 4OLIA 3TZ7A 3MVMA 5IISA 2CKOA 2IVVA 3EN6A 4D4RA 4UN0C 5J7BA 3E7VA 4BCKA 2XK6A 1Y8YA 2VGPA 2DS1A 4J52A 4O6LA 4AZVA 3CQEA 3OFMA 2AC3A 5HI2A 3MESA 3DV3A 2PPQA 1OPKA 4UX9A 2PSQA 3FMLA 3QHWA 4QMNA 3BU6A 4HVIA 4DT9A 4U43A 4A4OA 1XMMA 5CF5A 4ACGA 4KRCA 3VBQA 5LVPA 4NW6A 2C0OA 2IN6A 2PY3A 5CNOA 4JQ8A 5G1XA 3S4QA 2ITNA 4RA5A 1Q97A 1XBAA 5IU2A 5CZHA 2AC5A 3OC1A 3RKBA 5AWMA 2XIKA 4U97A 4YJTA 4BCMA 3L9MA 3WYYA 1M7QA 4ZTNA 4AGCA 5KX8A 2QU6A 4JOAA 2HENA 2ZJWA 3TZ9A 4DG0E 5KZIA 3VS6A 4JQ7A 4F9BA 5HVYA 4TWNA 3DAEA 4XP3A 4QT1A 1YWNA 4EUTA 1UKHA 5IQFA 2ZV7A 1H0VA 4HW7A 3GC8A 4L8MA 2UZOA 2VX0A 2FGIA 4LI5A 4WRGA 3RTPA 2ZVAA 3DT1A 4HZRA 3AKKA 3W32A 3PY0A 1ZARA 4W4XA 2P2HA 1SVEA 1Q8YA 3PJ8A 2R3IA 3CJGA 4G5JA 4PRJA 5T68A 3UO4A 4CD0A 4PNKA 5K0XA 2FUMA 1V0PA 4QYYA 3FWQA 4KUJA 2X4ZA 5F1ZA 4IFGA 4P90A 3ZUTA 4ALUA 2B53A 5C27A 4F6UA 1NT2A 5HVJA 5AJQA 2HK5A 3WBLA 2XAOA 1PW2A 3RCDA 3RPYA 3HV3A 4KIKA 3FXXA 4O4CA 4G6NA 2H9VA 1W82A 4TN6A 4F7NA 5EM5A 2B9HA 3VN9A 1KE9A 3W0RA 4JBVA 4O0YA 4O7LA 3GUBA 2UZNA 4GMYA 3RINA 5E8YA 4BCIA 4D2SA 4DFXE 4EOKA 3RGFA 4C36A 5EM8A 3VAPA 4S34A 5AP7A 2WTKC 2YM7A 3UMXA 1L3RE 3DCVA 4E26A 4UMUA 1ZY4A 3TV7A 4BICA 3TL8A 3P23A 3G0EA 3EQHA 3Q9WA 2VAGA 4E1ZA 5A4LA 4U79A 4FEVA 1Q8ZA 1Q99A 3MH2A 2PZRA 3F3ZA 3VF8A 2I0VA 3BEAA 5HOAA 5IUGA 1STCE 4GT5A 2B7AA 4XMOA 5HU9A 4LDTA 4FV8A 3H0ZA 4A9TA 2C30A 2W4OA 2YM4A 1JSTA 4RJ4A 4UZDA 3PDTA 1OMWA 5HG8A 4DDGA 1FGIA 4EZ7A 4S30A 3R9RA 4QYGA 1PHKA 4TNBA 2W1HA 2XIRA 3FMKA 2ZB0A 2BR1A 5ETIA 3DOGA 4KKGA 3MW1A 2YM6A 3QQHA 4KSPA 5DEYA 1QCFA 2Y4IC 3P7BA 2BTSA 5GJDA 3KEXA 5E8ZA 5C1QB 4Y5HA 1IR3A 1WBOA 3F7WA 3F9NA 3GXLA 4P7EA 2IPXA 5DBXA 2XVDA 2Y6MA 1V1KA 3H10A 5CY3A 3SLSA 5IQDA 3PP0A 5ANDA 3E64A 3UVQA 1APME 3OCTA 1Y6BA 3MFTA 3R9HA 2QG7A 4PDYA 2PE2A 4ACHA 4GRBA 2QKRA 4TRLA 3GFEA 4YNOA 4G16A 5ANGA 5TF9A 3UDSA 4DE4A 2X6EA 3QTQA 3VBYA 5ACKA 5FUTA 4FZFB 4FF8A 4GS6A 3RHKA 4RIXB 3JS2A 4TYGA 3IKAA 3RPVA 3N51A 3VS7A 2HZ4A 2EB2A 3QQFA 4RWJA 2XCKA 3ORLA 2VWVA 3WF9A 4K1BA 4XOYA 1GJOA 3W8QA 1Q8UA 5BUIA 3FLSA 2ONLC 2BRMA 3UP2A 1PJKA 3VUHA 4CZUA 2UZUE 2YIYA 4ZMFA 3DA6A 3R22A 2G2FA 4PTEA 4AW5A 2XNOA 3TTIA 5CEOA 4U9AA 1SZMA 4FKLA 1JBPE 4GUBA 3BYVA 5E8UA 5BMMA 5IZFA 2X8EA 2VGOA 3O51A 4DH3A 2VTJA 4GK2A 5CASA 5K3YA 4F64A 3RM7A 3K5UA