3NDMA

Crystal structure of rho-associated protein kinase (rock1) with a potent isoquinolone derivative
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
398
structure length
383
Chain Sequence
MSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEEETFPIPKAFVGNQLPFVGFTYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-Associated Protein Kinase (ROCK1)
publication title Substituted 2H-isoquinolin-1-ones as potent Rho-kinase inhibitors: part 3, aryl substituted pyrrolidines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 108
structure length 383
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ndmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ndmA01
3NYNA 4NTSA 3V5WA 3BE9A 3Q9YA 4L3JA 5ETIA 3RPOA 3BYMA 3BBTB 4C4HA 3RI1A 2JAVA 3ZBFA 3IG7A 2XCKA 3IO7A 2ZV8A 1YHSA 1JNKA 4FTRA 2RL5A 3G6HA 4OW8A 3VJOA 3ZLYA 3GXLA 2BAQA 3QAME 4I24A 5JGBA 3ID6C 4D5HA 1OI9A 2JAMA 3DA6A 4KIPA 3NAYA 4WUNA 3A7HA 3R00A 3IW6A 2BPMA 3ZC6A 5DT4A 4WNPA 4BZDA 4MNFA 1ZAOA 5T6KA 2YWVA 3GC0A 2HENA 5M55A 4GIIA 3UIMA 4QMUA 3ZOSA 3P7CA 5EHYA 1BX6A 2HW6A 2QR7A 4RIWA 5H9BA 2X39A 2B1PA 4J1RA 5D41A 5HE1A 3PXYA 4XUFA 5D1JA 3WF9A 3MH1A 3PUPA 5C8MA 2J0IA 1ERKA 1R0EA 4FV9A 2Y6MA 4G3CA 4FTMA 5L8LA 2OIQA 4MF1A 3GC8A 3DOGA 3VUHA 4MBLA 4XV2A 4YZDA 3E64A 5FDXA 4BWKA 5GIPE 3LXLA 4O1PA 4IX3A 4FI1A 4BHZA 4GEOA 4ANMA 3IK3A 2X7GA 3HV6A 5C03A 3DBQA 3SA0A 3QA8A 5HI2A 3WILA 3EZVA 1OB3A 2FGIA 5D9HA 4R78A 2YM6A 4AAAA 4FK6A 4KWPA 3TUBA 3GT8A 4ZY6A 3F3TA 4P7EA 2ITQA 4AUAA 4C02A 4KUJA 4J96A 4H36A 4CT2A 1MRYA 4O6LA 1OL7A 2IG7A 3BHTA 3G0EA 2VN9A 4K0YA 3ZBXA 1DAYA 2I0EA 3R63A 2GQRA 3MGYA 3DJ5A 3KU2A 3QRUA 5LOHA 4FG7A 2OW3A 1H26A 1Q8YA 4LRJA 4FG9A 2XJ2A 3M42A 4V04A 4FSUA 1H1WA 3Q9WA 5C4LA 4FZDB 3SGCA 2CLXA 1OBDA 4EH9A 4G5JA 3QTWA 3CKXA 4TY1A 3V3VA 2VO3A 2I1MA 4IWDA 4D5KA 4MWIA 3OD6X 1CM8A 1A06A 2X6DA 2GFCA 4QYGA 3L8XA 1ZMVA 4U45A 2J7TA 3K54A 2OIBA 2EXMA 4NIFB 3BYSA 3E7OA 4D4RA 3UZPA 4A07A 3QZFA 2CPKE 3LW0A 3MBLA 1H1QA 4ZSEA 3UG1A 5CSPA 3VUDA 4FTLA 4E6AA 3SXSA 2ETKA 2GS2A 3DBEA 4Z7HA 1Q3DA 5CVFA 5BVEA 2H34A 4GVJA 3RAWA 5CI7A 1FBNA 3L8SA 3PRIA 3I4BA 3RAKA 5EDRA 2OH4A 3UMXA 2IVTA 3ZLWA 4TL0A 3GEQA 4DH3A 5L8KA 2X81A 5AV2A 4F1TA 5KMLA 3MY5A 4LUDA 4YURA 3AD6A 3QBNA 4QMMA 3FZPA 4E4MA 3BX5A 2XNEA 1XO2B 5ICPA 3O8TA 3NYOA 3OTUA 2P33A 3EFWA 4AW5A 4C8BA 2WFYA 1SNXA 4OTGA 4X3FC 2KULA 3NVMB 4FSNA 4ZXTA 4ZY5A 3D94A 3P1AA 1TQIA 2OFUA 3P23A 3FQEA 2YCRA 5CU0A 2BAKA 4YSJA 3C4EA 2RSVA 3KC3A 2LAVA 4OT5A 3H9FA 1ZLTA 3P86A 3ZONA 3F5GA 4KRCA 5BUJA 3COHA 2E9PA 2V5QA 1QPJA 2XKDA 3E5AA 4MD7E 1SNUA 3TV6A 4E7WA 3KK8A 3A7IA 4GJ2A 2OG8A 2QLUA 3TT0A 2WMTA 4EI4A 1URCA 2P3GX 5FRIA 3BHUA 4BDCA 1XH6A 4L44A 3MTFA 3WF7A 3OWLA 4I5MA 1OIRA 1YXXA 2R3MA 1UU8A 3D2IA 5M07A 5LJJA 4BR3A 4OTIA 5CEPA 2ZV2A 5KKRB 4AZFA 1IEPA 1Y6AA 2BMCA 5GNKA 4LOQA 4LI5A 4LQMA 2QO7A 5M08A 4C4FA 3ZRMA 4EK3A 4AE6A 4O7SA 4JBVA 4MQ1A 4ALVA 4B99A 4BTKA 2UZOA 2XB7A 4BGGA 2OI4X 4F9WA 2BALA 4QMXA 3DPKA 3VBYA 4E20A 2XM8A 3EN4A 3LE6A 3MS9A 5IH6A 4O0UA 4ONAA 4ZSLA 5K4IA 3ORZA 3VRZA 3FI3A 2ITUA 4YJRA 4DHFA 1A48A 1UKIA 4U97A 4UV0A 4ERKA 4AE9A 4M13A 1WBTA 2QOCA 3ZC5A 4DEBA 5IQFA 5I9ZA 2XNPA 3VQHA 3D14A 3E8NA 2R3JA 3PPJA 4JBQA 2PYWA 1LEZA 4ASXA 2YIWA 1QL6A 3RPSA 3KFAA 3KULB 3ANRA 4D1ZA 2C1BA 4G3FA 4FKSA 4F70A 2WTWA 4IM3A 2UVYA 3ORLA 4YHTA 4YSMA 4RIOA 4WRGA 3FHIA 3I6WA 3AMAA 3CJGA 5ETFA 1V0PA 4QP1A 2XEZA 3EQIA 5EYDA 3E8DA 5D11A 4EOIA 3GENA 2ZB1A 4RVKA 1FVTA 3DAJA 2PVKA 4BIDA 3GCPA 2NRUA 3KXZA 2XMYA 5AR4A 1E1VA 2HY81 2VTLA 3ZSGA 3KGAA 1OM1A 4O21A 2IZTA 3ODZX 4F6WA 5FBOA 4OTRA 4W8DA 3FC2A 3LQ8A 2I7QA 2FYSA 1OKZA 1CTPE 5I3RA 3DDPA 4W4VA 4RX7A 4HCTA 4XG6A 3LQ5A 4LRKA 4QPAA 3PXKA 4TZRA 4YZBA 4E3CA 4ZJVA 5I9YA 5EI8A 5FUTA 5DR6A 3EQGA 3MVHA 3EN5A 3MESA 3V5TA 5AP1A 1Q24A 3MDYA 4XG7A 5CEOA 3KXGA 4BN1A 1GZNA 3PE1A 4RX8A 3OFMA 4XCUA 4Q9ZA 3W10A 3HRCA 2GNGA 3Q6UA 2XBJA 1YWNA 4GSBA 4TYGA 2IVUA 5IU2A 3W55A 3EHAA 3Q32A 4FKIA 4GT4A 4J95A 5ANJA 5AUXA 3WZKA 4BCPA 2WTKB 1KV2A 3EL7A 2WU7A 1NVRA 4FT9A 5CZIA 5I9UA 4M66A 2W7XA 4BTMA 3SHEA 4IDVA 4G5PA 5IMEA 2OWBA 4KD1A 3QF9A 1W7HA 3TNQB 5F9EA 2HXQA 3IGOA 1ZMWA 5EKNA 2B9IA 1IA9A 3DTCA 1ZXEA 4WO5A 5CSWA 5IPJA 4WBOA 5CENA 2BFXA 3T9IA 4QP2A 4AGDA 2WAJA 4QMQA 5EFQA 4BKZA 2JEDA 4X6RA 3V6SA 4DH5A 3PVWA 4BGQA 3ACKA 3R8MA 2JGZA 2C5XA 4RJ8A 3PG3A 3WI6A 2YISA 4M68A 3F3WA 4FICA 3R7IA 4O7WA 4FEUA 1NVQA 5BVWA 3R8VA 1OVEA 2X4ZA 1QCFA 1UU9A 2PVMA 3G9NA 4BRXA 4ENYA 4AW2A 2VWWA 2WQNA 4DT8A 5KZIA 4K33A 3B2TA 3W2QA 3Q04A 3BYOA 2HYYA 1IA8A 4EEVA 4YO6A 3DB8A 4YUQA 4L45A 3U4UA 4IWQA 3SRVB 4BCJA 1MP8A 5AP6A 4TNDA 2CGVA 2PUPA 4AT3A 4FA2A 3ZO2A 3OCGA 3VW6A 4M84A 3LFCA 3AT4A 5JQ5A 4YC3A 5K5NA 2OIDA 4F0FA 4KA3A 3ZS5A 2WTCA 3OF0A 4ID7A 4F9CA 2A1AB 3OEZA 4RZVA 2CNVA 2R3OA 4FV4A 1J7LA 2XK6A 2B0QA 4N0SA 4I21A 5L6OA 1Q3WA 4I23A 2X2KA 5HE2A 4RG0A 4TPTA 4YJVA 4RFMA 1JBPE 5J87A 4TTHB 3DK7A 3O8PA 4RJ6A 1MUOA 4KNBA 3R7OA 3NVKI 2F2UA 2P4IA 5I3OA 2W1IA 2ZMDA 3PXFA 5GJDA 4BI1A 4FK3A 4EKLA 4EOJA 2X2MA 2R3RA 2ITOA 4UXLA 3CR0A 4BBFA 4K18A 3W32A 5EQPA 3WF8A 4DE4A 2CSNA 3KXMA 2DYLA 3R04A 2OZOA 1PYXA 3HX4A 4J53A 1WBSA 2R3HA 3A99A 3DNDA 4J8MA 4MD9E 4X3JA 2R3QA 4ZSGA 2HIWA 2XK8A 4YHFA 4NYEA 3IDBA 5K4JA 4YJQA 4DEEA 3RWQA 4QTDA 2RFNA 5B2LA 4PMTA 5I0BA 3FLNC 4ASDA 2EVAA 4FG8A 2YWPA 2ONLA 4IFGA 4QP7A 4EBVA 1JQHA 4U44A 4AOIA 3QC4A 5AMNA 3QQKA 3IS5A 2R3KA 3G2FA 5HCYA 3TIYA 4C36A 3QCQA 3R9RA 3UQCA 4D9UA 2HELA 5F94A 2PL0A 4O2ZA 2PMOX 3CPCA 5T68A 4YR8A 3CTHA 2W1DA 4UX9A 4RPVA 5KMOA 3TNIA 5JQ8A 4XOYA 3GFEA 4EK5A 4I94A 3HMIA 4HYSA 1PMNA 4CZYB 3DJ7A 4XG3A 5AP4A 2RFSA 4O7TA 1M7NA 2J5EA 1JWHA 3SOAA 4U6RA 4FF8A 4PF4A 4EK8A 4DFYA 4XLVA 4UMRA 2H96A 2RKUA 5CNOA 4V0GB 3AD4A 3N4TA 1XH8A 5M09A 3ITZA 4DEIA 4C34A 4PL4A 1H08A 4G3GA 4F0IA 3E3PA 3E62A 4FV3A 4RLLA 4QPSA 5HD7A 5IEVA 2HZ0A 2JBPA 3CIKA 4WD5A 5AAEA 5LMKC 4CRLA 3NEWA 1Z5MA 2WMXA 3U6JA 1A9UA 3GCUA 5JK3A 4EOSA 3FYJX 2B55A 1KV1A 2GNIA 5EYKA 3HV7A 4PRJA 2CGWA 4ZS4A 5EOBA 1R0PA 2YHVA 4QYHA 3ZUUA 4KSPA 4C2VA 4IFCA 3MA6A 1OITA 2OGVA 2FSTX 4IAZA 1H1RA 4FTKA 3V8WA 3VO3A 4RX9A 3GC7A 4DFNA 3SG9A 3LFNA 2CGXA 3NYVA 3ZTXA 1NXKA 3QTSA 3F88A 4C2WA 2VX3A 2OBJA 2A2AA 4BCIA 3UTOA 4F09A 1T45A 3LOKA 4AG8A 3RP9A 3R9HA 1WBPA 1UKHA 3QU0A 3TXOA 3EZRA 4FVRA 3QA0A 5JN2A 5AP2A 4GK3A 3FZTA 3FXZA 5KHWA 3PWYA 3WE4A 2VWXA 4BZOA 2WMUA 3CP9A 4MAOA 4QMYA 5CAOA 5I5ZA 3DU8A 4NW6A 3VUIA 4DC2A 3HDNA 2R3PA 2VWZA 5AR5A 5HBHA 1P14A 4FKVA 3ATTA 5CEKA 2X8DA 3R1NA 3U9NA 1LR4A 2QOLA 1HCKA 4F4PA 4IADA 4UBAA 3CD8A 4EHEA 2AC3A 5AP5A 3D7TA 3VUTA 3FL5A 1ZOGA 1BI8A 2X7OA 2Y8OA 2VD5A 3ZSHA 4ACDA 4ANQA 2SRCA 4B8LA 2OJ9A 2WXVA 5CTPA 3WBLA 1XBAA 2W17A 3COIA 3FPMA 3WZDA 4M0YA 3L9LA 4NWMA 1WBVA 3TZMA 3VC4A 2JBOA 2B9FA 5ANDA 1RE8A 4GYGA 3ZHPC 2IPXA 2C5NA 5J5TA 2XM9A 5ACKA 1NT2A 1LPUA 2W05A 2BFYA 3Q4CA 4KINA 2ZDUA 4ACCA 4F7JA 3QD3A 1BL7A 5CVGA 3I0QA 4YC8A 3MSSA 3OXTA 1PXPA 2VX0A 2YIRA 3C51A 5AP3A 3ULZA 4AT5A 4O2PA 1VEBA 3SXRA 5FTGA 4AFEA 2GHMA 4E5AX 3UC3A 2LGCA 3QRJA 3UMWA 2GS6A 5FGKA 1JAMA 2CKEA 3ZO1A 3KQ7A 1WMKA 4H3QA 5TE0A 4E26A 4TWNA 3KXXA 3IOPA 3QWJA 3Q5ZA 2HW7A 1CKPA 4HZRA 3D7ZA 3GI3A 4RIXA 3QGWA 4UMQA 3AT3A 3B8QA 3FLSA 2WO6A 4FX3A 4GJ3A 5BYLA 4YLJA 2ERKA 2XKEA 4BWXA 3LFBA 3VBWA 5F4NA 3FQSA 2E9NA 2F7XE 4JLCA 5DRDA 5AADA 1QPCA 2UVXA 2G2FA 5DHJA 3M11A 4NFNA 3FSKA 5AIKA 4BDKA 3FHRA 2YLEA 3BU6A 3HVCA 4L46A 4OT6A 2XIXA 1AD5A 3V6RA 2ITZA 3EMGA 3R30A 3LJ1A 3II5A 3FAAA 4QMLA 4R3RA 5ANOA 3TZ9A 1XBCA 4DITA 4H05A 1UU3A 3P0MA 1MRVA 4CG9A 5A6NA 2WOTA 4O0SA 4GFGA 1YXUA 3ZM9A 3PY3A 5FTOA 3K5VA 3F82A 3GOKA 4JL9A 4N6YA 4OUCA 4FOBA 3CS9A 4BCGA 4M15A 1U54A 4APCA 3NX8A 5IA3A 3DGKA 3PFQA 4AZTA 2GQGA 3Q52A 3ZLSA 2X7FA 5I4NA 3PIYA 3UNZA 3QRIA 5C8NA 1SVEA 5HU3A 3QD4A 5JFXA 4K2RA 3CQUA 5L3AA 4L3PA 3R83A 3KEXA 1KOAA 3QXPA 4ZJJA 5DPVA 3C4WA 4RZWA 3POOA 4AS0A 4CLJA 2ZM3A 2YZAA 3TV4A 5AUYA 4YMJA 4IC7A 5IUHA 3CD3A 3QWKA 2H9VA 3AG9A 5BNJA 3C5IA 4MK0A 5C27A 3R73A 2C68A 4TNBA 2EUFB 5EI2A 3AGLA 3TNWA 4FKUA 5AUVA 2FA2A 2Y9QA 4EZ7A 1RW8A 3QQFA 3RCJA 4ALWA 2V55A 1YHWA 2XRWA 2X4FA 5E7RA 5HTIA 5IA0A 2YDKA 3CE3A 4B7TA 3ORKA 4QRCA 2F49A 3R9OA 4WIHA 1URWA 3PSBA 2XZSA 3R9DA 5EOLA 3UYTA 3RTPA 3PWDA 4FMQA 4RT7A 2Z60A 4EOOA 2PPQA 3O0GA 5HCXA 1WBNA 4IQ6A 3OEFX 1M2QA 2H6DA 1YOLA 3ZXTA 2YCSA 2YABA 3QD2B 4ANSA 1OPLA 3EQHA 4M97A 3PTGA 3FLZA 3I7CA 3VS1A 4DCAA 4FIHA 3FMDA 2DUVA 2WZJA 5IDPA 3JR1A 2ZOQA 4AGCA 4APPA 3DKGA 3H0ZA 4IB1A 5GJFA 5LWNA 2HZIA 5IQDA 4LL5A 4BFMA 2EB2A 4AOJA 3U54A 4BVUA 1ZOHA 4A4OA 2ZDTA 5GZAA 3A4OX 2CMWA 4JDKA 2VWVA 1Z9XA 4JRNA 4ZTNA 1MQBA 1I09A 5K3YA 2R7IA 4Y72A 3VVHA 3AC1A 3HECA 4LGGA 4FV6A 4XG9A 5FXRA 4G6LA 4O27B 4O7RA 1CKJA 1R3CA 3LPBA 3Q3BA 2I0VA 3EQRA 5L2QA 3HAVA 3FPQA 3NUXA 4KKEA 3GP0A 5ANKA 5B2KA 3RKBA 3V5JA 1ZYCA 5BYYA 4YPSA 4A9UA 1K3AA 4O7YA 2ZVAA 2WIHA 2OJFE 3RVGA 4DGLC 3FMJA 4U79A 2GNHA 3GOPA 4LL0A 3UQGA 3HMMA 3NZ0A 2PUNA 2PE1A 3BU5A 3F69A 4ORKA 3EN6A 1SZMA 5FEEA 3Q6WA 4GG5A 1PXIA 2BZHB 3IW5A 5E1SA 1FMKA 2J90A 3AMYA 2BRHA 2HOGA 3H9OA 4H3BA 3EB0A 3O8UA 1SM2A 3V51A 4EC9A 4Y8DA 2BZJA 4D4SA 1W83A 4FV2A 2WQEA 5EI6A 1G3NA 2PVYA 3E63A 4QMOA 2UW6A 2UW7A 4XNEA 4MXZA 5KX8A 4CT1A 2B4SB 3P7AA 4QQ5A 5H8BA 4XG4A 4XLIA 3F6XA 1Y91A 5F20A 2XKFA 3NUYA 1MRUA 3MWUA 4IAAA 4ITIA 5TKDA 5BX0A 3MVJA 3L8PA 3W2CA 1P5EA 3JUHA 4CKJA 4QPMA 5FQDC 5AV0A 4C4JA 2CCIA 5DI1A 5M06A 3CJFA 1BKXA 3HV4A 2XNOA 4F08A 3DKOA 3RCDA 2IVVA 3BV2A 4CTCA 5JRQA 1J1CA 2QHNA 4FTIA 4K6ZA 3G90X 3U55A 4W9XA 4CKIA 3TN8A 4L7SA 4ZTQA 2UVZA 3F7WA 2JDVA 3UDBA 4EH6A 5KMKA 5AUUA 4FSQA 4A9YA 3P5KA 1PXLA 2G9XA 4PMMA 2WTKC 2W1CA 4HVGA 5K9IA 3G5DA 4YP8A 1H1PA 4RWIA 2EWAA 2ETMA 2IZRA 5HOAA 4X0MA 2BRGA 4DYMA 2C3LA 4A9TA 5HHWA 3JXWA 3VJNA 2XCHA 3BU3A 4PPCA 4HNIA 4LV8A 3DV3A 5EG3A 5KMJA 3JY9A 1F5QA 3DKCA 3NYXA 1BMKA 4RWJA 4ASZA 2XK3A 4LGDA 3QTIA 4YJPA 4JJRA 4FVQA 2OF4A 5HX8A 5HORA 2FB8A 2X0GA 3VS7A 5FLFA 4JXFA 4OR5A 3TIZA 3HYHA 4EHGA 1K9AA 1GIJA 3WARA 4E5BA 4PTGA 4HNFA 2I40A 3HEGA 4Y5HA 3CQWA 3KMMA 1WBOA 3QXOA 1W82A 4MXOA 2W99B 1ZRZA 4AZSA 3OOGA 4O38A 3ATSA 4BWPA 5CX9A 3RAHA 3RHXA 4E8AA 4XG8A 4BIEA 2BRMA 3FLWA 3NR9A 3ZFMA 4EZ5A 3NUSA 2V62A 1P4OA 1GNGA 5HX6A 5HIEA 3E87A 4YBKA 4QNAA 3R7YA 2PE2A 4C4EA 3QGYA 3TEIA 4K1BA 3KN5A 3TTIA 5HG9A 4ZTMA 4FC0A 4UZHA 1UVRA 2ZM1A 4FNXA 2ITPA 4I0RA 5GZ8A 4AXAA 3C0HA 3GQIA 4FIJA 4C4IA 2R3NA 4H3PA 3SAYA 3VS5A 4AFJA 5JGDA 1T46A 4ERWA 5FEQA 2VTIA 3CXWA 4J8NA 3LM5A 2C0OA 3UOKA 4LOOA 5KBRA 2YM5A 3SDJA 5J7BA 5AR8A 3JPVA 5LCKA 1XBBA 2WB8A 4I92A 4M69A 5FM3A 3EKKA 2J9MA 1KE7A 2XNMA 5AX3A 3BPRA 3LFSA 3C4ZA 4GUBA 3ZXZA 4O7LA 4W4WA 4N57A 3JY0A 3N51A 4RIYB 4BDGA 4EH8A 4F9BA 2J4ZA 4UZDA 5EQYA 3AOXA 3MFTA 4L8MA 4S34A 5DIAA 1Q61A 3PE2A 2PZPA 4HJOA 4I6BA 5E1EA 4CFXA 5LVMA 3F3ZA 3PJ1A 5CQWA 4QP8A 4YGAA 3GBZA 5CAVA 2WTJA 3LKMA 2PZYA 2WD1A 2XIYA 1IASA 4I5CA 1B38A 3CBLA 3EKNA 2YJSA 1KE6A 1JLUE 4RQVA 5HE3A 3ZZWA 2UZWE 4CD0A 4G2FA 3K2LA 5A46A 2WIPA 3L1SA 5HBEA 4RC2A 5AUTA 1PKGA 2W4JA 3CGOA 2HAKA 3TTJA 2CHLA 4WNOA 4ZLOA 5CF5A 2BRNA 2O65A 3A7GA 3NNWA 5IQGA 3ZM4A 1XR1A 2YAAA 4RC3A 3H9RA 2X8EA 3A8WA 2XIKA 3PG1A 3GQLA 5EK7A 5FDPA 3WIKA 3W8LA 4NT4A 1PMUA 4U41A 2GTMA 3F5XA 4OBOA 4BICA 2CKOA 1Q8ZA 5J9LA 3QUDA 5I9XA 3FJQE 1KE5A 1FOTA 3QUEA 5A4LA 3UOHA 3R22A 4DEHA 2W5HA 3EFJA 3RK7A 3DS6A 3OY1A 5CVHA 2QHMA 3NPCA 3Q53A 4YJNA 3SRVA 3TL8A 4QQTA 3P9JA 5D12A 3NIEA 4RVLA 5DA3A 3OBJA 4V01A 4RRVA 2P55A 4BCNA 4BYJA 3VF9A 3KCKA 2XVDA 4Y5QA 2HCKA 4ZTLA 4ZTRA 3NRMA 4TYJA 5HBJA 4J99A 4BGHA 5IH5A 2H8HA 3HV3A 3PXQA 4FL3A 2AUHA 2QO2A 3EH9A 4NM7A 3S0OA 3ZYAA 2YIYA 2GMXA 4ACHA 2QOFA 5CAUA 4FIIA 2HK5A 4AN2A 3V5QA 3PDTA 2YDJA 1Q62A 3LJ0A 5HNGA 4QD6A 5JEBA 5BQ0A 2QR8A 4CCBA 3D5WA 3ZEPA 2IW9A 3PVGA 4OTQA 4QMSA 3VULA 5HO6A 2XBAA 2O5KA 2O3PA 4BL1A 3QLFA 4IIRA 4QP4A 5DOSA 4GT5A 5G1XA 4LM5A 5CZHA 4UMTA 2A4LA 3E88A 4DG0E 3KB7A 3LCDA 4CZUA 1OIUA 2J51A 2JKOA 5DBXA 3UP7A 2VUWA 2GQSA 4FTUA 4QYEA 5EW8A 1J1BA 4FL1A 4BDFA 4F7NA 4R5YA 3COKA 5M4UA 4D58A 2UZDA 3RHKA 4DEGA 5DT3A 3ENMA 4C0TA 3MH2A 2FVDA 1PHKA 4XEYA 3CSVA 1YI3A 3QRTA 4NKSA 1WCCA 5C26A 4GK2A 3DDQA 4D2SA 4C62A 3CY3A 4O1OA 4AA0A 2X6EA 4O0VA 5HLPA 2GCDA 3LCTA 4XP3A 4ACGA 3FMKA 4ZZOA 3W16A 3UIUA 4BDAA 4UMPA 3LFAA 3EL8A 5JFVA 2YCFA 3QKMA 3B8RA 1ZY4A 4GU9A 3SG8A 3ZU7A 2O63A 4UB7A 4X2KA 2IO6A 1WZYA 2Z2WA 4NM0A 4U81A 1ZYJA 2C0TA 2HXLA 2VGOA 3QYZA 4L00A 1OBGA 1PW2A 4BB4A 5AIRA 2VNYA 4FUXA 4IVCA 4M7IA 4KIKA 3ORXA 1XJDA 4I4FA 1AQ1A 1H27A 3UG2A 4LUEA 2QOOA 3VWAA 1Y6BA 2JKMA 2PE0A 4NSTA 4X3FA 3I81A 3EOCA 4FKRA 3EYHA 4TN6A 3KF4A 4FSRA 1KSWA 4PY1A 3NAXA 2JKKA 4AW1A 3WE8A 5H8EA 4QP9A 4G3DA 1JSUA 1YVJA 2Y0AA 1PXJA 1XHAA 4M14A 1FPUA 2FUMA 2WTDA 3HUCA 3LM0A 3R21A 5HU9A 1XKKA 4U43A 2W06A 2WOUA 2R5TA 4YPDA 3V01A 4KKGA 3R02A 2RG5A 3WZEA 1BL6A 4FBXA 1YOJA 2I6LA 3L8VA 4JQ7A 3UPZA 4JX3A 2BDJA 5CLPA 3RALA 2P2HA 4TYHA 1IG1A 3DLZA 4HVSA 2Z02A 1B6CB 4XX9A 5DT0A 3RZFA 3Q9XA 2WEVA 3TNPC 2OICA 4DEAA 3FYKX 4GH2A 4ZP5A 5FD2A 3PA4A 4GU6A 3NMUF 2Y6OA 3GU8A 4F64A 5CSVA 2Z7LA 2YM7A 2VWIA 1DI8A 5L4QA 2ACXA 2VTJA 2I0HA 2KTYA 4FTNA 5J1VA 2ITWA 2WQOA 4MXYA 4JAIA 2VZ6A 3QKKA 4UXQA 2J0MB 4RWKA 5AAFA 4EQCA 4EJ7A 3AGMA 4F99A 3BWFA 5D10A 2XK7A 1VYZA 4M3QA 5GIOE 2W96B 5CXHA 5DRBA 4B6LA 2E9UA 5CEIA 3C13A 2C6DA 3FMLA 3A2CA 3LFDA 3O50A 4KABA 5K0KA 4L42A 1F3MC 4LV5A 2YITA 3FMEA 2PUUA 4IC8A 3QQLA 3ZCLA 5HGIA 3CGFA 4FKWA 5ETAA 1OECA 3GVUA 3IGGA 4CXAA 4PTCA 2HWPA 3DNEA 1QPDA 4AN3A 3PRFA 1CKIA 2B52A 3NUNA 3HKOA 3QTUA 5CF6A 4AX8A 5DEYA 3T3UA 5BVKA 4PX6A 4EQUA 4HPUE 4F63A 3PVUA 5TR6A 3PSCA 5CSHA 4UMUA 4UYAA 1OL6A 2W1ZA 3HNGA 4CFUA 3ZZEA 4C61A 2VX1A 3KXHA 4EK6A 2PVRA 3RINA 3O7LD 3BE2A 5C8KA 3OROA 3ZUVA 4RLKA 5KMMA 4FEWA 2XF0A 5E92A 2GDOA 3L9NA 5D7AA 2C5YA 4ZSJA 1L3RE 4FTTA 4FGBA 2PK9A 4QQJA 5DR9A 3DAKA 1DM2A 2ZM4A 5CF8A 5KMIA 3HA6A 2OXYA 4BDDA 4O96A 5GHVA 3OXIA 2ZAZA 4OTPA 4EHVA 2RGPA 1FQ1B 4EYJA 1RDQE 4RJ5A 5ANGA 2F57A 3AC4A 3QQGA 4Z55A 1BUHA 2CN8A 3F7ZA 3PJ3A 4TKSA 4HVDA 1H00A 3V8TA 1NW1A 4N6ZA 4MYGA 4KB8A 3R8UA 2PVJA 1H4LA 1OGUA 2Q0BA 3OHTA 2OJIA 1YI4A 1YWVA 2YIQA 3DXNA 2F9GA 5HNBA 1TVOA 2PMNX 3Q9ZA 3DQWA 4ALUA 4HW7A 3A61A 2ITTA 4PPBA 4KSQA 4JOAA 3NCGA 5JMSA 1WVXA 3EFLA 4QNYA 4OTFA 4XV3A 5IQBA 1HOWA 2J50A 3FMNA 3OZ6A 4H39A 4O0XA 2ITVA 3SX9A 4IXPA 4QO9A 5AUWA 3F3UA 4RJ4A 2VTNA 3DK3A 4WNKA 5LARA 4MH7A 4EOQA 3O7LB 5HVYA 4G6NA 4J7BA 1OMWA 3KMUA 4BCMA 1S9JA 5M56A 5ACBC 1YDRE 4PNKA 4Z3VA 2OXXA 2XYUA 1GY3A 4CTBA 3BLHA 2W9ZB 4E73A 3FDNA 3L9MA 5LWMA 4X2FA 4IJPA 4HOKA 2F7ZE 2CCHA 3FXXA 3R2YA 3MA3A 1Q97A 3UE4A 2BHEA 4DTKA 2CNUA 3MFUA 4MX9A 5A4TA 3BGZA 4O86A 4Q9SA 3FEGA 3G0FA 4S32A 1F0QA 4K11A 4CYIA 4H58A 2PZ5A 3MYGA 4KBKA 3HUBA 3TV7A 4EQMA 2WPAA 3GFWA 4M8TA 1G5SA 2W0JA 3TNHA 4IX5A 4XBRA 3FL4A 5HESA 2PULA 3R28A 4O7VA 4RWLA 3HA8A 3U87A 4PPAA 1V0BA 4Y46A 4CSVA 3MN3A 2JDTA 2VTTA 4MBIA 1PXOA 4IAYA 4LOPA 4Z9LA 1NY3A 4IM0A 5GJGA 4PP9A 4QTEA 4MVFA 2ZJWA 3QLGA 2Y7JA 4YTCA 1S9IA 4MF0A 4I41A 4H1JA 1J7IA 5BVDA 4IEBA 1GIHA 4KKHA 4Q5HA 4UEUA 4GK4A 2J0JA 1OUKA 2UW5A 3ET7A 4OBQA 5CALA 2QONA 2OZAA 4IX6A 1FMOE 4G34A 2XIZA 4HGEA 5IQCA 5FP5A 5AA9A 1WVYA 4FR4A 2C30A 4NJ3A 4R3CA 2XNNA 4QMTA 3U51A 4RSSA 3VUGA 4WHZA 5BUIA 5IA4A 1BI7A 1H8FA 2CLQA 3S4QA 5HE0A 4IAFA 5CQUA 3QHWA 5I9WA 1IRKA 3I5NA 2QKRA 4XV1A 4JRVA 3BHYA 1Q4LA 3UOLA 4B8MA 5DR2A 1R39A 5A6OA 3L9PA 5LQFA 4DFUA 3HRFA 3THBA 3DZQA 4MCVA 4WSYA 1CSNA 2FO0A 5AUZA 3VS3A 3FLYA 4BCQA 5DNRA 4NCTA 1DS5A 1OIQA 1PMVA 2W1FA 3LVPA 3W2PA 4CFMA 5CANA 1LP4A 1M7QA 1M14A 1OKWA 4O0WA 4XS2A 3R7EA 2OK1A 2ERZE 3IDCA 4ZK5A 4EH3A 2C0IA 4E4XA 3R71A 4N70A 3ZUTA 3TUDA 4JIAA 1SVGA 3VBVA 3QX4A 3KA0A 4QOXA 1LUFA 4UALA 3DT1A 5EM6A 2QI8A 3SXFA 4AZVA 4BTFA 5IG1A 2QCSA 3MPTA 1RJBA 4BCOA 3VAPA 2QG7A 1H07A 3DLSA 2GNFA 4I0TA 5H8GA 5CU4A 2NO3A 1ND4A 3DXQA 4D2VA 2XK9A 5AFVA 3ROYA 5AM6A 4I22A 2ZV7A 3FZRA 5A54A 1W84A 4GUEA 1E1XA 2IN6A 3T3VA 5HICA 1REKA 3AC2A 4AGUA 1DAWA 4EWQA 4ZIMA 2BVAA 3CKWA 5L2IA 5E91A 2EXCX 4FKLA 4ZEGA 5C9CA 2Q0NA 2XIRA 2J6MA 4F9AA 3FV8A 3QTQA 4L43A 5CASA 3QQUA 4L01A 4NU1A 2WMQA 4GS6A 5FBNC 4ENXA 4UY9A 3ETAA 4II5A 4FTAA 5IKWA 2VO0A 3LQ3A 3FWQA 3KVXA 5EQEA 3PJ2A 3IDPA 2XJ1A 1Y8YA 3MI9A 5EM8A 5FXQA 2IW6A 1JKKA 4OAVB 5EW3A 4FSMA 2BIYA 3FSFA 3VHKA 3QCXA 1J3HA 1JSVA 3N9XA 4WA9A 2JC6A 3OS3A 2A19B 3VBQA 3E3BX 4AA4A 4PL3A 3PA3A 2QOIA 4ZTSA 4O7NA 2R0IA 4NM5A 5HLNA 3MY0A 3C1XA 4I93A 4BZNA 4E6CA 3KVWA 4TWPA 1PJKA 1W0XC 4FSWA 4CGAA 2CKPA 1QPEA 5F95A 4BBMA 3C9WA 2C5OA 4IB5A 4U9AA 3VBXA 3ZRLA 5M53A 3LFQA 5CI6A 3O23A 3AC5A 4U7ZA 2DWBA 4Y85A 3BKBA 3IPHA 1GJOA 2UW9A 3LFFA 3W2SA 3OMVA 2VAGA 4FIFA 5JGAA 4W4YA 2R3IA 5IUGA 3HAMA 1GZKA 3D4QA 5CNNA 5EHLA 2E2BA 4AN9A 3PLSA 4ZMFA 4IE9A 4L3LA 4BCHA 2NNWB 3C7QA 3EQDA 1JOWB 4DH8A 2JIVA 2P2IA 4IJ9A 3F66A 3ORNA 3UIXA 4YLKA 1FGIA 4GG7A 4WNMA 1UV5A 4JAJA 3GUBA 2XS0A 3BHHA 4AT4A 4JG8A 3FLQA 3OC1A 3BGQA 1P4FA 2BKZA 2WTVA 4F7SA 2G2HA 4U8ZA 1ZZ2A 2X2LA 3C50A 4QYYA 4E1ZA 4EYMA 3Q4UA 1JKSA 3E8EA 3KRJA 3MB7A 3CCNA 3QZHA 4RA5A 3DTWA 2QU6A 3OCSA 4X6QC 3NDMA 4CEGA 4USEA 2UZUE 1QMZA 1APME 4JR3A 3GU6A 4A7CA 5K0XA 3PY0A 3DJ6A 2UV2A 1SYKA 2XKCA 4BIBA 5I9VA 3TCPA 3A7JA 3VUKA 2Y4PA 3R8ZA 3VUMA 3WZJA 3ERKA 4NIFA 1HCLA 3I79A 4U42A 3VQUA 4USDA 1PXMA 5BMSA 5ANEA 5EH0A 3BLRA 4ZOGA 4FSZA 3S00A 3V8SA 3POZA 3RK9A 5ETCA 1JKTA 4EH7A 3DXPA 5ITAA 2C3JA 4WKQA 3H0YA 2QODA 5DGZA 3HRBA 3KN6A 3ALNA 4LMNA 4Q2AA 4FIEA 5HZNA 3D7TB 4I6QA 2J5FA 4LYNA 2JFMA 1YRPA 3DB6A 5CU6A 4KS7A 4DGNA 4PP7A 1H1SA 5JSMA 3NUAA 4P5ZA 3HMOA 1XQZA 3ULIA 3CLYA 2VWUA 4WG3A 4D1SA 2F2CB 2C4GA 3OG7A 1JKLA 3EQBA 3MPMA 4FKTA 2QQ7A 4BHNA 4AOTA 3IOKA 5CU3A 3V5LA 3BWJA 5C01A 4BYIA 3QCSA 2YZLA 2V0DA 4LFIA 4FKPA 5CY3A 3UO6A 4CFVA 4PDYA 1CDKA 3R1QA 5TO8A 2OFVA 1JSTA 4FSTA 2WMSA 4KIOA 4TT7A 4CRSA 4FSYA 4MXAA 4AW0A 2ITYA 2G01A 3QZGA 2YJRA 3HV5A 1ZYSA 4I5PA 1XH9A 4DLJA 2QOBA 2BHHA 3HMNA 3NNVA 4QTAA 5FEDA 5B0XA 4G17A 2C6IA 2JDSA 3A62A 4RGJA 3UJGA 5IEXA 4D4YA 4FKGA 3P7BA 1OL1A 4X21A 5L2SA 3HGKA 3CTJA 3HZTA 5CS6A 3FZOA 1X8BA 2BROA 3V5PA 4S2ZA 4R1VA 4CFNA 4EOPA 3UYSA 3ANQA 2JIIA 2VRXA 3OY3A 4WSQA 5IA1A 4GW8A 5CAPA 1ZARA 4UYNA 4FYOA 2C47A 4CV8A 4DF3A 4U0IA 3QCYA 1G8SA 5IF1A 2A27A 4XMOA 1XH5A 4WG4A 4U80A 5DWRA 4FV5A 4ZTHA 4RVTA 4ZY4A 4JI9A 3MTLA 1FINA 2VTQA 3CQEA 1YOMA 3PXZA 4EOLA 1YXTA 4RX5A 3N4VA 2C5VA 3O96A 2QD9A 5AR3A 5HNIX 5DE2A 4KBCA 4NTTA 5L8JA 1KOBA 5DH3A 3WZUA 3FE3A 4BDHA 2ETRA 4IAKA 5E8YA 3RM6A 3KULA 1U54B 1H0VA 2W1HA 4L53A 4O22A 5IZFA 3A8XA 5J1WA 4XRJA 4MQ2A 3EYGA 3EN7A 1GOLA 3TDVA 4F0GA 4E6QA 4EZ3A 3QRKA 2Z7RA 4FTOA 4L67A 2OJJA 4ANNA 4EH2A 3Q4TA 4V05A 4AF3A 4YNOA 2R7BA 4XG2A 4BCKA 4M67A 4CVAA 1OIYA 1I44A 1ZWSA 2WMWA 3BCEA 3PXRA 3JVSA 4XYFA 4C7TA 2Z7QA 4ARKA 2BAJA 4FVPA 4D0WA 5AP0A 1IR3A 4UWCA 4BC6A 4DINA 3IONA 3LXPA 3SW7A 1PYEA 2YM3A 3QFVA 4YZCA 3VS4A 2WTIA 5LVNA 4FEQA 3WF5A 3G15A 5J7HA 2C6OA 3DFCB 3OW3A 1H28A 5HG8A 2CKQA 3FQHA 4JG7A 4QMZA 2WELA 3MH0A 4FNYA 5E8VA 4DBXA 3E8CA 4C3RA 5FM2A 4KAOA 2WHBA 3PJCA 2VTSA 3IQ7A 3MJ1A 3DBCA 4NJDA 5AJQA 4F1MA 4HVIA 3BIZA 1Q8TA 4U3ZA 5DEWA 1DI9A 4J97A 4L6QA 4O0RA 5BUEA 5EKOA 5A9UA 2W9FB 4PQNA 5LXMA 3DZOA 3BZ3A 3UBDA 5HG5A 4XOZA 2W4OA 4UWBA 2IVSA 1GZOA 2BIKB 5HO8A 4Q5EA 4W8EA 5IEYA 3O2MA 3NSZA 4K8AA 2QNJA 5FXSA 3QD0A 5AWMA 4HYUA 5KHXA 4YZNA 3C4FA 2Y4IC 3LJ2A 1KUTA 4FIGA 2GNLA 3K3IA 3H4JA 2Z8CA 4GYIA 2VTPA 5BPYA 2B9HA 4JR7A 2QVSE 2R9SA 3I0OA 1ATPE 5E8TA 5B7VA 3OBGA 4MBJA 5AX9A 3UO4A 4JQ8A 4ITJA 4NM3A 5DYJA 4YJTA 4X2GA 3UC4A 4BDIA 3W33A 4E4NA 4IVBA 2CGUA 2XK4A 5J95A 1R78A 2EB3A 3F2RA 2OF2A 3F5UA 2UZNA 3ZDIA 3VIDA 4YZ9A 2UZLA 2IW8A 3SOCA 3D5VA 3LFEA 4CMUA 4AGWA 5E90A 4CYJA 2VTAA 3OXZA 5DMZA 3ZDUA 2O64A 4WT6A 4I5HA 2UW0A 1MQ4A 4D1XA 1Z57A 4CFWA 3BYVA 3SW4A 3ENHA 2J0KA 5EYCA 5IQHA 1Q8WA 1UWJA 4QT1A 2RG6A 4RJ7A 4FV8A 2E9OA 3RBWA 4RC4A 5FG8A 5BMMA 3U6IA 2VTRA 2VTHA 2O2UA 3F2NA 3UOJA 3OP5A 4P90A 3BV3A 3OTVA 3EFKA 4PDOA 3UIBA 2YIXA 2VO7A 3S1HA 3KXNA 4JIKA 4F6SA 4HVHA 1EH4A 2J0LA 3I1AA 1WVWA 2FSOX 4FZ6A 1BYGA 3R0TA 5LVLA 5K5XA 2HZ4A 2X1NA 1OKVA 3EQFA 1M17A 4F7LA 4EL9A 5LMAA 3RNYA 4TW9A 3OUNB 2G2IA 3NWWA 4P2KA 2HZNA 2V7AA 5ANIA 4PTEA 4MNEB 3UVQA 4LMUA 4YTIA 4BKJA 1OZ1A 4YTFA 5T3QA 2QC6A 3EIDA 4EJNA 2W4KA 3C5UA 3FI8A 2VU3A 2QOKA 4FGRA 4FOCA 4FZFB 5L6WL 2NPQA 1FVVA 4G6OA 4G9RA 2PUIA 1IAJA 1OPJA 3KMWA 4J98A 3FKOA 3KRLA 4S33A 4XBUA 4OLIA 3OWJA 4BCFA 4IHPA 2RFDA 2V22A 3COMA 3AT2A 3VS0A 5HG7A 3MVMA 3AD5A 3E93A 4DA5A 2EU9A 2JDRA 2IZSA 3AMBA 3BQRA 4YZMA 5D7VA 2WEIA 5EYMA 2BZIB 1XWSA 5HIDA 4DN5A 5M4FA 2W5BA 3CC6A 1NA7A 2G15A 2GHLA 4MXXA 4RFYA 4MKCA 4XH6A 4AQCA 3O51A 4PUZA 4FV0A 4YBJA 5EW9A 4OTHA 4RA4A 3ZO3A 4D9TA 3JVRA 4EWHA 3R1YA 4FT5A 4U5JA 4W4XA 5CEMA 5KO1A 2GHGA 5DN3A 3WIGA 4CV9A 4EORA 2W1EA 3R6XA 4CMTA 1J7UA 3UVPA 2UW8A 1XH4A 3P08A 3FZSA 3DKFA 4DFZE 2C6TA 5JRSA 3NW6A 4RJ3A 3ZSIA 4CNHA 3PP1A 2WNTA 4EUTA 3BELA 3ALOA 4RIWB 3TM0A 4KRDA 5M57A 5L2TA 3FI4A 5HO7A 4GFOA 4V0GA 4Y95A 2EXEA 3W8QA 5BVOA 4IZAA 3DFAA 4KIQA 1O9UA 4M12A 5IISA 3OCTA 4NL0A 5AV4A 3PPKA 1Y8GA 4ZLZA 4DFBA 4PMPA 3BRBA 1H25A 2CNQA 5CT0A 5DLSA 3S3IA 4DT9A 4IWOA 3OT3A 3RNIA 4DG2E 5CT7A 4DFLA 1TQMA 2BTRA 2JLDA 2QU5A 4K77A 3TKUA 3VRYA 4D2WA 2WMBA 2NP8A 4TYIA 2DS1A 4U3YA 4DTAA 5TOZA 2FH9A 1YDSE 1M52A 3QC9A 3EN9A 4O6EA 4X7QA 2BCJA 5AV3A 3PZHA 2BZKB 2VWBA 4M69B 3DY7A 4PNIA 4DG3E 5JZNA 3PP0A 3ZEWA 3T8OA 3EQPA 1Q41A 1Q5KA 2PMIA 3R7VA 3TKIA 1GAGA 2CN5A 3U8WA 5HTBA 4I6FA 2YM4A 2REIA 5J5SA 5LCJA 5IQEA 1ZYLA 4J71A 3DAEA 1YXVA 4HYHA 2JD5A 2Q83A 3BGPA 4FODA 4JBOA 5KCVA 2UUEA 4ZZNA 1KE9A 4DH7A 4WBBB 1CMKE 2OH0E 3R8PA 3UVRA 4ZAUA 4YLLA 5CU2A 3T9TA 3LMGA 3DK6A 5M4IA 2ONLC 1NVSA 3PYYA 3QYWA 2ESMA 5AV1A 4YU2A 4D4VA 3Q2MA 1FVRA 5JT2A 3PSDA 2FSMX 2WGJA 3IW4A 4OBPA 3E7VA 5AM7A 5EHOA 3AQVA 4C38A 3FKNA 4IVDA 4PV0A 5IA5A 5HKMA 2NRYA 1PXNA 4C37A 3MPAA 5A4EA 3SV0A 4EONA 4F65A 4DTBA 5HTCA 4JG6A 4HGSA 4ACMA 3LHJA 2UZTA 1KE8A 2CDZA 2PVFA 3BLQA 2PHKA 2IWIA 4GFMA 4Y73A 2VNWA 3SD0A 3AXWA 3TKHA 3QUPA 5G6VA 3LMHA 4B9DA 3D0EA 4YJSA 4BDEA 4R6VA 3OT8A 1R1WA 5CSXA 5HQ0A 3QTRA 4Y83A 4PMSA 5HEZA 1YW2A 3MVLA 4CLIA 4OTDA 1PKDA 2OXDA 4I0SA 3MY1A 4O91A 3UGCA 1WBWA 5CYIA 5A14A 3O17A 2W1GA 2XJ0A 2P0CA 3UODA 1JVPP 2PZRA 1VJYA 4FKOA 3G51A 3LCKA 3UNJA 1ZYDA 4YNEA 4EHZA 4GMYA 1UNLA 4B4LA 5H3QA 5AR7A 4KS8A 5A4QA 3FI2A 1ZOEA 3VNTA 4L68A 1UA2A 3ELJA 3TUCA 3BQCA 3I6UA 2VTOA 3NIZA 3QQJA 2YEXA 4YO4A 3C0IA 2R64A 4YC6A 2VGPA 3H3CA 4GKHA 4BDBA 4ZSAA 2XEYA 1PRYA 2J2IB 4IM2A 3ZLXA 4D2RA 3D9VA 4C57A 2ZYBA 1VR2A 3P4KA 2ZMCA 3F61A 4ZS0A 2R3GA 2QOHA 2Y4IB 2PZIA 1ZY5A 3KCFA 4JS8A 1YQJA 3BEAA 3FKLA 3F5PA 3GCSA 2ZB0A 2XP2A 3A4PA 3AC8A 3FXWA 3NUUA 2BR1A 4S31A 5E8WA 2GSFA 4FTJA 2YCQA 4IX4A 3VW8A 1YXSA 3CPBA 4HCUA 2GFSA 4NH1A 3SC1A 4IANA 3R7GA 3A7FA 4ZZMA 4B0GA 5IH4A 5M44A 4AA5A 4IH8A 2OO8X 2JKQA 3QZIA 2RFEA 4A9SA 2PSQA 3AC3A 3MFSA 4EOMA 3PIXA 4WOVA 3DQXA 4QTCA 4L7FA 3GU7A 2XUUA 4AZEA 3O71A 5IUIA 3C4CA 4BI2A 1V0OA 1V1KA 2F7EE 3E92A 3PVBA 3H30A 1Q8UA 4PDSA 4YJOA 5DVRA 1L8TA 4FT3A 2XNBA 4G1WA 4DCEA 2BKKA 2B53A 2GTNA 5J8IA 2RIOA 3R7UA 1U4DA 2R4BA 2JFLA 3EWHA 4BF2A 3U6HA 4HZSA 4PL5A 3MJ2A 3D2KA 3RAIA 5KUPA 4FKJA 4MTAA 4FV1A 4GKIA 2R0UA 2R3FA 3BEGA 4S30A 5E8UA 1GIIA 4NCTC 3QKLA 5EM7A 3F9NA 3JS2A 1B39A 2CJMA 2C3KA 3LZBA 4PWNA 3IW8A 3RMFA 2A0CX 4FTQA 4AACA 5AAGA 1U5RA 2YN8A 3OW4A 4D0XA 4FE2A 3G9LX 3OUKA 3UZRA 3KREA 4YTHA 1OL5A 1U5QA 2C1AA 3NUPA 3ROCA 2C6MA 3GB2A 3GGFA 2QURA 4IW0A 3DBFA 4KIKB 4QP3A 4LG4A 3KKVA 5LMBA 3CEKA 3GNIB 4FZAB 4X3FB 2BILB 4MHAA 1SMHA 3KRWA 4E5WA 4JDJA 1O6YA 3HP5A 4FV7A 4IB3A 4F9YA 5J79A 5M51A 3K3JA 1W98A 3RJCA 3KRXA 4OTWA 3NCZA 2VTMA 2WU6A 4USFA 2C6KA 2YA9A 3UPXA 4IB0A 2ZV9A 3VF8A 1J91A 4C33A 3MV5A 2X8IA 4XP0A 5TF9A 1VZOA 3OOMA 2V7OA 5JKGA 3BI6A 4G31A 5IQAA 3M2WA 4ASEA 3GU5A 5LVOA 5CEQA 2BTSA 3GU4A 1SVHA 5HLWA 5JZJA 5IMXA 3I5ZA 3D15A 3FMHA 1U46A 3CTQA 3C4XA 4TYHB 4X2JA 4CZTA 3RK5A 1P2AA 2VO6A 3EJ1A 4FT7A 5A3XA 1OL2A 4HGTA 5AR2A 3QTZA 4AWIA 4NKAA 3W1FA 3SQQA 4EH5A 5BVFA 4BDJA 2XA4A 2GPHA 3LMIA 3Q4ZA 4FKQA 1H24A 5EDPA 3ZRKA 1AGWA 4J52A 2VWYA 3UP2A 3P78A 4E4LA 5AEPA 3N4UA 3R1SA 4CQEA 3IW7A 4DEDA 4CKRA 4C35A 1VYWA 1ZZLA 1M2PA 4C4GA 3ODYX 2OJGA 2UZEA 4IACA 2ITNA 4EK4A 4NEUA 3ZH8A 4TXCA 4GIHA 4JQEA 3MW1A 4EUUA 4FEXA 4MEDA 2PU8A 1OPKA 3G6GA 4O0TA 4L9IA 4HGLA 4UWYA 4R3PA 3MB6A 4YJUA 3HLLA 5E8XA 2PVNA 4JNWA 2OSCA 3LAUA 2C6EA 4CG8A 3HL7A 1M2RA 1YHVA 4XRLA 4LRMA 2PY3A 4I4EA 2HY0A 4GVAA 3NLBA 4HPTE 2XYNA 1E9HA 4GT3A 2YDIA 1UWHA 4NZWB 4G9CA 4JT3A 4RQKA 1YDTE 3WF6A 5AA8A 4K9YA 4D55A 3BHVA 3ZMMA 3GCQA 3UO5A 4IDTA 5LMKA 5EDQA 4O0YA 5IDNA 4CQGA 3SLSA 4LGHA 2C6LA 3ORMA 1K2PA 2X9FA 3FZ1A 2DQ7X 3ORIA 3G33A 3VHEA 2YERA 2B7AA 4AU8A 4WUAA 4QMVA 2WQMA 3VS6A 5KBQA 3NNUA 4IWPA 5BYZA 2QO9A 4QYFA 4ANBA 4IVAA 4DAWA 4NUSA 4D2PA 3D83A 3IECA 4DBNA 5E4HA 3FUPA 3REPA 1Y57A 3S2PA 4C3FA 2B54A 4BBEA 2X9EA 3PZEA 3VS2A 4D28A 4UN0C 3LXKA 4TWCA 4A9RA 2XRUA 3M1SA 3R9NA 3TACA 3RM7A 3JYAA 4CCUA 3F2AA 4QTBA 4O84A 5GINE 4JVGA 3F3VA 2WQBA 4R5SA 1IAHA 4IAIA 5L6PA 5HIBA 3CY2A 2FSLX 5F1ZA 4C58A 3TZ8A 4IZ7A 4FTCA 3KL8A 4OAUC 5KNJA 1H0WA 2BDWA 4I20A 3UQFA 1STCE 1UNHA 3BYUA 3GCVA 2UZVA 3U4WA 4XP2A 4O7ZA 4E6DA 3I60A 4ZLYA 3EQCA 2WMVA 2QG5A 3ZO4A 3PY1A 4Z16A 3ACJA 3NGAA 5JFWA 3RGFA 4E93A 4ZMEA 1UNGA 3PLAE 4WRSA 4MXCA 4EH4A 3QALE 2OKRA 3QL8A 3KF7A 2JDOA 3NW7A 4MWHA 4QMWA 3RZBA 4ANLA 4FZ7A 1H01A 5JFSA 3D5XA 5JH6A 3Q2JA 3QTXA 4FT0A 2C3IB 3LIJA 4P4CA 3U9CA 2C69A 4I6HA 3TJDA 4FNZA 1U59A 5KE0A 3KY2A 1OUYA 3QX2A 3LLTA 4DLIA 3FC1X 5CWZA 4DGGA 5IA2A 4AP7A 5FP6A 4O83A 4TRLA 2R3LA 4XJ0A 4C59A 3LXNA 3SVVA 1JPAA 3MIYA 3FBVA 4D2TA 4EBWA 2W5AA 4JBPA 2WKMA 4XHKB 3RPYA 4PDPA 3MFRA 3LCOA 3NNXA 4XV9A 3MH3A 4GV1A 1G8AA 4RMZA 3IKAA 4L52A 3RWPA 2PTKA 1TQPA 5H2UA 2AC5A 1XH7A 3W2OA 5M4CA 1Q99A 2WMRA 3S95A 2AYPA 1WFCA 3PA5A 2OU7A 1TKIA 2O0UA 2O8YA 3P79A 4RIYA 4FUYA 3TDWA 2PWLA 4TWOA 4ITHA 2Z7SA 3Q5IA 2GS7A 4R8QA 4M0ZA 4A4XA 1PF8A 4GL9A 3V04A 4F1OA 5KZ0A 3LCSA 3B2WA 4ANOA 3UZTA 5LVPA 2QLQA 5IQIA 4RFZA 3W18A 3VN9A 5KKRC 4R7BA 4R7HA 4P5QA 2VV9A 4FEVA 4A06A 2PVHA 2IJMA 1KWPA 4QP6A 4X2NA 5DFPA 5E8ZA 5CF4A 3LLAA 4IBMA 1BLXA 5TT7A 3R8LA 5C1QB 3QHRA 1YKRA 4O81A 5KMNA 1ZMUA 3RPRA 5B2MA 3TG1A 2OZAB 3HMPA 4EC8A 4R7IA 5A4CA 4O82A 4DH1A 4W9WA 4QMPA 2HWOA 4QMNA 2PVLA 1YI6A 4IMYA 5HCZA 3NW5A 2GU8A 4TYEA 2BDFA 4AZWA 4CMOA 4BTJA 3FY0A 4GRBA 4FYNA 3H10A 4GCJA 5CAQA 4U40A 4C3PA 3A60A 3PPZA 1WAKA 3C0GA 4RBLA 3K5UA 3PIZA 3TZ7A 2R2PA 4DFXE 2YACA 1GZ8A 4Z7GA 2UW4A 1REJA 2GNJA 2YFXA 3KRRA 3TJCA 5C4KA 3R2BA 2XH5A 2QKWB 4DGMA 4IZYA 2ITXA 4FL2A 5J9YA 2B9JA 4EKKA 1LEWA 3HDMA 3NS9A 2JITA 2UZBA 4HYIA 2E9VA 3I7BA 5E8SA 4CFFA 5J9ZA 2UW3A 3DBDA 2I0YA 4MD8E 3UNKA 5E9EA 3KK9A 5FTQA 4ZJIA 2G1TA 5HVKA 4NK9A 4HCVA 3RPVA 3TWJA 3R01A 3WYXA 3GC9A 4BI0A 2BRBA 4NW5A 3QQHA 4JX7A 4DGOA 5AP7A 2BUJA 4IZ5A 3WOWA 4N4SA 4EOKA 4G3EA 3W2RA 3BBWA 1OKYA 1UU7A 3SKCA 3PJ8A 4RVMA 4FNWA 2F4JA 1FGKA 1PMEA 4OGRA 1O6LA 3MIAA 5L2WA 1PY5A 1O6KA 4QQCA 4RIXB 3OCBA 5GZ9A 4R1YA 4BKYA 4R77A 3D5UA 3TI1A 5EM5A 4MNEA 1YWRA 3OVVA 4KBAA 3ORPA 2PMLX 3OWPA 4H1MA 4NFMA 3WYYA 2RF9A 5HD4A 3ZFYA 2OLCA 4I1ZA 1W8CA 4JDHA 5BVNA 3OWKA 4A4LA 5DG5A 5CXZA 2YAKA 1PXKA 3ZFXA 5HVJA 5FWKK 2JIUA 4F6UA 3DCVA 3Q96A 2IZUA 3HP2A 2YM8A 2QOQA 3FY2A 3Q60A 4G16A 4BY9E 2YLFA 3FMMA 2WMAA 4I3ZA 2XNGA 1RQQA 3ORTA 4JDIA 4YHJA 4WG5A 3VBTA
chains in the Genus database with same CATH superfamily
3NYNA 4NTSA 3V5WA 3BE9A 3Q9YA 4L3JA 5ETIA 3RPOA 3BYMA 3BBTB 4C4HA 3RI1A 2JAVA 3ZBFA 3IG7A 2XCKA 3IO7A 2ZV8A 1YHSA 1JNKA 4FTRA 2RL5A 3G6HA 4OW8A 3VJOA 3ZLYA 3GXLA 2BAQA 3QAME 4I24A 5JGBA 3ID6C 4D5HA 1OI9A 2JAMA 3DA6A 4KIPA 3NAYA 4WUNA 3A7HA 3R00A 3IW6A 2BPMA 3ZC6A 5DT4A 4WNPA 4BZDA 4MNFA 1ZAOA 5T6KA 2YWVA 3GC0A 2HENA 5M55A 4GIIA 3UIMA 4QMUA 3ZOSA 3P7CA 5EHYA 1BX6A 2HW6A 2QR7A 4RIWA 5H9BA 2X39A 2B1PA 4J1RA 5D41A 5HE1A 3PXYA 4XUFA 5D1JA 3WF9A 3MH1A 3PUPA 5C8MA 2J0IA 1ERKA 1R0EA 4FV9A 2Y6MA 4G3CA 4FTMA 5L8LA 2OIQA 4MF1A 3GC8A 3DOGA 3VUHA 4MBLA 4XV2A 4YZDA 3E64A 5FDXA 4BWKA 5GIPE 3LXLA 4O1PA 4IX3A 4FI1A 4BHZA 4GEOA 4ANMA 3IK3A 2X7GA 3HV6A 5C03A 3DBQA 3SA0A 3QA8A 5HI2A 3WILA 3EZVA 1OB3A 2FGIA 5D9HA 4R78A 2YM6A 4AAAA 4FK6A 4KWPA 3TUBA 3GT8A 4ZY6A 3F3TA 4P7EA 2ITQA 4AUAA 4C02A 4KUJA 4J96A 4H36A 4CT2A 1MRYA 4O6LA 1OL7A 2IG7A 3BHTA 3G0EA 2VN9A 4K0YA 3ZBXA 1DAYA 2I0EA 3R63A 2GQRA 3MGYA 3DJ5A 3KU2A 3QRUA 5LOHA 4FG7A 2OW3A 1H26A 1Q8YA 4LRJA 4FG9A 2XJ2A 3M42A 4V04A 4FSUA 1H1WA 3Q9WA 5C4LA 4FZDB 3SGCA 2CLXA 1OBDA 3AKJA 4EH9A 4G5JA 3QTWA 3CKXA 4TY1A 3V3VA 2VO3A 2I1MA 4IWDA 4D5KA 4MWIA 3OD6X 1CM8A 1A06A 2X6DA 2GFCA 4QYGA 3L8XA 1ZMVA 4U45A 2J7TA 3K54A 2OIBA 2EXMA 4NIFB 3BYSA 3E7OA 4D4RA 3UZPA 4A07A 3QZFA 2CPKE 3LW0A 3MBLA 1H1QA 4ZSEA 3UG1A 5CSPA 3VUDA 4FTLA 4E6AA 3SXSA 2ETKA 2GS2A 3DBEA 4Z7HA 1Q3DA 5CVFA 5BVEA 2H34A 4GVJA 3RAWA 5CI7A 1FBNA 3L8SA 3PRIA 3I4BA 3RAKA 5EDRA 2OH4A 3UMXA 2IVTA 3ZLWA 4TL0A 3GEQA 4DH3A 5L8KA 2X81A 5AV2A 4F1TA 5KMLA 3MY5A 4LUDA 4YURA 3AD6A 3QBNA 4QMMA 3FZPA 4E4MA 3BX5A 2XNEA 1XO2B 5ICPA 3O8TA 3NYOA 3OTUA 2P33A 3EFWA 4AW5A 4C8BA 2WFYA 1SNXA 4OTGA 4X3FC 2KULA 3NVMB 4FSNA 4ZXTA 4ZY5A 3D94A 3P1AA 1TQIA 2OFUA 3P23A 3FQEA 2YCRA 5CU0A 2BAKA 4YSJA 3C4EA 2RSVA 3KC3A 2LAVA 4OT5A 3H9FA 1ZLTA 3P86A 3ZONA 3F5GA 4KRCA 5BUJA 3COHA 2E9PA 2V5QA 1QPJA 2XKDA 3E5AA 4MD7E 1SNUA 3TV6A 4E7WA 3KK8A 3A7IA 4GJ2A 2OG8A 2QLUA 3TT0A 2WMTA 4EI4A 4AXCA 1URCA 2P3GX 5FRIA 3BHUA 4BDCA 1XH6A 4L44A 3MTFA 3WF7A 3OWLA 4I5MA 1OIRA 1YXXA 2R3MA 1UU8A 3D2IA 5M07A 5LJJA 4BR3A 4OTIA 5CEPA 2ZV2A 5KKRB 4AZFA 1IEPA 1Y6AA 2BMCA 5GNKA 4LOQA 4LI5A 4LQMA 2QO7A 5M08A 4C4FA 3ZRMA 4EK3A 4AE6A 4O7SA 4JBVA 4MQ1A 4ALVA 4B99A 4BTKA 2UZOA 2XB7A 4BGGA 2OI4X 4F9WA 2BALA 4QMXA 3DPKA 3VBYA 4E20A 2XM8A 3EN4A 3LE6A 3MS9A 5IH6A 4O0UA 4ONAA 4ZSLA 5K4IA 3ORZA 3VRZA 3FI3A 2ITUA 4YJRA 4DHFA 1A48A 1UKIA 4U97A 4UV0A 4ERKA 4AE9A 4M13A 1WBTA 2QOCA 3ZC5A 4DEBA 5IQFA 5I9ZA 2XNPA 3VQHA 3D14A 3E8NA 2R3JA 3PPJA 4JBQA 2PYWA 1LEZA 4ASXA 2YIWA 1QL6A 3RPSA 3KFAA 3KULB 3ANRA 4D1ZA 2C1BA 4G3FA 4FKSA 4F70A 2WTWA 4IM3A 2UVYA 3ORLA 4YHTA 4YSMA 4RIOA 4WRGA 3FHIA 3I6WA 3AMAA 3CJGA 5ETFA 1V0PA 4QP1A 2XEZA 3EQIA 5EYDA 3E8DA 5D11A 4EOIA 3GENA 2ZB1A 4RVKA 3NFFB 1FVTA 3DAJA 2PVKA 4BIDA 3GCPA 2NRUA 3KXZA 2XMYA 5AR4A 1E1VA 2HY81 2VTLA 3ZSGA 3KGAA 1OM1A 4O21A 2IZTA 3ODZX 4F6WA 5FBOA 4OTRA 4W8DA 3FC2A 3LQ8A 2I7QA 2FYSA 1OKZA 1CTPE 5I3RA 3DDPA 4W4VA 4RX7A 4HCTA 4XG6A 3LQ5A 4LRKA 4QPAA 3PXKA 4TZRA 4YZBA 4E3CA 4ZJVA 5I9YA 5EI8A 5FUTA 5DR6A 3EQGA 3MVHA 3EN5A 3MESA 3V5TA 5AP1A 1Q24A 3MDYA 4XG7A 5CEOA 3KXGA 4BN1A 1GZNA 3PE1A 3AKLA 4RX8A 3OFMA 4XCUA 4Q9ZA 3W10A 3HRCA 2GNGA 3Q6UA 2XBJA 1YWNA 4GSBA 4TYGA 2IVUA 5IU2A 3W55A 3EHAA 3Q32A 4FKIA 4GT4A 4J95A 5ANJA 5AUXA 3WZKA 4BCPA 2WTKB 1KV2A 3EL7A 2WU7A 1NVRA 4FT9A 5CZIA 5I9UA 4M66A 2W7XA 4BTMA 3SHEA 4IDVA 4G5PA 5IMEA 2OWBA 4KD1A 3QF9A 1W7HA 3TNQB 5F9EA 2HXQA 3IGOA 1ZMWA 5EKNA 2B9IA 1IA9A 3DTCA 1ZXEA 4WO5A 5CSWA 5IPJA 4WBOA 5CENA 2BFXA 3T9IA 4QP2A 4AGDA 2WAJA 4QMQA 5EFQA 4BKZA 2JEDA 4X6RA 3V6SA 4DH5A 3PVWA 4BGQA 3ACKA 3R8MA 2JGZA 2C5XA 4RJ8A 3PG3A 3WI6A 2YISA 4M68A 3F3WA 4FICA 3R7IA 4O7WA 4FEUA 1NVQA 5BVWA 3R8VA 1OVEA 2X4ZA 1QCFA 1UU9A 2PVMA 3G9NA 4BRXA 4ENYA 4AW2A 2VWWA 2WQNA 4DT8A 5KZIA 4K33A 3B2TA 3W2QA 3Q04A 3BYOA 2HYYA 1IA8A 4EEVA 4YO6A 3DB8A 4YUQA 4L45A 3U4UA 4IWQA 3SRVB 4BCJA 1MP8A 5AP6A 4TNDA 2CGVA 2PUPA 4AT3A 4FA2A 3ZO2A 3OCGA 3VW6A 4M84A 3LFCA 3AT4A 5JQ5A 4YC3A 5K5NA 2OIDA 4F0FA 4KA3A 3ZS5A 2WTCA 3OF0A 4ID7A 4F9CA 2A1AB 3OEZA 4RZVA 2CNVA 2R3OA 4FV4A 1J7LA 2XK6A 2B0QA 4N0SA 4I21A 5L6OA 1Q3WA 4I23A 2X2KA 5HE2A 4RG0A 4TPTA 4YJVA 4RFMA 1JBPE 5J87A 4TTHB 3DK7A 3O8PA 4RJ6A 1MUOA 4KNBA 3R7OA 3NVKI 2F2UA 2P4IA 5I3OA 2W1IA 2ZMDA 3PXFA 5GJDA 4BI1A 4FK3A 4EKLA 4EOJA 2X2MA 2R3RA 2ITOA 4UXLA 3CR0A 4BBFA 4K18A 3W32A 5EQPA 3WF8A 4DE4A 2CSNA 3KXMA 2DYLA 3R04A 2OZOA 1PYXA 3HX4A 4J53A 1WBSA 2R3HA 3A99A 3DNDA 4J8MA 4MD9E 4X3JA 2R3QA 4ZSGA 2HIWA 2XK8A 4YHFA 4NYEA 3IDBA 5K4JA 4YJQA 4DEEA 3RWQA 4QTDA 2RFNA 5B2LA 4PMTA 5I0BA 3FLNC 4ASDA 2EVAA 4FG8A 2YWPA 2ONLA 4IFGA 4QP7A 4EBVA 1JQHA 4U44A 4AOIA 3QC4A 5AMNA 3QQKA 3IS5A 2R3KA 3G2FA 5HCYA 3TIYA 4C36A 3QCQA 3R9RA 3UQCA 4D9UA 2HELA 5F94A 2PL0A 4O2ZA 2PMOX 3CPCA 5T68A 4YR8A 3CTHA 2W1DA 4UX9A 4RPVA 5KMOA 3TNIA 5JQ8A 4XOYA 3GFEA 4EK5A 4I94A 3HMIA 4HYSA 1PMNA 4CZYB 3DJ7A 4XG3A 5AP4A 2RFSA 4O7TA 1M7NA 2J5EA 1JWHA 3SOAA 4U6RA 4FF8A 4PF4A 4EK8A 4DFYA 4XLVA 4UMRA 2H96A 2RKUA 5CNOA 4V0GB 3C5IA 3AD4A 3N4TA 1XH8A 5M09A 3ITZA 4DEIA 4C34A 4PL4A 1H08A 4G3GA 4F0IA 3E3PA 3E62A 4FV3A 4RLLA 2AEGA 4QPSA 5HD7A 5IEVA 2HZ0A 2JBPA 3CIKA 4WD5A 5AAEA 5LMKC 4CRLA 3NEWA 1Z5MA 2WMXA 3U6JA 1A9UA 3GCUA 5JK3A 4EOSA 3FYJX 2B55A 1KV1A 2GNIA 5EYKA 3HV7A 4PRJA 2CGWA 4ZS4A 5EOBA 1R0PA 2YHVA 4QYHA 3ZUUA 4KSPA 4C2VA 4IFCA 3MA6A 1OITA 2OGVA 2FSTX 4IAZA 1H1RA 4FTKA 3V8WA 3VO3A 4RX9A 3GC7A 4DFNA 3SG9A 3LFNA 2CGXA 3NYVA 3ZTXA 1NXKA 3QTSA 3F88A 4C2WA 2VX3A 2OBJA 2A2AA 4BCIA 3UTOA 4F09A 1T45A 3LOKA 4AG8A 3RP9A 3R9HA 1WBPA 1UKHA 3QU0A 3TXOA 3EZRA 4FVRA 3QA0A 5JN2A 5AP2A 4GK3A 3FZTA 3FXZA 5KHWA 3PWYA 3WE4A 2VWXA 4BZOA 2WMUA 3CP9A 4MAOA 4QMYA 5CAOA 5I5ZA 3DU8A 4NW6A 3VUIA 4DC2A 3HDNA 2R3PA 2VWZA 5AR5A 5HBHA 1P14A 4FKVA 3ATTA 5CEKA 2X8DA 3R1NA 3U9NA 1LR4A 2QOLA 1HCKA 4F4PA 4IADA 4UBAA 3CD8A 4EHEA 2AC3A 5AP5A 3D7TA 3VUTA 3FL5A 1ZOGA 1BI8A 2X7OA 2Y8OA 2VD5A 3ZSHA 4ACDA 4ANQA 2SRCA 4B8LA 2OJ9A 2WXVA 5CTPA 3WBLA 1XBAA 2W17A 3COIA 3FPMA 3WZDA 4M0YA 3L9LA 4NWMA 1WBVA 3TZMA 3VC4A 2JBOA 2B9FA 5ANDA 1RE8A 4GYGA 3ZHPC 2IPXA 2C5NA 5J5TA 4BJJA 2XM9A 5ACKA 1NT2A 1LPUA 2W05A 2BFYA 3Q4CA 4KINA 2ZDUA 4ACCA 4F7JA 3QD3A 1BL7A 5CVGA 3I0QA 4YC8A 3MSSA 3OXTA 1PXPA 2VX0A 2YIRA 3C51A 5AP3A 3ULZA 4AT5A 4O2PA 1VEBA 3SXRA 5FTGA 4AFEA 2GHMA 4E5AX 3UC3A 2LGCA 3QRJA 3UMWA 2GS6A 5FGKA 1JAMA 2CKEA 4AQKA 3ZO1A 3KQ7A 1WMKA 4H3QA 5TE0A 4E26A 4TWNA 3KXXA 3IOPA 3QWJA 3Q5ZA 4QDVA 2HW7A 1CKPA 4HZRA 3D7ZA 3GI3A 4RIXA 3QGWA 4UMQA 3AT3A 3B8QA 3FLSA 2WO6A 4FX3A 4GJ3A 5BYLA 3W0MA 4YLJA 2ERKA 2XKEA 4BWXA 2XARA 3LFBA 3VBWA 5F4NA 3FQSA 2E9NA 2F7XE 4JLCA 5DRDA 5AADA 1QPCA 2UVXA 2G2FA 5DHJA 3M11A 4NFNA 3FSKA 5AIKA 4BDKA 3FHRA 2YLEA 3BU6A 3HVCA 4L46A 4OT6A 2XIXA 1AD5A 3V6RA 2ITZA 3EMGA 3R30A 3LJ1A 3II5A 3FAAA 4QMLA 4R3RA 5ANOA 3TZ9A 1XBCA 4DITA 4H05A 1UU3A 3P0MA 1MRVA 4CG9A 5A6NA 2WOTA 4O0SA 4GFGA 1YXUA 3ZM9A 3PY3A 5FTOA 3K5VA 3F82A 3GOKA 4JL9A 4N6YA 4OUCA 4FOBA 3CS9A 4BCGA 4M15A 1U54A 4APCA 3NX8A 5IA3A 3DGKA 3PFQA 4AZTA 2GQGA 3Q52A 3ZLSA 2X7FA 5I4NA 3PIYA 3UNZA 3QRIA 5C8NA 1SVEA 5HU3A 3QD4A 5JFXA 4K2RA 3CQUA 4LDTA 5L3AA 4L3PA 3R83A 3KEXA 1KOAA 3QXPA 4ZJJA 5DPVA 3C4WA 4RZWA 3POOA 4AS0A 4CLJA 2ZM3A 2YZAA 3TV4A 5AUYA 4YMJA 4IC7A 5IUHA 3CD3A 3QWKA 2H9VA 2X0PA 3AG9A 5BNJA 4MK0A 5C27A 3R73A 2C68A 4TNBA 2EUFB 5EI2A 3AGLA 3TNWA 4FKUA 5AUVA 2FA2A 2Y9QA 4EZ7A 1RW8A 3QQFA 3RCJA 4ALWA 2V55A 1YHWA 2XRWA 2X4FA 5E7RA 5HTIA 5IA0A 2YDKA 3CE3A 4B7TA 3ORKA 4QRCA 2F49A 3R9OA 4WIHA 1URWA 3PSBA 2XZSA 3R9DA 5EOLA 3UYTA 3RTPA 3PWDA 4FMQA 4RT7A 2Z60A 4EOOA 2PPQA 3O0GA 5HCXA 1WBNA 4IQ6A 3OEFX 1M2QA 2H6DA 1YOLA 3ZXTA 2YCSA 2YABA 3QD2B 4ANSA 1OPLA 3EQHA 4M97A 3PTGA 3FLZA 3I7CA 3VS1A 4DCAA 4FIHA 3FMDA 2DUVA 2WZJA 5IDPA 3JR1A 2ZOQA 4AGCA 4APPA 3DKGA 3H0ZA 4IB1A 5GJFA 5LWNA 2HZIA 5IQDA 4LL5A 4BFMA 2EB2A 4AOJA 3U54A 4BVUA 1ZOHA 4A4OA 2ZDTA 5GZAA 3A4OX 2CMWA 4JDKA 2VWVA 1Z9XA 4JRNA 4ZTNA 1MQBA 1I09A 5K3YA 2R7IA 4Y72A 3VVHA 3AC1A 3HECA 4LGGA 4FV6A 4XG9A 5FXRA 4G6LA 4O27B 4O7RA 1CKJA 1R3CA 3LPBA 3Q3BA 2I0VA 3EQRA 5L2QA 3HAVA 3FPQA 3NUXA 4KKEA 3GP0A 5ANKA 5B2KA 3RKBA 3V5JA 1ZYCA 5BYYA 4YPSA 4A9UA 1K3AA 4O7YA 2ZVAA 2WIHA 2OJFE 3RVGA 4DGLC 3FMJA 4U79A 2GNHA 3GOPA 4LL0A 3UQGA 3HMMA 3NZ0A 2PUNA 2PE1A 3BU5A 3F69A 4ORKA 3EN6A 1SZMA 5FEEA 3Q6WA 4GG5A 1PXIA 2BZHB 3IW5A 5E1SA 1FMKA 2J90A 3AMYA 2BRHA 2HOGA 3H9OA 4H3BA 3EB0A 3O8UA 1SM2A 3V51A 4EC9A 4Y8DA 2BZJA 4D4SA 1W83A 4FV2A 2AQXA 2WQEA 5EI6A 1G3NA 2PVYA 3E63A 4QMOA 2UW6A 2UW7A 4XNEA 4MXZA 5KX8A 4CT1A 2B4SB 3P7AA 4QQ5A 5H8BA 4XG4A 4XLIA 3F6XA 1Y91A 5F20A 2XKFA 3NUYA 1MRUA 3MWUA 4IAAA 4ITIA 5TKDA 5BX0A 3MVJA 3L8PA 3W2CA 1P5EA 3JUHA 4CKJA 4QPMA 5FQDC 5AV0A 4C4JA 2CCIA 5DI1A 5M06A 3CJFA 1BKXA 3HV4A 2XNOA 4F08A 3DKOA 3RCDA 2IVVA 3BV2A 4CTCA 5JRQA 1J1CA 2QHNA 4FTIA 4K6ZA 3G90X 3U55A 4W9XA 4CKIA 3TN8A 4L7SA 4ZTQA 2UVZA 3F7WA 2JDVA 3UDBA 4EH6A 5KMKA 5AUUA 4FSQA 4DHZA 4A9YA 3P5KA 1PXLA 2G9XA 4PMMA 2WTKC 2W1CA 4HVGA 5K9IA 3G5DA 4YP8A 1H1PA 4RWIA 2EWAA 2ETMA 2IZRA 5HOAA 4X0MA 2BRGA 4DYMA 2C3LA 4A9TA 5HHWA 3JXWA 3VJNA 2XCHA 3BU3A 4O4EA 4PPCA 4HNIA 4LV8A 3DV3A 5EG3A 2XAMA 5KMJA 3JY9A 1F5QA 3DKCA 3NYXA 1BMKA 4RWJA 4ASZA 2XK3A 4LGDA 3QTIA 4YJPA 4JJRA 4FVQA 2OF4A 5HX8A 5HORA 2FB8A 2X0GA 3VS7A 5FLFA 4JXFA 4OR5A 3TIZA 3HYHA 4EHGA 1K9AA 1GIJA 3WARA 4E5BA 4PTGA 4HNFA 2I40A 3HEGA 4Y5HA 3CQWA 3KMMA 1WBOA 3QXOA 1W82A 4MXOA 2W99B 1ZRZA 4AZSA 3OOGA 4O38A 3ATSA 4BWPA 5CX9A 3RAHA 3RHXA 4E8AA 4XG8A 4BIEA 2BRMA 3FLWA 3NR9A 3ZFMA 4EZ5A 3NUSA 2V62A 1P4OA 1GNGA 5HX6A 5HIEA 3E87A 4YBKA 4QNAA 3R7YA 2PE2A 4C4EA 3QGYA 3TEIA 4K1BA 3KN5A 3TTIA 5HG9A 4ZTMA 4FC0A 4UZHA 1UVRA 2ZM1A 4FNXA 2ITPA 4I0RA 5GZ8A 4AXAA 1XMMA 3C0HA 3GQIA 4FIJA 4C4IA 2R3NA 4H3PA 3SAYA 3VS5A 4AFJA 5JGDA 1T46A 4ERWA 5FEQA 2VTIA 3CXWA 4J8NA 3LM5A 2C0OA 3UOKA 4LOOA 5KBRA 2YM5A 3SDJA 5J7BA 5AR8A 3JPVA 5LCKA 1XBBA 2WB8A 4I92A 4M69A 5FM3A 3EKKA 2J9MA 1KE7A 2XNMA 5AX3A 3BPRA 3LFSA 3C4ZA 4GUBA 3ZXZA 4O7LA 4W4WA 4N57A 3JY0A 3N51A 4RIYB 4BDGA 4EH8A 4F9BA 2J4ZA 4UZDA 5EQYA 3AOXA 3MFTA 4L8MA 4S34A 5DIAA 1Q61A 3PE2A 2PZPA 4HJOA 4I6BA 5E1EA 4CFXA 5LVMA 3F3ZA 3PJ1A 5CQWA 4QP8A 4YGAA 3GBZA 5CAVA 2WTJA 3LKMA 2PZYA 2WD1A 2XIYA 1IASA 4I5CA 1B38A 3CBLA 3UDZA 3EKNA 2YJSA 1KE6A 1JLUE 4RQVA 5HE3A 3ZZWA 2UZWE 4CD0A 4G2FA 3K2LA 5A46A 2WIPA 3L1SA 5HBEA 1TZDA 4RC2A 5AUTA 1PKGA 2W4JA 3CGOA 2HAKA 3TTJA 2CHLA 4WNOA 4ZLOA 5CF5A 2BRNA 2O65A 3A7GA 3NNWA 5IQGA 3ZM4A 1XR1A 2YAAA 4RC3A 3H9RA 2X8EA 3A8WA 2XIKA 3PG1A 3GQLA 5EK7A 5FDPA 3WIKA 3W8LA 4NT4A 1PMUA 4U41A 2GTMA 3F5XA 4OBOA 4BICA 2CKOA 1Q8ZA 5J9LA 3QUDA 5I9XA 3FJQE 1KE5A 1FOTA 3QUEA 5A4LA 3UOHA 3R22A 4DEHA 2W5HA 3EFJA 3RK7A 3DS6A 3OY1A 5CVHA 2QHMA 3NPCA 3Q53A 4YJNA 3SRVA 3TL8A 4QQTA 3P9JA 5D12A 3NIEA 4RVLA 5DA3A 3W0QA 3OBJA 4V01A 4RRVA 2P55A 4BCNA 4BYJA 3VF9A 3KCKA 2XVDA 4Y5QA 2HCKA 4ZTLA 4ZTRA 3NRMA 4TYJA 5HBJA 4J99A 4BGHA 5IH5A 2H8HA 3HV3A 3PXQA 4FL3A 2AUHA 2QO2A 3EH9A 4NM7A 3S0OA 3ZYAA 2YIYA 2GMXA 4ACHA 2QOFA 5CAUA 4FIIA 2HK5A 4AN2A 3V5QA 3PDTA 2YDJA 1Q62A 3LJ0A 5HNGA 4QD6A 5JEBA 5BQ0A 2QR8A 4CCBA 3D5WA 3ZEPA 2IW9A 5BV3A 3PVGA 4OTQA 4QMSA 3VULA 5HO6A 2XBAA 2O5KA 2O3PA 4BL1A 3QLFA 4IIRA 4QP4A 5DOSA 4GT5A 5G1XA 4LM5A 5CZHA 4UMTA 2A4LA 3E88A 4DG0E 3KB7A 3LCDA 4CZUA 1OIUA 2J51A 2JKOA 5DBXA 3UP7A 2VUWA 2GQSA 4FTUA 4QYEA 5EW8A 1J1BA 4FL1A 4BDFA 4F7NA 4R5YA 3COKA 1G8JA 5M4UA 4D58A 2UZDA 3RHKA 4DEGA 5DT3A 3ENMA 4C0TA 3MH2A 2FVDA 1PHKA 4XEYA 3CSVA 1YI3A 3QRTA 4NKSA 1WCCA 5C26A 4GK2A 3DDQA 4D2SA 4C62A 3CY3A 3PUFC 4O1OA 4AA0A 2X6EA 4O0VA 5HLPA 2GCDA 3LCTA 4XP3A 4ACGA 3FMKA 4ZZOA 3W16A 3UIUA 4BDAA 4UMPA 3LFAA 3EL8A 5JFVA 2YCFA 3QKMA 3B8RA 1ZY4A 4GU9A 3SG8A 3ZU7A 2O63A 4UB7A 4X2KA 2IO6A 1WZYA 2Z2WA 4NM0A 4U81A 1ZYJA 2C0TA 2HXLA 4DDGA 2VGOA 3QYZA 4L00A 1OBGA 1PW2A 4BB4A 5AIRA 2VNYA 4FUXA 4IVCA 4M7IA 4KIKA 3ORXA 1XJDA 4I4FA 1AQ1A 1H27A 3UG2A 4LUEA 2QOOA 3VWAA 1Y6BA 2JKMA 2PE0A 4NSTA 4X3FA 3I81A 3EOCA 4FKRA 3EYHA 4TN6A 3KF4A 4FSRA 1KSWA 4PY1A 3NAXA 2JKKA 4AW1A 3WE8A 5H8EA 4QP9A 3W0PA 4G3DA 1JSUA 1YVJA 2Y0AA 1PXJA 1XHAA 4M14A 1FPUA 2FUMA 2WTDA 3HUCA 3LM0A 3R21A 5HU9A 1XKKA 4U43A 2W06A 2WOUA 2R5TA 4YPDA 3V01A 4KKGA 3R02A 2RG5A 3WZEA 1BL6A 4FBXA 1YOJA 2I6LA 3L8VA 4JQ7A 3UPZA 4JX3A 2BDJA 5CLPA 3RALA 2P2HA 4TYHA 1IG1A 3DLZA 4HVSA 2Z02A 1B6CB 4XX9A 5DT0A 3RZFA 3Q9XA 1ST0A 2WEVA 3TNPC 2OICA 4DEAA 3FYKX 4GH2A 4ZP5A 5FD2A 3PA4A 4GU6A 3NMUF 2Y6OA 3GU8A 4F64A 5CSVA 2Z7LA 2YM7A 2VWIA 1DI8A 5L4QA 2ACXA 2VTJA 2I0HA 2KTYA 4FTNA 5J1VA 2ITWA 2WQOA 4MXYA 4JAIA 2VZ6A 3QKKA 4UXQA 2J0MB 4RWKA 5AAFA 4EQCA 4EJ7A 3AGMA 4F99A 3BWFA 5D10A 2XK7A 1VYZA 4M3QA 5GIOE 2W96B 5CXHA 5DRBA 4B6LA 2E9UA 4FRFA 5CEIA 3C13A 2C6DA 3FMLA 3A2CA 3LFDA 3O50A 4KABA 5K0KA 4L42A 4MUQA 1F3MC 4LV5A 2YITA 3FMEA 2PUUA 4IC8A 3QQLA 3ZCLA 5HGIA 3CGFA 4FKWA 5ETAA 1OECA 3GVUA 3IGGA 4CXAA 4PTCA 2HWPA 1G8KA 3DNEA 1QPDA 4AN3A 3PRFA 1CKIA 2B52A 3NUNA 3HKOA 3QTUA 5CF6A 4AX8A 5DEYA 3T3UA 5BVKA 4PX6A 4EQUA 4HPUE 4F63A 3PVUA 5TR6A 3PSCA 5CSHA 4UMUA 4UYAA 1OL6A 2W1ZA 3HNGA 4O4CA 3ZZEA 4CFUA 4C61A 2VX1A 1W2FA 3KXHA 4EK6A 2PVRA 3RINA 3O7LD 3BE2A 5C8KA 3OROA 3ZUVA 4RLKA 5KMMA 4FEWA 2XF0A 5E92A 2GDOA 3L9NA 5D7AA 2C5YA 4ZSJA 3W0RA 1L3RE 4FTTA 4FGBA 2PK9A 4QQJA 5DR9A 3DAKA 1DM2A 2ZM4A 5CF8A 5KMIA 3HA6A 2OXYA 4BDDA 4O96A 5GHVA 3OXIA 2ZAZA 4OTPA 4EHVA 4AXEA 2RGPA 1FQ1B 4EYJA 1RDQE 4RJ5A 5ANGA 2F57A 3AC4A 3QQGA 4Z55A 1BUHA 2CN8A 3F7ZA 3PJ3A 4TKSA 4HVDA 1H00A 3V8TA 1NW1A 4N6ZA 2XANA 4MYGA 4KB8A 3R8UA 2PVJA 1H4LA 1OGUA 2Q0BA 3OHTA 2OJIA 1YI4A 1YWVA 2YIQA 3DXNA 2F9GA 5HNBA 1TVOA 2PMNX 3Q9ZA 3DQWA 4ALUA 4HW7A 3O5AA 3A61A 2ITTA 4PPBA 4KSQA 4JOAA 3UDTA 3NCGA 5JMSA 1WVXA 3EFLA 4QNYA 4OTFA 4XV3A 5IQBA 1HOWA 2J50A 3FMNA 3OZ6A 4H39A 4O0XA