3NDMA

Crystal structure of rho-associated protein kinase (rock1) with a potent isoquinolone derivative
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
398
structure length
383
Chain Sequence
MSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEEETFPIPKAFVGNQLPFVGFTYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substituted 2H-isoquinolin-1-ones as potent Rho-kinase inhibitors: part 3, aryl substituted pyrrolidines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Rho-Associated Protein Kinase (ROCK1)
total genus 108
structure length 383
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ndmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ndmA01
3SRVB 3ENMA 4CZYB 3WF7A 4EUUA 5HX8A 2C4GA 3CP9A 2R3GA 3M2WA 1V0BA 4EH8A 3IKAA 4CFNA 4E4XA 1CMKE 4ZJIA 2YDKA 2PZIA 3PA3A 4FKTA 5JRSA 4TNBA 4OT6A 3SXRA 3LM0A 3HMIA 4PPCA 4JQ7A 4BDJA 3R9RA 2E9UA 3NUPA 2JKQA 5G1XA 4HZRA 3PG3A 4MKCA 4BL1A 3CTHA 4H39A 2JDVA 3QLFA 4IHPA 1PW2A 2ITYA 4FV6A 4GJ3A 3LJ2A 3IGOA 4UWCA 5HI2A 5CTPA 2R7BA 4G17A 2XBAA 5HLNA 4TZRA 4PDOA 4M69A 3FKNA 5ANGA 3TDWA 1V0OA 4M7IA 4NUSA 4FTLA 4A07A 4XV1A 5DRBA 4IAYA 2Q0NA 2Z7RA 4MXYA 5GNKA 5J1WA 2OF4A 4FT9A 1Q4LA 2F2UA 2XUUA 4IACA 1GNGA 3DDQA 4BHNA 4CFXA 2XIYA 3C9WA 4IWDA 2Z60A 2BMCA 4QMZA 3OTUA 5CQUA 4RIYB 4JRNA 4YJRA 4YGAA 2QOHA 5DBXA 4EK6A 3C5IA 4I5CA 4RFYA 3L8XA 2C1AA 4J1RA 1S9IA 4NL0A 4C4IA 3I7BA 5IA2A 4O7TA 2OI4X 4GFMA 2VWIA 4K33A 4DT8A 1Z5MA 3SRVA 4HVIA 3DBEA 1XH6A 5AUUA 2XCKA 2JDSA 4O1PA 4FSMA 4HNFA 4TT7A 5K3YA 4YU2A 4IBMA 4J96A 5ETIA 3QHRA 4C02A 5FEDA 4J71A 3V8SA 3MFRA 2DWBA 5TR6A 1FINA 5HCZA 4HGTA 4O0TA 3ZSGA 4EH7A 2I0HA 1MUOA 3PXYA 4Y83A 2XYUA 4MAOA 3F7WA 1YHVA 5EHYA 4MF0A 3LQ3A 4TKSA 4W4YA 1H08A 3PVGA 4I92A 4GIHA 3LLAA 3KXXA 4EOJA 2G15A 4ZSLA 3MJ2A 3NCZA 1T46A 1E9HA 3F5XA 2UZDA 5B0XA 4A4LA 4X7QA 1MQ4A 4A7CA 1UV5A 2NRUA 1NVRA 3H9FA 5HX6A 2BIYA 4CSVA 3GCPA 3WZEA 3EQFA 4DE4A 3R7OA 4CMTA 2X6DA 4U97A 2PUIA 4O7SA 4BZDA 2VTIA 4CQGA 4CKRA 3IDBA 5L6PA 2UZNA 4BGGA 3M11A 2WTJA 4RQVA 1P4OA 3EFJA 2IZTA 4FGBA 2RFNA 4L9IA 2BRGA 3ZFXA 4LGDA 3BV3A 5IUHA 4JBQA 3POOA 4DH5A 3S00A 5EI6A 4HVDA 3OY3A 3C1XA 4BGQA 4X21A 3VS2A 4AZWA 3BCEA 5HBJA 3UNKA 2RIOA 4PPAA 4FV0A 3COIA 1K9AA 3VUTA 4BCJA 4ZS4A 4N0SA 5IH6A 4UYNA 3ZTXA 3SG9A 2EU9A 3ANQA 4CLIA 1YI4A 2JC6A 4HYUA 4ZZMA 3GC8A 5J8IA 5KZIA 1ZZLA 3PVWA 2QG7A 5KBQA 2ITOA 4NU1A 1FOTA 1PMUA 4DFLA 1OIRA 3NNXA 4EKKA 5JGBA 1DI9A 3DK3A 2XCHA 3Q4UA 3QA0A 4QMOA 5CEPA 4EH3A 2PE1A 4F64A 5AADA 2VWVA 4F65A 1GIJA 3QTSA 5FEEA 3TDVA 2QQ7A 4XYFA 4B7TA 4IX5A 4YJPA 5AR7A 5HBHA 3DV3A 2XNBA 3NAXA 5BYYA 5FGKA 4MCVA 2UVXA 2XA4A 2XJ0A 3EQBA 3PA4A 4F7NA 3UOKA 2IPXA 4XP3A 3TIYA 4H05A 3R04A 4G31A 4FBXA 3W32A 3EQPA 4AP7A 3ORMA 3EN9A 3VHKA 1G5SA 3KULB 4O21A 4BDFA 4BCFA 4BFMA 1ZYJA 2W7XA 3P08A 1OKYA 4B9DA 4PL3A 4XV2A 4UN0C 5A4TA 4ZLYA 4QQTA 1HCLA 2GMXA 2HZ0A 4RLLA 3DTWA 3GNIB 2ZM3A 3P78A 4ALWA 1JWHA 4YO6A 2OICA 3L9MA 3SA0A 2GS2A 3BWJA 3ID6C 1UNLA 2A1AB 4ACGA 1YHSA 3JY0A 3FY2A 1M2RA 3QL8A 4XG2A 4E8AA 4BTJA 3AC5A 5BUEA 2CMWA 3R8ZA 3TNIA 3KMUA 3EQIA 4P4CA 4FG7A 4XG8A 4BC6A 4KB8A 2XKDA 4MNEB 5C26A 5B2KA 4RWLA 5EYKA 5GHVA 2XRWA 3VRYA 4O81A 1WBTA 2QVSE 2PVNA 1Y91A 2W06A 3IQ7A 4J8NA 2XEZA 5BVEA 3RWPA 1RE8A 4UMTA 3L8PA 5CI7A 2XIZA 3QRJA 2YIXA 3O8UA 5L4QA 4F1MA 4YJQA 4TWCA 2BTRA 3RK7A 4FVRA 3CCNA 2B9HA 2HY0A 1YXTA 2X4ZA 3CQEA 3EYHA 4EWHA 2QKRA 5BVFA 1ZOHA 5BVKA 5EM8A 2QLUA 3W2CA 1DAWA 5C8KA 3I7CA 2FGIA 3FE3A 4LGHA 4ASDA 3SGCA 4E93A 1M2QA 4JR3A 5IMEA 3OXZA 1REJA 4L44A 2OXYA 4FV3A 1ZY5A 2R3LA 3RAIA 3TZ9A 3DQWA 4YO4A 4IAIA 5I3RA 3HV5A 4BWPA 4OAVB 2YZLA 2Y9QA 3HMPA 4BIBA 4WOVA 5K0KA 3QUPA 5KE0A 1IEPA 3K3JA 5IZFA 4NM7A 5CAVA 4EBWA 3B2WA 2PU8A 4IC8A 4E3CA 5HGIA 2QCSA 3LFCA 4O7ZA 4FTRA 3C5UA 4G6LA 2QOLA 3EN6A 4DFUA 1H1WA 3U87A 2JKKA 2WQOA 4FSRA 4IWPA 3Q9YA 3OVVA 5ETCA 2JDRA 3ZHPC 4BI2A 2RFEA 4ASEA 2ZOQA 4Y8DA 5EW9A 5AA9A 1MRUA 4J97A 1XBBA 5AIRA 5BNJA 5JEBA 3R83A 2PMOX 4PP9A 3OCBA 3F61A 2O65A 3VRZA 4Y5HA 2XRUA 4I1ZA 4FTMA 4RWJA 3RCDA 1WVWA 3E8DA 3QQUA 1RW8A 1GY3A 2Z2WA 3F7ZA 4I6FA 3A7JA 5EW8A 4EH9A 5AIKA 2BHEA 1XH5A 3MB7A 5AV2A 5HO8A 4EOQA 4XRLA 2OIDA 5EI8A 2R4BA 3EN4A 4FIJA 2YJRA 5HHWA 3UP2A 5A6OA 2CSNA 3PRIA 4B8LA 2UW3A 2YM6A 2YM4A 4BDGA 5AP7A 1XKKA 3AMAA 5FRIA 5A6NA 5CSXA 3BELA 3QD2B 3W8LA 4QYEA 3ODYX 1PMNA 1A06A 5IQBA 5LCKA 1FMOE 3BE2A 1Q8YA 4AZSA 4YPDA 5L2QA 3EMGA 5BYLA 2ZV8A 4O86A 5IEVA 2W9ZB 3TV6A 3HV4A 4QMLA 3E63A 3BQRA 4Q2AA 5EHOA 4BKYA 3DNDA 3FLWA 3NW5A 4JBOA 1OBGA 3PVUA 4RWKA 2XJ2A 3RBWA 4YPSA 3ZC5A 4G9RA 4WUAA 3MJ1A 4R3CA 2OIBA 4EH5A 1H8FA 3LOKA 3V8TA 4JIAA 5DOSA 4JDKA 3UPXA 4CKJA 4KKGA 4F0FA 2PE2A 3JXWA 4EL9A 1TQPA 3TN8A 3G51A 5FG8A 4RIWA 3IW4A 4GK3A 4BDEA 3D7TA 4Y73A 4GT5A 3HMNA 4WHZA 3L1SA 3WBLA 1OGUA 2XM9A 5FBNC 5LXMA 3EKKA 3NMUF 3NW7A 2J0MB 3Q5ZA 4FEXA 3GENA 3NYOA 4O82A 4A9SA 2NRYA 2IW8A 5BQ0A 3FMJA 5FXRA 3UPZA 4S32A 4BRXA 1KV2A 4KBKA 4BN1A 3PE1A 2WTVA 3GU5A 5DR6A 3IW5A 2WPAA 4FL3A 4XP2A 4L3LA 1PYXA 4HPUE 3FXWA 4UALA 2YM7A 4EK8A 4GIIA 3ZCLA 4DF3A 5HCXA 2PVFA 5HVKA 4YMJA 3MPMA 1W82A 3EIDA 4OBQA 5M4UA 3NYNA 5ANEA 5L6WL 4ALVA 3LFFA 3C4FA 3PTGA 3QBNA 4F9BA 2RSVA 3GGFA 2A0CX 4AW5A 3P1AA 3NYVA 5C4LA 4R7HA 4FKRA 4O6LA 1Y8GA 3AD6A 2KULA 5AA8A 3UC4A 1OL2A 4G6NA 5BX0A 5B7VA 4CMUA 4DTBA 3Q60A 3ELJA 1KV1A 2WZJA 3AC2A 4A9TA 4AOIA 2WU7A 5HO7A 3QD3A 3EFLA 5AR4A 2UVZA 4PTEA 3WE8A 4NEUA 3I6UA 3TUBA 3V51A 2CCIA 4K6ZA 1YI3A 5DYJA 2PVKA 2XIRA 4EYJA 4QMWA 3TKUA 3LFDA 2AC3A 2J0LA 5KBRA 1ZXEA 4OTWA 4XV9A 3FKLA 1NVQA 3COHA 3BBWA 4XBUA 3KC3A 3LVPA 3HRFA 4BYJA 5K4JA 5M4IA 3O50A 2UZUE 1KUTA 1MP8A 5EM5A 4RVKA 5IMXA 4MD8E 5ANDA 3PYYA 2BR1A 1H1RA 3VBWA 3L9LA 4WD5A 4TW9A 4UEUA 3U55A 4G2FA 4QYHA 4B6LA 4FTNA 5AR8A 4YNOA 5F94A 2XK7A 3VUHA 3ZH8A 4IVCA 4MXCA 1CKJA 1OZ1A 4DYMA 3W8QA 5KMMA 2VAGA 2XK9A 3C7QA 3E62A 1H4LA 3RZBA 4AAAA 1Y6BA 4U3ZA 2YA9A 3LFEA 1IASA 4XNEA 4JX7A 3U6JA 2ZMCA 4LQMA 3DLSA 4NIFA 3IO7A 3MYGA 3UDBA 4ASZA 5IU2A 4WIHA 4ERKA 2AUHA 5AMNA 3KL8A 1BUHA 1I44A 4I4EA 4ZZNA 5A4LA 3ZC6A 4PDPA 3KMMA 5GIPE 3VC4A 3BPRA 3O7LB 4U3YA 2JFLA 4IAFA 3R1QA 3VO3A 3QRIA 3E5AA 2RL5A 4WRSA 2A2AA 1LP4A 4DGNA 3G15A 1XJDA 4FIIA 4FKSA 2J5EA 3RPOA 4OTDA 4GU9A 4RZWA 1B38A 4B99A 1PHKA 2XNMA 3BEAA 5AJQA 2IW9A 3MFUA 3VS1A 4U43A 4I0RA 2PVMA 4XH6A 5LCJA 4R3PA 5JFVA 3R01A 2J4ZA 2R3IA 4G1WA 4NWMA 4KD1A 5I9UA 3KEXA 5IQIA 4AXAA 1LEWA 3ZZWA 1P5EA 1O6KA 2PZYA 5LMKA 1OL5A 4X2GA 3ERKA 4FNWA 1XH4A 5I9ZA 3W55A 2W5BA 5DFPA 2CKEA 4GYGA 4FI1A 4I23A 4I6BA 2ITNA 3U6IA 4FOBA 4K8AA 2F7XE 4RJ8A 2IWIA 4MBLA 3LQ5A 4D9UA 5KMLA 4AW2A 2YM5A 4I4FA 3WILA 1OIUA 4QMQA 4FODA 4IZYA 3KGAA 4JRVA 3HV3A 3AC4A 4GS6A 4JG7A 5IKWA 1UVRA 1XHAA 2B7AA 4LUDA 4TXCA 5BYZA 1Z57A 1WBNA 3R8PA 1W7HA 4L3PA 3ZUTA 3FBVA 2Z7SA 4F6WA 4NSTA 3ACJA 2B1PA 3RTPA 3OY1A 2BRBA 3VBTA 3VF8A 4NTSA 4QMNA 1F5QA 4BCKA 4PMTA 4V05A 3UP7A 1URWA 2FB8A 2LGCA 4BDAA 1HCKA 2W1CA 3BU6A 1ZWSA 2HAKA 3HX4A 4QTDA 2BPMA 2WMXA 3C4EA 3QXPA 4P90A 1WBSA 2BDWA 1J7IA 4V0GB 1M17A 3VS0A 4AE9A 4AX8A 4F9CA 4RMZA 3EL7A 4BICA 4O96A 4L01A 3I5NA 4X3FA 5TKDA 1R78A 4P5ZA 1YOLA 4B0GA 2PYWA 3QKMA 4EOSA 5JFXA 4QP1A 4J95A 3IECA 1JKTA 2P4IA 3LXPA 4H3PA 4I21A 4USDA 5CU0A 5KMOA 4USFA 1V0PA 3UZPA 3NUUA 5L2TA 3EQGA 4DITA 1BL6A 1YVJA 2UW0A 2VWXA 4G3CA 3LMHA 1ZMVA 1DAYA 3F3TA 3DKOA 3GP0A 2YAAA 3GU6A 3PJ8A 4L8MA 3FEGA 2OJIA 2R3JA 3DY7A 3HLLA 3QQLA 4KWPA 4DEHA 4FTIA 2PUUA 4ZY4A 4G3DA 3N51A 4XG6A 5HE3A 4D9TA 2OJ9A 4EWQA 3TM0A 1W0XC 2VGOA 3A8XA 3JY9A 3PWYA 5FTGA 4F9WA 2CDZA 2BDFA 1OKVA 3DFAA 2HW6A 2ZDUA 3CGOA 3GCUA 3OT3A 4ITJA 3R00A 4WG3A 2JIUA 2CHLA 3SXFA 4C62A 5LVMA 3EB0A 3PPZA 4UV0A 2VTLA 3G5DA 2JFMA 2QD9A 2X8EA 4R7IA 4IB1A 2P33A 2VZ6A 3A7HA 3IW6A 1JPAA 1U4DA 4NK9A 3SW4A 2HIWA 2ESMA 2R3NA 4RX7A 1JVPP 2I40A 4YURA 4C57A 3LHJA 3ZS5A 4L67A 2VWYA 3UVRA 3W16A 2O64A 2ZM4A 1OL1A 3NX8A 4CNHA 4EC9A 2GNGA 4AFEA 2AYPA 5J1VA 4CZUA 2V22A 2Q0BA 3ORXA 4WG4A 3QAME 4AG8A 1YWNA 2JD5A 4CYIA 5BPYA 4YC8A 5EOLA 1H07A 4E6DA 3TV7A 1KSWA 3KQ7A 1JOWB 1YXXA 3NAYA 4IADA 3ZYAA 3UE4A 4UMPA 4OUCA 4U81A 4AS0A 2GS6A 4L68A 3VBYA 4OTRA 2XYNA 4FVQA 3NLBA 3I0OA 1ZLTA 3QFVA 4EK3A 3UYTA 2W1IA 5HO6A 4C4FA 2VX0A 4LRMA 4RX9A 3JYAA 4FSNA 1VYWA 4YZDA 5IUGA 5DT0A 4BDCA 3ZSIA 4E26A 3UVQA 2XNEA 2VU3A 3UNZA 2OU7A 4ACHA 4ENXA 5D9HA 1SVHA 3Q4TA 1ZRZA 3CD3A 3DK6A 4E20A 1SMHA 1Q62A 3O96A 4ZK5A 4YNEA 4RVTA 3VJNA 5M56A 4BI0A 4IW0A 2W96B 3TZ8A 3OBJA 3OWPA 3DCVA 3RPSA 5KHXA 1XQZA 2W5HA 4NTTA 4PL4A 3R7EA 4C38A 2PY3A 5LVPA 3MWUA 1JLUE 1PXOA 3IGGA 5E90A 3T9TA 2J90A 3LE6A 3UO6A 4CD0A 5A46A 2PTKA 2Z7QA 1UU8A 3MESA 3QD4A 4EEVA 4CFMA 4DA5A 4DGLC 3RZFA 2BZIB 2ONLC 4M0ZA 3PJ2A 4IX6A 1YW2A 3GT8A 5JZJA 2CNUA 1OPLA 1ZY4A 3HRCA 5GIOE 3FC1X 3FMNA 3OS3A 2ERKA 4M97A 3OHTA 1ZYSA 2UZEA 4DEIA 1DS5A 4ZTSA 2X81A 4HVGA 1BLXA 2OG8A 3PJCA 3QTZA 5H8EA 5F20A 3E3BX 3MY5A 4D2WA 4CLJA 1WMKA 4PX6A 4RZVA 4X2NA 1CM8A 2WD1A 4QMVA 5E8TA 3LCKA 5C4KA 1F0QA 2XNNA 1YRPA 2ZB0A 4FIGA 3HA8A 2ITQA 3R2BA 4CQEA 4ANOA 4LFIA 2R3MA 4C4EA 3O23A 1I09A 3KA0A 3ZEWA 4X3FC 5DNRA 3C13A 1Y57A 4OTGA 5FP5A 4OW8A 5GJGA 1NVSA 4UWBA 1U54B 3CQUA 5A9UA 5M06A 3BHYA 2RG6A 3KXNA 4BR3A 2YM8A 4LOOA 1UA2A 3V6RA 1Q97A 2UV2A 3ACKA 3CKWA 3A62A 4J53A 5A4QA 2ZYBA 5FXSA 4OTIA 3PY0A 4IAAA 1BI8A 4PDSA 4Y95A 4DG2E 5G6VA 4RIXB 4JAJA 3W10A 2JDOA 1R0EA 2C3IB 4DN5A 5H3QA 1JSTA 3TL8A 4OAUC 4C3FA 3ZLXA 4G5PA 2X7GA 2GNHA 3TIZA 4Q9ZA 2WTKC 4ZLOA 5AR5A 3FMEA 4X6RA 5E8ZA 5FUTA 4IZ7A 3I5ZA 4HVSA 4YJOA 5HEZA 4BIEA 3DU8A 3CPCA 1YQJA 3QWJA 4OBPA 3ORIA 5M4FA 1UKHA 4FV9A 4NW5A 3NSZA 4FC0A 4FICA 3JVRA 1H25A 2J9MA 4ORKA 2W1HA 1XBCA 2PMLX 5LMBA 2BILB 3O8TA 5DWRA 3H3CA 5E8UA 5AFVA 1JQHA 4PMSA 4YTCA 1X8BA 3FLNC 3NS9A 2GCDA 4QMPA 2C69A 4KS8A 3HEGA 2JDTA 5C01A 2NNWB 4AZVA 3O0GA 3P0MA 3BQCA 4C34A 4DEBA 4FT5A 5C03A 4QD6A 4IH8A 3NW6A 3ROCA 4FT3A 3D2IA 3KXMA 5HD7A 2YJSA 2G2FA 3OCSA 3DXNA 3UODA 5L8JA 3LJ0A 3RM6A 3A99A 4FOCA 3C0IA 3ORTA 1H24A 2JGZA 4HCUA 4OGRA 4QMTA 4YZ9A 5DT3A 5IUIA 2OGVA 2A19B 3Q04A 3QHWA 1H00A 4BDIA 4FSQA 3VS4A 3ZBFA 5JSMA 1H0VA 4GVJA 1WZYA 1R3CA 3NUYA 4O0WA 3JS2A 3BV2A 4LL5A 4RFMA 1BKXA 4RG0A 4RX8A 4LV5A 2VNWA 4XLIA 3ZFYA 5HTBA 1PKGA 3TNQB 4X2JA 1WVYA 5HD4A 5CSPA 5IQDA 2PMIA 4GYIA 4AT5A 3WF8A 3FLYA 2XKCA 3AGLA 2HW7A 3FI8A 1KE6A 4V0GA 3UTOA 1E1VA 4PY1A 5K5XA 2PL0A 2VTJA 2VTTA 1U5RA 1MRVA 2BKZA 3F2AA 5DIAA 3H0ZA 5AP4A 3R2YA 2WHBA 4RJ7A 1H01A 5AP0A 4RVMA 3NYXA 3R8MA 4AA0A 3O71A 2WELA 3TUDA 3BU3A 2AC5A 3IG7A 4CCUA 3V8WA 4CCBA 1M7QA 2XNOA 3EJ1A 3Q2JA 2BRHA 4DFXE 1UWHA 2ZV2A 4TYEA 3ZRLA 4UMRA 2BKKA 5B2LA 3CJFA 3QQKA 5HG7A 5ACBC 4L3JA 1A48A 4KIQA 3CEKA 3KU2A 3TI1A 3GC9A 3U51A 1FPUA 5EDQA 4AE6A 4R6VA 5HG5A 3ZSHA 4AW0A 1OIQA 2EXEA 5CVGA 5HNGA 1P14A 3LM5A 1T45A 3Q9ZA 4UYAA 3FI4A 4F1TA 2CPKE 1GOLA 3KVXA 4XHKB 3VWAA 4QTAA 3M1SA 4E5AX 2WTIA 3CGFA 5JGDA 4O7VA 2UZOA 3UNJA 3CBLA 5F1ZA 3BEGA 5IA0A 3D0EA 4QTBA 4QYYA 4CG9A 1FVRA 2WIHA 4O84A 4ASXA 1U59A 3C0HA 2W4OA 3R1SA 5ACKA 1J91A 3H9RA 3H4JA 3ZEPA 3F3ZA 5AX9A 4KNBA 3TNWA 5IH4A 5IISA 4E4MA 4HGSA 2GFSA 2VO7A 4AT4A 1STCE 3AT4A 3LFNA 1AQ1A 1FQ1B 3TJCA 4MBJA 2YDIA 4FEWA 3QZFA 4RA5A 3VQUA 4NKAA 3AOXA 3AC1A 1ERKA 4XG9A 3PY3A 3ZRKA 4OTFA 1OMWA 1H26A 5EOBA 5DI1A 5CSVA 3ZLSA 2B9JA 4IVAA 4KRDA 3TNPC 1M2PA 3FXZA 3BYSA 3O2MA 4FKUA 4PQNA 5IEXA 4D2RA 5DH3A 2IZSA 3QU0A 2J6MA 3OW3A 4JJRA 3QWKA 1PXLA 1SVGA 3I79A 4L00A 1R1WA 1LUFA 3PIXA 4UXQA 1OUYA 3FHRA 4G16A 3GXLA 2OIQA 4IE9A 5DE2A 1GJOA 4ZLZA 4C8BA 4PNKA 3ENHA 3ZM9A 1CKIA 2Y6MA 3QZGA 4FKWA 4D2SA 4NYEA 3PIZA 3VUIA 5E8SA 5ANIA 5JZNA 3BYOA 2CN8A 3BWFA 2ZJWA 4J7BA 3D5VA 3R1YA 3UJGA 4CFVA 4FKPA 4AGWA 2YACA 2PVYA 2Y4IC 4F7JA 3K5UA 2B9IA 2OO8X 3PJ1A 1LR4A 2OJJA 3R8LA 3RAHA 2WMQA 3IOPA 1WBVA 4L52A 3FQSA 3M42A 4AGDA 2R0IA 2E9OA 3Q4ZA 4U9AA 2BZJA 5C9CA 3DAKA 5HE0A 5IDNA 3FUPA 4NT4A 4U79A 4ANQA 2VO3A 3PA5A 4MXXA 5KHWA 3PXFA 3ORZA 4MX9A 1REKA 2UZVA 1J7UA 4MYGA 3NIEA 5L6OA 3D7ZA 2C6LA 4X2KA 5F4NA 4NM0A 3GEQA 1BMKA 4JL9A 1TQMA 4F70A 5E8YA 3RALA 4O7RA 1H1PA 2X6EA 3QQGA 1PXNA 4UMUA 5E8WA 3TCPA 5DPVA 1JNKA 1Y6AA 5E91A 3W2PA 3MVMA 3VBVA 4DGGA 1SM2A 2VWUA 3HDMA 5ANOA 4G9CA 4FIHA 4O2PA 4X3FB 3UIUA 1YHWA 2OWBA 4R1YA 3F66A 5I4NA 2GDOA 4FKVA 3QQJA 4PMMA 3VVHA 5FTOA 3MW1A 4W8DA 4N70A 4FZ6A 2IO6A 2VO0A 3TG1A 4ZMEA 4IZAA 3L8VA 4F99A 3LFAA 3A7FA 1NXKA 2BHHA 2R9SA 3FMKA 4D0XA 3OCGA 4ITHA 3OMVA 4HNIA 4AOJA 4DC2A 3FI3A 4Y5QA 5BVWA 5CF5A 4BCGA 2VTMA 4K2RA 3UIBA 1IRKA 3D4QA 3IK3A 4KIKB 3RINA 3RJCA 4RGJA 3VUMA 3G0EA 4FYOA 2PZPA 3WOWA 4DHFA 3R21A 4EOOA 3QRTA 2C6KA 4D1ZA 1BX6A 2QKWB 2W1DA 2WTCA 2RKUA 3EN7A 4O2ZA 5LMKC 2ITTA 5L8LA 2GQSA 3FQEA 2JEDA 4EHZA 3P86A 4BZOA 2I0YA 3JR1A 4CT1A 1G3NA 4EK4A 3FMDA 3H9OA 4FSTA 5T68A 5F95A 4XG3A 3FZ1A 3QRKA 4I6HA 4FTCA 2X9FA 4PL5A 4V04A 5AV0A 3MFTA 4IC7A 1CSNA 1QPEA 1ZARA 2ITXA 1FMKA 2CLXA 3K2LA 1R39A 4ZTHA 3R9NA 2OXXA 4YR8A 1FVTA 2QOBA 3R9HA 1Q61A 2PZRA 4J52A 4DINA 2B53A 2REIA 3LFBA 4C33A 5M53A 5DR9A 3VUDA 5LQFA 1FVVA 4BDBA 3P7BA 3A4OX 4XRJA 1R0PA 5EW3A 4C2VA 5I9VA 4XMOA 4RQKA 5KKRC 2W1GA 2ITUA 2WO6A 4I5HA 3RPRA 4D1XA 4FEVA 2B9FA 3UBDA 3V5LA 4DH7A 4OT5A 2XK3A 2J51A 4OTPA 3DAJA 5AP6A 3LMGA 3GUBA 4M15A 3UMWA 4GL9A 3THBA 1GZOA 3EQRA 1O6YA 4FT7A 3E87A 5LARA 3BRBA 5E9EA 3JVSA 4D28A 3WZUA 1OITA 3KXZA 2JAVA 2V62A 3F88A 1JSVA 4ZZOA 5AUWA 3S1HA 3D2KA 4QQJA 5CEQA 4LMUA 4IEBA 3VN9A 4M0YA 2OKRA 3A61A 4DGMA 4F09A 5LJJA 2CGXA 2WTDA 4GK2A 4MD9E 4ZSJA 4ONAA 1QPCA 2WIPA 1QMZA 4GV1A 2BROA 4FKOA 1KE7A 3G6HA 2B52A 2DQ7X 2QO7A 3HL7A 3MI9A 3OTVA 4YTHA 1WFCA 2R3RA 5CI6A 3R7VA 4LOPA 2WNTA 3UG2A 1H1QA 4YSJA 5IQHA 2O2UA 4FR4A 5CT7A 3T9IA 4FGRA 2YISA 1TVOA 3P4KA 5JK3A 4CVAA 3F2RA 2YDJA 1P2AA 4CZTA 4DH3A 1FGKA 3R7UA 4IFGA 2PVRA 3ORLA 4Y46A 1PF8A 2O5KA 3LFQA 4Y85A 3N9XA 2UW8A 4Q9SA 5TOZA 3ZDIA 5E4HA 1XR1A 4L43A 4HZSA 4ZSEA 3NNWA 4DLIA 5FWKK 4TYIA 3FXXA 4G34A 2X2LA 2XB7A 4MD7E 3S3IA 3UZRA 4FIFA 5BVNA 4C59A 1UNHA 2BRMA 4D1SA 4QQ5A 4ZY6A 2WMRA 3HRBA 4Z16A 1YXVA 4EYMA 5LVOA 3A7IA 4QTCA 3EFWA 4EHVA 3LCDA 3RPVA 5K5NA 4CG8A 2V0DA 3NGAA 3MV5A 1UKIA 4J99A 4PF4A 4D55A 2C0IA 3F6XA 3GQLA 3KN5A 4IWOA 2C1BA 3EZRA 2V7OA 3MPAA 3O51A 4JX3A 4PDYA 3MY1A 5HU9A 1W84A 4TTHB 5J7BA 5HOAA 4FKJA 3EH9A 4CKIA 5HCYA 3E88A 3WYXA 4YHTA 4ANSA 5FDPA 5HU3A 3ZLWA 4C61A 3BYMA 4IWQA 2W0JA 3S2PA 1OECA 4FV1A 2OBJA 4FEQA 2R64A 4S34A 5IQGA 3NCGA 4YJUA 4FG8A 4WSQA 3UC3A 3K3IA 2CCHA 4EH2A 3I6WA 3R71A 4E6CA 2IVVA 5HVYA 4BDKA 2YCRA 3B8RA 3F3UA 3LPBA 3K54A 3PSCA 4JNWA 5CAQA 1IAHA 4YUQA 4LRKA 3CXWA 4HJOA 4IM0A 2YM3A 4D0WA 2BFYA 4L42A 5DGZA 3ULZA 4EONA 3ZO1A 4L45A 3MSSA 2QO9A 4LRJA 2CGUA 3BHTA 5AUZA 2R0UA 4XV3A 1U5QA 3IW8A 4NKSA 4TYJA 3WF9A 3E64A 4BHZA 4DEDA 3NPCA 2WFYA 4Z3VA 3S95A 3PSBA 4C7TA 1XBAA 2QOQA 3QALE 3P79A 3AT2A 3CY2A 3PP0A 4OTHA 5CU4A 1L8TA 4KAOA 3UYSA 4BDHA 2H6DA 2VWBA 2FSMX 5EDPA 4HW7A 3EWHA 3RAWA 4BTMA 4II5A 4LI5A 1VZOA 4C36A 5IQEA 2O3PA 4BDDA 3V5WA 3KRJA 3NUSA 1QPDA 5C27A 5A4CA 4FTAA 1GZNA 3S4QA 3OBGA 2H34A 3BYVA 2J0JA 1WCCA 5CU2A 5HICA 3WIGA 5I0BA 2YLEA 4IXPA 3K5VA 2VTPA 4QPAA 4RA4A 4ANBA 4BWXA 2G01A 2XIXA 3DB6A 2P55A 2RFSA 3SW7A 4QP4A 2WQMA 4D4YA 1IA9A 1H0WA 4FL1A 5CVHA 4R1VA 4W4WA 3HMMA 4FNYA 4EOPA 5CVFA 1WBWA 5I9YA 3DBCA 4MQ2A 3RPYA 5M57A 3VUKA 4IB3A 4F7LA 5EM6A 5KMNA 3ZO2A 4ZSAA 2XS0A 3JUHA 2QOFA 1TKIA 2W1EA 4IX4A 1CKPA 3ALNA 3R6XA 4DEAA 1YWVA 4M68A 2B54A 3MIAA 3DT1A 3IOKA 5CLPA 5CZIA 3Q4CA 4RIXA 3QTXA 5DG5A 3TKHA 2F9GA 4K11A 3OWKA 4ZMFA 3QTUA 1OUKA 2X9EA 3KVWA 4AACA 5CEMA 2YCFA 2ZM1A 2I6LA 3OT8A 4I41A 5DT4A 3MH1A 5CF4A 3WF6A 5ETFA 2X1NA 1GIHA 2HZ4A 3HP2A 5DRDA 1WVXA 5FM3A 3GU8A 4NH1A 3R9OA 1H28A 3DAEA 2WTKB 3UMXA 3U6HA 4RSSA 4AF3A 4XOZA 3PZHA 4GW8A 4DFNA 5JFWA 4K0YA 4I6QA 4F0IA 1YDRE 4IM2A 4FT0A 3DS6A 4QT1A 2WAJA 4RPVA 1B6CB 4BIDA 4NM5A 4IJ9A 5TE0A 4V01A 2C30A 5D7VA 3SD0A 1OIYA 3ETAA 1APME 4B8MA 3EYGA 3HNGA 4EH4A 2C47A 2FSOX 1ND4A 2CKQA 2ITWA 4R8QA 1S9JA 4XG4A 5CU3A 2IVSA 2OLCA 1YI6A 5IDPA 3RM7A 4UXLA 4FSUA 2QOIA 4NZWB 4XX9A 3VW6A 4EBVA 3DDPA 3QTQA 3ZUUA 3DA6A 4WUNA 1ZYLA 3ODZX 3QRUA 1SVEA 2O63A 5DEWA 4I20A 4FA2A 3WZJA 3RP9A 3KN6A 5AP5A 5HNIX 2C6OA 3R28A 4U45A 3PXZA 4FV8A 4G5JA 4ANMA 1PMVA 3ORNA 2QG5A 4F08A 3G2FA 3TKIA 1PJKA 4RIOA 3BHVA 3MIYA 3MS9A 3MTLA 4BWKA 1ZZ2A 4NCTA 1XO2B 4A4XA 2PULA 4AZTA 1KOAA 4FF8A 4IVBA 1VYZA 1GZKA 4QTEA 3LLTA 3SVVA 4I5PA 2IW6A 4IB5A 3WF5A 3QKKA 3O8PA 4JBVA 3CD8A 4I94A 4O0VA 5EDRA 4DG3E 4YLKA 3MTFA 1Y8YA 4RX5A 3PXQA 3DK7A 4FIEA 4EKLA 4G3GA 4BCOA 2JBPA 5HVJA 4R5SA 1KWPA 2GTNA 5EKNA 3CS9A 4XG7A 4TY1A 4FUXA 2QU6A 2FSTX 4MVFA 3BX5A 4GT3A 3WZKA 4U40A 5B2MA 3HGKA 4ANNA 4YJTA 4FZAB 5AEPA 4O0XA 3U4WA 2WMSA 4M69B 4TWNA 2Y6OA 5L3AA 3B2TA 2VNYA 5J9ZA 3DBDA 5DLSA 2NPQA 2BFXA 3UOLA 3KULA 3V5QA 4EOKA 3MH2A 4JDJA 5EQPA 3BGQA 2ZMDA 3C4CA 3IDCA 2CKOA 1SNUA 3GCSA 3CSVA 3MVJA 3I81A 3OOMA 1W98A 2PMNX 3PJ3A 4ZS0A 2OH4A 3GCVA 3FLZA 3ZDUA 2C5XA 4DTAA 3RCJA 2QO2A 4QYFA 1GZ8A 5HG9A 5LVNA 3R1NA 3P9JA 2YN8A 3VAPA 4M66A 5GJDA 3HV6A 3KRXA 3LMIA 3V5TA 2QNJA 4FVPA 4HVHA 4LG4A 1YDTE 2OK1A 3GOKA 3MBLA 2W4JA 3FJQE 3OF0A 4WNPA 5IA4A 3FL4A 4ZP5A 5AR2A 2BALA 4YJSA 2VTQA 2WOTA 3OCTA 4H36A 1DM2A 4RWIA 5ICPA 3WYYA 3NUXA 4U80A 2QLQA 2WMWA 3DOGA 5DHJA 2QR7A 2W99B 4CV9A 2X2KA 1JBPE 1UU7A 5DN3A 3EL8A 5E1EA 4QQCA 2CJMA 2HXQA 4D4SA 5L8KA 2R3PA 4KBAA 4JDHA 1BYGA 1YKRA 4E5BA 3D5XA 3U8WA 2IVTA 1IAJA 4KIOA 3TTIA 4D2VA 2JIVA 3FZOA 3PP1A 4QP2A 3V04A 2WQNA 4GKIA 2XH5A 2G2IA 2E9VA 3AD4A 2VO6A 5HE2A 3BU5A 2YWPA 3VJOA 1UWJA 3CLYA 4UB7A 3Q9XA 2A27A 3E93A 3OD6X 4FZ7A 5A14A 4Q5EA 3S0OA 3AT3A 1NW1A 4IAKA 1HOWA 2XJ1A 4ENYA 1LPUA 2BAQA 3LJ1A 4JIKA 4LM5A 4ZTMA 5E8VA 3NUNA 5IPJA 2RFDA 4FTJA 4GH2A 3PLAE 3OG7A 2CGVA 2H9VA 2JIIA 3VW8A 2YWVA 3EQHA 2FH9A 1B39A 1IG1A 2XMYA 5C8MA 4CYJA 3OZ6A 4MWIA 5EI2A 2ACXA 4A9RA 5GINE 1QL6A 1Q41A 2CN5A 5H9BA 2QONA 4O7YA 4TYGA 2F2CB 4ANLA 4GRBA 3W2SA 3BYUA 2W9FB 1KOBA 2JBOA 4WSYA 1P4FA 4TYHB 2WB8A 2WOUA 3DZOA 3A7GA 3HECA 3RGFA 4R78A 2QC6A 4BBFA 5AUYA 1CTPE 3LCSA 3MN3A 3OXTA 3QYZA 5E8XA 5CQWA 2BDJA 4TYHA 3N4VA 4MXOA 3R8UA 2I0EA 4YZMA 2BRNA 3QKLA 3BBTB 2X39A 4MXZA 4XCUA 4FKIA 4IAZA 3RMFA 4AGUA 3OROA 4EZ7A 4RIYA 4TNDA 4QO9A 4KIPA 2RF9A 3PSDA 4F63A 3LKMA 3SAYA 4ZJJA 2X7OA 3F5GA 4Z7GA 1G8AA 3Q52A 1KE5A 4WBOA 2H96A 4QMXA 1OL6A 4WA9A 2VTRA 5FEQA 4C4JA 2HZNA 5CX9A 5C1QB 3QGYA 4O1OA 4FV5A 1DI8A 4GJ2A 2GS7A 3FPMA 3ZBXA 4F6SA 1F3MC 2FVDA 3UZTA 2B0QA 4IIRA 4ACDA 1VEBA 4JXFA 3TUCA 5J5TA 4ACMA 3RKBA 3DKGA 3D5UA 4APCA 5CF6A 5J7HA 2P3GX 1URCA 5J9YA 1QCFA 4XEYA 4RC4A 3WZDA 1FGIA 5DR2A 4A9UA 2XNPA 2C3JA 2JITA 4QPSA 3HVCA 4PWNA 4DH1A 4NW6A 3W2QA 3ZU7A 2YLFA 3UQCA 5E1SA 5IQFA 5KMJA 2YZAA 5D7AA 3E8NA 3E8EA 4JI9A 4RJ4A 3FL5A 1O6LA 2WQEA 2Z02A 3MGYA 4FTKA 1WAKA 1Q8TA 2PVJA 4H1MA 1PY5A 3KY2A 4IM3A 4L53A 4QMUA 4DTKA 4AN3A 3OWLA 1VJYA 1W8CA 3FI2A 2BVAA 4BVUA 5HTCA 3UIXA 1YDSE 4QPMA 3UVPA 5CALA 3GU7A 5K9IA 2CKPA 1SYKA 4RFZA 4YTIA 3I1AA 5AM6A 3EQCA 1GIIA 2UZWE 4YHJA 4PP7A 1M7NA 4U5JA 2YCSA 5CNOA 3DFCB 5M51A 2GPHA 2ETRA 3G0FA 5GZ8A 3E8CA 3NR9A 5IA1A 2C3KA 4PV0A 2QR8A 2A4LA 3QF9A 4C37A 2OFVA 2VWWA 4G3EA 2NP8A 2UW6A 4JR7A 2PSQA 1XWSA 5FXQA 3DJ6A 5D11A 3REPA 2GSFA 4DH8A 2C5OA 3BI6A 4KINA 2QHNA 3SLSA 5I3OA 2ZB1A 2J5FA 2VX3A 4XJ0A 2ZVAA 4QP6A 2R3FA 2ETKA 3G9LX 2OW3A 2W05A 2R7IA 4RRVA 3IPHA 4LV8A 2R2PA 3PXRA 1TQIA 3R63A 3VBXA 3DNEA 1YOMA 2GHLA 3Q6UA 4JBPA 4RC2A 1PYEA 4C3PA 2OZAB 4GK4A 3R7YA 4E6AA 3TNHA 2PHKA 3QA8A 1G8SA 4ZSGA 4EC8A 2UW4A 5EFQA 4KABA 2YAKA 5JQ8A 5ITAA 4AQCA 3P7CA 3KRLA 4PNIA 2WEIA 3SKCA 4E1ZA 3TJDA 1YXSA 2EXCX 3HP5A 4M12A 5HORA 3AXWA 2OFUA 2P2IA 3QZHA 2ZDTA 2HELA 3FZSA 4C2WA 4CMOA 2OSCA 5CU6A 2FYSA 4IZ5A 2Y7JA 3C4WA 4MK0A 5GZAA 5HIDA 5CAPA 5JT2A 3MH0A 5KZ0A 3PVBA 3QXOA 3QZIA 3W18A 4FMQA 3FLQA 4ZTRA 3HA6A 5IG1A 2BTSA 5LWMA 5GJFA 5M07A 2WMVA 4CFFA 3D94A 4I24A 4GCJA 4JS8A 2IVUA 4GFGA 2YHVA 3PRFA 4G6OA 3KXGA 2WMBA 5EYDA 2W1ZA 2WU6A 3SHEA 1PXIA 2Y8OA 3R8VA 4K1BA 3D7TB 4DFZE 5L2WA 4NIFB 1ZMUA 2R3QA 5AAFA 5KO1A 3L8SA 4RBLA 3B8QA 3BE9A 2X7FA 3G9NA 3NEWA 3LAUA 1ZOEA 2VN9A 4FV2A 2GQRA 5JH6A 3R73A 4C4GA 4MF1A 2BCJA 3LXKA 3GOPA 4R3RA 2WMTA 5AM7A 4EOMA 2UZBA 4I22A 4KKHA 4XLVA 4BBEA 3TZMA 2XNGA 4BTKA 4FTQA 4YLLA 5HTIA 4R7BA 4IX3A 4H58A 4D2TA 2XK8A 4EQCA 2UUEA 3E3PA 3FAAA 4ZEGA 1OM1A 3QQHA 4O38A 3ATTA 4BCPA 2ZV7A 1BI7A 1ZYDA 1A9UA 4PTCA 2F57A 2QURA 3GC0A 3VS6A 3VHEA 1MQBA 1UNGA 3FMLA 5KMIA 5BMSA 4FG9A 4D5HA 5IEYA 4FTTA 3D83A 4PUZA 3ZZEA 3EHAA 1U54A 3W2OA 3PIYA 4C3RA 2EWAA 3DPKA 3R22A 3NRMA 2EXMA 2IN6A 4U44A 4WO5A 2QOCA 3V3VA 2CNQA 5EQYA 3DGKA 1JKKA 3KKVA 3ANRA 1JKLA 1Q8ZA 3CTJA 5IQAA 3QUEA 3SC1A 3ORPA 3ZRMA 3RK9A 2C3LA 4DLJA 2ERZE 4PTGA 3FWQA 3GU4A 3NZ0A 2PPQA 4ZTQA 4F9YA 5E7RA 3SDJA 4E7WA 5JGAA 4AFJA 3I60A 3MA3A 4HGEA 3ROYA 2IJMA 4O0UA 4LL0A 5J79A 4KSPA 3KMWA 3PPJA 4Y72A 5BMMA 3SV0A 3FZRA 3CQWA 4FSYA 4UZHA 1YOJA 4GUEA 5EM7A 1OKZA 2O8YA 3BZ3A 4F6UA 3PG1A 4BZNA 2XKEA 3P5KA 5J87A 3WI6A 3HKOA 2I1MA 3Q6WA 4USEA 3PE2A 3LFSA 4I0SA 3IDPA 5HBEA 4BKJA 5AUTA 4MQ1A 4F7SA 2B55A 1V1KA 3TXOA 4XP0A 3A2CA 3UG1A 2WXVA 4AUAA 5M08A 3EKNA 1SNXA 2QI8A 4NCTC 4MH7A 4EQUA 2ZAZA 3D15A 3IS5A 4O7LA 1OVEA 2YIWA 5LWNA 1UU3A 3EFKA 4GT4A 2X8IA 4IVDA 4ZOGA 3BLHA 5ANKA 3G33A 4FTOA 3RAKA 2E9PA 4O0YA 4EHGA 4L6QA 3MY0A 2W4KA 2X4FA 2VD5A 3ZOSA 3BHUA 2ITPA 2R3HA 4S33A 3DKCA 4JLCA 5TF9A 1KE9A 2V7AA 4RT7A 5IH5A 2WKMA 2I7QA 4MHAA 5EG3A 4BKZA 5AAGA 2VTSA 2R3OA 2Y0AA 3QYWA 4YZCA 2C6TA 4MNEA 4O27B 3OUKA 4EHEA 1XH9A 4NFMA 4QP8A 4YP8A 4PPBA 3H10A 4GVAA 5CEOA 1CDKA 2BAJA 3VBQA 1JAMA 2OZOA 3HDNA 4RJ6A 4TL0A 4ZAUA 1OKWA 4FTUA 4QOXA 3SQQA 2HK5A 5D10A 2R5TA 1Z9XA 3CPBA 4N6ZA 4W9WA 4XOYA 4DGOA 1PKDA 4CRSA 1NY3A 3NVMB 4ID7A 3F3WA 3R9DA 4RJ5A 2PZ5A 5CSWA 2GQGA 4AT3A 5AP3A 5CASA 5HIEA 4AGCA 2C5NA 2VTNA 3KF4A 2J0KA 4F4PA 5HKMA 4BBMA 2XIKA 5A54A 4FV7A 3DXPA 5M4CA 2FA2A 2OZAA 3VS5A 2VTHA 4U7ZA 5H8BA 4DBXA 4NJDA 3UO4A 4CTCA 4KS7A 3C0GA 3VNTA 4G3FA 5TO8A 5AAEA 5FM2A 4OR5A 4OTQA 1J3HA 2HWPA 3U54A 3DJ7A 1FBNA 4YZNA 4W4XA 1JSUA 4YC3A 1Q5KA 4AN2A 3LXNA 4EZ3A 3TTJA 2YEXA 4TRLA 4W4VA 4JVGA 2C6IA 1OPKA 2ZV9A 1Q8WA 3AC3A 3AMYA 3FC2A 2HENA 3NDMA 3QX4A 3NNUA 1WBPA 3E7VA 4L7FA 5IA5A 3RVGA 3ULIA 1XH7A 2E9NA 2ETMA 2G2HA 4HYSA 3HYHA 4MNFA 5CENA 4AW1A 4R77A 4EUTA 3MH3A 4FSZA 3DXQA 3FHIA 4OLIA 4CT2A 2UW7A 3Q5IA 4RLKA 3A60A 4WT6A 3L9NA 5M44A 2HWOA 3KRRA 2ITZA 2LAVA 2Y4PA 4U42A 4ARKA 2WMUA 2OH0E 2PVLA 3QCYA 3UQGA 4W8EA 3LIJA 1KE8A 4BCIA 2GFCA 5J9LA 4O7NA 3RK5A 5AP2A 2BZHB 3T8OA 2Z7LA 4O91A 2VX1A 3P23A 3C50A 3O7LD 4LUEA 2XBJA 4M8TA 4Q5HA 1K2PA 2E2BA 2UW5A 4JDIA 5HESA 4EI4A 1NT2A 4JT3A 3BKBA 3N4UA 2C5VA 4ITIA 4RVLA 3R0TA 3CIKA 4ERWA 3POZA 4ZIMA 4CFWA 4ZXTA 4IJPA 1O9UA 3TWJA 1RJBA 2B4SB 2EVAA 4X6QC 3PWDA 3PLSA 5HE1A 4I0TA 2BIKB 3QC9A 2YIRA 3OW4A 1PRYA 3QUDA 5AX3A 1L3RE 5HLWA 3Q2MA 1PXJA 4HCVA 5BUIA 2GHMA 3UIMA 3VS7A 3CTQA 3ZO4A 3R02A 5HZNA 2KTYA 3NIZA 1J1BA 4GU6A 5KMKA 2UW9A 3HAVA 3G90X 2UZTA 1AGWA 4JG6A 3FYKX 4P7EA 4QNYA 4QP9A 4EZ5A 4O22A 5ETAA 4IQ6A 5FP6A 4CV8A 2HXLA 2Y4IB 1ZYCA 3RHXA 3C4ZA 3DKFA 2WQBA 4A9YA 4F1OA 5CEKA 4IANA 3FZTA 3GFEA 4TPTA 1H1SA 4WRGA 4CGAA 4DG0E 5JQ5A 3ATSA 5HG8A 4XUFA 3I4BA 1PXMA 4K77A 4MEDA 4C4HA 4C58A 3AQVA 4BI1A 4YLJA 3GC7A 4WNOA 1BL7A 4UMQA 2VTOA 2GNFA 3TEIA 3H30A 3OP5A 1PMEA 3HAMA 4HGLA 1K3AA 3AC8A 3MVHA 4U8ZA 5CZHA 4YTFA 3GQIA 5KX8A 3GVUA 4HYHA 5CXZA 3HUCA 4O83A 2F7ZE 3EOCA 3V01A 5HNBA 4J8MA 4LMNA 5H8GA 4I3ZA 4AWIA 3FV8A 4KKEA 4YBJA 4ZY5A 5IA3A 3QTRA 1OBDA 4FEUA 2QHMA 3MA6A 4MWHA 4S30A 3VUGA 4GFOA 5FQDC 4YZBA 3H0YA 3GBZA 3QTWA 3F3VA 3IW7A 4A4OA 4GMYA 3DBQA 4GEOA 3SOCA 1YXUA 3AGMA 4P5QA 4K9YA 5EYCA 3LW0A 5CT0A 4FNZA 4ZJVA 3F82A 2Q83A 3UOHA 2CLQA 2XK4A 4JQ8A 3VF9A 2ITVA 2JKOA 5EK7A 2DS1A 4WBBB 4W9XA 4HOKA 4F9AA 5EKOA 3EN5A 5AV4A 3MPTA 4DFBA 1VR2A 2H8HA 4KSQA 4H1JA 2GHGA 4O0SA 3E7OA 4DEGA 3ZXTA 5M55A 4GG7A 2YERA 4M67A 2C6EA 4CRLA 3QTIA 3DJ5A 4S31A 5D12A 4FZDB 3OUNB 2WGJA 4JAIA 1M14A 2XZSA 4APPA 5KNJA 4O7WA 4I93A 3C51A 2J0IA 4MBIA 2GNLA 5DVRA 3TV4A 3CR0A 5BUJA 2C6DA 4DEEA 5CAUA 2NO3A 2JLDA 3BIZA 3KK8A 4KIKA 4PRJA 1ZMWA 5LVLA 1YWRA 3NUAA 3PDTA 5A4EA 3FYJX 2ONLA 2BAKA 3LQ8A 3ZONA 4RC3A 4YSMA 4TWOA 2PUPA 4TN6A 3D5WA 4NJ3A 3F5PA 1Q99A 5CAOA 2X8DA 2Z8CA 3FLSA 3CJGA 3FZPA 5CS6A 5CY3A 4YHFA 2V55A 3N4TA 4E5WA 2F49A 2F4JA 3KK9A 3JPVA 4Z9LA 4BCNA 3SOAA 2YCQA 2PK9A 4HCTA 3RNYA 3T3VA 5I5ZA 3AG9A 3V6SA 1H27A 4EK5A 4FK3A 2OXDA 2VGPA 3FSKA 2I0VA 4O0RA 3Q9WA 3HMOA 1IR3A 4U41A 2HZIA 4IFCA 1Q3DA 5FD2A 3MB6A 4UWYA 5HLPA 5CF8A 2XVDA 4EH6A 4DCAA 2G9XA 1PXPA 2G1TA 4D5KA 4QMYA 3FQHA 4HPTE 2VRXA 3ZXZA 2J2IB 4BTFA 4IDTA 4HYIA 3RI1A 4D58A 4P2KA 4CFUA 2CNVA 2OJFE 3QCQA 1ZOGA 3RHKA 5J5SA 3O17A 2BZKB 4AZEA 5JFSA 2FO0A 4FE2A 5M09A 3DBFA 3NWWA 1ATPE 3SXSA 3II5A 4WNKA 5FTQA 4EJ7A 3EQDA 2DUVA 5T6KA 3GCQA 2XM8A 3ORKA 4R5YA 4EOIA 5EHLA 3NVKI 2QOKA 4I5MA 4AN9A 4WKQA 3KB7A 2IZUA 2EUFB 4JQEA 3QC4A 3U9NA 5IQCA 2SRCA 3CC6A 5AV1A 3KREA 3TZ7A 2XF0A 5D1JA 4KRCA 4FL2A 3QCSA 2UZLA 5I9WA 5FLFA 4O6EA 1OPJA 3MFSA 5CNNA 5JRQA 2QU5A 4XBRA 3PZEA 3QGWA 4K18A 2HY81 3WIKA 2HYYA 3BLRA 2OJGA 4KBCA 2WEVA 3UO5A 5KCVA 5LOHA 5HIBA 4TWPA 2EB2A 2XP2A 3MVLA 5CYIA 5AWMA 5CSHA 3VULA 4EORA 2YFXA 4UZDA 4M3QA 1UU9A 4LGGA 1Q3WA 4LYNA 4AA5A 4LOQA 4DT9A 1SZMA 2VWZA 3KF7A 1GAGA 3QLGA 3SX9A 3FMHA 5HQ0A 1OL7A 5JN2A 4N57A 4M14A 3OOGA 3P7AA 3SG8A 3BGPA 3OFMA 5K4IA 3A8WA 1AD5A 3ITZA 3KCKA 1E1XA 2RG5A 4E4NA 4PMPA 5KUPA 4A06A 3DTCA 1MRYA 4CXAA 5FDXA 4BYIA 4IDVA 4EJNA 3F2NA 3U4UA 5CANA 3GB2A 3COMA 3CE3A 2P2HA 4F0GA 3C4XA 3Q53A 2RGPA 5KKRB 2C5YA 3A4PA 3F9NA 5C8NA 3VS3A 3F69A 4BY9E 2FUMA 2GTMA 3KFAA 4FYNA 3PFQA 4EQMA 3BHHA 3DB8A 3IONA 4NM3A 1QPJA 4ZTLA 4IMYA 2X2MA 2VUWA 3CY3A 5D41A 4DBNA 3DLZA 3G6GA 4AA4A 2UVYA 1EH4A 3GI3A 4FV4A 4YJNA 2V5QA 2YITA 3Q3BA 4FSWA 4DCEA 3KRWA 4UBAA 4X2FA 3VIDA 4ALUA 3FMMA 4YBKA 4FNXA 3ZUVA 3ZFMA 2O0UA 3AMBA 3R30A 3RNIA 3BLQA 4QNAA 3OC1A 4X3JA 3ZMMA 2PE0A 3ALOA 2HOGA 3PUPA 4MXAA 4WNMA 5CXHA 4CTBA 3F5UA 4FKLA 1JKSA 4GG5A 2GU8A 3OWJA 4U6RA 5AP1A 2YIYA 4IB0A 4QMMA 4DFYA 3GFWA 3PPKA 3LXLA 1LEZA 3QD0A 4BF2A 5AUVA 2EB3A 4NFNA 3D9VA 2JAMA 1IA8A 3V5JA 4KUJA 2WMAA 2PWLA 4J98A 3WE4A 3KCFA 4JG8A 5BVDA 4BCHA 5H2UA 4FK6A 3WARA 4AU8A 4E6QA 4S2ZA 4L7SA 4ZTNA 3Q32A 2YABA 5J95A 1Q8UA 3L9PA 4B4LA 2F7EE 3FPQA 2CGWA 4GSBA 2HCKA 4E4LA 3LCOA 1J7LA 5DEYA 3R7GA 2VV9A 4C35A 4H3QA 2W1FA 3UGCA 2XEYA 3TACA 4AOTA 5L2IA 5A3XA 5AV3A 2XK6A 4N4SA 5AR3A 1OB3A 4BCMA 3DZQA 4QRCA 2DYLA 3RWQA 5IF1A 3R7IA 5L2SA 1WBOA 4M13A 3FDNA 2WTWA 3NNVA 3W33A 4Z7HA 4DAWA 1RQQA 3MDYA 4U0IA 5T3QA 4RIWB 3DQXA 2C6MA 4MTAA 4D2PA 4XS2A 2C0OA 4ACCA 2C0TA 1PXKA 3FKOA 2QODA 3W2RA 2J7TA 5JMSA 1M52A 2W17A 4YC6A 3U9CA 2GNJA 4EOLA 4AZFA 1NA7A 2J50A 3OXIA 3Q96A 2FSLX 4FKGA 4H3BA 4BCQA 5FBOA 5BVOA 3PY1A 5I9XA 2PVHA 4GUBA 3OEZA 3ZO3A 3VQHA 4BB4A 4CEGA 4D4VA 3AD5A 3D14A 3LZBA 4D4RA 5CWZA 2QOOA 2IG7A 4WG5A 3KXHA 5EH0A 3PXKA 4YJVA 3E92A 3ZM4A 5JKGA 1RDQE 1W83A 2P0CA 2YIQA 2VTAA 2BUJA 4RJ3A 4QP3A 3I0QA 2XKFA 5GZ9A 5EQEA 4GKHA 4C0TA 3TT0A 3ZLYA 2JKMA 5TT7A 3COKA 4L46A 4OBOA 3V5PA 4E73A 5K0XA 4QYGA 5DA3A 2PUNA 5CEIA 3HV7A 3QQFA 1OI9A 3T3UA 4BGHA 3ET7A 5ANJA 4UX9A 3HUBA 4Z55A 3UOJA 4FKQA 3FSFA 2R3KA 2C68A 3CKXA 1ZAOA 2OF2A 4KA3A 5E92A 4FUYA 4QMSA 3FY0A 4FZFB 5LMAA 5DMZA 2IZRA 3LCTA 3OEFX 4QP7A 4M84A 4X0MA 5EYMA 3EZVA 5F9EA 3UQFA 2X0GA 3HZTA 3QX2A 4FX3A 1Q24A 1J1CA 3BGZA 1U46A 4UY9A 5AUXA 3W1FA 2GNIA 3QCXA 1XH8A 4N6YA 4JOAA 2W5AA
chains in the Genus database with same CATH superfamily
3SRVB 3ENMA 4CZYB 3WF7A 4EUUA 5HX8A 2C4GA 3CP9A 2R3GA 3M2WA 1V0BA 4EH8A 3IKAA 4CFNA 4E4XA 1CMKE 4ZJIA 2YDKA 2PZIA 3PA3A 4FKTA 5JRSA 4TNBA 4OT6A 3SXRA 3LM0A 3HMIA 4PPCA 4JQ7A 4BDJA 3R9RA 2E9UA 3NUPA 2JKQA 5G1XA 4HZRA 3PG3A 4MKCA 4BL1A 3CTHA 4H39A 2JDVA 3QLFA 4IHPA 1PW2A 2ITYA 4FV6A 4GJ3A 3LJ2A 3IGOA 4UWCA 5HI2A 5CTPA 2R7BA 4G17A 2XBAA 5HLNA 4TZRA 4PDOA 4M69A 3FKNA 5ANGA 3TDWA 1V0OA 4M7IA 4NUSA 4FTLA 4A07A 4XV1A 5DRBA 4IAYA 2Q0NA 2Z7RA 4MXYA 5GNKA 5J1WA 2OF4A 4FT9A 1Q4LA 2F2UA 2XUUA 4IACA 1GNGA 3DDQA 4BHNA 4CFXA 2XIYA 3C9WA 4IWDA 2Z60A 2BMCA 4QMZA 3OTUA 5CQUA 4RIYB 4JRNA 4YJRA 4YGAA 2QOHA 5DBXA 4EK6A 3C5IA 4I5CA 4RFYA 3L8XA 2C1AA 4J1RA 1S9IA 4NL0A 4C4IA 3I7BA 5IA2A 4O7TA 2OI4X 4GFMA 2VWIA 4K33A 4DT8A 1Z5MA 3SRVA 4HVIA 3DBEA 1XH6A 5AUUA 2XCKA 2JDSA 4O1PA 4FSMA 4HNFA 4TT7A 5K3YA 4YU2A 4IBMA 4J96A 5ETIA 3QHRA 4C02A 5FEDA 4J71A 3V8SA 3MFRA 2DWBA 5TR6A 1FINA 5HCZA 3PFYA 4HGTA 4O0TA 3ZSGA 4EH7A 2I0HA 1MUOA 3PXYA 4Y83A 2XYUA 4MAOA 3F7WA 1YHVA 5EHYA 4MF0A 3LQ3A 4TKSA 4W4YA 1H08A 3PVGA 4I92A 4GIHA 3LLAA 3KXXA 4EOJA 2G15A 4ZSLA 3MJ2A 3NCZA 1T46A 1E9HA 3F5XA 2UZDA 5B0XA 4A4LA 4X7QA 1MQ4A 4A7CA 1UV5A 2NRUA 1NVRA 3H9FA 5HX6A 2BIYA 4CSVA 3GCPA 3WZEA 3EQFA 4DE4A 3R7OA 4CMTA 2X6DA 4U97A 2PUIA 4O7SA 4BZDA 2VTIA 4CQGA 4CKRA 3IDBA 5L6PA 2UZNA 4BGGA 3M11A 2WTJA 4RQVA 1P4OA 3EFJA 2IZTA 4FGBA 2RFNA 4L9IA 2BRGA 3ZFXA 4LGDA 3BV3A 5IUHA 4JBQA 3POOA 4DH5A 3S00A 5EI6A 4HVDA 3OY3A 3C1XA 4BGQA 4X21A 3VS2A 4AZWA 3BCEA 5HBJA 3UNKA 2RIOA 4PPAA 4FV0A 3COIA 1K9AA 3VUTA 4BCJA 4ZS4A 4N0SA 5IH6A 4UYNA 3ZTXA 3SG9A 2EU9A 3ANQA 4CLIA 1YI4A 2JC6A 4HYUA 4ZZMA 3GC8A 5J8IA 5KZIA 1ZZLA 3PVWA 2QG7A 5KBQA 2ITOA 4NU1A 1FOTA 1PMUA 4DFLA 1OIRA 3NNXA 4EKKA 5JGBA 1DI9A 3DK3A 2XCHA 3Q4UA 3QA0A 4QMOA 5CEPA 4EH3A 2PE1A 4F64A 5AADA 2VWVA 4F65A 1GIJA 3QTSA 5FEEA 3TDVA 2QQ7A 4XYFA 4B7TA 4I6LA 4IX5A 4YJPA 5AR7A 5HBHA 3DV3A 2XNBA 3NAXA 5BYYA 5FGKA 4MCVA 2UVXA 2XA4A 2XJ0A 3EQBA 3PA4A 4F7NA 3UOKA 2IPXA 4XP3A 3TIYA 4H05A 3R04A 4G31A 2XAOA 4FBXA 3W32A 3EQPA 3BL7A 4AP7A 3ORMA 3EN9A 3VHKA 1G5SA 3KULB 4O21A 4BDFA 4BCFA 4BFMA 1ZYJA 2W7XA 3P08A 1OKYA 4B9DA 4PL3A 1VLRA 4XV2A 4UN0C 5A4TA 4ZLYA 4QQTA 1HCLA 2GMXA 2HZ0A 4RLLA 3W0SA 3DTWA 3GNIB 2ZM3A 3P78A 4ALWA 4AQKA 1JWHA 4YO6A 2OICA 3L9MA 3SA0A 2GS2A 3BWJA 3ID6C 1UNLA 2A1AB 4ACGA 1YHSA 3JY0A 3FY2A 1M2RA 3QL8A 4XG2A 4E8AA 4BTJA 3AC5A 5BUEA 2CMWA 3R8ZA 3TNIA 3KMUA 3EQIA 4P4CA 4FG7A 4XG8A 4BC6A 4O4BB 4KB8A 2XKDA 4MNEB 5C26A 5B2KA 4RWLA 5EYKA 5GHVA 2XRWA 3VRYA 4O81A 1WBTA 2QVSE 2PVNA 1Y91A 2W06A 3IQ7A 4J8NA 2XEZA 5BVEA 3RWPA 1RE8A 4UMTA 3L8PA 5CI7A 2XIZA 3QRJA 2YIXA 3O8UA 5L4QA 4F1MA 4YJQA 4TWCA 2BTRA 3RK7A 4FVRA 3CCNA 2B9HA 2HY0A 1YXTA 2X4ZA 3CQEA 3EYHA 4EWHA 3PUFC 2QKRA 5BVFA 1ZOHA 5BVKA 5EM8A 2QLUA 3W2CA 1DAWA 5C8KA 3I7CA 2FGIA 3FE3A 4LGHA 4ASDA 3SGCA 4E93A 1M2QA 4JR3A 5IMEA 3OXZA 1REJA 4L44A 2OXYA 4FV3A 1ZY5A 2R3LA 3RAIA 3TZ9A 3DQWA 4YO4A 4IAIA 5I3RA 3HV5A 4BWPA 2X0OA 4OAVB 2YZLA 2Y9QA 3HMPA 4BIBA 4WOVA 5K0KA 3QUPA 5KE0A 1IEPA 3K3JA 5IZFA 4NM7A 5CAVA 4EBWA 3B2WA 2PU8A 4IC8A 4E3CA 5HGIA 2QCSA 3LFCA 4O7ZA 4FTRA 3C5UA 4G6LA 2QOLA 3EN6A 4DFUA 1H1WA 3U87A 2JKKA 2WQOA 4FSRA 4IWPA 3Q9YA 3OVVA 5ETCA 2JDRA 3ZHPC 4BI2A 2RFEA 4ASEA 2ZOQA 4Y8DA 5EW9A 5AA9A 1MRUA 4J97A 1XBBA 5AIRA 5BNJA 5JEBA 3R83A 2PMOX 4PP9A 3OCBA 3F61A 2O65A 3VRZA 4Y5HA 2XRUA 4I1ZA 4FTMA 4RWJA 3RCDA 1WVWA 3E8DA 3QQUA 1RW8A 1GY3A 2Z2WA 3F7ZA 4I6FA 3A7JA 5EW8A 4EH9A 5AIKA 2BHEA 1XH5A 3MB7A 5AV2A 5HO8A 4EOQA 4XRLA 2OIDA 5EI8A 2R4BA 3EN4A 4FIJA 2YJRA 5HHWA 3UP2A 5A6OA 2CSNA 3PRIA 4B8LA 2UW3A 2YM6A 2YM4A 4BDGA 5AP7A 1XKKA 3AMAA 5FRIA 5A6NA 5CSXA 3BELA 3QD2B 3W8LA 2IEWA 4QYEA 3ODYX 1PMNA 1A06A 5IQBA 5LCKA 1FMOE 3BE2A 1Q8YA 4AZSA 4YPDA 5L2QA 3EMGA 5BYLA 2ZV8A 4O86A 5IEVA 2W9ZB 3TV6A 3HV4A 4QMLA 3E63A 3BQRA 4Q2AA 5EHOA 4BKYA 3DNDA 3FLWA 3NW5A 3P5JC 4JBOA 1OBGA 3PVUA 4RWKA 2XJ2A 3RBWA 4YPSA 3ZC5A 4G9RA 4WUAA 2XANA 3MJ1A 4R3CA 2OIBA 4EH5A 1H8FA 3LOKA 3V8TA 4JIAA 5DOSA 4JDKA 3UPXA 4CKJA 4KKGA 4F0FA 2PE2A 3JXWA 4EL9A 1TQPA 3TN8A 3G51A 5FG8A 4RIWA 3IW4A 4GK3A 4BDEA 3D7TA 4Y73A 4GT5A 3HMNA 4WHZA 3L1SA 3WBLA 1OGUA 2XM9A 5FBNC 5LXMA 3EKKA 3NMUF 3NW7A 2J0MB 3Q5ZA 4FEXA 3GENA 3NYOA 4O82A 4A9SA 2NRYA 2IW8A 5BQ0A 3FMJA 5FXRA 3UPZA 4S32A 4BRXA 1KV2A 4KBKA 4BN1A 3PE1A 2WTVA 3GU5A 5DR6A 3IW5A 2NYAA 2WPAA 4FL3A 4XP2A 4L3LA 1PYXA 4HPUE 3FXWA 4UALA 2YM7A 4EK8A 4GIIA 3ZCLA 4O4EA 4DF3A 5HCXA 2PVFA 5HVKA 4YMJA 3MPMA 1W82A 3EIDA 4OBQA 5M4UA 3VONA 3NYNA 5ANEA 5L6WL 4ALVA 3LFFA 3TMOA 3C4FA 3PTGA 3QBNA 4F9BA 2RSVA 3GGFA 2A0CX 4AW5A 3P1AA 3NYVA 5C4LA 4R7HA 4FKRA 4O6LA 1Y8GA 3AD6A 2KULA 5AA8A 3UC4A 1OL2A 4G6NA 5BX0A 5B7VA 4CMUA 4DTBA 3Q60A 3ELJA 1KV1A 2WZJA 3AC2A 4A9TA 4AOIA 2WU7A 5HO7A 3QD3A 3EFLA 5AR4A 2UVZA 4PTEA 3WE8A 4NEUA 3I6UA 3TUBA 3V51A 2CCIA 4K6ZA 3W0RA 1YI3A 5DYJA 2PVKA 2XIRA 4EYJA 4QMWA 3TKUA 3LFDA 2AC3A 2J0LA 5KBRA 1ZXEA 4OTWA 4XV9A 3FKLA 3COHA 1NVQA 3BBWA 4XBUA 3KC3A 3LVPA 3HRFA 4BYJA 5K4JA 5M4IA 3O50A 2UZUE 1KUTA 1MP8A 5EM5A 4RVKA 5IMXA 4MD8E 4O4CA 5ANDA 3PYYA 2BR1A 1H1RA 3VBWA 3L9LA 4WD5A 4TW9A 4UEUA 3U55A 4G2FA 4QYHA 4B6LA 4FTNA 5AR8A 4YNOA 5F94A 2XK7A 3VUHA 3ZH8A 4IVCA 4MXCA 1CKJA 1OZ1A 4DYMA 3W8QA 5KMMA 2VAGA 2XK9A 3C7QA 3E62A 1H4LA 3RZBA 4AAAA 1Y6BA 4U3ZA 2YA9A 3LFEA 1IASA 4XNEA 4JX7A 3U6JA 2ZMCA 4LQMA 3DLSA 1W2DA 3UDSA 4NIFA 3IO7A 3MYGA 3UDBA 4ASZA 5IU2A 4WIHA 4ERKA 2AUHA 5AMNA 3KL8A 1BUHA 1I44A 4I4EA 4ZZNA 5A4LA 3ZC6A 4PDPA 3KMMA 5GIPE 3VC4A 3BPRA 3O7LB 4U3YA 2JFLA 4IAFA 3R1QA 3NFFB 3VO3A 3QRIA 3E5AA 2RL5A 4WRSA 2A2AA 1LP4A 4DGNA 3G15A 1XJDA 4FIIA 4FKSA 2J5EA 3RPOA 4OTDA 4GU9A 4RZWA 1B38A 4B99A 1PHKA 2XNMA 3BEAA 5AJQA 2IW9A 3MFUA 3VS1A 4U43A 4I0RA 2PVMA 4XH6A 5LCJA 4R3PA 5JFVA 3R01A 2J4ZA 2R3IA 4G1WA 4NWMA 4KD1A 5I9UA 3KEXA 5IQIA 4AXAA 1LEWA 3ZZWA 1P5EA 1O6KA 2PZYA 5LMKA 1OL5A 4X2GA 3ERKA 4FNWA 1XH4A 5I9ZA 3W55A 2W5BA 5DFPA 2CKEA 4GYGA 4FI1A 4I23A 4I6BA 2ITNA 3U6IA 4FOBA 4K8AA 2F7XE 4RJ8A 2IWIA 4MBLA 3LQ5A 4D9UA 5KMLA 4AW2A 2YM5A 4I4FA 3WILA 1OIUA 4QMQA 4FODA 4IZYA 3KGAA 4JRVA 3HV3A 3AC4A 4GS6A 4JG7A 5IKWA 1UVRA 1XHAA 2B7AA 4LUDA 4TXCA 5BYZA 1Z57A 1WBNA 3R8PA 1W7HA 4L3PA 3UDTA 3ZUTA 3FBVA 2Z7SA 4F6WA 4NSTA 3ACJA 2B1PA 3RTPA 3OY1A 2BRBA 3VBTA 3VF8A 4NTSA 4QMNA 4FJVA 1F5QA 4BCKA 4PMTA 4V05A 3UP7A 1URWA 2FB8A 2LGCA 4BDAA 1HCKA 2W1CA 3BU6A 1ZWSA 2HAKA 3HX4A 4QTDA 2BPMA 2WMXA 3C4EA 3QXPA 4P90A 1WBSA 2BDWA 1J7IA 4V0GB 1M17A 3VS0A 4AE9A 4AX8A 4F9CA 4RMZA 3EL7A 4BICA 4O96A 4L01A 3I5NA 4X3FA 5TKDA 1R78A 4P5ZA 1YOLA 1ST4A 4B0GA 2PYWA 3QKMA 4EOSA 5JFXA 4QP1A 4J95A 3IECA 1JKTA 2P4IA 3LXPA 4H3PA 4I21A 4USDA 5CU0A 5KMOA 4USFA 1V0PA 4AXFA 3UZPA 3NUUA 5L2TA 3EQGA 4DITA 1BL6A 1YVJA 2UW0A 2VWXA 4G3CA 3LMHA 1ZMVA 3W0MA 1DAYA 1XMMA 3F3TA 3DKOA 3GP0A 2YAAA 3GU6A 3PJ8A 4L8MA 3FEGA 2OJIA 2R3JA 3DY7A 3HLLA 3QQLA 4KWPA 4DEHA 4FTIA 2PUUA 4ZY4A 4G3DA 3N51A 4XG6A 5HE3A 4D9TA 2OJ9A 4EWQA 3TM0A 1W0XC 2VGOA 3A8XA 3JY9A 3PWYA 5FTGA 4F9WA 2CDZA 2BDFA 1OKVA 3DFAA 2HW6A 2ZDUA 3CGOA 3GCUA 3OT3A 4ITJA 3R00A 4WG3A 2JIUA 2CHLA 3SXFA 4C62A 5LVMA 3EB0A 3PPZA 4UV0A 2VTLA 3G5DA 2JFMA 2QD9A 2X8EA 4R7IA 4IB1A 2P33A 2VZ6A 3A7HA 3IW6A 1JPAA 1U4DA 4NK9A 3SW4A 2HIWA 2ESMA 2R3NA 4RX7A 1JVPP 2I40A 4YURA 4C57A 3LHJA 3ZS5A 4L67A 2VWYA 3UVRA 3W16A 2O64A 2ZM4A 1OL1A 3NX8A 4CNHA 4EC9A 2GNGA 4AFEA 2AYPA 5J1VA 4CZUA 2V22A 2Q0BA 3ORXA 4WG4A 3QAME 4AG8A 1YWNA 2JD5A 4CYIA 5BPYA 4YC8A 5EOLA 1H07A 4E6DA 3TV7A 1KSWA 3KQ7A 1JOWB 1YXXA 3NAYA 4IADA 3ZYAA 3UE4A 4UMPA 4OUCA 4U81A 4AS0A 2GS6A 4L68A 3VBYA 4OTRA 2XYNA 4FVQA 3NLBA 3I0OA 1ZLTA 3QFVA 4EK3A 3UYTA 2W1IA 5HO6A 4C4FA 2VX0A 4LRMA 4RX9A 3JYAA 4FSNA 1VYWA 4YZDA 4LV7A 5IUGA 5DT0A 4BDCA 3ZSIA 4E26A 3UVQA 2XNEA 2VU3A 3UNZA 2OU7A 4ACHA 4ENXA 5D9HA 1SVHA 3Q4TA 1ZRZA 3CD3A 3DK6A 4E20A 1SMHA 1Q62A 3O96A 4ZK5A 4YNEA 4RVTA 3VJNA 5M56A 4BI0A 4IW0A 2W96B 3TZ8A 3OBJA 3OWPA 3DCVA 3RPSA 5KHXA 1XQZA 2W5HA 4NTTA 4PL4A 3R7EA 4C38A 2PY3A 3UDZA 5LVPA 3MWUA 1JLUE 1PXOA 3IGGA 5E90A 3T9TA 2J90A 3LE6A 3UO6A 4CD0A 5A46A 2PTKA 4BJJB 2Z7QA 1UU8A 3MESA 3KIOC 3QD4A 4EEVA 4CFMA 4DA5A 4DGLC 3RZFA 2BZIB 2ONLC 4M0ZA 3PJ2A 4IX6A 1YW2A 3GT8A 5JZJA 2CNUA 1OPLA 1ZY4A 3HRCA 5GIOE 3FC1X 3FMNA 3OS3A 2ERKA 4M97A 3OHTA 1ZYSA 2UZEA 4DEIA 1DS5A 4ZTSA 2X81A 4HVGA 1BLXA 2OG8A 3PJCA 3QTZA 5H8EA 5F20A 3E3BX 3MY5A 4D2WA 4CLJA 1WMKA 4PX6A 4RZVA 4X2NA 1CM8A 2WD1A 4QMVA 5E8TA 3LCKA 5C4KA 1F0QA 2XNNA 1YRPA 2ZB0A 4FIGA 3HA8A 2ITQA 3R2BA 4CQEA 4ANOA 4LFIA 2R3MA 4C4EA 3O23A 1I09A 3KA0A 3ZEWA 4X3FC 5DNRA 3C13A 1Y57A 4OTGA 5FP5A 4OW8A 5GJGA 1NVSA 4UWBA 1U54B 3CQUA 5A9UA 4QDEA 5M06A 3BHYA 2RG6A 3KXNA 4BR3A 2YM8A 4LOOA 1UA2A 3V6RA 1Q97A 2UV2A 3ACKA 3CKWA 3A62A 4J53A 5A4QA 2ZYBA 5FXSA 4OTIA 3PY0A 4IAAA 1BI8A 4PDSA 4Y95A 4DG2E 5G6VA 4RIXB 4JAJA 3W10A 2JDOA 1R0EA 2C3IB 4DN5A 5H3QA 1JSTA 3TL8A 4OAUC 4C3FA 3ZLXA 4G5PA 2X7GA 2GNHA 3TIZA 4Q9ZA 2WTKC 4ZLOA 5AR5A 3FMEA 4X6RA 5E8ZA 5FUTA 4IZ7A 3I5ZA 4HVSA 4YJOA 5HEZA 4BIEA 3DU8A 3CPCA 1YQJA 3QWJA 4OBPA 3ORIA 5M4FA 1UKHA 4FV9A 4NW5A 3NSZA 4FC0A 4FICA 3JVRA 1H25A 2J9MA 4ORKA 2W1HA 1XBCA 2PMLX 5LMBA 2BILB 3O8TA 5DWRA 3H3CA 5E8UA 5AFVA 1JQHA 4PMSA 4YTCA 1X8BA 3FLNC 3NS9A 2GCDA 4QMPA 2C69A 4KS8A 3HEGA 2JDTA 5C01A 2NNWB 4AZVA 3O0GA 3P0MA 3BQCA 4C34A 4DEBA 4FT5A 5C03A 4FRFA 4QD6A 4IH8A 3NW6A 3ROCA 4FT3A 3D2IA 3KXMA 5HD7A 2YJSA 2G2FA 3OCSA 3DXNA 3UODA 5L8JA 3LJ0A 3RM6A 3A99A 4FOCA 3C0IA 3ORTA 1H24A 2JGZA 4HCUA 4OGRA 4QMTA 4YZ9A 5DT3A 5IUIA 2OGVA 2A19B 3Q04A 3QHWA 1H00A 4BDIA 4FSQA 3VS4A 3ZBFA 5JSMA 1H0VA 4GVJA 1WZYA 1R3CA 3NUYA 4O0WA 3JS2A 3BV2A 4LL5A 4RFMA 1BKXA 4RG0A 4RX8A 4LV5A 2VNWA 4XLIA 3ZFYA 5HTBA 1PKGA 3TNQB 4X2JA 1WVYA 5HD4A 5CSPA 5IQDA 2PMIA 4GYIA 4AT5A 3WF8A 3FLYA 2XKCA 3AGLA 2HW7A 3FI8A 1KE6A 4V0GA 3UTOA 1E1VA 4PY1A 5K5XA 2PL0A 2VTJA 2VTTA 1U5RA 1MRVA 2BKZA 3F2AA 5DIAA 3H0ZA 5AP4A 3R2YA 2WHBA 4RJ7A 1H01A 5AP0A 4RVMA 3NYXA 3R8MA 4AA0A 3O71A 2WELA 3TUDA 3BU3A 2AC5A 3IG7A 4CCUA 3V8WA 4CCBA 1M7QA 2XNOA 3EJ1A 3Q2JA 2BRHA 4DFXE 1UWHA 2ZV2A 4TYEA 3ZRLA 4UMRA 2BKKA 5B2LA 3CJFA 3QQKA 5HG7A 5ACBC 4L3JA 1A48A 4KIQA 3CEKA 3KU2A 3TI1A 3GC9A 3U51A 1FPUA 5EDQA 4AE6A 4R6VA 1W2CA 5HG5A 3ZSHA 4AW0A 1OIQA 2EXEA 5CVGA 5HNGA 1P14A 3LM5A 1T45A 3Q9ZA 4UYAA 3FI4A 4F1TA 2CPKE 1GOLA 3KVXA 4XHKB 3VWAA 4QTAA 3M1SA 3TYKA 4E5AX 2WTIA 3CGFA 5JGDA 4O7VA 2UZOA 3UNJA 3CBLA 5F1ZA 3BEGA 5IA0A 3D0EA 4QTBA 4QYYA 4CG9A 1FVRA 2WIHA 4O84A 4ASXA 1U59A 3C0HA 2W4OA 3R1SA 4MUQA 5ACKA 1J91A 3H9RA 3H4JA 3ZEPA 3F3ZA 5AX9A 4KNBA 3TNWA 5IH4A 5IISA 4E4MA 4HGSA 2GFSA 2VO7A 4AT4A 1STCE 3AT4A 3LFNA 1AQ1A 1FQ1B 3TJCA 4MBJA 2YDIA 4FEWA 3QZFA 4RA5A 3VQUA 4NKAA 2XALA 3AOXA 3AC1A 1ERKA 4XG9A 3PY3A 3ZRKA 4OTFA 1OMWA 1H26A 5EOBA 5DI1A 5CSVA 3ZLSA 2B9JA 4IVAA 4KRDA 3TNPC 1M2PA 3FXZA 3BYSA 3O2MA 4FKUA 4PQNA 5IEXA 4D2RA 5DH3A 2IZSA 3QU0A 2J6MA 3OW3A 4JJRA 3QWKA 1PXLA 1SVGA 3I79A 4L00A 1R1WA 1LUFA 3PIXA 4UXQA 1OUYA 3FHRA 4G16A 3GXLA 2OIQA 4IE9A 5DE2A 1GJOA 4ZLZA 4C8BA 4PNKA 3ENHA 3ZM9A 1CKIA 2Y6MA 3QZGA 4FKWA 4D2SA 4NYEA 3PIZA 3VUIA 5E8SA 5ANIA 5JZNA 3BYOA 2CN8A 3BWFA 2ZJWA 4J7BA 3D5VA 3R1YA 3UJGA 4CFVA 4FKPA 4AGWA 2YACA 2PVYA 2Y4IC 4F7JA 3K5UA 2B9IA 2OO8X 3PJ1A 1LR4A 2OJJA 3R8LA 3RAHA 2WMQA 3IOPA 1WBVA 4L52A 3FQSA 3M42A 4AGDA 2R0IA 2E9OA 3Q4ZA 4U9AA 2BZJA 5C9CA 3DAKA 5HE0A 5IDNA 3FUPA 4NT4A 4U79A 4ANQA 2VO3A 3PA5A 4MXXA 5KHWA 3PXFA 3ORZA 4MX9A 1REKA 2UZVA 1J7UA 4MYGA 3NIEA 5L6OA 3D7ZA 2C6LA 4X2KA 5F4NA 4NM0A 1ST0A 3GEQA 1BMKA 4JL9A 1TQMA 4F70A 5E8YA 3RALA 4O7RA 1H1PA 2X6EA 3QQGA 1PXNA 4UMUA 5E8WA 3TCPA 5DPVA 1JNKA 1Y6AA 5E91A 3W2PA 3MVMA 3VBVA 4DGGA 1SM2A 2VWUA 3HDMA 5ANOA 4G9CA 4FIHA 4O2PA 4X3FB 3UIUA 1YHWA 2OWBA 4R1YA 3F66A 5I4NA 2GDOA 4FKVA 3QQJA 4PMMA 3VVHA 5FTOA 3MW1A 4W8DA 4N70A 4FZ6A 2IO6A 2VO0A 3TG1A 4ZMEA 4IZAA 3L8VA 4F99A 3LFAA 3A7FA 1NXKA 2BHHA 2R9SA 3FMKA 4D0XA 3OCGA 4ITHA 3OMVA 4HNIA 4AOJA 4DC2A 3FI3A 4Y5QA 5BVWA 5CF5A 4BCGA 2VTMA 4K2RA 3UIBA 1IRKA 3D4QA 3IK3A 4KIKB 3RINA 3RJCA 4RGJA 2A98A 3G0EA 3VUMA 4FYOA 2ZFYA 2PZPA 3WOWA 4DHFA 3R21A 4EOOA 3QRTA 2C6KA 4D1ZA 1BX6A 2QKWB 2W1DA 2WTCA 2RKUA 3EN7A 4O2ZA 5LMKC 2ITTA 5L8LA 2GQSA 4DDIA 3FQEA 2JEDA 4EHZA 3P86A 4BZOA 2I0YA 3JR1A 4CT1A 1G3NA 4EK4A 3FMDA 3H9OA 4FSTA 5T68A 1TFFA 5F95A 4XG3A 3FZ1A 3QRKA 4I6HA 4FTCA 2X9FA 4PL5A 4V04A 5AV0A 3MFTA 4IC7A 1CSNA 1QPEA 1ZARA 2ITXA 1FMKA 2CLXA 3K2LA 1R39A 4ZTHA 3R9NA 2OXXA 4YR8A 4DHIB 1FVTA 2QOBA 3R9HA 1Q61A 2PZRA 4J52A 4DINA 2B53A 2REIA 3LFBA 4C33A 5M53A 5DR9A 3VUDA 5LQFA 1FVVA 4BDBA 3P7BA 3A4OX 4XRJA 1R0PA 5EW3A 4C2VA 5I9VA 4XMOA 4RQKA 5KKRC 2W1GA 2ITUA 2WO6A 4I5HA 3RPRA 4D1XA 4FEVA 2B9FA 3UBDA 3V5LA 4DH7A 4OT5A 2XK3A 2J51A 4OTPA 3DAJA 5AP6A 3LMGA 3GUBA 4M15A 3UMWA 4GL9A 3THBA 1GZOA 3EQRA 1O6YA 4FT7A 3E87A 5LARA 3BRBA 5E9EA 3JVSA 4D28A 3WZUA 1OITA 3KXZA 2JAVA 2V62A 3F88A 1JSVA 4ZZOA 5AUWA 3S1HA 3D2KA 4QQJA 5CEQA 4LMUA 4IEBA 3VN9A 4M0YA 2OKRA 3A61A 4DGMA 4F09A 5LJJA 1TZDA 3AKJA 2CGXA 2WTDA 4GK2A 4MD9E 4ZSJA 4ONAA 1QPCA 2WIPA 1QMZA 4GV1A 2BROA 4FKOA 1KE7A 3G6HA 2B52A 2DQ7X 2QO7A 3HL7A 3MI9A 3OTVA 4O4DA 4YTHA 1WFCA 2R3RA 5CI6A 3R7VA 4LOPA 2WNTA 3UG2A 1H1QA 4YSJA 5IQHA 2O2UA 4FR4A 5CT7A 3T9IA 4FGRA 2YISA 1TVOA 3P4KA 5JK3A 4CVAA 3F2RA 2YDJA 1P2AA 4CZTA 4DH3A 1FGKA 3R7UA 4IFGA 2PVRA 3ORLA 4Y46A 1PF8A 2O5KA 3LFQA 4Y85A 3N9XA 2UW8A 4Q9SA 5TOZA 3ZDIA 5E4HA 1XR1A 4L43A 4HZSA 4ZSEA 3NNWA 4DLIA 5FWKK 4TYIA 3FXXA 4G34A 2X2LA 2XB7A 4MD7E 3S3IA 3UZRA 4FIFA 5BVNA 4C59A 1UNHA 2BRMA 4D1SA 4QQ5A 4ZY6A 2WMRA 3HRBA 4Z16A 1YXVA 4EYMA 5LVOA 3A7IA 4QTCA 3EFWA 4EHVA 3LCDA 3RPVA 5K5NA 4CG8A 3BL9A 2V0DA 3NGAA 3MV5A 1UKIA 4J99A 4PF4A 4D55A 2C0IA 3F6XA 3GQLA 3KN5A 4IWOA 2C1BA 3EZRA 2V7OA 3MPAA 3O51A 4JX3A 4PDYA 3MY1A 5HU9A 1W84A 4TTHB 5J7BA 5HOAA 4FKJA 3EH9A 4CKIA 5HCYA 3E88A 3WYXA 4YHTA