3NDMA

Crystal structure of rho-associated protein kinase (rock1) with a potent isoquinolone derivative
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
398
structure length
383
Chain Sequence
MSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEEETFPIPKAFVGNQLPFVGFTYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-Associated Protein Kinase (ROCK1)
publication title Substituted 2H-isoquinolin-1-ones as potent Rho-kinase inhibitors: part 3, aryl substituted pyrrolidines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 108
structure length 383
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ndmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ndmA01
2XK4A 5IPJA 3BU3A 2XEYA 3BGZA 4F7SA 3DNDA 1PHKA 2WIHA 3PA4A 3NGAA 5LMKA 5AUXA 5AX9A 4CCBA 2VTAA 2J5EA 4NW6A 1JVPP 3FLYA 4WG5A 3LIJA 1FMKA 2B52A 3N4VA 2XK6A 3R7GA 5D9HA 3PVUA 4EOJA 2KULA 3SC1A 3K3JA 1OB3A 4EOOA 3LW0A 2IJMA 4ZZOA 1VJYA 4EYJA 4II5A 5GJDA 2X0GA 4Y5QA 5HG8A 3S95A 4KIOA 4EH8A 4F64A 3U55A 3H4JA 3JY9A 3LLTA 4YGAA 4DGMA 4UXQA 3FSFA 3AC1A 3ITZA 3DZOA 1ZLTA 3TNHA 4QOXA 1OKWA 5H3QA 3NYXA 4M97A 4TPTA 3RWQA 5H9BA 4CT2A 2F7ZE 2XNPA 3MA3A 5E8XA 5I3OA 4MWHA 4UWBA 1PXPA 4GK3A 3KXGA 4XNEA 3EJ1A 3V5WA 3QTZA 2UUEA 4WBOA 3DK7A 2LAVA 3TNPC 3ZUVA 2W4JA 2PZRA 2YM8A 4TWPA 5BVKA 4GG7A 4PRJA 4CTBA 4YC8A 2VWIA 1H1WA 3E8NA 1H1PA 4DEHA 2Z02A 1URWA 5FDXA 3R9NA 3ZMMA 3PG3A 4BBMA 2J0MB 4QMZA 1CKJA 4FTLA 3ZBFA 4C2VA 2JKOA 4R5SA 4FZFB 4L67A 4LOPA 5AP2A 1ZMUA 5HEZA 4YO6A 3BWFA 4CFMA 5HBJA 2WQMA 4CFFA 5K9IA 3OXIA 5M06A 2VAGA 3E93A 2QOCA 5FD2A 5HTCA 1J7UA 4CG8A 4IWPA 3KK9A 3R6XA 4FR4A 4LV8A 2CNVA 3A61A 4HCUA 4DFLA 3FSKA 4XBUA 2J2IB 2Z8CA 5LVMA 3GI3A 3MVJA 4FV0A 4G5JA 1OITA 2J6MA 2GNIA 4BCFA 3UNZA 4MWIA 5CAPA 5HQ0A 3PDTA 2CKPA 2WOTA 3PE2A 3P86A 4XMOA 2V7AA 4MXZA 3NUSA 1O6KA 4IAKA 4ZS0A 1AD5A 5T3QA 4CCUA 4U5JA 2Y7JA 4EBVA 3KREA 4N6YA 4ORKA 3PG1A 3PLSA 5FTGA 2XYNA 3WOWA 3MN3A 1XBCA 3CD3A 3EWHA 4GYIA 4JS8A 5M51A 1J7IA 3ZTXA 4HYIA 1YQJA 5LQFA 3FMDA 5AV2A 4N57A 3G0FA 3OWKA 4YZCA 3EN6A 2OO8X 2PE2A 4LFIA 5AP0A 3R2YA 3BU6A 4FMQA 2PVMA 5HVJA 4BCQA 1A9UA 2E9PA 5DG5A 3EFWA 3QX2A 4FKJA 4GV1A 4JI9A 2FGIA 4GIIA 5KNJA 3DK3A 3HDNA 2HOGA 4ZTLA 3R9RA 2F49A 2HXQA 2WD1A 2X2LA 4G16A 3IW4A 1NY3A 3E8CA 4OTWA 4QQCA 4QYEA 4WNKA 4DT8A 4AZFA 1Q8UA 3R9DA 5EHLA 2BILB 5BMMA 2W5HA 3AC8A 3VN9A 4Z7HA 5CQUA 4CRLA 4JNWA 3GCUA 5JK3A 2DQ7X 2ITOA 4FGBA 4HZSA 4TY1A 5IQHA 2JEDA 4CKIA 3BYUA 1L8TA 3QCXA 2WMBA 4IX6A 4IZ7A 2JKKA 2VNWA 3KRRA 5CANA 2PUIA 2J51A 4DFBA 3ZM4A 2OIDA 4E7WA 1Q8ZA 4L00A 2VZ6A 5AP1A 1V0PA 2LGCA 4JDKA 3HP2A 4QMWA 3OW3A 3ROCA 3SOAA 3NZ0A 5BNJA 3RALA 4DCEA 4HYSA 3REPA 3CE3A 1UNGA 1P4OA 3GOKA 5HE2A 2V22A 4L45A 4C8BA 3O71A 4MXAA 5JFVA 3SG9A 3R22A 2GTNA 4BGGA 4RZVA 3VHEA 2JD5A 1Y8GA 2VX3A 3FMLA 3HA8A 4RFMA 5C8KA 5LVLA 5AR7A 4UMPA 5CF5A 2Q83A 1PXMA 1URCA 2QKRA 5ETIA 3T8OA 2UW9A 3D4QA 2QURA 3LQ8A 3COKA 2IWIA 5BX0A 3OC1A 2OWBA 4GT5A 4D0WA 1ERKA 4F4PA 3GU8A 3PP0A 3TNQB 2VTIA 2H34A 5CSPA 1ZXEA 4O6LA 5I3RA 3TV7A 4PP9A 3LCSA 3PFQA 3F2AA 4O0TA 3UTOA 1UWJA 2X9EA 2XH5A 4DGNA 3GQLA 4U0IA 5LARA 3KRJA 4PTEA 1YHSA 3AQVA 3IW5A 5GIPE 4F6WA 2W1FA 4L46A 2ERKA 2UZTA 3HYHA 2PMNX 3W1FA 1J7LA 5CSVA 2O8YA 4TRLA 5EKOA 1YXXA 1SYKA 1YXTA 2JC6A 3UOLA 4BCJA 1SM2A 2I1MA 2B7AA 4NM0A 5HO8A 2GPHA 4PMSA 2Y8OA 5HE0A 4BZOA 1R78A 4QPAA 2Y9QA 3MS9A 3GQIA 1H28A 4O83A 5K3YA 5ANEA 2BAQA 4Q5EA 4Z7GA 5CXZA 4F0FA 2C1AA 5BQ0A 2NRYA 4X0MA 3JVRA 2FB8A 2R3NA 5DIAA 2YIYA 4YJQA 3I4BA 2CJMA 3OCBA 4XLIA 4C4IA 1F3MC 2HY81 4LGHA 4ANLA 4O0UA 4AW2A 4FSZA 5ACKA 3QBNA 4YLJA 1PXLA 5A46A 5HNIX 2CGWA 5CZHA 5BVDA 3FV8A 4UN0C 3F5UA 2VTJA 3DXPA 2RG5A 2WMTA 3HEGA 3QQGA 4IAZA 4EHGA 5HD4A 3NRMA 3ZUTA 2UVZA 3CCNA 3GC9A 5AX3A 3JUHA 4RJ6A 1H0WA 5CSWA 5I4NA 4LOOA 2BPMA 3ZUUA 2YJSA 4PY1A 4PWNA 4C61A 5EQPA 1A48A 3BYMA 3UVQA 4BDAA 3DAEA 4CQGA 2GQRA 2I40A 3PXKA 4FIHA 4DFZE 4F9BA 5HTIA 3VBQA 3EMGA 4FICA 4ZAUA 4PF4A 4ACDA 4BWXA 4MD7E 4QP1A 2UZVA 3G15A 3R8ZA 2GQSA 3E3BX 3C9WA 4OTQA 3F5PA 5CSXA 5AV1A 4F1TA 2PPQA 3P7CA 2I0YA 3NLBA 3V3VA 2A19B 5JSMA 3RINA 3VBYA 5DH3A 3KULB 3F9NA 4CSVA 2OFVA 3PPZA 1FBNA 3GC7A 1XHAA 4IAIA 5ANOA 5TF9A 5EQYA 5IEVA 3C0HA 4DH7A 5EOBA 4R1VA 3DKCA 1PKGA 2GSFA 3KCFA 3PVWA 4WSYA 2X8EA 3AC3A 4APPA 2EVAA 4FX3A 3O17A 2XM8A 3PTGA 4ZTNA 3WF6A 1XR1A 3DT1A 3FZTA 4CMTA 5K5XA 3BHHA 5IEXA 5HIDA 3DA6A 5HCZA 4FVQA 5JGAA 1PXNA 4F9YA 4UMTA 4LOQA 4CFNA 2ZM3A 4D4VA 2C3LA 4K2RA 4KSPA 4ZIMA 3AMBA 1UA2A 3Q4CA 1HCLA 4GFOA 3PE1A 2YACA 4A06A 5CAOA 2BKKA 1H08A 3DJ7A 3MFSA 3BBWA 3LM0A 4FI1A 4FTCA 3W2RA 4YTFA 5L8JA 4FUXA 4YC3A 2X2KA 4I5HA 4JT3A 4FV7A 4ZMFA 5IA0A 4X2FA 3EQDA 4W8DA 4DFUA 3EYHA 4I20A 4KBCA 4AW1A 3UJGA 2P2HA 2PK9A 2J90A 2Y4PA 4JIAA 1MQ4A 1U5QA 1ZY4A 2CN5A 2OJIA 2YDJA 3H0ZA 4BDKA 5I9UA 2VUWA 2RGPA 3Q6WA 5IQDA 4K6ZA 4DEEA 5JMSA 2C68A 1T45A 4FSTA 3DXNA 3SXRA 4C0TA 3MH2A 4NU1A 3FMJA 4DTKA 2XYUA 4G34A 4LYNA 3FEGA 4IADA 4YNEA 4GU9A 4J53A 1UU3A 4QD6A 4DG3E 3COHA 4FOBA 3WARA 1YI3A 1MQBA 4JVGA 4UWCA 4P5ZA 5C4LA 2FVDA 2W4KA 2XCKA 1BL6A 3H30A 4UMQA 4V0GA 2ETRA 4DITA 1JSUA 4Z3VA 3OBGA 2ZDUA 3UQFA 2IVTA 4QMYA 5HLPA 4J1RA 4F6SA 2C5VA 4I6FA 4FIIA 2WZJA 3VBXA 1JKKA 4FV9A 4JXFA 4ACHA 3FL4A 3HP5A 1RE8A 2BKZA 4G6LA 1UNLA 5EHOA 4UXLA 2WMXA 2XZSA 1RDQE 4BWPA 3ERKA 4M3QA 3TI1A 5CF8A 3C5IA 3V5QA 2VWYA 2FSOX 2G2IA 3ORPA 5D7VA 4F7LA 4O96A 1SNXA 3O8PA 4O7LA 3TM0A 3OTUA 5FTOA 4AN2A 2PZ5A 4AN3A 2C6IA 3Q9WA 1GAGA 2X8DA 5AUYA 3NR9A 4QMVA 4E20A 2KTYA 1KV1A 4UWYA 3BEAA 4FKPA 2REIA 4Y73A 4BICA 2PVYA 3R1QA 4WNMA 1PXJA 3RNIA 4LL5A 3SGCA 3RZFA 2C69A 2G9XA 2C6LA 2QD9A 2UVXA 2XM9A 4NUSA 2Z7LA 2ETKA 2XBAA 4YPDA 2IZRA 4JDJA 3V8TA 2ITYA 1OBGA 4EEVA 2BAJA 1WZYA 4DLIA 1ZARA 3IW7A 3KULA 4NZWB 3TG1A 5E8YA 1XKKA 3L8XA 4M0YA 2QODA 3HMPA 4FG8A 4FTJA 1OPKA 3HZTA 4H1JA 4I92A 5AUTA 4CFUA 1ZRZA 5JT2A 2X7GA 4Y8DA 5L2IA 2C6KA 2JDOA 3CTJA 2HAKA 1WBPA 3WF7A 4D9UA 4U40A 1YRPA 4IVBA 1H07A 4MXCA 4FNZA 2RG6A 2VTTA 3F61A 2B55A 3RK7A 4JAJA 4A9SA 1LEZA 2HW6A 1V0BA 2W96B 5JGBA 3KKVA 1OUKA 3ZOSA 4I94A 3FMNA 1Y57A 4YMJA 1KE9A 3QX4A 2R4BA 4IANA 4KS8A 3W8LA 3HA6A 3FI8A 4RIYB 4BY9E 1W84A 3E8DA 4O7WA 4NIFB 3P08A 1YDSE 3TTIA 4D2PA 4U7ZA 4MXXA 1WVYA 5KMKA 2ZV8A 4GK2A 3ETAA 3PWYA 2QLUA 2PZPA 2QCSA 4AT5A 2XK9A 2V62A 3BE9A 4EC9A 3GB2A 1I44A 5AADA 2XIXA 5IF1A 3QTXA 5L2QA 3U6IA 3CGOA 5A9UA 1BL7A 2PHKA 2VWZA 3MVMA 5IQBA 5KCVA 5F95A 2P55A 4G31A 3UMXA 2I6LA 4HNIA 4W9XA 3QCQA 4FKIA 5DMZA 2BRBA 1PF8A 3ZLSA 2XNEA 3F3ZA 4LRMA 3LVPA 4YJSA 4EC8A 3GCPA 4YHFA 5AP6A 4BDFA 3W2OA 5LXMA 2JFLA 4FSUA 1V1KA 2Y6MA 3HRBA 3LFNA 2I0EA 3DBFA 3L9PA 4DINA 1PY5A 4PQNA 2Y0AA 3OVVA 4I0TA 5EI2A 4PNKA 3MI9A 4B6LA 3VBWA 4EQCA 3DPKA 3CJGA 2B9IA 3AT2A 3EN4A 2ZB0A 5JZJA 2XKFA 3E7OA 3DOGA 3KF4A 3KK8A 4JG7A 4LRKA 4O27B 3W2SA 3LQ3A 3IW6A 5HORA 4ZJJA 2XKEA 3QYWA 4FC0A 4LV5A 4ANBA 2V0DA 5IQAA 2UW7A 2SRCA 3OFMA 3SLSA 3QLGA 4TYGA 4A9YA 2C5YA 5D11A 2YIRA 4AX8A 4DCAA 3T3VA 2ZM1A 4E93A 2WTWA 5DRDA 4FKOA 4K1BA 2OKRA 5FXRA 3K54A 2IVSA 4C4EA 4RG0A 3KFAA 5ACBC 1L3RE 3QTRA 2VWUA 4BTJA 2WMUA 5FP5A 4AT3A 5AP5A 1I09A 2EWAA 2ZOQA 3F88A 4R3RA 3VF9A 4ANOA 3PUPA 3KF7A 2OH4A 4FTTA 3FAAA 4A9RA 4L42A 3HX4A 3CQEA 4WG3A 3TNIA 3RK5A 3W10A 4EK5A 1NT2A 3PSBA 3QQKA 5CTPA 4MCVA 2R3PA 5KBRA 2X81A 2YAAA 1G3NA 4TWNA 4RLLA 2YJRA 2I0HA 4GU6A 4XG6A 4Y85A 5FP6A 3IDBA 3P4KA 4RX7A 3KC3A 3BLQA 3EN7A 3V8WA 3IO7A 2WQEA 4W4VA 2XJ2A 1YDRE 5EDRA 4H36A 4BGHA 2CKQA 4YJNA 2FSMX 2HY0A 3TJCA 5ETAA 4PPAA 3O23A 3ODYX 4RVLA 4HZRA 3NX8A 3ID6C 4C57A 5AV3A 4GS6A 3C0GA 1M52A 3R7IA 3TDVA 3M11A 5L2SA 4ZS4A 4F6UA 3OUNB 2WU7A 3WILA 3FBVA 4N70A 4D55A 2XF0A 3I60A 4TN6A 3QC9A 3L8VA 4IFCA 5AM6A 5AUWA 4AUAA 4NJDA 2VD5A 3Q5ZA 1OUYA 1OL7A 3QZHA 3TUCA 5DR6A 4C3RA 3A2CA 4RC3A 3G5DA 3ORZA 4RIYA 2XBJA 4RPVA 5HICA 3PA5A 1BX6A 2ZM4A 2WEIA 4D2RA 2GNHA 4O0VA 3VUDA 5CI7A 4C59A 1RW8A 2YA9A 3QD2B 3ZU7A 3A7FA 2C5OA 1PKDA 3QTUA 4RFYA 4U9AA 5HOAA 3LXKA 2RF9A 3R83A 3EIDA 5IH6A 5JRQA 5CI6A 1PXKA 3GXLA 4FKTA 3OUKA 4X3FC 2J0JA 4XRLA 4B9DA 1JPAA 3FYJX 2W1DA 4PX6A 4D1ZA 3S0OA 1OL5A 3BLRA 2B9HA 2DS1A 3FKOA 3POZA 2YLFA 3KU2A 2BDFA 4BCKA 2FH9A 4BHZA 1YKRA 3CTQA 4I3ZA 3QKKA 4KUJA 3VC4A 1H27A 4JBQA 2P33A 2O3PA 1WBOA 4FTOA 2RFNA 4Z9LA 3ENHA 2P0CA 2XMYA 2XRUA 2OI4X 4GT3A 3I7BA 4WT6A 4FTAA 4BVUA 2F7EE 3OMVA 5AUVA 2YFXA 2BIKB 5ANKA 4A9TA 1YWVA 4PNIA 3SQQA 4CT1A 3RHXA 1JWHA 2PSQA 1BKXA 3LFEA 3H0YA 3PY3A 4MVFA 3GUBA 4YJTA 3OWPA 4UMRA 4YUQA 3TV6A 5HTBA 3BE2A 3UPZA 4FEXA 3ORTA 4GFMA 3DAJA 2BTSA 4E6CA 4Y95A 5CSHA 3FLSA 5I9ZA 3GOPA 3RVGA 3ALOA 1J1CA 2CNUA 2UW4A 3MPTA 3RZBA 4D5HA 4OTPA 5CLPA 1FPUA 3O0GA 3KMUA 3UZRA 5AIKA 4FSNA 4QP3A 3ZFMA 4QYFA 4W4WA 2CLQA 3ANRA 3KRXA 2A2AA 3AXWA 4YO4A 3DTWA 3HDMA 4A7CA 4PTCA 3H10A 4QNYA 5LWMA 4QP6A 5FQDC 5GZ9A 4ENXA 2OBJA 5AAEA 2WTIA 4YJRA 3AC2A 3PJ1A 4MKCA 2QOBA 4RQVA 4QP4A 5DGZA 5L2TA 1ZZ2A 3UOKA 2W4OA 5IA2A 2QG7A 4WUNA 5B2KA 5HBEA 4DLJA 3KGAA 1JSTA 3BYVA 3N9XA 3ULZA 2F4JA 5BMSA 4XLVA 3DK6A 3ENMA 3FUPA 5LWNA 3FE3A 3NUYA 3K3IA 4IC8A 3WYYA 3SVVA 3E8EA 3MH1A 1R1WA 1TQPA 1Z5MA 1LPUA 3QCYA 1XQZA 4XJ0A 1JBPE 3L1SA 4EOLA 2WOUA 1P5EA 1QPCA 3FMKA 4JIKA 2CNQA 4DTAA 4QP9A 5G1XA 2ZYBA 1JAMA 3DY7A 3CY2A 3Q4TA 4MBLA 4X3FA 3W55A 5K4IA 1PJKA 3OT8A 5IQEA 3O7LB 1IAJA 5IQFA 1YOJA 5FLFA 3PIXA 1IG1A 4XUFA 5M4IA 4FKLA 4NYEA 3V04A 2C30A 2C5XA 1XH7A 2PMLX 2YISA 4MF1A 5IKWA 2F9GA 5J1WA 1VYZA 4XH6A 5C01A 4YPSA 4ACMA 5HG5A 5IMEA 4XCUA 3DS6A 3Q6UA 5CVGA 4FF8A 3SW7A 4L3LA 4FSQA 4U80A 5HKMA 5HX6A 1JQHA 4WRGA 4OAUC 5HE1A 2ITZA 2O63A 4TNDA 5AR8A 3O7LD 2XNGA 1QCFA 4ZLYA 4W4XA 3DXQA 4X6RA 3THBA 4EZ7A 3JVSA 5AR5A 3ZFXA 5L8LA 2YWPA 4FEUA 4KD1A 4QO9A 1KE5A 4QMPA 4TXCA 2OJFE 4V01A 3RJCA 3CXWA 4AE9A 2O64A 2UZEA 1OGUA 4K8AA 1XWSA 4XG2A 4F08A 3SA0A 3TTJA 5A14A 1Y8YA 4MEDA 5KKRC 3RPYA 1QPEA 2YITA 2XJ0A 3E88A 4XHKB 3MA6A 3OOGA 5E1EA 2VTLA 2CLXA 1M7QA 1OIUA 4BIBA 5M4UA 4FT0A 2RFSA 3HL7A 5E8TA 3MTLA 2R3OA 4AFEA 4A4OA 4AGWA 3OT3A 5E92A 4EYMA 3F3WA 3HUCA 5L4QA 2OIQA 4B0GA 2Z7SA 5C26A 3FWQA 4MAOA 1R39A 3KRLA 4FT7A 4FV1A 5FM3A 5AEPA 2H8HA 5I5ZA 4EOSA 1G5SA 3CD8A 3DNEA 4OTHA 4QMTA 4RJ4A 3TNWA 1OECA 4FL1A 3IECA 4F1MA 2UZDA 2IZUA 3WIGA 5J1VA 4LGDA 4HCTA 1XJDA 3UO4A 3PSCA 5CVFA 2JFMA 3BX5A 3EFKA 2I7QA 3FC2A 3EFLA 4X3JA 3MV5A 1IA9A 2C47A 3G9LX 3CKXA 1Z57A 2OZOA 5ANJA 3NIEA 2OXYA 5FUTA 4O22A 2X1NA 2P2IA 4ALWA 3QYZA 5BUJA 5CEMA 5K5NA 2QOOA 3KMWA 1OPJA 4M69B 4TYHB 5D12A 2Y4IB 4CQEA 3P78A 1U54B 3GU6A 4ANQA 4XEYA 2HYYA 4EQMA 3LMHA 4GIHA 4RBLA 4ASEA 2W1ZA 4I5PA 2YIWA 3EQPA 3MWUA 4RC2A 4EH2A 5CEOA 3LXNA 3D7ZA 5EOLA 3TL8A 4YNOA 3MH0A 3QC4A 3ORXA 2R3RA 2DUVA 4L8MA 4Y83A 4IJ9A 3EQBA 5DYJA 2J9MA 4FTKA 3UC3A 4PV0A 5DI1A 3PRIA 3IS5A 2QONA 5DE2A 1IASA 2WMVA 3KN5A 3QTWA 2HCKA 2R3IA 4FTRA 3KRWA 3UOHA 4BCNA 4C62A 3FL5A 3I81A 4MD8E 4F99A 3GP0A 5HNGA 1WBSA 3UOJA 1U46A 2BZJA 3MIAA 3NW5A 3PXQA 3R00A 4PDYA 3PLAE 4RA4A 4YSJA 2Y4IC 3VUHA 4HCVA 2OIBA 4IW0A 4AZTA 3KVWA 1P14A 2PE0A 4P7EA 3TWJA 4QMOA 1W82A 5HLNA 4WIHA 1YXSA 1Q5KA 3DGKA 2BAKA 2WTJA 5HCXA 4FZDB 4H39A 3QAME 5EDQA 1H1QA 2WTCA 1P4FA 4QTEA 3UO6A 5FXSA 4FKSA 4UBAA 4FTQA 4ERKA 2OJ9A 2BFYA 3PXRA 4ONAA 4YURA 5KO1A 2R3HA 3I0OA 4FIFA 5A6NA 2CMWA 5F20A 3TACA 4F9AA 4Y46A 3ZCLA 2HWPA 3QGWA 4EK8A 2PU8A 3KCKA 2ZV2A 2FSLX 4QTDA 4IZYA 4PPBA 5DEYA 3FI3A 5FWKK 4WD5A 2YAKA 4DH8A 3FMMA 1W83A 3ZYAA 5HIEA 4GKIA 2JKMA 2VO3A 3FKNA 4DN5A 5HHWA 1FINA 4NM7A 1W98A 3MH3A 2YCFA 2BFXA 4BBFA 4Z55A 2JLDA 4NKSA 1Q99A 4J98A 1FGKA 2RFDA 2G01A 3ZEPA 3U6HA 2H9VA 2JAVA 3L8PA 3NAXA 4L43A 1Q8YA 3HRCA 2ITWA 4BWKA 4FUYA 3MYGA 3RK9A 4W8EA 3C4WA 3MPAA 1OIQA 4P4CA 1M2QA 3N4UA 1K9AA 4QYYA 5DOSA 1B39A 4X2KA 2HZ4A 5AIRA 4EL9A 4XS2A 1Q62A 3R01A 3VUKA 3D9VA 2ITXA 4CLIA 4B8MA 3L9MA 3U9CA 3MDYA 3UO5A 3RKBA 2X4ZA 1MRUA 2ZDTA 3RPRA 3R7UA 2Z7QA 4B99A 4F7JA 1OBDA 1YW2A 3C4CA 4FSRA 3D5WA 3HKOA 5DLSA 1QL6A 3KXZA 4M69A 3KQ7A 3F7WA 4O6EA 4BYJA 1OL6A 1U54A 5KX8A 3WBLA 2UZUE 2JITA 3R63A 4Q9SA 4RX9A 4TKSA 4FV8A 3UNKA 1F5QA 1IAHA 3QGYA 2VN9A 4HJOA 3ACJA 4OT6A 5G6VA 3UIBA 4QQTA 3II5A 2XNBA 3R28A 2UZBA 3R9OA 4L53A 1T46A 4E5BA 3QA0A 2QO7A 2H6DA 3BGPA 4UYNA 5E8UA 3GBZA 2C6OA 1OKZA 2B1PA 3CC6A 2OFUA 3QFVA 5EHYA 3JY0A 2WMRA 4D4RA 3IW8A 3HMIA 2BIYA 5BVFA 3Q53A 3NVKI 4QYGA 5TT7A 4NTSA 3DB6A 3FMEA 4L7FA 4ZZMA 5EW3A 3VQHA 2R3JA 2F2CB 4G6OA 4YC6A 1KUTA 4O82A 2NO3A 3FQEA 4ZTHA 4E73A 3NYVA 4GJ2A 3QTSA 4KKGA 1YOLA 5ANGA 2JDTA 4BI2A 3CBLA 5AAFA 3G9NA 4ACGA 1ZOGA 1M7NA 3A8XA 3PA3A 5IH5A 5AA8A 2VWXA 4GUBA 5BYZA 3H3CA 2GCDA 4O0SA 4IHPA 1ZWSA 3FZSA 4YBKA 2WMWA 2OLCA 2GHMA 4KKEA 3F2NA 4ZY5A 1XO2B 2B0QA 2IN6A 4U8ZA 2C1BA 2R9SA 2Z60A 3EQCA 3PZEA 4MD9E 5GINE 5FXQA 5JFWA 3VF8A 3ZC5A 3AC4A 3GC8A 3HVCA 4RWLA 2YM7A 3QUPA 5IMXA 2JIVA 3HV6A 5A4CA 2YIXA 5M09A 1ZMWA 4GSBA 2GQGA 3VS2A 4IVCA 3ORLA 4PDOA 1A06A 5D7AA 2R3QA 3TZMA 4CZUA 4GMYA 4PP7A 4YR8A 3D15A 5HO6A 4BRXA 4EUUA 3Q4ZA 3GVUA 3P7AA 3PY1A 4K77A 3V01A 4YTCA 3UG2A 4BZNA 4KBKA 2UZNA 4F0IA 1TQIA 3C7QA 4D5KA 5F9EA 4QTCA 1YWNA 2GHLA 4ERWA 4AW5A 4EK6A 3LM5A 5CT7A 5GNKA 2QU6A 3FQSA 4JQ8A 5DR9A 4BBEA 4KIKB 3Q5IA 1U59A 2WXVA 4TWOA 2BRHA 5M44A 3NNUA 4FYNA 4Q2AA 4AQCA 4F09A 3MESA 4RWJA 4UY9A 3LJ1A 3PIYA 4R78A 3I7CA 3MPMA 1ZYJA 4XG9A 4AS0A 4EKKA 4E3CA 3VW8A 4O7RA 4ENYA 4OBPA 2GNGA 3G6GA 3LZBA 5IU2A 2VTMA 5CF4A 3AT4A 4X2JA 4RJ8A 3MGYA 2ONLC 3OY1A 2JDVA 3FZRA 4FL2A 2IPXA 3R7EA 3QQUA 4NEUA 4EBWA 4NJ3A 1Y91A 4M12A 3DBEA 3QKLA 4AN9A 3KA0A 3Q60A 4JJRA 3LPBA 3CEKA 4RVTA 5KZ0A 4CVAA 1UNHA 3MY5A 4LUEA 3UMWA 2R3LA 4DEDA 3S00A 4PTGA 1YI4A 2XNMA 1W7HA 2E9UA 4YZDA 5DA3A 5T68A 4TWCA 3S3IA 4CGAA 4U6RA 4NM3A 2WIPA 4E6AA 3GFEA 2B4SB 1ZMVA 4FZ7A 5CASA 3CS9A 4QNAA 4JL9A 2QOQA 4QPMA 3U9NA 3QWJA 4UYAA 5IUGA 3GCVA 4WOVA 3SX9A 4K0YA 1LEWA 3N51A 3QQJA 2WEVA 4DFXE 3RBWA 4D1XA 2J0LA 3P7BA 5CAQA 3QZFA 5CT0A 3W8QA 2XK7A 3PSDA 4N0SA 3VUGA 4MQ2A 4U79A 5KZIA 3BPRA 3EQRA 3LFQA 4P2KA 3U8WA 2QOLA 3GEQA 3D94A 1DI8A 4I0RA 5E8ZA 2R5TA 1CKIA 3BV3A 3KEXA 3ZRLA 5IUHA 4BR3A 2YCQA 4OBQA 4QMUA 3ZLYA 4MBIA 4Z16A 3SAYA 3QRTA 4IZ5A 3PPKA 4M0ZA 4BL1A 4YZBA 4JBVA 4K11A 3R2BA 3TV4A 3VULA 4G6NA 4MH7A 4BHNA 3PPJA 3PY0A 3UNJA 3A8WA 1HOWA 4IB0A 3ZEWA 2X7OA 5HU3A 3PZHA 3VBTA 4M13A 4AOIA 2ITQA 4C36A 2QU5A 3G90X 2BUJA 4GH2A 4H05A 2OU7A 3GNIB 3QRUA 4ITJA 4AWIA 4QMNA 4K18A 4FK6A 4O2ZA 5BVOA 1H0VA 4JQ7A 3ZH8A 4FTIA 3F3VA 2ZMCA 3Q04A 4WSQA 3SDJA 2O0UA 5CEIA 2AC3A 3D0EA 4YLKA 4BFMA 2JDRA 3BQRA 5M55A 3LFBA 3UODA 2B53A 2BZKB 2ONLA 4JR7A 3PP1A 1Z9XA 4MQ1A 4R3CA 3WE8A 1XH4A 4DYMA 2WQOA 3W18A 4AFJA 1OVEA 1V0OA 2BDJA 1UU8A 5AFVA 4CFVA 4L6QA 4ZY6A 2CCHA 3UQGA 5D10A 3E3PA 5EYDA 2VGOA 2C6MA 3D5XA 4KWPA 1H24A 5AV4A 2ITTA 3NAYA 2XEZA 4UALA 5IA3A 1SNUA 2GTMA 3C4ZA 4MNEB 4OTGA 4MBJA 2AUHA 5EKNA 3UP2A 1AQ1A 2YDKA 4EH7A 3M2WA 4PUZA 3R02A 3LXLA 4K9YA 4RIWB 3AD4A 3C5UA 4U41A 2OZAB 3IDPA 3DBCA 4HGTA 3QD4A 1TKIA 3EZRA 4U44A 3VRZA 4BTMA 3EH9A 2C3KA 1FVVA 1XH9A 4XYFA 5H8BA 4WKQA 4FIEA 1E1VA 5J9LA 3FI4A 5B7VA 3TJDA 3OWLA 1FMOE 4G3DA 4J99A 4RGJA 3Q32A 4IAFA 4ZSEA 4FA2A 5CU0A 2WELA 4D2WA 1H00A 4UB7A 5AUZA 4YU2A 2BROA 5E90A 2XVDA 3FYKX 1XH8A 3EL8A 4IX5A 4USEA 3KN6A 4FV5A 3R1NA 4GYGA 3MSSA 1R0EA 2P3GX 3AMYA 3NIZA 5ETFA 3NNXA 5IG1A 3HNGA 4IFGA 3T3UA 4BYIA 5J7HA 1KOBA 4BI0A 3BU5A 1JKSA 4FKGA 1YHVA 5A4LA 5KBQA 5IISA 3PJCA 3PJ3A 4TNBA 4H1MA 4I93A 3QRIA 4I24A 4HW7A 4CD0A 5EM5A 2PZYA 3OROA 3VRYA 3ZDIA 3H9RA 1SZMA 2G2HA 4ZXTA 4RT7A 1KSWA 2OICA 3EKNA 3PIZA 3NYNA 3ATSA 1PRYA 1RQQA 2BRGA 3L9LA 4LG4A 3FXXA 5DN3A 1OIYA 4YZMA 3HV5A 3ZO1A 3BELA 2UW0A 2B9JA 3MFUA 1PMEA 3QU0A 4L9IA 3T9TA 1HCKA 1Q41A 1IEPA 4O7TA 3ZRMA 4ZSGA 2YM5A 1ZOHA 3VJNA 3SV0A 1OM1A 5DRBA 3R21A 2QLQA 3KXMA 3R7VA 2C0TA 5IH4A 4IM0A 3HMMA 1YOMA 1STCE 5BPYA 2OJJA 2IG7A 5B2LA 1JKTA 3QQLA 3GCSA 3S2PA 2BRNA 4IACA 3HV3A 4IX4A 4O7ZA 4DTBA 1WVXA 3IPHA 4B8LA 5EFQA 3DQXA 3NUPA 4ITIA 4L68A 5BYLA 3NUXA 3QKMA 3UGCA 1OMWA 3AC5A 4HVDA 2IVVA 4U81A 3ZRKA 3ZM9A 4UMUA 2GNJA 4R1YA 3LAUA 3BRBA 4CZTA 3LKMA 3UG1A 2OXDA 4C37A 2QR8A 3R73A 5IZFA 1CKPA 4S30A 3RMFA 3C4XA 4X21A 3LXPA 4MXYA 5E8SA 4FNWA 3EZVA 4ZTRA 1LR4A 4YLLA 4GG5A 1WAKA 4CXAA 3R8VA 3FKLA 3LFDA 4USFA 3JS2A 4O7NA 3ZLXA 2WHBA 5KMNA 3FI2A 3OEZA 4FL3A 5CQWA 5HIBA 3NCGA 3OOMA 3PXZA 5M08A 2ZB1A 5TKDA 4PDSA 5IEYA 4FOCA 1CM8A 2UZLA 2GS6A 3PYYA 2GDOA 4K33A 4AP7A 5JQ5A 1ZY5A 3EQIA 1YDTE 4ITHA 4RIWA 3O8UA 2QI8A 5EQEA 5EW9A 4H3BA 4YJPA 4EOQA 2QOFA 5BVEA 3SRVB 3ZXTA 5IDNA 3FXWA 3DBQA 2FSTX 4AZVA 5BVWA 3KMMA 2G15A 3U87A 3LJ2A 3A4OX 3ODZX 4PL5A 2XIZA 2QVSE 3OCGA 4KBAA 4GK4A 3G2FA 4PL4A 2HXLA 4EUTA 5FEDA 4MTAA 1U5RA 2GMXA 2J0KA 2PZIA 2VWWA 1IA8A 3A7JA 4IB1A 3MTFA 4CMUA 4CV9A 5J79A 4ASDA 3JR1A 4YZ9A 4PMTA 1KV2A 4G3FA 2CDZA 4DG2E 4E5WA 5B2MA 4JRVA 4NIFA 4YZNA 3HGKA 2R3KA 5AMNA 5E8WA 5HESA 4L44A 4H3PA 4RMZA 3BBTB 4I23A 4ZZNA 3CGFA 1VZOA 3E5AA 4IH8A 3NNVA 4IM3A 5DWRA 4A07A 4EH9A 4XV2A 4M68A 3LE6A 4FNXA 4J52A 3SG8A 4NSTA 5K4JA 3OXZA 2CCIA 3MB6A 3IOPA 3FZ1A 3TKHA 3QHRA 5DT0A 3EYGA 3RGFA 2GNLA 3CR0A 4MK0A 2EU9A 4C35A 1M17A 5ANDA 4AGDA 4O2PA 2IZTA 4DEIA 4DFNA 3PXYA 4ARKA 3FLNC 4BN1A 3S1HA 1DM2A 4U42A 3TZ8A 4EH4A 3FXZA 4QMLA 2X6EA 2XA4A 1OL1A 3RTPA 4EWQA 3BQCA 1MUOA 3BIZA 4A4XA 2WKMA 5LVNA 4AZWA 1SVHA 3R9HA 3A7GA 2ITUA 1CTPE 4QT1A 2CGVA 2F7XE 5FEEA 3BYSA 3NVMB 4S2ZA 3WF5A 5JN2A 5J9YA 4NCTC 3ZC6A 4L7SA 4WNPA 5DBXA 4FV6A 2XNOA 5CU2A 4DGGA 2ZJWA 4O0RA 1GOLA 3CPCA 3B2TA 5IUIA 5JFXA 1QMZA 4RJ3A 1MP8A 3EOCA 5BYYA 1FOTA 3A60A 2XP2A 3UYSA 3VNTA 4J96A 3Q52A 4IZAA 3R7OA 3ZO4A 3BZ3A 4GUEA 4G9CA 4O0WA 3W32A 4OAVB 4GW8A 4AZSA 2QOHA 3VBVA 1SVEA 5AV0A 1NVQA 4X2GA 4OTDA 3TIYA 1UV5A 4EH5A 5FDPA 4ZSLA 1J91A 5T6KA 3ANQA 1Q8WA 2X7FA 4MF0A 4AAAA 5DT3A 2PY3A 1JOWB 3QHWA 4FTMA 2O2UA 5LVPA 4YJUA 3O50A 3O8TA 4YBJA 3C13A 5C27A 3V6SA 4GCJA 4MNFA 1APME 3RM7A 2EXCX 3PJ8A 4QQ5A 5AR4A 3IOKA 2UW8A 4IJPA 4FT9A 5GHVA 3D83A 4YHTA 5E9EA 1OKYA 1H01A 1NVSA 5B0XA 3MFRA 4EOMA 3HLLA 3TXOA 1G8SA 4FGRA 5ICPA 2J4ZA 5J8IA 3F82A 5CF6A 2RL5A 4AOJA 1GNGA 2IW8A 4FTNA 2W9FB 5LCKA 2J0IA 4FIGA 3TIZA 4EJNA 4M15A 2E9OA 4G9RA 4BDDA 2XIYA 4ZOGA 2NRUA 1FVTA 1XBBA 2YABA 3CPBA 3BEGA 5LOHA 3WE4A 2F57A 2E9NA 4D2VA 3VS4A 3FPMA 3SXFA 2C3JA 3OTVA 4MXOA 4W9WA 3DBDA 3GCQA 4XV9A 5CU4A 3C4FA 5F1ZA 2J5FA 4RQKA 5FG8A 5M4FA 3L9NA 3FY2A 4LL0A 5C8MA 5CNOA 1QPJA 4FG7A 3V8SA 1WFCA 3R8LA 1FVRA 1B38A 1W0XC 2BR1A 2EUFB 4HVHA 4CRSA 2X8IA 3RAWA 4NCTA 4L3JA 4D9TA 4EWHA 1J3HA 1OZ1A 4I21A 2VTOA 4EZ3A 5KMLA 5I9WA 2W9ZB 3BHTA 4IAYA 2PL0A 2XIRA 3QTIA 4HVGA 4QMMA 2QG5A 2VV9A 2OW3A 3DZQA 5I0BA 4I6QA 3SXSA 4NW5A 4BGQA 3R04A 2JDSA 4J95A 2C6TA 5EK7A 4CV8A 3R30A 3JYAA 3KXNA 3VUTA 2W99B 3MJ1A 4QP2A 5JEBA 1IR3A 2WTVA 3KB7A 4J97A 4BKZA 1B6CB 2HWOA 4XG8A 2W1CA 1ZZLA 3LHJA 1IRKA 3T9IA 3UDBA 3WYXA 5HVYA 3B2WA 3RP9A 3AG9A 3QA8A 2ACXA 1OL2A 4LMUA 4AGUA 5A6OA 5M56A 4J71A 3RI1A 1BYGA 4XP3A 2R3MA 3CKWA 3Q9ZA 4YP8A 1U4DA 3SW4A 4L3PA 3RM6A 2XNNA 1WBVA 5BVNA 3C1XA 1GZKA 4WBBB 4J8NA 1K2PA 4IWDA 5FTQA 4E5AX 2YWVA 5CU3A 3HMNA 2BDWA 3AMAA 3P9JA 5H8GA 4ZY4A 2DWBA 4LUDA 4E4NA 2BZIB 3GT8A 5HGIA 3CY3A 3ULIA 1OI9A 4XG3A 3ORNA 5DHJA 3MVHA 5I9YA 3R71A 4OTRA 3R8PA 3VS7A 5K0KA 5HX8A 3FPQA 4JBPA 2HK5A 2C3IB 3EN5A 5HD7A 1X8BA 4DHFA 2W1IA 4FT5A 4A4LA 4DC2A 4EI4A 4V04A 5IQCA 4S34A 4BDGA 4XP2A 3SOCA 4QRCA 4C02A 3HAMA 3KL8A 4I4FA 2PUNA 2QHNA 2GFSA 5J5TA 5HBHA 2BMCA 3BLHA 3MY1A 4Y5HA 4LGGA 3V51A 2C6EA 3VS0A 4A9UA 2RKUA 5ANIA 2FA2A 3OD6X 1ATPE 1E1XA 1YI6A 1ZYSA 1YXVA 1UU7A 2FYSA 3OY3A 4GRBA 3O51A 4G3CA 3V5LA 5I9XA 4CFWA 4DG0E 5HZNA 4O21A 5FEQA 3F5XA 4FKRA 2QKWB 3D2IA 4JR3A 4O38A 5EM7A 2JKQA 4BC6A 2YZLA 4O1OA 3VIDA 3TUDA 4YJVA 4M8TA 2PE1A 3QD3A 4H3QA 3NS9A 4PL3A 3IGOA 3TUBA 4HVIA 3G51A 5GJGA 1VYWA 2GS7A 2ZMDA 3P79A 2UVYA 4E4LA 1Y6BA 3WZKA 1WBNA 4PMPA 3DFCB 3BHYA 4C34A 1NXKA 3AD5A 3COMA 2FO0A 4F65A 3U6JA 1REKA 2XUUA 2C0OA 5KMJA 3B8RA 4R6VA 5C1QB 3NNWA 4JQEA 5L2WA 4JAIA 2OXXA 4NTTA 2HIWA 4DEGA 1KE6A 2HZNA 2I0VA 3OEFX 1NVRA 1GY3A 2QO9A 4G3GA 4IAAA 5F94A 3M42A 5TR6A 4FSMA 3S4QA 2VU3A 4FKQA 4E1ZA 3SKCA 4IB5A 4R7IA 4F9WA 4IB3A 2E2BA 2ZVAA 2X2MA 4FSWA 4AXAA 4RA5A 2CGXA 5IQIA 4DEAA 4X6QC 3D2KA 3FLQA 1GZ8A 4JDIA 4M84A 4BDJA 5HU9A 3CLYA 3LCDA 3EQGA 4FEQA 4ALVA 5CS6A 2Q0BA 2WGJA 2A4LA 3HUBA 1UU9A 4NFNA 3UZPA 5EM6A 4D1SA 5EM8A 5E7RA 1BI8A 2XKDA 3TKUA 3R1YA 2PWLA 4BF2A 1Q4LA 4O91A 2R64A 2CKEA 5JRSA 5M4CA 4FT3A 3HAVA 4KRCA 3U4UA 4FV2A 2W0JA 5FBNC 2PYWA 3ACKA 3H9OA 2WFYA 4JRNA 3VUIA 4O7VA 3OXTA 2JBPA 2OSCA 4O84A 5EDPA 5H2UA 2EB2A 4BCGA 4D58A 4MYGA 4E26A 4TYHA 2BCJA 4HGLA 3LCTA 5CVHA 2IVUA 2X4FA 3LOKA 4I22A 4O0XA 3D5UA 3IDCA 3OWJA 4LRJA 4C58A 4LMNA 5IQGA 1QPDA 4TT7A 3KVXA 2PTKA 2YIQA 2VO0A 4EH3A 4I5CA 3NCZA 3ATTA 2ZAZA 3IK3A 4D28A 4H58A 4HVSA 1H1SA 2R0UA 5CU6A 2AYPA 3FLZA 2HENA 3HV7A 4IE9A 3DFAA 3WF8A 3D5VA 3LQ5A 4BDIA 5CYIA 3QL8A 3K5UA 2XS0A 4WUAA 4E4XA 2CHLA 4OUCA 1GIIA 2PVKA 3LMGA 2XK3A 3MY0A 2XJ1A 1ZYCA 4FKVA 4PPCA 4FKWA 4I41A 4O7YA 4NT4A 4IX3A 3VS5A 3ZXZA 4BKYA 3RAKA 4QMXA 3C4EA 3DKFA 4C7TA 4NH1A 4R7HA 1Q61A 3ELJA 3W2PA 4RX5A 5JH6A 3Q2JA 1CDKA 4WHZA 5AA9A 4F9CA 4E6DA 4IWQA 5HG7A 2YM3A 4ID7A 4KS7A 2UW6A 2VTRA 5GIOE 5CEQA 2VGPA 2J7TA 2W1HA 4ZTMA 2W7XA 4CKRA 4IQ6A 4HPUE 2R0IA 3MFTA 5CAVA 4ACCA 3IG7A 3UVPA 4IDTA 4IXPA 1S9JA 3A62A 2PVHA 3DU8A 3U4WA 1EH4A 2CPKE 4WO5A 4KRDA 2PVJA 1NA7A 3G33A 2CGUA 4AGCA 3UIUA 4KABA 3Q9YA 1SVGA 2AC5A 1WVWA 4FV3A 2OF4A 3R8MA 5LVOA 3RWPA 3U54A 1Q3DA 4V0GB 4D4YA 4ASXA 2C6DA 1DAYA 2GU8A 3COIA 3ROYA 4AG8A 1WMKA 4CEGA 1K3AA 2PULA 4QQJA 4UEUA 2RFEA 3GU5A 4DH3A 2UW5A 2VTHA 3D14A 3LJ0A 4FVPA 4TYEA 4UZDA 3QQHA 4G3EA 5J87A 3VVHA 3GC0A 3Q9XA 3NW7A 2O5KA 4RFZA 3DV3A 3RAIA 4EK3A 3NW6A 3OCSA 4OW8A 5IA4A 4P5QA 5KMOA 3C50A 3O96A 2H96A 2PVRA 2A0CX 2BHEA 4R3PA 4NFMA 2PVFA 4QYHA 5KHXA 5DFPA 4JG8A 3H9FA 3ZONA 4IBMA 4IVDA 3CTHA 4WRSA 3RNYA 3E87A 4I4EA 2PVLA 1UWHA 4AACA 1Q3WA 3HV4A 4CMOA 2YHVA 3QCSA 2R7IA 4M7IA 3LFFA 3RPSA 2YDIA 2V55A 3AT3A 4QP7A 4RWIA 1JKLA 4EZ5A 5IDPA 1Y6AA 4NL0A 1LP4A 3VUMA 3QWKA 5CY3A 2BVAA 4FG9A 4HGEA 4JDHA 3QLFA 3QUDA 3IONA 4KA3A 4QTBA 2EXMA 3A4PA 4GEOA 4DAWA 4D0XA 2W17A 2HZ0A 2VTSA 2VWVA 3QRKA 4CYIA 5H8EA 2YM6A 4ZTQA 3D7TB 4D2SA 3CJFA 2WB8A 4XG7A 3VJOA 2VTNA 3R0TA 2QQ7A 4XOZA 4KIPA 3B8QA 2BZHB 5KUPA 4BDEA 3G6HA 1J1BA 4M66A 3VS3A 3FC1X 4XX9A 4AA0A 2VX0A 5HI2A 3EHAA 3MW1A 2R7BA 4KNBA 5CEPA 1F0QA 5J95A 4EOIA 5HCYA 2X9FA 1TVOA 3I1AA 4RIXB 4CYJA 1KE7A 2UZWE 3V6RA 2ETMA 3FQHA 4P90A 2ITVA 4YTHA 3EL7A 4CNHA 4Y72A 1FGIA 2XIKA 4FK3A 1WBWA 4LQMA 1BMKA 5BUEA 1VEBA 2JIUA 2YCRA 3F2RA 2CSNA 5LMAA 3ALNA 4BCIA 1H8FA 5AJQA 4O1PA 2C0IA 2Y6OA 1PMUA 4WG4A 5ITAA 4ZMEA 1ZAOA 4KKHA 2W5AA 4AT4A 2B54A 1H26A 5J5SA 3EQHA 3NEWA 1RJBA 3MVLA 3HRFA 4ANNA 4DFYA 1G8AA 4CLJA 4F63A 2BALA 3NMUF 4IIRA 4YJOA 4ASZA 1Q24A 5KE0A 4RZWA 2GHGA 4GVAA 3TEIA 3F69A 3MBLA 3OBJA 3P23A 3JXWA 4RX8A 4O7SA 2CKOA 4N4SA 3V5JA 4QTAA 2WMAA 3UYTA 3W16A 4CZYB 4IWOA 4FEVA 1M14A 3TDWA 3QXOA 3OCTA 2BRMA 2HELA 3K5VA 4L52A 3LFSA 4NM5A 4CFXA 2EXEA 1GJOA 4JX3A 4JX7A 4EOPA 3GENA 3OZ6A 2VTPA 4C3FA 3L8SA 5C9CA 2QOIA 5AR2A 4I5MA 4EOKA 4OBOA 3OG7A 4USDA 4DGLC 4EQUA 4M67A 4D2TA 2WTKB 5L8KA 1DS5A 2VO6A 2A1AB 4KIKA 4BTKA 3R8UA 2PMOX 4KSQA 1OPLA 5EYCA 1GIJA 4AW0A 4F70A 3V5PA 4NK9A 3TZ7A 1O6YA 4RVKA 4C4FA 4ZP5A 4QP8A 3G0EA 3W33A 2X6DA 4KAOA 4DBXA 1BLXA 4EJ7A 5L6WL 4XOYA 1OKVA 3WZJA 2UW3A 4EKLA 3HECA 4WA9A 5A4EA 2JIIA 3FJQE 2A27A 4XP0A 5LMBA 3RAHA 4FV4A 4LI5A 4DBNA 4U3YA 4BCHA 3NUUA 4EHZA 1O6LA 3DKOA 4FKUA 2JBOA 2BTRA 2WNTA 4BDBA 4FIJA 5AUUA 1PMVA 4C38A 4FSYA 3GU7A 4EHVA 4PDPA 3ZZWA 5K0XA 2W1GA 2JAMA 4S33A 1O9UA 4R5YA 5AP7A 2WTKC 3UPXA 4AA4A 4AZEA 5EI8A 4GJ3A 4O86A 2FUMA 2WTDA 4RWKA 4IVAA 5FRIA 5CZIA 5JKGA 3UIMA 3D7TA 4G17A 4AU8A 3C0IA 2IW6A 5KMIA 4R77A 3DJ5A 1LUFA 5FM2A 4TW9A 3FHRA 5CAUA 5HLWA 3GU4A 2UV2A 3AOXA 3I79A 1CSNA 3EQFA 3BWJA 3QD0A 1YWRA 4TTHB 3DDPA 3QALE 5F4NA 3FDNA 4ZLOA 3UP7A 5L3AA 2OJGA 2C5NA 2XKCA 2P4IA 3BV2A 5E1SA 3EB0A 1S9IA 2WMSA 4RIXA 5TO8A 4E6QA 4U97A 3R7YA 4XG4A 4G5PA 2YN8A 4B7TA 3BYOA 3U51A 4UX9A 4AF3A 2RIOA 5GJFA 2WO6A 4L01A 1JLUE 4S31A 4I6BA 3QTQA 5L6PA 4OLIA 5E4HA 2VNYA 3PWDA 5AP3A 1UVRA 3LMIA 3UQCA 2Z2WA 5KHWA 3PXFA 3NUNA 5LJJA 3Q4UA 4G1WA 3DKGA 2G2FA 4I0SA 1PXOA 3I0QA 3NDMA 1VR2A 3GFWA 4RJ7A 3KY2A 4OTIA 2QR7A 5HO7A 5J9ZA 2F2UA 2ZV7A 4JLCA 3MB7A 1E9HA 4JOAA 3I5NA 1BUHA 5HVKA 2VWBA 3BCEA 4FYOA 4C4JA 2XCHA 2ITNA 4F7NA 3WZUA 2WQBA 3R1SA 5HNBA 1SMHA 2E9VA 3TZ9A 3DLSA 3QUEA 5DNRA 4ZSJA 1ZYLA 1Q97A 2IZSA 1JSVA 2GNFA 5FBOA 3VQUA 4ALUA 1YVJA 3NSZA 2YERA 3W2QA 3ZS5A 5C8NA 3CSVA 1PW2A 4FZ6A 4TYJA 3IKAA 4TL0A 3NYOA 4KIQA 4ZK5A 3P0MA 5I9VA 2QHMA 5CWZA 3DB8A 4WNOA 3F5GA 3FMHA 4BCPA 4X7QA 2ESMA 4ZJVA 3DQWA 1R3CA 4Q9ZA 2YM4A 2C4GA 3ZBXA 3GGFA 4RC4A 4GKHA 4YSMA 4FZAB 4GL9A 5IA5A 2XK8A 1DAWA 1WCCA 2IW9A 2BHHA 1M2RA 2QC6A 1CMKE 4MNEA 4KINA 3VS6A 3ZO3A 4FE2A 4XRJA 3NWWA 5EI6A 3ORKA 1PYEA 2WU6A 3AGMA 4RLKA 1GZNA 2PMIA 4FBXA 2OZAA 3E92A 3ZSHA 2Q0NA 4YHJA 3P1AA 2W06A 3RHKA 3UE4A 2O65A 3ZSIA 3BHVA 4CTCA 1H25A 4GVJA 3W2CA 5EW8A 3Q3BA 3ORMA 2B9FA 3I6WA 2PVNA 3OW4A 4I6HA 4EHEA 2XRWA 3KXHA 3K2LA 4V05A 2WQNA 2ITPA 3TT0A 5LCJA 2X39A 4M14A 3FZPA 4HYHA 4DH1A 5D41A 4OGRA 3LLAA 2W1EA 4ANMA 4DT9A 4HPTE 2OGVA 3VAPA 2JGZA 3F6XA 3FHIA 3IQ7A 3NPCA 3OS3A 5CX9A 4BI1A 4HGSA 3A7IA 4ZEGA 2NP8A 5TE0A 5FGKA 4EK4A 4BCMA 2XB7A 5DR2A 4GT4A 1H4LA 4X3FB 2W5BA 3PVBA 3EKKA 4J8MA 2GFCA 2QO2A 5J7BA 4DE4A 3BI6A 5HE3A 5C4KA 2ERZE 4E4MA 3ORIA 3QZGA 3LCKA 4DGOA 4XV1A 3QQFA 4TYIA 3QXPA 2Z7RA 4RJ5A 5AM7A 3SD0A 4C3PA 1R0PA 4E8AA 4CKJA 4CG9A 2UZOA 4HNFA 3DJ6A 4QPSA 4ZSAA 4C4HA 5JFSA 2WAJA 1ZYDA 4R8QA 4O81A 3MIYA 4JG6A 3E62A 4EORA 3C51A 5M53A 2VTQA 1XBAA 2R3FA 3F3UA 5BUIA 5TOZA 4W4YA 4XV3A 4MX9A 5DVRA 3M1SA 4ZLZA 4BDCA 3DDQA 3UIXA 3F66A 4ZJIA 3FZOA 4IM2A 4LM5A 4U43A 3F3TA 3DTCA 3RPOA 3ZSGA 4R7BA 1YXUA 3PVGA 4GFGA 5ETCA 2NNWB 3PJ2A 1ND4A 4KB8A 4RSSA 2EB3A 4RVMA 5M57A 5DT4A 3VS1A 1PMNA 3BKBA 3FY0A 4BZDA 4DEBA 5A4TA 1P2AA 5A54A 4DH5A 2J50A 4NWMA 3VHKA 4FVRA 3ZFYA 4BTFA 5EYKA 5DEWA 2OF2A 3QRJA 4ANSA 2DYLA 2NPQA 1M2PA 4QMQA 3RPVA 1Q8TA 3SHEA 1KOAA 5JQ8A 3AD6A 1TQMA 4FTUA 4HYUA 2PUUA 3A7HA 4FNYA 4UZHA 5HG9A 2IO6A 2OK1A 3RCDA 5EYMA 4AOTA 3I6UA 3UC4A 3VW6A 4AE6A 3CQWA 3LCOA 4RRVA 5A3XA 1KE8A 3UZTA 2W05A 2WMQA 2CN8A 5CXHA 3N4TA 3MJ2A 4BIEA 3ET7A 3VWAA 4DA5A 4IDVA 2VRXA 5AP4A 1PYXA 4O0YA 3WIKA 3O2MA 5L6OA 2V7OA 4C4GA 1YHWA 2OH0E 3FLWA 4G2FA 4I1ZA 4X2NA 5LMKC 2G1TA 4C33A 1BI7A 3A99A 2OG8A 2GS2A 3IGGA 4MHAA 4Q5HA 5CEKA 5D1JA 2YCSA 3AGLA 3DLZA 2QNJA 3Q2MA 4QMSA 1OIRA 4UV0A 1JNKA 5KMMA 3F7ZA 3UBDA 3SRVA 3VO3A 4U45A 5C03A 2R3GA 3DCVA 2VX1A 4F0GA 1XH5A 3E7VA 3LFAA 5JGDA 1AGWA 3EN9A 3POOA 4IC7A 3ZLWA 5IA1A 3WI6A 1MRVA 2RSVA 4B4LA 5CENA 1KWPA 4EH6A 4OTFA 4C2WA 3V5TA 4EONA 2HW7A 5CALA 3JPVA 4N6ZA 5GZAA 3WF9A 3WZDA 4APCA 3TN8A 3WZEA 3BGQA 3OHTA 3PRFA 4BDHA 2PUPA 4IMYA 5AWMA 3P5KA 3CP9A 2V5QA 5EG3A 5AR3A 3EFJA 4F1OA 3ZO2A 5JZNA 4AA5A 4FEWA 1H1RA 3I5ZA 3DAKA 3TCPA 3ZHPC 1FQ1B 5CNNA 2YEXA 4DF3A 3KXXA 2WPAA 2YZAA 4U3ZA 4PMMA 4BKJA 3ZZEA 5KKRB 3OP5A 3RCJA 3BHUA 3CQUA 5M07A 3UVRA 1MRYA 5E91A 4J7BA 4YTIA 1UKHA 4OT5A 1GIHA 3LFCA 4XBRA 5E8VA 4BB4A 3HMOA 2ZV9A 1XH6A 1UKIA 4BCOA 2YLEA 3QF9A 3ZDUA 3E64A 4RIOA 3OF0A 4S32A 2R2PA 4IEBA 5AAGA 4D4SA 1GZOA 4ZTSA 5GZ8A 2HZIA 4NKAA 2QOKA 5DPVA 1WBTA 3QZIA 4OR5A 4TZRA 5EH0A 1REJA 1PXIA 1W8CA 3Q96A 1DI9A 4FODA 4JBOA 3TKIA 3NUAA 1ZOEA 4HOKA 5A4QA 3CIKA 1NW1A 2VO7A 4BIDA 3E63A
chains in the Genus database with same CATH superfamily
2XK4A 5IPJA 3BU3A 2XEYA 3BGZA 4F7SA 3DNDA 1PHKA 2WIHA 3PA4A 3NGAA 5LMKA 5AUXA 5AX9A 4CCBA 2VTAA 2J5EA 4NW6A 1JVPP 3FLYA 4WG5A 3LIJA 1FMKA 2B52A 3N4VA 3W0OA 2XK6A 3R7GA 5D9HA 3PVUA 4EOJA 2KULA 3SC1A 3K3JA 1OB3A 4EOOA 3LW0A 2IJMA 4ZZOA 1VJYA 4EYJA 4II5A 5GJDA 2X0GA 4Y5QA 5HG8A 3S95A 4KIOA 4EH8A 4F64A 3U55A 3H4JA 3JY9A 3LLTA 4YGAA 4DGMA 4UXQA 3FSFA 3AC1A 3ITZA 3DZOA 3BL7A 1ZLTA 3TNHA 4QOXA 1OKWA 5H3QA 3NYXA 4M97A 4TPTA 3RWQA 5H9BA 4CT2A 2F7ZE 2XNPA 3MA3A 5E8XA 5I3OA 4MWHA 4UWBA 1PXPA 4GK3A 3KXGA 4XNEA 3EJ1A 3V5WA 3QTZA 2UUEA 4WBOA 3DK7A 2LAVA 3TNPC 3ZUVA 2W4JA 2PZRA 2YM8A 4TWPA 5BVKA 4GG7A 4PRJA 4CTBA 4YC8A 2VWIA 1H1WA 3E8NA 1H1PA 4DEHA 2Z02A 3AKJA 1URWA 5FDXA 3R9NA 3ZMMA 3PG3A 4BBMA 2J0MB 4QMZA 1CKJA 4FTLA 3ZBFA 4C2VA 2JKOA 4R5SA 4FZFB 4L67A 4LOPA 5AP2A 1ZMUA 5HEZA 4YO6A 3BWFA 4CFMA 5HBJA 2WQMA 4CFFA 5K9IA 3OXIA 5M06A 2VAGA 3E93A 2QOCA 5FD2A 5HTCA 1J7UA 4CG8A 4IWPA 3KK9A 3R6XA 4FR4A 4LV8A 2CNVA 3A61A 4HCUA 4DFLA 3FSKA 4XBUA 2J2IB 2Z8CA 5LVMA 3GI3A 3MVJA 4FV0A 4G5JA 1OITA 2J6MA 2GNIA 4BCFA 3UNZA 4MWIA 5CAPA 5HQ0A 3PDTA 2CKPA 2WOTA 3PE2A 3P86A 4XMOA 2V7AA 4MXZA 3NUSA 1O6KA 4IAKA 4ZS0A 3UDSA 1AD5A 5T3QA 4CCUA 4U5JA 2Y7JA 4EBVA 3KREA 4N6YA 4ORKA 3PG1A 3PLSA 5FTGA 2XYNA 3WOWA 3MN3A 1XBCA 3CD3A 3EWHA 4GYIA 4JS8A 5M51A 1J7IA 3ZTXA 4HYIA 1YQJA 5LQFA 3FMDA 5AV2A 4N57A 3G0FA 3OWKA 4YZCA 3EN6A 2OO8X 2PE2A 4LFIA 5AP0A 3R2YA 3BU6A 4FMQA 2PVMA 5HVJA 4BCQA 1A9UA 2E9PA 5DG5A 3EFWA 3QX2A 4FKJA 4GV1A 4JI9A 2FGIA 4GIIA 5KNJA 3DK3A 3HDNA 2HOGA 4ZTLA 3R9RA 2F49A 2HXQA 2WD1A 2X2LA 4G16A 3IW4A 1NY3A 3E8CA 4OTWA 4QQCA 4QYEA 4WNKA 4DT8A 4AZFA 1Q8UA 3R9DA 5EHLA 2BILB 5BMMA 2W5HA 3AC8A 3VN9A 4Z7HA 5CQUA 4CRLA 4JNWA 3GCUA 5JK3A 2DQ7X 2ITOA 4FGBA 4HZSA 4TY1A 5IQHA 2JEDA 4CKIA 3BYUA 1L8TA 3QCXA 2WMBA 4IX6A 4IZ7A 2JKKA 2VNWA 3KRRA 5CANA 2PUIA 2J51A 4DFBA 3ZM4A 2OIDA 4E7WA 1Q8ZA 4L00A 2VZ6A 5AP1A 1V0PA 2LGCA 4JDKA 3HP2A 4QMWA 3OW3A 3ROCA 3SOAA 3NZ0A 5BNJA 3RALA 4DCEA 4HYSA 3REPA 3CE3A 1UNGA 1P4OA 3GOKA 5HE2A 2V22A 4L45A 4C8BA 3O71A 4MXAA 5JFVA 3SG9A 3R22A 2GTNA 4BGGA 4RZVA 3VHEA 2JD5A 1Y8GA 2VX3A 3FMLA 3HA8A 4RFMA 5C8KA 5LVLA 5AR7A 4UMPA 5CF5A 2Q83A 1PXMA 1URCA 2QKRA 5ETIA 3T8OA 2UW9A 3D4QA 2QURA 3LQ8A 3COKA 2IWIA 5BX0A 3OC1A 2OWBA 4GT5A 4D0WA 1ERKA 4F4PA 3GU8A 3PP0A 3TNQB 2VTIA 2H34A 5CSPA 1ZXEA 4O6LA 5I3RA 3TV7A 4PP9A 3LCSA 3PFQA 3F2AA 4O0TA 3UTOA 1UWJA 2X9EA 2XH5A 4DGNA 3GQLA 4U0IA 5LARA 3KRJA 4PTEA 1YHSA 3AQVA 3IW5A 5GIPE 4F6WA 2W1FA 4L46A 2ERKA 2UZTA 3HYHA 2PMNX 3W1FA 1J7LA 5CSVA 2O8YA 4TRLA 5EKOA 1YXXA 1SYKA 1YXTA 2JC6A 3UOLA 4BCJA 1SM2A 2I1MA 2B7AA 4NM0A 5HO8A 2GPHA 4PMSA 2Y8OA 5HE0A 4QDVA 4BZOA 1R78A 4QPAA 2Y9QA 3MS9A 3GQIA 1H28A 4O83A 5K3YA 5ANEA 2BAQA 4Q5EA 4Z7GA 5CXZA 4F0FA 2C1AA 5BQ0A 2NRYA 4X0MA 3JVRA 2FB8A 2R3NA 5DIAA 2YIYA 4YJQA 3I4BA 2CJMA 3OCBA 4XLIA 4C4IA 1F3MC 2HY81 4LGHA 4ANLA 4O0UA 4AW2A 4FSZA 5ACKA 3QBNA 4YLJA 1PXLA 5A46A 5HNIX 2CGWA 5CZHA 5BVDA 3FV8A 4UN0C 3F5UA 2VTJA 4LV7A 3DXPA 2RG5A 2WMTA 3HEGA 3QQGA 4IAZA 4EHGA 5HD4A 3NRMA 3ZUTA 2UVZA 3CCNA 3GC9A 5AX3A 3JUHA 4RJ6A 1H0WA 5CSWA 5I4NA 4LOOA 2BPMA 3ZUUA 2YJSA 4PY1A 4PWNA 4C61A 5EQPA 1A48A 3BYMA 3UVQA 4BDAA 3DAEA 4CQGA 2GQRA 2I40A 3PXKA 4FIHA 4DFZE 4F9BA 5HTIA 3VBQA 3EMGA 4FICA 4ZAUA 4PF4A 4ACDA 4BWXA 4MD7E 4QP1A 2UZVA 3G15A 3R8ZA 2GQSA 3E3BX 3C9WA 4OTQA 3F5PA 5CSXA 5AV1A 4F1TA 2PPQA 3P7CA 2I0YA 3NLBA 3V3VA 2A19B 5JSMA 3RINA 3VBYA 5DH3A 3KULB 3F9NA 4CSVA 2OFVA 3PPZA 1FBNA 3GC7A 1XHAA 4IAIA 5ANOA 5TF9A 5EQYA 5IEVA 3C0HA 4DH7A 5EOBA 4R1VA 3DKCA 1PKGA 2GSFA 3KCFA 3PVWA 4WSYA 2X8EA 3AC3A 4APPA 2EVAA 4FX3A 3O17A 2XM8A 3PTGA 4ZTNA 3WF6A 1XR1A 3DT1A 3FZTA 4CMTA 5K5XA 3BHHA 5IEXA 5HIDA 3DA6A 5HCZA 4FVQA 5JGAA 1PXNA 4F9YA 4UMTA 4LOQA 4CFNA 2ZM3A 4D4VA 2C3LA 4K2RA 4KSPA 4ZIMA 3AMBA 1UA2A 3Q4CA 1HCLA 4GFOA 3PE1A 2YACA 4A06A 5CAOA 2BKKA 1H08A 3DJ7A 3MFSA 1OGYA 3BBWA 3LM0A 4FI1A 4FTCA 3W2RA 4YTFA 5L8JA 4FUXA 4YC3A 2X2KA 4I5HA 4JT3A 4FV7A 4ZMFA 5IA0A 4X2FA 3EQDA 4W8DA 4DFUA 3EYHA 4I20A 4KBCA 3W0PA 4AW1A 3W0MA 3UJGA 2P2HA 2PK9A 2J90A 2Y4PA 4JIAA 1MQ4A 1U5QA 1ZY4A 2CN5A 2OJIA 2YDJA 3H0ZA 4BDKA 5I9UA 2VUWA 2RGPA 3Q6WA 5IQDA 4K6ZA 4DEEA 5JMSA 2C68A 1T45A 4FSTA 3DXNA 3SXRA 4C0TA 3MH2A 4NU1A 3FMJA 4DTKA 2XYUA 4G34A 4LYNA 3FEGA 4IADA 4YNEA 4GU9A 4J53A 1UU3A 4QD6A 4DG3E 3COHA 4FOBA 3WARA 1YI3A 1MQBA 4JVGA 4UWCA 4P5ZA 5C4LA 2FVDA 2W4KA 2XCKA 1BL6A 3H30A 4UMQA 4V0GA 2ETRA 4DITA 1JSUA 4Z3VA 3OBGA 2ZDUA 3UQFA 2IVTA 4QMYA 5HLPA 4J1RA 4F6SA 2C5VA 4I6FA 4FIIA 2WZJA 3VBXA 1JKKA 4FV9A 4JXFA 4ACHA 3FL4A 3HP5A 1RE8A 2BKZA 4G6LA 1UNLA 5EHOA 4UXLA 2WMXA 2XZSA 1RDQE 4BWPA 3ERKA 4M3QA 3TI1A 5CF8A 3C5IA 3V5QA 2VWYA 2FSOX 2G2IA 3ORPA 5D7VA 4F7LA 4O96A 1SNXA 3O8PA 4O7LA 3TM0A 3OTUA 5FTOA 4AN2A 2PZ5A 4AN3A 2C6IA 3Q9WA 1GAGA 2X8DA 5AUYA 3NR9A 4QMVA 4E20A 2KTYA 1KV1A 4UWYA 3BEAA 4FKPA 2REIA 4Y73A 4BICA 2PVYA 3R1QA 4WNMA 1PXJA 3RNIA 4LL5A 3SGCA 3RZFA 2C69A 2G9XA 2C6LA 2QD9A 2UVXA 2XM9A 4NUSA 2Z7LA 2ETKA 2XBAA 4YPDA 2IZRA 4JDJA 3V8TA 2ITYA 1OBGA 4EEVA 2BAJA 1WZYA 4DLIA 1ZARA 3IW7A 3KULA 4NZWB 3TG1A 5E8YA 1XKKA 3L8XA 4M0YA 1W2FA 2QODA 3HMPA 4FG8A 4FTJA 1OPKA 3HZTA 4H1JA 4I92A 5AUTA 4CFUA 1ZRZA 5JT2A 2X7GA 4Y8DA 5L2IA 2C6KA 2JDOA 3CTJA 2HAKA 1WBPA 3WF7A 4D9UA 4U40A 1YRPA 4IVBA 1H07A 4MXCA 4FNZA 2RG6A 2VTTA 3F61A 2B55A 3RK7A 4JAJA 4A9SA 1LEZA 2HW6A 1V0BA 2W96B 5JGBA 3KKVA 1OUKA 3ZOSA 4I94A 3FMNA 1Y57A 4YMJA 1KE9A 3QX4A 2R4BA 4IANA 4KS8A 3W8LA 5BV3A 3HA6A 3FI8A 4RIYB 4BY9E 1W84A 3E8DA 4O7WA 4NIFB 3P08A 1YDSE 3TTIA 4D2PA 4U7ZA 4MXXA 1WVYA 5KMKA 2ZV8A 4GK2A 3ETAA 1TZDA 3PWYA 2QLUA 2PZPA 2QCSA 4AT5A 2XK9A 2V62A 3BE9A 4EC9A 3GB2A 1I44A 5AADA 2XIXA 5IF1A 3QTXA 5L2QA 3U6IA 3CGOA 2XALA 5A9UA 1BL7A 2PHKA 2VWZA 3MVMA 5IQBA 5KCVA 5F95A 2P55A 4G31A 3UMXA 2I6LA 4HNIA 4W9XA 3QCQA 4FKIA 5DMZA 2BRBA 3BLAA 1PF8A 3ZLSA 2XNEA 3F3ZA 4LRMA 3LVPA 4YJSA 4EC8A 3GCPA 4YHFA 5AP6A 4BDFA 3W2OA 5LXMA 2JFLA 4FSUA 1V1KA 2Y6MA 3HRBA 3LFNA 2I0EA 3DBFA 3L9PA 4DINA 1PY5A 4PQNA 2Y0AA 3OVVA 4I0TA 5EI2A 4PNKA 3TYKA 3MI9A 4B6LA 2X0OA 3VBWA 4EQCA 3DPKA 3CJGA 2B9IA 3AT2A 3EN4A 2ZB0A 5JZJA 2XKFA 3E7OA 3DOGA 3KF4A 3KK8A 4JG7A 4LRKA 4O27B 3W2SA 3LQ3A 3IW6A 5HORA 4ZJJA 2XKEA 3QYWA 4FC0A 4LV5A 4ANBA 2V0DA 5IQAA 2UW7A 2SRCA 3OFMA 3SLSA 3QLGA 4TYGA 4A9YA 2C5YA 5D11A 2YIRA 4AX8A 4DCAA 3T3VA 2ZM1A 4E93A 2WTWA 5DRDA 4FKOA 4K1BA 2OKRA 5FXRA 3K54A 2IVSA 4C4EA 4RG0A 3KFAA 5ACBC 1L3RE 3QTRA 2VWUA 4BTJA 2WMUA 5FP5A 4AT3A 4MUQA 5AP5A 1I09A 2EWAA 2ZOQA 3F88A 4R3RA 3VF9A 4ANOA 3PUPA 3KF7A 2OH4A 4FTTA 3FAAA 4A9RA 4L42A 3HX4A 3CQEA 4WG3A 3TNIA 3RK5A 3W10A 4EK5A 1NT2A 3PSBA 3QQKA 5CTPA 4AAYA 4MCVA 2R3PA 5KBRA 2X81A 2YAAA 1G3NA 4TWNA 4RLLA 2YJRA 2I0HA 4GU6A 4XG6A 4Y85A 5FP6A 3IDBA 3P4KA 4RX7A 3KC3A 3BLQA 3EN7A 3V8WA 3IO7A 2WQEA 4W4VA 2XJ2A 1YDRE 5EDRA 4H36A 4BGHA 2CKQA 4YJNA 2FSMX 2HY0A 3TJCA 5ETAA 4PPAA 3O23A 3ODYX 4RVLA 4HZRA 3NX8A 3ID6C 4C57A 5AV3A 4GS6A 3C0GA 1M52A 3R7IA 3TDVA 3M11A 5L2SA 4ZS4A 4F6UA 3OUNB 2WU7A 3WILA 3FBVA 4N70A 4D55A 2XF0A 3I60A 4TN6A 3QC9A 3L8VA 4IFCA 5AM6A 5AUWA 4AUAA 4NJDA 2VD5A 3Q5ZA 1OUYA 1OL7A 3QZHA 3TUCA 5DR6A 4C3RA 3A2CA 4RC3A 3G5DA 3ORZA 4RIYA 2XBJA 4RPVA 5HICA 3PA5A 1BX6A 2ZM4A 2WEIA 4D2RA 2GNHA 4O0VA 3VUDA 5CI7A 4C59A 1RW8A 2YA9A 3QD2B 3ZU7A 3A7FA 2C5OA 1PKDA 3QTUA 4RFYA 4U9AA 4AXFA 5HOAA 3LXKA 2RF9A 3R83A 3EIDA 5IH6A 5JRQA 5CI6A 1PXKA 3GXLA 4FKTA 3OUKA 4X3FC 2J0JA 4XRLA 4B9DA 1JPAA 3FYJX 2W1DA 4PX6A 4D1ZA 3S0OA 1OL5A 3BLRA 2B9HA 2DS1A 3FKOA 3POZA 2YLFA 3KU2A 2BDFA 4BCKA 2FH9A 4BHZA 1YKRA 3CTQA 4I3ZA 3QKKA 4KUJA 3VC4A 1H27A 4JBQA 2P33A 2O3PA 1WBOA 4FTOA 2RFNA 4Z9LA 3ENHA 2P0CA 2XMYA 2XRUA 2OI4X 4GT3A 3I7BA 4WT6A 4FTAA 4BVUA 2F7EE 3OMVA 5AUVA 3O5AA 2YFXA 2BIKB 5ANKA 4A9TA 1YWVA 4PNIA 3SQQA 4CT1A 3RHXA 1JWHA 2PSQA 1BKXA 3LFEA 3H0YA 3PY3A 4MVFA 3GUBA 4YJTA 3OWPA 4UMRA 4YUQA 3TV6A 5HTBA 3BE2A 3UPZA 4FEXA 3ORTA 4GFMA 3DAJA 2BTSA 4E6CA 4Y95A 5CSHA 3FLSA 5I9ZA 3GOPA 3RVGA 3ALOA 1J1CA 2CNUA 2UW4A 3MPTA 3RZBA 4D5HA 4OTPA 5CLPA 1FPUA 3O0GA 3KMUA 3UZRA 5AIKA 4FSNA 4QP3A 3ZFMA 4QYFA 4W4WA 2CLQA 3ANRA 3KRXA 2A2AA 3AXWA 4YO4A 3DTWA 3HDMA 4A7CA 4PTCA 3H10A 4QNYA 5LWMA 4FJVA 4QP6A 5FQDC 5GZ9A 4ENXA 2OBJA 5AAEA 2WTIA 4YJRA 3AC2A 3PJ1A 4MKCA 2NYAA 2QOBA 4RQVA 4QP4A 5DGZA 5L2TA 1ZZ2A 3UOKA 2W4OA 5IA2A 2QG7A 4WUNA 5B2KA 5HBEA 4DLJA 3KGAA 1JSTA 3BYVA 3N9XA 3ULZA 2F4JA 5BMSA 4XLVA 3DK6A 3ENMA 3FUPA 5LWNA 3FE3A 3NUYA 3K3IA 4IC8A 3WYYA 3SVVA 3E8EA 3MH1A 1R1WA 1TQPA 1Z5MA 1LPUA 3QCYA 1XQZA 4XJ0A 1JBPE 3L1SA 4EOLA 2WOUA 1P5EA 1QPCA 3FMKA 4JIKA 2CNQA 4DTAA 4QP9A 5G1XA 2ZYBA 1JAMA 3DY7A 3CY2A 3Q4TA 4MBLA 4X3FA 3W55A 5K4IA 1PJKA 3OT8A 5IQEA 3O7LB 1IAJA 5IQFA 1YOJA 5FLFA 3PIXA 1IG1A 4XUFA 5M4IA 4FKLA 4NYEA 3V04A 2C30A 2C5XA 1XH7A 2PMLX 2YISA 4MF1A 5IKWA 2F9GA 5J1WA 1VYZA 4QDEA 4XH6A 5C01A 4YPSA 4ACMA 5HG5A 5IMEA 4XCUA 3DS6A 3Q6UA 5CVGA 4FF8A 3SW7A 4L3LA 4FSQA 4U80A 5HKMA 5HX6A 1JQHA 4WRGA 4OAUC 5HE1A 2ITZA 2O63A 4TNDA 5AR8A 3O7LD 2XNGA 1QCFA 4ZLYA 4W4XA 3DXQA 4X6RA 3THBA 4EZ7A 3JVSA 5AR5A 3ZFXA 5L8LA 2YWPA 3VONA 4FEUA 4KD1A 4QO9A 1KE5A 1VLRA 4QMPA 4TXCA 2OJFE 4V01A 3RJCA 3CXWA 4AE9A 2O64A 2UZEA 1OGUA 4K8AA 1XWSA 4XG2A 4F08A 3SA0A 3TTJA 5A14A 1Y8YA 4MEDA 5KKRC 3RPYA 1QPEA 2YITA 2XJ0A 3E88A 4XHKB 3MA6A 3OOGA 5E1EA 2VTLA 2CLXA 2X0QA 1M7QA 1OIUA 4BIBA 5M4UA 4FT0A 2RFSA 3HL7A 5E8TA 3MTLA 2R3OA 4AFEA 4A4OA 4AGWA 3OT3A 5E92A 4EYMA 3F3WA 3HUCA 5L4QA 2OIQA 4B0GA 2Z7SA 5C26A 3FWQA 4MAOA 1R39A 3KRLA 4FT7A 4FV1A 5FM3A 5AEPA 2H8HA 5I5ZA 4EOSA 1G5SA 3CD8A 3DNEA 4OTHA 4QMTA 4RJ4A 3TNWA 1OECA 4FL1A 3IECA 4F1MA 2UZDA 2IZUA 3WIGA 5J1VA 4LGDA 4HCTA 1XJDA 4FRFA 3UO4A 3PSCA 5CVFA 2JFMA 3BX5A 3EFKA 2I7QA 3FC2A 3EFLA 4X3JA 3MV5A 1IA9A 2C47A 3G9LX 3BL9A 1W2CA 3CKXA 1Z57A 2OZOA 5ANJA 3NIEA 2OXYA 5FUTA 4O22A 2X1NA 2P2IA 4ALWA 3QYZA 5BUJA 5CEMA 5K5NA 2QOOA 3KMWA 1OPJA 4M69B 4TYHB 5D12A 2Y4IB 4CQEA 3P78A 1U54B 3GU6A 4ANQA 4XEYA 2HYYA 4EQMA 3LMHA 4GIHA 4RBLA 4ASEA 2W1ZA 4I5PA 2YIWA 3EQPA 3MWUA 4RC2A 4EH2A 5CEOA 3LXNA 3D7ZA 5EOLA 3TL8A 4YNOA 3MH0A 3QC4A 3ORXA 2R3RA 2DUVA 4L8MA 4Y83A 4IJ9A 3EQBA 5DYJA 4O4DA 2J9MA 4FTKA 3UC3A 4PV0A 5DI1A 3PRIA 3IS5A 2QONA 5DE2A 1IASA 2WMVA 3KN5A 3QTWA 2HCKA 2R3IA 2X0PA 3KRWA 4FTRA 3UOHA 4BCNA 3FL5A 3I81A 4MD8E 4C62A 4F99A 3GP0A 5HNGA 1WBSA 3UOJA 1U46A 2BZJA 3MIAA 3NW5A 3PXQA 3R00A 4PDYA 2XAMA 3PLAE 4RA4A 4YSJA 2Y4IC 3VUHA 4HCVA 2OIBA 4IW0A 4AZTA 3KVWA 1P14A 2PE0A 4P7EA 3TWJA 4QMOA 1W82A 5HLNA 4WIHA 1YXSA 1Q5KA 3DGKA 2BAKA 2WTJA 5HCXA 4FZDB 4H39A 3QAME 5EDQA 1H1QA 2WTCA 1P4FA 4QTEA 3UO6A 4AXDA 5FXSA 4FKSA 4EK3A 4UBAA 4FTQA 4ERKA 2OJ9A 2BFYA 3PXRA 4ONAA 4YURA 5KO1A 2R3HA 3I0OA 4FIFA 5A6NA 2CMWA 5F20A 3TACA 4F9AA 4Y46A 3ZCLA 2HWPA 3QGWA 4EK8A 2PU8A 3KCKA 2ZV2A 2FSLX 4QTDA 4IZYA 4PPBA 5DEYA 3FI3A 5FWKK 4WD5A 2YAKA 4DH8A 3FMMA 1W83A 3ZYAA 5HIEA 4GKIA 2JKMA 2VO3A 3FKNA 4DN5A 5HHWA 1FINA 4NM7A 1W98A 3MH3A 2YCFA 2BFXA 4BBFA 4Z55A 2JLDA 4NKSA 1Q99A 4J98A 1FGKA 2RFDA 2G01A 3ZEPA 3U6HA 2H9VA 2JAVA 3L8PA 3NAXA 4L43A 1Q8YA 3HRCA 2ITWA 4O4BB 4BWKA 4FUYA 3MYGA 3RK9A 4W8EA 3C4WA 3MPAA 1OIQA 4P4CA 1M2QA 3N4UA 1K9AA 4QYYA 5DOSA 1B39A 4X2KA 2HZ4A 5AIRA 4EL9A 4XS2A 1Q62A 3R01A 3VUKA 3D9VA 2ITXA 4CLIA 4B8MA 3L9MA 3U9CA 3MDYA 3UO5A 3RKBA 2X4ZA 1MRUA 2ZDTA 3RPRA 3R7UA 2Z7QA 4B99A 4F7JA 1OBDA 1YW2A 3C4CA 4FSRA 3D5WA 3HKOA 5DLSA 1QL6A 3KXZA 4M69A 3KQ7A 3F7WA 4O6EA 4BYJA 1OL6A 1U54A 5KX8A 3WBLA 2UZUE 2JITA 3R63A 4Q9SA 4RX9A 4TKSA 4FV8A 3UNKA 1F5QA 1IAHA 3ML1A 3QGYA 2VN9A 4HJOA 3ACJA 4OT6A 5G6VA 3UIBA 4QQTA 3II5A 2XNBA 3R28A 2UZBA 3R9OA 4L53A 1T46A 4E5BA 3QA0A 2QO7A 2H6DA 3BGPA 4UYNA 5E8UA 3GBZA 2C6OA 1OKZA 2B1PA 3CC6A 2OFUA 3QFVA 5EHYA 3JY0A 2WMRA 4D4RA 3IW8A 3HMIA 2BIYA 5BVFA 3Q53A 3NVKI 4QYGA 5TT7A 4NTSA 3DB6A 3FMEA 4L7FA 4ZZMA 5EW3A 3VQHA 2R3JA 2F2CB 4G6OA 4YC6A 1KUTA 4O82A 2NO3A 3FQEA 4ZTHA 4E73A 3NYVA 4GJ2A 3QTSA 4KKGA 4DHZA 1YOLA 5ANGA 2JDTA 4BI2A 3CBLA 5AAFA 3G9NA 4ACGA 1ZOGA 1M7NA 3A8XA 3PA3A 5IH5A 5AA8A 2VWXA 4GUBA 5BYZA 3H3CA 2GCDA 4O0SA 4IHPA 1ZWSA 3FZSA 4YBKA 2WMWA 2OLCA 2GHMA 4KKEA 3F2NA 4ZY5A 1XO2B 2B0QA 2IN6A 4U8ZA 2C1BA 2R9SA 2Z60A 3EQCA 3PZEA 4MD9E 5GINE 5FXQA 5JFWA 3VF8A 3ZC5A 3AC4A 3GC8A 3HVCA 4RWLA 2YM7A 3QUPA 5IMXA 2JIVA 3HV6A 5A4CA 4AQKA 2YIXA 5M09A 1ZMWA 4GSBA 2GQGA 3VS2A 4IVCA 3ORLA 4PDOA 1A06A 5D7AA 2R3QA 3TZMA 4CZUA 4GMYA 4PP7A 4YR8A 3D15A 5HO6A 4BRXA 4EUUA 3Q4ZA 3GVUA 3P7AA 3PY1A 4K77A 3V01A 4YTCA 3UG2A 4BZNA 4KBKA 2UZNA 4F0IA 1TQIA 3C7QA 4D5KA 5F9EA 3UDZA 4QTCA 1YWNA 2GHLA 4ERWA 4AW5A 4EK6A 3LM5A 5CT7A 5GNKA 2QU6A 3FQSA 4JQ8A 5DR9A 4BBEA 4KIKB 3Q5IA 1U59A 2WXVA 4TWOA 2BRHA 5M44A 3NNUA 4FYNA 4Q2AA 4AQCA 4F09A 3MESA 4RWJA 4UY9A 3LJ1A 3PIYA 4R78A 3I7CA 3MPMA 1ZYJA 4XG9A 4AS0A 4EKKA 4E3CA 3VW8A 4O7RA 4DDGA 4ENYA 4OBPA 2GNGA 3G6GA 3LZBA 5IU2A 2VTMA 5CF4A 3AT4A 4X2JA 4RJ8A 3MGYA 2ONLC 4JMQA 3OY1A 2JDVA 3FZRA 4FL2A 2IPXA 3R7EA 3QQUA 4NEUA 4EBWA 4NJ3A 1Y91A 4M12A 3DBEA 3QKLA 4AN9A 3KA0A 3Q60A 4I6LA 4JJRA 3LPBA 3CEKA 4RVTA 5KZ0A 2AQXA 4CVAA 1UNHA 3MY5A 4LUEA 3UMWA 2R3LA 4DEDA 3S00A 4PTGA 1YI4A 2XNMA 1W7HA 2E9UA 4YZDA 5DA3A 5T68A 4TWCA 3S3IA 4CGAA 4U6RA 4NM3A 2WIPA 4E6AA 3GFEA 3AKLA 2B4SB 1ZMVA 4FZ7A 5CASA 3CS9A 4QNAA 4JL9A 2QOQA 4QPMA 3U9NA 3QWJA 4UYAA 5IUGA 3GCVA 4WOVA 3SX9A 4K0YA 1LEWA 3N51A 3QQJA 2WEVA 4DFXE 3RBWA 4D1XA 2J0LA 3P7BA 5CAQA 3QZFA 5CT0A 3W8QA 2XK7A 3PSDA 4N0SA 3VUGA 4MQ2A 4U79A 5KZIA 3BPRA 3EQRA 3LFQA 4P2KA 3U8WA 2QOLA 3GEQA 2AEGA 3D94A 1DI8A 4I0RA 5E8ZA 2R5TA 1CKIA 3BV3A 3KEXA 3ZRLA 5IUHA 4BR3A 2YCQA 4OBQA 4QMUA 3ZLYA 4MBIA 4Z16A 3SAYA 3QRTA 4IZ5A 3PPKA 4M0ZA 4BL1A 4YZBA 4JBVA 4K11A 3R2BA 3TV4A 3VULA 4G6NA 4MH7A 4BHNA 3PPJA 3PY0A 3UNJA 3A8WA 1HOWA 4IB0A 3ZEWA 2X7OA 5HU3A 3PZHA 3VBTA 4M13A 4AOIA 2ITQA 4C36A 2QU5A 4DHIB 3G90X 2BUJA 4GH2A 4H05A