3NDMA

Crystal structure of rho-associated protein kinase (rock1) with a potent isoquinolone derivative
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
398
structure length
383
Chain Sequence
b'MSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEEETFPIPKAFVGNQLPFVGFTYYSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho-Associated Protein Kinase (ROCK1)
publication title Substituted 2H-isoquinolin-1-ones as potent Rho-kinase inhibitors: part 3, aryl substituted pyrrolidines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 108
structure length 383
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ndmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ndmA01
5EK7A 2ONLC 2WU7A 4X2GA 2PYWA 2ZB0A 3POOA 2VN9A 4D2TA 1YXUA 3ORMA 3RZFA 4PL3A 3BGZA 1AD5A 3OBGA 3ZXZA 4O0SA 4GMYA 4IW0A 1REJA 4QMOA 4B99A 3AD5A 3TZ9A 4FTIA 2VAGA 3G2FA 3KXZA 3QCQA 3PLSA 2CCIA 5DGZA 2WMSA 1CKJA 2QLQA 4XS2A 3O50A 3UE4A 2OF4A 3DFAA 1P2AA 3GOKA 2QOHA 3LXLA 4N57A 2WAJA 3COMA 4X6QC 4CKJA 3SDJA 3KULB 2B54A 2R3FA 3L9LA 3WE8A 3ZBXA 2PK9A 4O7WA 3JY9A 3F9NA 2R3LA 3DNDA 4PV0A 5J79A 5FEQA 4ZZMA 4LG4A 5DLSA 5LMKC 2Y0AA 2CHLA 4NT4A 2PUIA 4C3FA 4ORKA 4EONA 4XG3A 3BLHA 3HP2A 3KXNA 1M2RA 2KULA 3LW0A 2EWAA 4FT3A 5EM5A 3Q04A 4WKQA 2WZJA 4Y95A 1YXTA 1LP4A 3PTGA 2IO6A 3AOXA 4DFNA 3TNIA 4RMZA 3QLGA 5C26A 5HVJA 5CNNA 3R7IA 3LJ1A 4BICA 2X7FA 1OPJA 2VTRA 3ZO1A 3N4VA 4E93A 5CALA 1J7IA 3MVMA 3VIDA 1FVTA 4O22A 3QX4A 4I6HA 3HX4A 5D7AA 3FI8A 2YZLA 2FVDA 4YJQA 1Q3DA 4NKAA 4MNEB 4LL5A 4RWKA 5JFSA 2VO6A 4NFMA 2V62A 3PPJA 5FGKA 4EOQA 5IQBA 3BLRA 5AR8A 4O7RA 2HYYA 3C4FA 2ITUA 3B2WA 2XNNA 3CTHA 3QQUA 3EQFA 3N4UA 3PJ2A 5KUPA 3D94A 4YJNA 3A7GA 4QNYA 5B2MA 1V0OA 4LOQA 4FKGA 2QOIA 3IONA 5ETAA 2HCKA 3QRIA 4BIDA 3HV7A 4G3FA 4MD9E 3UMWA 3O2MA 2J0KA 4OGRA 5IQCA 3TIYA 4PMSA 2YM8A 3TI1A 1Y6AA 2CNUA 2JDTA 2Z7QA 1T45A 4XV2A 3OEFX 4ZS4A 3QGYA 1UV5A 3D5VA 3ROYA 3PLAE 1YHVA 4FIHA 4EC9A 2R3QA 1U5RA 2UZLA 2PY3A 4DCEA 4D5KA 1E1VA 1GJOA 3CGFA 4QMYA 4I41A 3TL8A 4YZCA 3SQQA 3GCPA 4R7HA 3ZM4A 3D2KA 5TOZA 1FBNA 5J9ZA 4MBLA 1UKHA 3I7BA 4YMJA 1IAHA 4KAOA 5EM8A 2XEYA 4AZTA 2V5QA 3L8VA 3D5WA 3NYOA 5FDPA 3UQCA 5AFVA 4DF3A 2JBPA 4A07A 4D4VA 3HA6A 3PVWA 4UMRA 2F7EE 2J50A 4ZOGA 1ZMWA 3II5A 2QG5A 4MXXA 2ACXA 2P2IA 1WFCA 1KSWA 2Y4IC 3MFTA 3Q9WA 1T46A 1PXMA 4S30A 5IEVA 3K2LA 5F9EA 2B9HA 3QQLA 1OM1A 3PSBA 4ZP5A 3W2CA 3QD3A 2I0EA 5HE0A 3OCSA 1XBCA 3DKGA 3DS6A 3O51A 3Q96A 3O0GA 4K33A 4F99A 3IW5A 1ZMVA 3MYGA 3LXKA 4KA3A 4D0XA 2WHBA 3T9TA 4G3CA 4FTJA 2OK1A 4GRBA 3W8LA 3P7AA 1BYGA 2VWVA 3DU8A 4FUXA 4Z55A 4PDOA 5ICPA 5IZFA 4WOVA 2YM3A 4KBAA 4HPTE 4K11A 5A4QA 5EYDA 4OTPA 1OPLA 3W55A 4BY9E 3UODA 2ZDUA 3E7VA 4IJ9A 4G31A 1PYXA 3W2OA 3NCGA 2E9VA 3FZSA 2PZPA 3G9LX 3GU7A 5AIRA 5K5XA 1GZNA 5AR3A 3OC1A 2X81A 3SXSA 4A4OA 3NNVA 3O23A 4E6CA 4RWLA 4QP8A 1PXKA 4FG9A 4F6SA 2OF2A 3L1SA 1Q99A 4UMQA 4XCUA 3S00A 2V22A 1H07A 2W05A 3OOMA 4AXAA 1UVRA 3R7OA 3W32A 4DEHA 4FEVA 3FWQA 4RX9A 2VNYA 3UIMA 3IPHA 3RBWA 4BTJA 3DJ5A 3QUDA 2KTYA 3Q4ZA 3C50A 3R71A 4X21A 1UNHA 3ANQA 4QMXA 3V04A 2OIDA 2XB7A 4GKHA 5DRBA 2VTHA 3M2WA 4LM5A 4QMWA 5FTOA 5M4FA 4P4CA 3RJCA 2WMAA 2XIYA 3I0OA 3Q4UA 4TT7A 3SC1A 3BHUA 4W4YA 5HKMA 2PPQA 3KMMA 2DWBA 5CNOA 2PVMA 4U44A 1CKIA 2WIPA 3M42A 2P3GX 3D5XA 1RE8A 1JSVA 3PZHA 4I92A 2CDZA 4ACGA 4AA5A 2BRNA 1V0BA 1UU7A 1NY3A 3LCOA 4QMVA 4U97A 4DEDA 4WRGA 2GPHA 2WQBA 4L3PA 4RJ4A 2OWBA 2NO3A 2VGOA 3EWHA 3P08A 3PWDA 3R6XA 5DEWA 4ANOA 3VRYA 4L9IA 5DPVA 3HP5A 2VTPA 3KRRA 4AW1A 5HHWA 3ANRA 4O91A 3TG1A 3D7ZA 3PP0A 4DFZE 3MVHA 3ZFYA 5IA0A 3MWUA 4D2SA 2ZMDA 5F1ZA 4EL9A 4MTAA 4W8EA 3SG8A 3Q4CA 1TVOA 3FZPA 1DM2A 1REKA 4BTKA 2IN6A 2C6LA 4BBEA 1MUOA 4EHZA 4N70A 4XOYA 1BI8A 4JG8A 5FXSA 4WUAA 2JEDA 2RG5A 2OXXA 4FIFA 2I0YA 1ZY5A 4YJVA 2RKUA 3SHEA 3DAEA 3R22A 4FV4A 3F66A 3QQKA 1M2QA 2A19B 3NUXA 5DE2A 2WTJA 2XJ2A 4F1OA 5HLWA 3R9DA 4U5JA 4DTAA 3MB6A 3SG9A 4KKHA 4AE9A 5HBHA 3ZU7A 3ZXTA 4FTKA 2X7GA 4OW8A 3WARA 1YOLA 3C51A 2YAAA 3JVRA 3HAMA 3PP1A 4GUEA 3PXFA 4RX7A 5F94A 1GIJA 4M69B 3UMXA 4P5QA 4PMMA 4FSQA 4C4HA 2BVAA 4USEA 4EI4A 3DNEA 2HY0A 5JRSA 3G33A 1OIUA 2WQEA 1PMEA 4FV0A 3WI6A 3BX5A 3WZDA 4C3PA 4Y46A 4YR8A 4BCOA 5CEKA 3DQXA 3C1XA 1FVVA 4NTTA 4YZDA 3ZZEA 5A6OA 3FMJA 3JS2A 5ANJA 4EWHA 2GTMA 3FEGA 3A7JA 4R6VA 4I94A 4U0IA 2Y4PA 3ACKA 3QGWA 5HU9A 2XK3A 3FHIA 5A14A 4GK4A 1YI4A 3BWFA 1LUFA 5DT3A 2OZAB 5T68A 5AAGA 4XRJA 5CU0A 4CT2A 2CNQA 4RX8A 4F7JA 2VZ6A 4ANNA 4OBQA 2R2PA 4EHGA 5KZ0A 3LCDA 4FK3A 4ZMEA 1NXKA 3DK7A 4IAFA 4FEQA 3ACJA 3ETAA 5A3XA 3FKLA 5LOHA 2YA9A 5BVDA 4IZ7A 2ETRA 3NIEA 4QMZA 2OH0E 2PMOX 1Q8TA 2EVAA 2R3RA 3AMBA 4O7VA 3HYHA 3QX2A 4MNEA 2R9SA 5JQ5A 4ZS0A 2ZV8A 3Q32A 4LGHA 2XNOA 1MP8A 3E88A 3RVGA 4O83A 2RFSA 4I6FA 2X4ZA 4AOIA 1OUYA 4LQMA 2BZJA 3I0QA 3R9HA 2H96A 2YM4A 5HCYA 5CEPA 3ZRLA 2GQSA 1ZRZA 1IA8A 4CD0A 4QOXA 4HZRA 4QYFA 3RPYA 2UVXA 3C0GA 2W96B 4YP8A 3RHKA 1YDRE 2YIXA 3LJ2A 5AV3A 2ITZA 4QRCA 5JFWA 4TW9A 4IWDA 3I1AA 2UW6A 2GNHA 1F3MC 2FA2A 5HG5A 4BFMA 1NVQA 4BI2A 1H27A 2B52A 3BQCA 4NTSA 4O7TA 2VO0A 4O0XA 4J97A 4F7LA 1YXVA 5CF6A 4YLJA 4ZJIA 2W4KA 5LCKA 2X8DA 5AP5A 3V5TA 4BGQA 3QQGA 4JDHA 3W2PA 3UZPA 3D4QA 3FMEA 4I93A 3DKOA 3NAXA 1SVHA 1FVRA 4QPMA 3R7EA 5HLNA 3ZMMA 1H1SA 2OGVA 2CLXA 4QT1A 2ITNA 3V5PA 4YBJA 3SA0A 2EUFB 3QXOA 3BQRA 1YI6A 2QR8A 2WIHA 3HVCA 2HZNA 3TACA 3MPTA 4F9BA 4IQ6A 1PXJA 3E93A 3GXLA 4ANBA 4XX9A 4AE6A 1LEWA 2XNGA 4O7SA 1KE9A 4XP2A 4MQ1A 3KU2A 3MW1A 2BUJA 2JITA 3CJFA 3V5QA 4RZVA 5AADA 3KXXA 3MN3A 4FTMA 4ZSGA 3HUCA 5TT7A 4XYFA 3DXQA 3C0IA 3QUEA 5C01A 4M8TA 4RA4A 4U43A 1J3HA 3ZO4A 4C61A 3GU5A 5FTQA 2YITA 4PPBA 4KIKB 2B4SB 3C4CA 3WIGA 2GFSA 1UKIA 4D9TA 3EQBA 4FOCA 4V04A 2PSQA 4XG4A 4H36A 3B2TA 4O6LA 4CFUA 5BUIA 3FL5A 3UO5A 2XIKA 3WZUA 3UZRA 1ZOEA 5I9XA 3TWJA 3W2RA 3RWQA 2X6DA 2JGZA 5IA4A 2F2UA 5HNGA 2VD5A 3QTIA 3SX9A 3ZO2A 5J5SA 2Z02A 5EYCA 1CTPE 5GIPE 4JQ7A 3PXZA 1WAKA 3NMUF 3IQ7A 1V0PA 4U3ZA 3E8EA 3G6HA 2O65A 4MH7A 2YIRA 1O6KA 4YO6A 2G1TA 4HCVA 5EOLA 4RJ5A 1Q61A 2ITVA 3CIKA 1A9UA 4IVDA 4L53A 3PRFA 4XV9A 4Y85A 2BROA 5AV2A 5FG8A 4CXAA 3QRJA 4O1OA 4QP7A 5CSXA 3R83A 4CFMA 3TNQB 3DPKA 4AN2A 4QQCA 2W1ZA 2W17A 2E2BA 2WTWA 5EDPA 5L3AA 3IW6A 3V51A 4ASDA 3F7ZA 4HYUA 4DGOA 5J1VA 4MXCA 4I0RA 1MRYA 4EOOA 1K3AA 5FXRA 2QOLA 5FM3A 5CEMA 5DN3A 3FLZA 2GQGA 3CPCA 4X3FA 2R3HA 3PSCA 4X2FA 4FNZA 2F4JA 2I0VA 4JJRA 2BDJA 3DTWA 2OIBA 1KUTA 4D1ZA 3GB2A 5J7BA 1YWVA 3FXZA 2QKRA 2EXMA 3DB8A 3Q5ZA 4FTUA 4JLCA 4O6EA 3VBYA 2GU8A 5TO8A 3VS6A 4BKZA 1PXIA 1KV1A 2JDSA 3U54A 2PWLA 3PA5A 4J99A 4IBMA 4V0GB 3AD4A 4ITHA 1KE5A 4YNOA 4O1PA 5D1JA 2ZMCA 5AV1A 4RIWB 3LMHA 4ENYA 1TQIA 5CU4A 1OZ1A 3A99A 3FKNA 2A1AB 4I5HA 2XA4A 1WBWA 4HVGA 3TDVA 4HCUA 5FEDA 2P55A 3Q6UA 3CC6A 4FICA 3UP7A 4LGDA 1G8SA 4GT5A 2OFUA 4YHFA 4RFYA 2R5TA 4D0WA 4UYAA 3EQRA 3IG7A 2F49A 3VJOA 4IM0A 3O8TA 2WTCA 2YEXA 3BV3A 4W4VA 5EM7A 1H01A 5KMIA 1UNGA 1SVEA 3TZ8A 5KMJA 1IR3A 3AD6A 2HZIA 2R3NA 3KMUA 1M7NA 4UZDA 2WTKB 3FLNC 3G6GA 4XBRA 5E8UA 3VUHA 4ZLZA 4GVJA 4FL1A 4NCTA 3ELJA 3K5UA 4G16A 1UWHA 4UMPA 1XHAA 2JFLA 2REIA 4ALVA 4WG4A 4ZSLA 3GU8A 4YJTA 3VBWA 3C9WA 4I24A 3AGLA 3MSSA 4S32A 5HD7A 3PIZA 3GCQA 4J1RA 5LARA 3WBLA 3TUCA 4XG9A 5BYZA 5FBOA 2VTTA 2EB2A 3FZ1A 3WF9A 5GIOE 5JK3A 5KMMA 4M69A 2OFVA 4ZTSA 3KMWA 2C0IA 4QYHA 1JQHA 3PJ8A 2XCKA 4DGLC 1XH6A 4PNIA 4GFGA 4OT5A 4XUFA 4Y5QA 4UWBA 3ZLWA 3TNPC 3TCPA 5KBQA 4Y83A 3W18A 1MRUA 3V8SA 3DQWA 4MXZA 3U55A 2RFDA 1L8TA 4G9RA 4MWHA 5EI6A 2WXVA 3NSZA 3BU6A 4FL3A 3THBA 2CGUA 3G0EA 2XVDA 1Q8WA 3PIYA 4Q2AA 2XBAA 5AUYA 1JOWB 2UZBA 3RALA 4C37A 5IQDA 2PZRA 4MAOA 2CKQA 3G0FA 1SNXA 5AEPA 2PE0A 3COHA 4FF8A 3LOKA 3DBDA 4KIPA 2Z60A 5ANGA 3F2NA 3QC9A 2G2FA 4L43A 1SYKA 5EQEA 2CJMA 3ZSIA 1WBVA 2YM6A 2UZEA 3QTRA 2P2HA 5CSVA 3VF8A 4IE9A 4BDKA 3RM7A 2GNLA 2WTVA 3NS9A 4IX3A 3VS5A 4NM0A 5FEEA 4PNKA 2W1CA 3GCVA 5M4CA 3Q9XA 2BAJA 1WBOA 2YJSA 3HV6A 1U46A 3C13A 5DR6A 3VBXA 5DOSA 2C5XA 4LFIA 2J2IB 3CEKA 4OBOA 2JIUA 4YZMA 4FA2A 5IU2A 5M56A 2CN5A 3OWKA 4IMYA 4JDIA 2HENA 3EFKA 4M97A 1WVXA 3CXWA 4RA5A 1IASA 2IVTA 3DAJA 3N51A 3PY3A 3QWKA 2PZYA 4MD8E 5HG8A 4HPUE 1JAMA 4NWMA 4BDFA 1O9UA 3R8VA 3A8WA 3C5UA 4E5AX 1IG1A 2ZDTA 2X2KA 1MQBA 4EOMA 3SW7A 5LVMA 3IO7A 4BYIA 4F64A 4M14A 4WG3A 5AUZA 1Q4LA 3EH9A 3GGFA 3JPVA 4UMTA 5FWKK 5BX0A 4OAVB 3OW3A 2WGJA 1L3RE 1R0PA 4IB0A 4BYJA 3NNWA 2WMTA 4GVAA 2OJJA 3QXPA 3OWJA 3IK3A 4NZWB 2WQOA 3ENMA 4YPSA 5IQEA 3ZC6A 3SVVA 2X1NA 1K2PA 1Y57A 4JS8A 5BUJA 3ZUVA 5ETIA 3VS4A 3D14A 3R63A 3LCKA 2JKOA 5DG5A 5I9UA 5ANKA 3COKA 3H30A 1HCKA 4BCKA 5FP6A 5F4NA 4A9UA 1VEBA 4XLIA 4KINA 3BE9A 4N6YA 4DITA 2A2AA 2WU6A 4KS7A 4ZSJA 4L3LA 3MS9A 5HLPA 4RLKA 4C4EA 3K54A 2FH9A 2R3JA 2C5OA 5GHVA 1M2PA 1GZ8A 3UYTA 5AP4A 2JDRA 4L3JA 3WOWA 5CAUA 4KABA 4DGGA 2E9NA 2VTIA 4F4PA 3OTVA 5ANIA 4ASZA 4KIKA 2YERA 4M12A 2P4IA 2XNPA 4M3QA 3EN5A 3ITZA 3ORNA 5D9HA 2CCHA 3WZJA 4AT3A 4BZNA 3R8LA 1FMOE 2PMLX 3MESA 3ZBFA 4F65A 3FMMA 4KD1A 4E4LA 4LYNA 2LAVA 1UNLA 4GSBA 3DXPA 4BF2A 2RF9A 4FIGA 3NGAA 3MTFA 2WMUA 2XK4A 4KWPA 3I79A 4IZAA 3FSFA 4NW5A 4WNKA 2UW5A 2IVUA 3DLSA 5HO8A 3KEXA 4BDHA 4FIJA 4FSTA 2UZDA 3PJ3A 4DT9A 5BPYA 3D9VA 3KFAA 4I5CA 4M13A 3P5KA 4QMSA 3LMIA 2AUHA 2WTKC 2BR1A 4WNMA 4JBPA 5G1XA 1K9AA 3F2AA 5K5NA 1H00A 2PL0A 3LM0A 4X2JA 1WBPA 2PVRA 3I6WA 4OTWA 4ERWA 5EG3A 5EKNA 2OJGA 5IEXA 4B6LA 3OD6X 3CQEA 3RPOA 4ZTMA 3VBTA 3TZMA 1PF8A 3FYJX 4XP3A 2UUEA 3TIZA 1URWA 3QUPA 4WNPA 3W8QA 5KMKA 3UZTA 1G8AA 4DT8A 1RJBA 3LM5A 2G2HA 2Y6MA 3MDYA 3ODZX 2A0CX 1GIIA 4UYNA 3T3UA 2W5BA 3L9MA 4WA9A 4DE4A 3RTPA 2CLQA 4FNWA 1TQMA 4QYGA 5CVHA 4WO5A 4AGCA 3HGKA 3DCVA 4ANLA 5D12A 5IA2A 4M7IA 2J90A 4TYJA 3MVLA 3O71A 4YNEA 5CAPA 3R1NA 2CMWA 4G17A 3DAKA 1XH9A 4O0VA 3UIXA 3CD3A 2OU7A 3H0YA 1NVSA 3QKKA 4AN9A 4BDIA 1JNKA 4V0GA 5J87A 4QTDA 3IECA 4RIWA 4Z9LA 3NVKI 2GDOA 1H24A 4GJ2A 5EM6A 2BRBA 3DV3A 1URCA 3WF7A 3E63A 3O17A 3PPZA 3FMKA 1B6CB 3BI6A 3FXXA 4ZSEA 2A4LA 3BPRA 3BHTA 2R4BA 3FAAA 3K3JA 4R3RA 3SXRA 4Q5HA 2DS1A 1I44A 3C4WA 1H4LA 4ONAA 2UW7A 3KGAA 4DHFA 4JI9A 4NSTA 4UZHA 1SM2A 3BGQA 3U9CA 4EEVA 3KREA 3IOPA 3NYVA 3RAHA 2QD9A 4NIFA 4EC8A 2G01A 4YUQA 5HO7A 2R3PA 1PXNA 2CGWA 2UZNA 2VTAA 2J7TA 4QMTA 4R77A 4OR5A 4NW6A 3IGGA 3RK9A 3LFSA 3QCXA 4OTRA 4EOSA 4GT4A 5BVOA 1W83A 5M44A 3RM6A 3A7FA 3EQIA 3FXWA 4QMLA 4EH5A 2B0QA 1TQPA 3OUNB 5L6WL 4CSVA 3LIJA 5I0BA 3GU4A 1IAJA 2IG7A 5IQIA 4DA5A 4IAYA 3FC2A 4HCTA 4JOAA 5HX8A 3DTCA 5CEQA 3PZEA 4RZWA 5L2IA 5E9EA 3A2CA 2YIWA 4PF4A 1OGUA 4TTHB 3KXGA 1FQ1B 2QOQA 3OVVA 4FT0A 4IWPA 4XV1A 4CNHA 4E5WA 3R21A 4OTGA 2PUPA 2X2MA 3BYMA 4KNBA 1XQZA 1CKPA 5JEBA 4FNYA 4A9YA 4G6LA 4OTIA 2F9GA 3BRBA 3WZKA 4TWOA 5B2KA 3ZONA 3U51A 3WYYA 4FIIA 4UX9A 3OG7A 4FMQA 1PXOA 3BHHA 4QPSA 4JG7A 4O81A 3TTIA 1Q62A 4YO4A 1U4DA 4G9CA 4ANSA 1CDKA 2WKMA 2W0JA 1LEZA 3E92A 4PTGA 4WNOA 4C2VA 5IQAA 2GNGA 2W99B 3KC3A 5ANOA 3PRIA 2VU3A 5LXMA 3UJGA 4NKSA 3L9NA 4FSWA 3ZLXA 5BMMA 2QI8A 5HZNA 4RVMA 4CZUA 3EFJA 5CLPA 4O7YA 3L8XA 2R7IA 2XRWA 1BI7A 3LFNA 3EN6A 4FTNA 3LE6A 3HUBA 4F1MA 2XUUA 4QP6A 2J9MA 5EI2A 4E6QA 4EH8A 3HDMA 4HYIA 2GS7A 3ZDIA 3GBZA 5KKRC 1GAGA 3FY0A 2X4FA 2DYLA 5GZ8A 2W9ZB 1SNUA 3BKBA 3PYYA 4C36A 3DOGA 2NP8A 3RAWA 4D58A 3LCSA 4M15A 2C3JA 2XM8A 1R3CA 2ZYBA 4GV1A 4XG8A 2YIQA 4YZBA 4D5HA 3ROCA 3D5UA 5L4QA 5DI1A 3EJ1A 2UZOA 4NH1A 3R9NA 1YHWA 2R0IA 2Z8CA 5A4CA 4DBNA 3OF0A 2BZIB 1FGIA 3ERKA 4FKQA 4JRVA 5HE1A 4YTIA 4WHZA 5IQHA 5CT0A 1H08A 2E9OA 1J7LA 2C3LA 2JKQA 4IM3A 4KS8A 3V6SA 3DJ7A 3JYAA 3VUIA 3HLLA 5KBRA 5FDXA 3P1AA 1PW2A 4WBOA 4A4LA 3GC0A 3SW4A 3A60A 4EOJA 2B7AA 3DKFA 4JT3A 4N4SA 5CI6A 3OBJA 3MFSA 2BFYA 4AW5A 4BCPA 2W4JA 3NUNA 4TWCA 3QF9A 3TV7A 4EHVA 2JC6A 3QQJA 3QRKA 3VBQA 2P33A 3E87A 3V01A 3LFCA 2QU5A 3RK5A 3QAME 2W9FB 3PVUA 3QA0A 4RIXA 5E8XA 3RI1A 3W2SA 3F2RA 3QFVA 3R04A 5HVKA 2WOUA 5I9WA 4QMQA 5ACKA 2NNWB 4U3YA 4YLKA 5EOBA 3PG3A 3TTJA 3KRWA 4DBXA 2WQMA 4HVDA 4G5JA 3RZBA 1Y8GA 5JZNA 4MQ2A 5IUGA 1G3NA 3BV2A 4J52A 3F88A 3FV8A 3SV0A 2GSFA 2XMYA 2ZM1A 4CLIA 4EK3A 3CQWA 1SMHA 2XK7A 4NFNA 5HE2A 5M4UA 4X3FB 3RCDA 1ZYCA 3S95A 3QWJA 1QPCA 5CSPA 3QHWA 2HWPA 4H1MA 2Z7RA 2C6MA 3EL8A 4FC0A 4LRJA 4ACMA 3PG1A 4BDJA 5BVNA 2ITWA 5K9IA 1A06A 4KRCA 2CGVA 3VRZA 4JG6A 1YXXA 4RPVA 3FI4A 4PL5A 4RX5A 2Z2WA 2CKEA 3WZEA 3F69A 4YTCA 3H10A 2SRCA 2QR7A 3ORPA 3BYUA 5M4IA 5FRIA 4LV8A 3CQUA 4HGEA 3POZA 4EBWA 3TUDA 3AMYA 5AWMA 5C03A 4E1ZA 3QKLA 4CYJA 1OMWA 4E20A 4B8MA 3FHRA 1Q24A 4CLJA 4BIBA 1ND4A 2Q0NA 4JAJA 4H58A 1NA7A 4CTBA 1YQJA 2W5HA 5CAVA 3TNWA 4FBXA 3BWJA 4RIOA 4C2WA 4FZ7A 2F2CB 2XH5A 3MH0A 4RIYB 3AT4A 4MX9A 2QKWB 4EOIA 4RWJA 4G34A 4ALUA 2HELA 2YN8A 5A6NA 2VWUA 2XNEA 3FKOA 1WVWA 2BILB 4NM5A 5AX9A 4FV9A 4BGHA 5D10A 3ZLSA 5HCXA 3DBQA 1E9HA 4KSPA 3JR1A 3P23A 5K0KA 5ANDA 2XJ1A 3PXKA 3VUKA 3CY3A 3OY1A 3W2QA 4BCGA 4AAAA 5BQ0A 2UV2A 2PVJA 3NNUA 2BRMA 4FKLA 4HNIA 3BELA 4K2RA 4AACA 3RGFA 1AQ1A 2OG8A 4EH7A 5KHXA 3EHAA 2C3KA 3LAUA 5CU3A 5D41A 2CPKE 5H3QA 2YLEA 4BB4A 5CF8A 4FKWA 3GUBA 4MHAA 2UW9A 3FZTA 3GQIA 5AP1A 5AP7A 3R7UA 3ZFMA 3W33A 1WCCA 5BMSA 4YJSA 4AUAA 5IMEA 2F7ZE 4BCJA 1JLUE 4IX4A 5C4KA 2RFNA 1UU8A 4QD6A 1ZYDA 5L2TA 1YWRA 2FB8A 4D28A 5L2WA 4F1TA 2FYSA 2JAMA 3V5WA 4AA0A 3AMAA 4O7LA 5LMBA 4IFGA 3R0TA 3A8XA 3ZS5A 2I1MA 3MV5A 3OFMA 2FSLX 1FPUA 2JFMA 2IPXA 4EWQA 4CRSA 4A9TA 3NVMB 3PDTA 4L01A 2RIOA 4Q9SA 4UY9A 3ZSHA 4C7TA 4FTRA 2IVSA 2W4OA 4GS6A 4AOTA 3I81A 3ORKA 2QOBA 2FSOX 2XIRA 3QKMA 4TWNA 1R0EA 2G15A 3AG9A 5AUTA 5JRQA 4CQEA 2W5AA 1Q8ZA 4UBAA 3UIBA 3H9OA 3MIYA 2YM7A 3KCKA 2C4GA 1H1RA 4BDAA 4CEGA 2H6DA 4J71A 5A4LA 2WMWA 4I23A 5IPJA 4Y5HA 2YFXA 3PJ1A 2QC6A 4IAAA 4YURA 2GCDA 2WOTA 4W4WA 3NX8A 2VO7A 4PDPA 1XKKA 4XMOA 1W98A 1GY3A 4ZTRA 4DEEA 4ZY5A 2R3IA 3EFWA 2O5KA 4Y8DA 1KE8A 1ZXEA 2IZRA 2VWZA 3TV6A 5CQUA 3FMNA 5GJDA 4A7CA 4LMNA 3C4XA 4YHJA 4APCA 3HMIA 4KKEA 4E4NA 3LMGA 3TKHA 1XH8A 5CF5A 4Z3VA 3KF4A 3C7QA 3S0OA 1PJKA 3V8TA 1KE6A 4ZTNA 2W06A 3LCTA 2RGPA 4JX3A 4AGWA 3W10A 4HW7A 3D83A 4CVAA 4HNFA 1O6LA 3FPQA 4BCNA 4FV3A 2H34A 1H25A 4QMMA 2DQ7X 2IW9A 3SRVB 2W7XA 5L8KA 4E8AA 3NDMA 3RINA 2XP2A 3VBVA 3BEGA 4XRLA 5FLFA 3ZRMA 3PXYA 4FGRA 4O7NA 2QOKA 5EYKA 4AS0A 1FMKA 2C6EA 1WMKA 2WMVA 4GIHA 4YPDA 3QZIA 4UV0A 3VQHA 3Q2JA 4C58A 4C3RA 1PMVA 4O2PA 3F82A 4L7SA 3OT3A 4ALWA 2PZIA 3ZM9A 2BHHA 1VYWA 2X7OA 4ZTHA 1WBTA 4IAIA 4EQUA 3EFLA 4QYYA 4A4XA 3UOHA 4XOZA 4JR7A 3G9NA 4B7TA 3UBDA 4FV2A 4X3FC 4BTMA 3DZOA 4G6NA 2WTIA 4FV1A 2YDIA 2CSNA 3NW5A 4O86A 4DH8A 4IH8A 3K3IA 5AAFA 2V7AA 4DH1A 1JKTA 5B0XA 3HDNA 4U9AA 2PVHA 3VAPA 4ZLOA 4JBOA 1X8BA 4X0MA 4DCAA 2OJIA 3QZHA 1TKIA 3QTUA 2BAQA 4EKKA 1U54A 2A27A 3S4QA 1OUKA 3OY3A 3H0ZA 4D1SA 4D1XA 5C1QB 5HESA 5I3RA 4GK2A 4HGSA 4QPAA 4PTCA 2VTNA 3MH1A 2JBOA 5IUHA 3ORZA 3U9NA 2JDVA 5HX6A 3MPAA 4CGAA 3TZ7A 1VZOA 4U8ZA 5I5ZA 5HIBA 5K4JA 4CG8A 3U6IA 5M57A 1YXSA 5AR4A 1EH4A 1DAYA 2HOGA 4G3GA 3R7YA 5GINE 3AC4A 3O7LD 3OXIA 3QYZA 3SKCA 5JH6A 4AZEA 1WVYA 2YDKA 1OIQA 2QVSE 4FTQA 3MH2A 3M1SA 5CY3A 1OL1A 4FV5A 2ZAZA 3VULA 1ZWSA 3ET7A 3JXWA 2RG6A 4FG8A 5M07A 3DBEA 3FBVA 3NIZA 3WYXA 2UZVA 4BCIA 3AT2A 4XJ0A 2QHMA 4TXCA 2Z7LA 1ZARA 3R02A 2XRUA 4NCTC 4R5YA 5HIEA 1JSTA 5J9YA 3DFCB 2WMBA 4CFFA 3EQHA 4BZDA 4O84A 4C59A 4HOKA 4E73A 4FK6A 3HMOA 4PL4A 2JDOA 1IRKA 5ETCA 4QP1A 5E8VA 4KRDA 3EL7A 3GCUA 4D9UA 4DTKA 2YM5A 4G3EA 4EOPA 3UNJA 2XNMA 3QQFA 3OTUA 3P7CA 1YHSA 3CTJA 2QQ7A 4GG5A 4AWIA 1OKZA 5AUWA 3QTXA 4AW2A 2ITPA 1LR4A 2ITYA 5TKDA 3MA3A 3OROA 4TYHB 4P90A 4IDTA 5CXHA 1JWHA 4BDEA 3RCJA 3BIZA 2BHEA 4P2KA 2XYUA 4BCQA 2EU9A 3MPMA 4X3JA 3T8OA 3R1QA 5TE0A 3ZDUA 4NU1A 2VX0A 3L8SA 3HA8A 3EOCA 4BTFA 2JAVA 4J7BA 3VN9A 1PHKA 1B38A 2FUMA 3QCSA 4U42A 2C6DA 4U7ZA 4D2WA 1OBDA 3JUHA 4H3PA 5AR5A 1S9JA 4OBPA 3ZRKA 3ATTA 3C5IA 5BUEA 4FV8A 3KL8A 3HV3A 1FOTA 4YC3A 4MKCA 2PVNA 3OEZA 4E4XA 5IDPA 4S2ZA 4KBCA 2CNVA 4W9XA 5IEYA 4FEWA 3LFFA 1SZMA 5DT4A 2BPMA 4CCUA 4XBUA 3FLYA 1WZYA 3OXTA 4WG5A 4RGJA 5CTPA 2J51A 2IW6A 1OKWA 4RIYA 3R8MA 3PE2A 2VV9A 4U45A 4BCMA 3OOGA 3QD0A 3R1YA 4DG2E 4YJPA 4JRNA 3GFEA 3RK7A 4C8BA 4FT7A 2VRXA 3MBLA 3U8WA 4NIFB 3TEIA 4QMNA 3TKIA 3R9RA 3F6XA 5TF9A 5EKOA 3BE2A 3S3IA 2B9FA 5LMAA 3UPXA 3DDQA 3IOKA 4IAZA 2J0IA 4J95A 5JN2A 5CEIA 4CKRA 1DI9A 1XH4A 3DZQA 3PA4A 2UVZA 3PY1A 4L00A 3PIXA 4FOBA 4Q9ZA 5JFXA 3P86A 5IA1A 3HV5A 3HEGA 1H1WA 5LVLA 1XH5A 2UW0A 2CKOA 4AA4A 5E8ZA 4FE2A 3EQCA 3PPKA 4EH2A 5LJJA 1A48A 4RC3A 2B53A 3NUSA 2BRGA 4M66A 4IM2A 3L8PA 4PY1A 4TNDA 4AQCA 4DTBA 5DR9A 4X7QA 1STCE 2GMXA 3UGCA 3B8RA 3LXPA 4HJOA 3E8DA 2OW3A 1JBPE 4N0SA 1XJDA 4HGTA 4ERKA 5BYLA 4LI5A 3FUPA 4JBQA 3F5PA 2CN8A 4I22A 2LGCA 2QU6A 5CAQA 3ZEWA 5KMNA 1W84A 4BWPA 1M14A 3CTQA 3Q2MA 1APME 2JD5A 4EHEA 3PWYA 5EDRA 4O0UA 4PWNA 4F9YA 4F08A 2VTSA 3ORTA 4USFA 1Z9XA 3F5UA 5DNRA 5D11A 3QHRA 3CE3A 3VQUA 4FVQA 2H9VA 4QP4A 1XBBA 2RL5A 3E64A 2OICA 1QL6A 2VTJA 5DIAA 5J5TA 5CVFA 4BRXA 3BHVA 5DMZA 1Z57A 2WD1A 5H8EA 2V0DA 2YCQA 3VO3A 4B8LA 2X8EA 4IJPA 2GHLA 4J53A 4EBVA 3QTQA 3V5JA 3GENA 2GS6A 2QO7A 3OCTA 5CAOA 4O0WA 1DI8A 4RVTA 1NW1A 2DUVA 3ZHPC 2NPQA 5H9BA 2OLCA 2QOFA 1MQ4A 4BDGA 3LFQA 3D7TA 3OUKA 3C4ZA 2BMCA 3KN5A 4IVAA 5J1WA 3E5AA 4APPA 3EYGA 1VR2A 4BKJA 3VVHA 3NUAA 4E4MA 4FGBA 5F95A 1Y6BA 2BCJA 3OT8A 3SRVA 2X2LA 3Q60A 1PXLA 3WF5A 4GW8A 2XKEA 2Y6OA 4B4LA 1QCFA 2PUNA 2HZ4A 1ZMUA 2Y8OA 5JT2A 3LQ5A 5EH0A 2PU8A 3GNIB 3FLSA 4LMUA 3KQ7A 5L6OA 4ARKA 3O8UA 4JIAA 4RIXB 4DAWA 5DR2A 1H0VA 5IMXA 5HQ0A 5FQDC 3R2BA 1JVPP 4EZ7A 5C8KA 2JKKA 4O7ZA 2V7OA 4ZSAA 3UQGA 3NEWA 5D7VA 4DINA 5M53A 3C4EA 4QMPA 4PX6A 4R8QA 4RJ6A 5BVEA 2PVLA 3D15A 4YBKA 3FMLA 3ATSA 3GU6A 1ZZLA 2F7XE 3ZZWA 3RHXA 1OL5A 2GS2A 2IJMA 2OBJA 2IWIA 3HECA 3PJCA 4IX6A 3RNIA 3ZH8A 4CMTA 5HD4A 4FUYA 3ZEPA 2QNJA 4FVRA 2FO0A 3O7LB 1YDSE 2UZWE 4BVUA 5DYJA 3QU0A 2HIWA 5BVFA 3UPZA 4UXLA 3FE3A 3FI3A 4FX3A 3F7WA 5AA9A 4XP0A 3OWLA 2VX1A 4FYOA 3ZYAA 5L2SA 3S1HA 3P78A 2HXLA 4UMUA 2XK8A 3GVUA 1B39A 1PMUA 3NRMA 3Q9YA 3CPBA 4MBIA 1OBGA 4WSQA 3FYKX 3IKAA 3NUYA 2CGXA 3TJDA 5J7HA 2BKKA 3IDBA 3UO6A 3MY5A 4QTBA 4GG7A 4MEDA 5A4EA 2C5YA 4K6ZA 2QO2A 2HAKA 4FKSA 4I0TA 3OCGA 4IC8A 3VW6A 2XK9A 4W9WA 4YSJA 4FKPA 4C35A 3R2YA 1PXPA 4NEUA 5GJFA 3F3VA 5EHOA 1OKYA 3F3UA 2O2UA 3SLSA 5HOAA 4EOLA 2R64A 1O6YA 4U81A 3U6HA 2XS0A 4FKVA 1GZKA 2OKRA 3DJ6A 2C0OA 2UZUE 4JXFA 5EHYA 3COIA 4DG3E 4OAUC 2ETKA 5AUUA 5CWZA 1PYEA 3MJ1A 2JLDA 3R28A 4H39A 3I7CA 3M11A 2YCFA 3EZVA 4TYIA 3I60A 3A61A 4X2NA 1YWNA 3R7GA 2IW8A 3RAKA 4C4FA 4NK9A 4O2ZA 4BN1A 1KV2A 4MF0A 5AR7A 4AFJA 3KB7A 3VUGA 5IH4A 3CKXA 4DLIA 3EMGA 3BLQA 5AR2A 4TYHA 5I9VA 4EQCA 2UZTA 3LFDA 4JQ8A 4MCVA 4IZYA 4XG2A 5FXQA 3PA3A 2W1DA 4L45A 3BBWA 4QP3A 1BL7A 4QQJA 4RFMA 4CZYB 3FPMA 4DH5A 3O8PA 4RJ3A 4PDYA 1JKSA 2UW4A 2ESMA 1PY5A 3WF8A 4B0GA 4E7WA 3E62A 3HMPA 2VNWA 2C6KA 2W1IA 1QMZA 3NR9A 4FV7A 1V1KA 4IACA 3ZCLA 5ACBC 1H8FA 1IEPA 5BNJA 2QG7A 2X8IA 4FSNA 4OTQA 4FTOA 4D2VA 3R9OA 5AJQA 5HEZA 4JVGA 4M67A 1BX6A 4FTCA 5HGIA 4QTEA 2RFEA 5GZ9A 3ULZA 5L8JA 5AP2A 2OJ9A 3F5XA 1XR1A 3BEAA 4QP2A 1H28A 2NRYA 2C30A 3QYWA 3EKKA 4LOOA 3LJ0A 4F7SA 1E1XA 3EQGA 5LVOA 1ZYJA 3GC9A 3K5VA 3ZO3A 2BDFA 3PUPA 3HKOA 3HRFA 3RPRA 3E8CA 5I4NA 3TDWA 4KBKA 5AMNA 5IKWA 4RRVA 2XKDA 3Q4TA 3QD2B 4LV5A 3JVSA 2X39A 4YZ9A 5EQYA 3GCSA 4FZAB 4FKJA 4D4SA 4AZFA 4CYIA 4RQKA 4S33A 5AV4A 3EZRA 4GU9A 4AG8A 4JL9A 4AN3A 4QP9A 4Z7HA 3OW4A 5IH5A 3FY2A 5IISA 4PTEA 2GFCA 3GFWA 3KK8A 3NYNA 2E9UA 4HYHA 5HIDA 3CD8A 4WD5A 5DH3A 4R3PA 5I9YA 2F57A 3QBNA 4FSZA 3LVPA 4RC2A 5AUXA 3UIUA 4CCBA 3SD0A 1ZAOA 2XKCA 4PPAA 5K0XA 2IZSA 4RLLA 2OH4A 3NW6A 4ZY6A 5CI7A 3REPA 4E6DA 2PULA 4DFBA 1HCLA 4LRKA 5GZAA 1OECA 1RDQE 4FYNA 1P5EA 4JQEA 3RP9A 4IVCA 4JBVA 2JIVA 3FZOA 3FMDA 4PMTA 1RW8A 3AQVA 4XG6A 5AIKA 1DAWA 2O0UA 3W1FA 4IHPA 4G3DA 2PMNX 3A7IA 4KB8A 4MXAA 1ZY4A 3LQ8A 3FL4A 1CM8A 2YWVA 3LZBA 4X2KA 5HICA 3NAYA 2ONLA 3MB7A 4HVSA 3BHYA 1OIRA 3W16A 5DT0A 4O0TA 4Q5EA 4EQMA 3ORXA 1KE7A 5HE3A 3MTLA 2XEZA 2PE2A 3D2IA 5JMSA 1YW2A 2X0GA 4IB5A 4WRSA 3IS5A 4F6UA 2VX3A 3H4JA 4ZZNA 4LGGA 4BHNA 1AGWA 3VS3A 2UW3A 4CT1A 3LXNA 1BKXA 3AC3A 5CS6A 1YDTE 1YVJA 3FSKA 3N4TA 4CTCA 1J1CA 2YJRA 4G2FA 2C0TA 2UVYA 4TRLA 2ERKA 4LUDA 4JR3A 4FKIA 3TKUA 3UG1A 4EK4A 1M17A 5CEOA 5DBXA 1U54B 1OITA 3KVWA 4AF3A 4NM7A 4QQTA 3DBFA 4FG7A 5LMKA 5FD2A 4UALA 4R7IA 3MI9A 5LVNA 3UNKA 3RWPA 5IDNA 3A62A 4EH3A 3OCBA 4U79A 3P4KA 4HGLA 4UWYA 5KHWA 1H26A 4EUUA 3DKCA 1ERKA 3ORLA 4I4EA 4FKTA 4EK5A 4DH3A 4WBBB 2ZJWA 3FI2A 3R01A 4ZAUA 4U80A 5HO6A 5H8GA 4NL0A 2P0CA 4N6ZA 5M06A 1R1WA 4R1YA 2QCSA 4FTAA 3GOPA 4GL9A 1BMKA 5DEYA 5EW9A 4BBFA 4GT3A 4U40A 3Q9ZA 5IUIA 4Z7GA 3CR0A 3VWAA 5ETFA 4QO9A 2WNTA 4D2PA 4DGNA 1J1BA 3IW7A 3PXQA 4AW0A 3Q3BA 2XYNA 1YOMA 3H9RA 4ZK5A 3TN8A 3ID6C 4F9AA 1JPAA 3EB0A 3CKWA 2OXYA 3V8WA 4K1BA 2ZM3A 2J0LA 3FDNA 3FQHA 5GNKA 5KZIA 5LWNA 4KUJA 2VTQA 3NZ0A 5M51A 3UC4A 4RJ8A 2J5EA 4YGAA 3KXHA 4ZLYA 3RPVA 4MWIA 3AC5A 3G5DA 4FTTA 4RT7A 4MNFA 3PFQA 3T9IA 4OTFA 4FEUA 2WB8A 4IAKA 3ULIA 5I9ZA 2YIYA 4FR4A 3FZRA 2IVVA 4CMUA 4K8AA 5CXZA 2VWBA 3DBCA 2C47A 2PUUA 4RVKA 4L42A 3RMFA 4ENXA 5L6PA 3EQPA 3UTOA 5FUTA 2B9IA 5H2UA 4L7FA 4V05A 5EW8A 4FSRA 1BLXA 4PPCA 5LWMA 4ZY4A 3I4BA 4OTDA 3BBTB 3O96A 3BGPA 3DT1A 5CT7A 1ZLTA 5DFPA 3KRXA 3RKBA 3VJNA 5H8BA 2QOOA 3FMHA 4F9CA 4HVHA 3Q6WA 2JIIA 1F5QA 4IX5A 3UVPA 4PRJA 5C9CA 1QPJA 3DB6A 3AXWA 4C34A 4RC4A 2X9EA 2W1FA 5EFQA 2BTRA 2W1HA 3IGOA 3QCYA 4XV3A 2VWYA 2VO3A 4C4JA 4F0IA 4IZ5A 4W8DA 3NPCA 4ZXTA 4CFVA 4EH4A 2Y9QA 3QTSA 2PE1A 3TV4A 3KCFA 4FV6A 1Q3WA 4C02A 2WMQA 5KCVA 3KKVA 3BZ3A 2G9XA 4GH2A 4NM3A 4BDCA 3BU3A 3BYOA 5C8NA 4O27B 4QQ5A 3EKNA 4FODA 4FSYA 3OZ6A 1HOWA 3MA6A 1ZZ2A 2R3KA 5HTCA 1DS5A 3VC4A 5ITAA 4R78A 3KVXA 4RBLA 4O96A 2J4ZA 1OVEA 4FI1A 3AC8A 3BU5A 3A4OX 3NCZA 3PSDA 2VWXA 4YSMA 1OB3A 2H8HA 5E92A 3V3VA 3VF9A 2VWIA 2ZVAA 5C27A 4F7NA 4HYSA 5L8LA 5BVWA 3KRJA 3GQLA 4DFUA 2Z7SA 4RSSA 4OLIA 3P0MA 4RJ7A 4F70A 2BKZA 4ID7A 5JZJA 5CF4A 2HW7A 5AUVA 3DA6A 5DWRA 2BIYA 4FVPA 3VS0A 4D4RA 3OHTA 2BTSA 4GYGA 2ITXA 5DHJA 5E8WA 4ZJVA 5JQ8A 2C68A 3LFEA 4AT4A 5HVYA 4WSYA 5CANA 4I5MA 3UO4A 3G15A 3VS7A 4EH9A 3HAVA 4DYMA 2J0JA 2PZ5A 3MVJA 4G1WA 3PVGA 4TY1A 4YC8A 4OTHA 4C38A 4ZJJA 4EOKA 4CKIA 3Q53A 2BIKB 5DA3A 4E6AA 1PRYA 2C69A 1OL6A 2EXEA 2C6OA 5BVKA 3QZFA 4YJOA 5CENA 1PKDA 3WE4A 1XO2B 2XCHA 1VJYA 2I0HA 4BR3A 5CYIA 2J6MA 4OUCA 4UWCA 3TT0A 4A9RA 4BWXA 5AAEA 1S9IA 1R78A 4G5PA 4R5SA 1OI9A 2XKFA 4TPTA 5B2LA 5J9LA 4FSMA 3QRTA 2BAKA 3V5LA 3QD4A 3CP9A 4DGMA 3KULA 3ALNA 3PVBA 2OXDA 5HG7A 1CSNA 3CGOA 4IXPA 5JKGA 1VYZA 1YI3A 2J5FA 1P14A 1LPUA 4JDJA 4WUNA 3LFAA 3HV4A 3ODYX 4TZRA 3OP5A 3TNHA 3LLAA 3OS3A 4J96A 4DEAA 2R0UA 4L8MA 4DN5A 1P4OA 1GNGA 1ZYLA 3U87A 4XEYA 4CG9A 2XF0A 3UVQA 4FTLA 4F0GA 4FZDB 1W82A 4I0SA 3A4PA 3EIDA 4C0TA 4GKIA 3DLZA 3CCNA 1ZOHA 4G6OA 3UC3A 2QONA 3D7TB 4TNBA 5KX8A 3VW8A 5AV0A 3UP2A 5HBJA 5JSMA 2X9FA 1XH7A 3MH3A 3LFBA 4F63A 3ALOA 3UOLA 4GK3A 3CSVA 1YRPA 1Z5MA 4JX7A 4L46A 2VTOA 5M09A 4AZVA 4DFYA 3F3ZA 3JY0A 2WEVA 4Y72A 4P5ZA 4O21A 4ASEA 2QURA 2BFXA 4TKSA 3KA0A 5M08A 2Y7JA 5EQPA 3NYXA 4TYEA 5FTGA 3FC1X 2PVYA 1W7HA 4YJUA 5A4TA 3PY0A 2XM9A 4I21A 2YABA 3EN4A 4KSQA 4L68A 4ACDA 4W4XA 4YTFA 3H9FA 3R30A 4V01A 1BL6A 3GEQA 2YHVA 3ORIA 2X6EA 4XLVA 3B8QA 4IDVA 2WEIA 2ITTA 4FKOA 2BZKB 4FZFB 4AGUA 3P7BA 4EYJA 3IDPA 5EW3A 2C6IA 3FJQE 2FGIA 2FSMX 5KNJA 4M68A 4JIKA 2XIZA 3R00A 2XJ0A 2QODA 2R3MA 4CFXA 4TYGA 3CBLA 3E3PA 1I09A 1QPDA 3QLFA 4L52A 2J0MB 4GYIA 4YTHA 5HNBA 1OPKA 4X6RA 1Y91A 5E1EA 5DRDA 1U59A 4L6QA 3QTZA 4GFOA 2YDJA 3KN6A 4IFCA 2VUWA 3I5NA 4F09A 4LRMA 3UDBA 2ZB1A 2GHMA 2R7BA 3GT8A 3P9JA 4TL0A 2PVKA 1W0XC 4IB3A 5CZHA 5JGAA 1UWJA 4EZ3A 3AC1A 3LKMA 1GIHA 4ZTQA 2YCSA 3IW4A 2ITQA 2ZV7A 4L44A 4O0YA 4YHTA 3QALE 5IQFA 4BCFA 5IF1A 4I4FA 2B55A 5K4IA 1WBSA 4JNWA 3Q52A 4K9YA 2WMXA 4DFXE 4EK8A 5KO1A 3SXFA 1JKKA 3TJCA 5LCJA 4JAIA 2G2IA 3DY7A 4EKLA 4QMUA 3RNYA 2IZTA 4K77A 3RAIA 3DDPA 3UVRA 3EN7A 4BKYA 5HNIX 1Q41A 3OXZA 2ITOA 3NW7A 4EH6A 4ASXA 3ZSGA 5C8MA 1FGKA 4BI1A 3AT3A 2WQNA 3HMNA 4F6WA 5JGBA 4WT6A 3QRUA 2ZV2A 3HL7A 1JSUA 5FBNC 4EUTA 3NUUA 4O38A 3MFRA 3WILA 2WMRA 5CU2A 3BYSA 3ZTXA 3R8ZA 1M52A 3F61A 4K18A 3DK3A 3E7OA 4DEGA 2GNFA 2QO9A 3QA8A 4RFZA 4RWIA 3ENHA 4XHKB 4FKRA 3MJ2A 5A46A 3R8UA 3MIAA 3MY0A 4I3ZA 3LHJA 4EZ5A 3PE1A 2GTNA 5BYYA 3MGYA 2OJFE 1UU3A 4ACHA 4XNEA 5CASA 5HG9A 4D4YA 2EXCX 5IG1A 4IVBA 2QLUA 3NWWA 3DXNA 5A9UA 2XZSA 5I3OA 2E9PA 4XG7A 4EJ7A 3VS2A 3TM0A 3FLWA 4DLJA 4EYMA 2XBJA 3QQHA 4WIHA 5CX9A 1M7QA 4H1JA 4CFWA 3IDCA 4LL0A 4MF1A 2VTMA 3KY2A 3KXMA 4IC7A 4QYEA 5HI2A 4NUSA 4ACCA 4AT5A 1OL7A 2VWWA 4C62A 1NT2A 2OI4X 4TWPA 2HK5A 5AM7A 2ZOQA 1MRVA 2YISA 3GI3A 4RG0A 2ZM4A 4ZZOA 5IH6A 4BDBA 3ZUUA 4S31A 2XIXA 3E3BX 5F20A 3ZC5A 4NJ3A 2I6LA 3GC7A 4FIEA 4PDSA 3V6RA 4GUBA 3VHKA 3KF7A 5M55A 5EDQA 1QPEA 2UW8A 1ZOGA 3VUDA 2PHKA 4HVIA 2YAKA 3NUPA 5LQFA 3EQDA 3GC8A 4O0RA 4YZNA 2HZ0A 4UXQA 3R7VA 4PP9A 5HTIA 3BCEA 3IW8A 4CV9A 1P4FA 3SOAA 2ETMA 4I1ZA 2QHNA 4QTAA 4O82A 5C4LA 1J7UA 3CLYA 2O63A 5T3QA 4YU2A 5AP6A 1IA9A 4J8NA 5CVGA 3HMMA 3DGKA 4FT9A 4GCJA 2JKMA 1U5QA 4UB7A 5E90A 1BUHA 3RPSA 4CMOA 1FINA 4CV8A 4MXOA 4CZTA 2HWOA 4JDKA 4I6BA 2CKPA 4C57A 4MK0A 3LQ3A 2HW6A 2BALA 3R1SA 4NJDA 2BZHB 3CS9A 2B1PA 3A7HA 4U41A 4AGDA 1KOBA 1KOAA 5EHLA 4DC2A 4PMPA 3U6JA 2I40A 3QL8A 5HCZA 3FQEA 1NVRA 4F9WA 4B9DA 4J8MA 4NYEA 4AP7A 2I7QA 2C1AA 2Q0BA 3D0EA 4AFEA 3H3CA 3DK6A 3P79A 5DVRA 3SOCA 4BC6A 4M0YA 3UOJA 2C6TA 4U6RA 2QOCA 4MYGA 4EK6A 2C1BA 5CSHA 2HY81 4E3CA 2OIQA 2O3PA 4KKGA 3SGCA 4R3CA 4MXYA 1YOJA 4IANA 3U4WA 4S34A 5CU6A 4FEXA 2WPAA 5E91A 4IADA 4FZ6A 4YC6A 4IWQA 4BI0A 5K3YA 3PXRA 3R73A 5HORA 3OMVA 4I6QA 2XNBA 4ZIMA 3NNXA 2WELA 5JGDA 3UG2A 2AC5A 4I20A 3WIKA 4DFLA 2WO6A 4GIIA 4YLLA 3UOKA 3HZTA 4BZOA 1YKRA 2OZAA 5HTBA 4BL1A 2VGPA 4FKUA 3T3VA 5G6VA 3KRLA 5KMLA 2NRUA 1J91A 2PMIA 3AGMA 3I5ZA 3UQFA 3HRBA 3OWPA 3U4UA 4D55A 1H1PA 4IB1A 4RQVA 2YACA 2YWPA 1KWPA 4MD7E 4PQNA 3ZFXA 3R8PA 4DG0E 4M84A 4KIQA 4M0ZA 3ZLYA 3G90X 3LPBA 3CY2A 3VS1A 5E7RA 1PMNA 5E8SA 2GHGA 3VUMA 4ITJA 4ZEGA 4XH6A 3SAYA 1CMKE 5EI8A 4H05A 1ATPE 4ZTLA 2W1EA 2YCRA 5E4HA 1Q8UA 3C0HA 1OL2A 4GEOA 3VUTA 3E8NA 1ZYSA 4IEBA 2Q83A 2OSCA 3QTWA 2YLFA 5E8YA 4FSUA 4CFNA 3I6UA 1Q8YA 5AM6A 5E8TA 4EORA 3HNGA 4IWOA 5CSWA 4ANMA 5KE0A 4C4GA 2PVFA 5B7VA 4FNXA 4HZSA 3ZUTA 4A9SA 4AU8A 4PUZA 2WTDA 4D2RA 1GZOA 5IQGA 4GU6A 3FLQA 3UNZA 1W8CA 4ANQA 4BWKA 2HXQA 5AP3A 2O64A 3FQSA 3L9PA 3NLBA 5CZIA 3UYSA 5T6KA 4F0FA 1UA2A 2VTLA 3MFUA 5FP5A 2AYPA 5HBEA 2YZAA 5LVPA 2R3GA 4CRLA 4BCHA 5E1SA 3F5GA 1Q5KA 2O8YA 4RVLA 4A06A 1RQQA 4AZSA 4C4IA 2IZUA 2AC3A 4FT5A 5IA5A 3QZGA 4AX8A 4LUEA 2GNJA 5AP0A 4K0YA 3GP0A 1WBNA 4LOPA 4IIRA 4BGGA 4AOJA 3ZOSA 2W1GA 3HRCA 4II5A 3Q5IA 3MY1A 4DH7A 4E5BA 1JKLA 5L2QA 3TXOA 1PKGA 1G5SA 4GFMA 4J98A 4GJ3A 5FM2A 3N9XA 4DEIA 2Y4IB 3LLTA 2C3IB 4R1VA 3BYVA 5GJGA 4QTCA 4FL2A 5AX3A 4H3QA 1H0WA 1OKVA 4OT6A 4P7EA 5TR6A 5AA8A 4BIEA 2C5VA 4CQGA 4R7BA 4TN6A 3VHEA 4MVFA 4DEBA 5KKRB 2OZOA 1R39A 3AC2A 4ITIA 1Y8YA 4KIOA 4Z16A 1GOLA 1XWSA 2PTKA 3F3TA 3G51A 4MBJA 4USDA 4YJRA 2ERZE 4L67A 5CQWA 3VNTA 3S2PA 1F0QA 5ANEA 3CJGA 2R3OA 5EYMA 2XK6A 4BBMA 2OO8X 4C33A 4I5PA 2BRHA 4AZWA 2B9JA 4BDDA 5IA3A 1H1QA 2EB3A 2RSVA 4UEUA 2C5NA 4E26A 3EN9A 2ZV9A 2GNIA 5J95A 2V55A 5KMOA 5A54A 1SVGA 4EJNA 1OIYA 1XBAA 2WFYA 5HU3A 4QNAA 3F3WA 3QC4A 3TUBA 4Y73A 5JFVA 2GQRA 2BDWA 3WF6A 4PP7A 1UU9A 2FSTX 1Q97A 5J8IA 4H3BA 4UN0C 4ZMFA 4BHZA 3EYHA 3KK9A
chains in the Genus database with same CATH superfamily
5EK7A 2ONLC 2WU7A 4X2GA 2PYWA 2ZB0A 3POOA 2VN9A 4D2TA 1YXUA 3ORMA 3RZFA 4PL3A 3BGZA 1AD5A 3OBGA 3ZXZA 4O0SA 4GMYA 4IW0A 1REJA 4QMOA 4B99A 3AD5A 3TZ9A 4FTIA 2VAGA 3G2FA 3KXZA 3QCQA 3PLSA 2CCIA 5DGZA 2WMSA 1CKJA 2QLQA 4XS2A 3O50A 3UE4A 2OF4A 3DFAA 1P2AA 3GOKA 2QOHA 3LXLA 4N57A 2WAJA 3COMA 4X6QC 4CKJA 3SDJA 3KULB 2B54A 2R3FA 3L9LA 3WE8A 3ZBXA 2PK9A 4O7WA 3JY9A 3F9NA 2R3LA 3DNDA 4PV0A 5J79A 5FEQA 4ZZMA 4LG4A 5DLSA 5LMKC 2Y0AA 2CHLA 4NT4A 2PUIA 4C3FA 4ORKA 4EONA 4XG3A 3BLHA 3HP2A 3KXNA 1M2RA 2KULA 3LW0A 2EWAA 4FT3A 5EM5A 3Q04A 4WKQA 2WZJA 4Y95A 1YXTA 1LP4A 3PTGA 2IO6A 3AOXA 4DFNA 3TNIA 4RMZA 3QLGA 5C26A 5HVJA 5CNNA 3R7IA 3LJ1A 4BICA 2X7FA 1OPJA 2VTRA 3ZO1A 3N4VA 4E93A 5CALA 1J7IA 3MVMA 3VIDA 1FVTA 4O22A 3QX4A 4I6HA 3HX4A 5D7AA 3FI8A 2YZLA 2FVDA 4YJQA 1Q3DA 4NKAA 4MNEB 4LL5A 4RWKA 5JFSA 2VO6A 4NFMA 2V62A 3PPJA 4O4BB 5FGKA 4EOQA 3BLRA 5IQBA 5AR8A 4O7RA 2HYYA 3C4FA 2ITUA 3B2WA 2XNNA 3CTHA 3QQUA 3EQFA 3N4UA 3PJ2A 5KUPA 3D94A 4YJNA 3A7GA 4QNYA 5B2MA 1V0OA 4LOQA 4FKGA 2QOIA 3IONA 5ETAA 2HCKA 3QRIA 4BIDA 3HV7A 4G3FA 4MD9E 3UMWA 3O2MA 2J0KA 4OGRA 5IQCA 3TIYA 4PMSA 2YM8A 3TI1A 1Y6AA 2CNUA 2JDTA 2Z7QA 1T45A 4XV2A 3OEFX 4ZS4A 4MUQA 3QGYA 1UV5A 3D5VA 3ROYA 2AEGA 1YHVA 3PLAE 4FIHA 4EC9A 2R3QA 1U5RA 2UZLA 2PY3A 4DCEA 4D5KA 1E1VA 1GJOA 3CGFA 4QMYA 4I41A 3TL8A 4YZCA 3SQQA 3GCPA 4R7HA 3ZM4A 3D2KA 5TOZA 1FBNA 5J9ZA 4MBLA 1UKHA 3I7BA 4YMJA 1IAHA 4KAOA 5EM8A 2XEYA 4AZTA 2V5QA 3L8VA 3D5WA 3NYOA 5FDPA 3UQCA 5AFVA 4DF3A 2JBPA 4A07A 4D4VA 3HA6A 3PVWA 4UMRA 2F7EE 2J50A 4ZOGA 1ZMWA 3II5A 2QG5A 4MXXA 2ACXA 3W0SA 2P2IA 1WFCA 1KSWA 2Y4IC 3MFTA 3Q9WA 1T46A 1PXMA 4S30A 5IEVA 3K2LA 5F9EA 2B9HA 3QQLA 1OM1A 3PSBA 4ZP5A 3W2CA 4FRFA 3QD3A 2I0EA 5HE0A 3OCSA 1XBCA 3DKGA 3DS6A 3O51A 3Q96A 3O0GA 4K33A 4F99A 3IW5A 1ZMVA 3MYGA 3LXKA 4KA3A 4D0XA 2WHBA 3T9TA 4G3CA 4FTJA 2OK1A 4GRBA 3W8LA 3P7AA 1BYGA 2VWVA 3DU8A 4FUXA 4Z55A 4PDOA 5ICPA 5IZFA 4WOVA 2YM3A 4KBAA 4HPTE 4K11A 5A4QA 5EYDA 4OTPA 1G8KA 1OPLA 3W55A 4BY9E 3UODA 2ZDUA 3E7VA 4IJ9A 4G31A 1PYXA 3W2OA 3NCGA 2E9VA 3FZSA 2PZPA 3G9LX 3GU7A 5AIRA 5K5XA 1GZNA 5AR3A 3OC1A 2X81A 3SXSA 4A4OA 3NNVA 3O23A 4E6CA 4RWLA 4QP8A 1PXKA 4FG9A 4F6SA 2OF2A 3L1SA 1Q99A 4UMQA 4XCUA 3S00A 2V22A 4QDVA 1H07A 2W05A 3OOMA 4AXAA 1UVRA 3R7OA 3W32A 4DEHA 4FEVA 3FWQA 4RX9A 2VNYA 3UIMA 3IPHA 3RBWA 4BTJA 3DJ5A 3QUDA 2KTYA 3Q4ZA 3C50A 3R71A 4X21A 1UNHA 3ANQA 4QMXA 3V04A 2OIDA 2XB7A 4GKHA 5DRBA 2VTHA 3M2WA 4LM5A 4QMWA 5FTOA 5M4FA 4P4CA 3RJCA 2WMAA 2XIYA 3I0OA 3Q4UA 4TT7A 3SC1A 3BHUA 4W4YA 5HKMA 2PPQA 3KMMA 2DWBA 5CNOA 2PVMA 4U44A 1CKIA 2WIPA 3M42A 2P3GX 3D5XA 1RE8A 1JSVA 3PZHA 4I92A 2CDZA 4ACGA 4AA5A 2BRNA 1V0BA 1UU7A 1NY3A 3LCOA 4QMVA 4U97A 4DEDA 4WRGA 2GPHA 1XMLA 2WQBA 4L3PA 4RJ4A 2OWBA 2NO3A 2VGOA 3EWHA 3P08A 3PWDA 3R6XA 5DEWA 4ANOA 3VRYA 4L9IA 5DPVA 3HP5A 2VTPA 3KRRA 4AW1A 5HHWA 3ANRA 4O91A 3TG1A 3D7ZA 3PP0A 4DFZE 3MVHA 3ZFYA 5IA0A 3MWUA 4D2SA 2ZMDA 5F1ZA 4EL9A 4MTAA 4W8EA 3SG8A 3Q4CA 1TVOA 3FZPA 1DM2A 1REKA 4BTKA 2IN6A 2C6LA 4BBEA 1MUOA 4EHZA 4N70A 4XOYA 1BI8A 4JG8A 5FXSA 4WUAA 2JEDA 2RG5A 2OXXA 4FIFA 2I0YA 1ZY5A 4YJVA 2RKUA 3SHEA 3DAEA 3R22A 4FV4A 1W2FA 3F66A 1M2QA 2A19B 3NUXA 3QQKA 5DE2A 2XAMA 2WTJA 2XJ2A 4F1OA 5HLWA 3R9DA 4U5JA 4DTAA 3MB6A 3SG9A 4KKHA 4AE9A 5HBHA 3ZU7A 3ZXTA 4FTKA 2X7GA 4OW8A 3WARA 1YOLA 3C51A 2YAAA 3JVRA 3HAMA 3PP1A 4GUEA 3PXFA 4RX7A 5F94A 1GIJA 4M69B 3UMXA 4P5QA 4PMMA 4FSQA 4C4HA 2BVAA 4USEA 4EI4A 3DNEA 2HY0A 5JRSA 3G33A 1OIUA 2WQEA 1PMEA 4FV0A 3WI6A 3BX5A 3WZDA 4C3PA 4Y46A 4YR8A 4BCOA 5CEKA 3DQXA 3C1XA 1FVVA 4NTTA 4YZDA 3UDSA 3ZZEA 5A6OA 3FMJA 3JS2A 5ANJA 4EWHA 2GTMA 3FEGA 3A7JA 4R6VA 4I94A 4U0IA 2Y4PA 3ACKA 3QGWA 5HU9A 2XK3A 3FHIA 5A14A 4GK4A 1YI4A 3BWFA 1LUFA 5DT3A 2OZAB 5T68A 5AAGA 4XRJA 5CU0A 4CT2A 2CNQA 4RX8A 2AQXA 4F7JA 2VZ6A 4ANNA 4OBQA 2R2PA 4EHGA 5KZ0A 3LCDA 4FK3A 4ZMEA 1NXKA 3DK7A 4IAFA 4FEQA 3ACJA 3ETAA 5A3XA 3FKLA 5LOHA 2YA9A 5BVDA 4IZ7A 2ETRA 3NIEA 2NYAA 4QMZA 2OH0E 2PMOX 1Q8TA 2EVAA 2R3RA 3AMBA 4O7VA 3HYHA 3QX2A 4MNEA 2R9SA 5JQ5A 4ZS0A 2ZV8A 3Q32A 4LGHA 2XNOA 1MP8A 3E88A 3RVGA 4O83A 2RFSA 4I6FA 2X4ZA 4AOIA 1OUYA 4LQMA 2BZJA 3I0QA 3R9HA 2H96A 2YM4A 5HCYA 5CEPA 3ZRLA 2GQSA 1ZRZA 1IA8A 4CD0A 4QOXA 4HZRA 4QYFA 3RPYA 2UVXA 3C0GA 2W96B 4YP8A 3RHKA 1YDRE 2YIXA 3LJ2A 5AV3A 2ITZA 4QRCA 5JFWA 2X0PA 4TW9A 4IWDA 3I1AA 2UW6A 2GNHA 1F3MC 2FA2A 5HG5A 4BFMA 1NVQA 4BI2A 1H27A 2B52A 3BQCA 4NTSA 4O7TA 2VO0A 4O0XA 4J97A 4F7LA 1YXVA 5CF6A 4YLJA 4ZJIA 1ST4A 2W4KA 5LCKA 2X8DA 5AP5A 3V5TA 4BGQA 3QQGA 4JDHA 3W2PA 3UZPA 3D4QA 3FMEA 4I93A 3DKOA 3NAXA 1SVHA 1FVRA 4QPMA 3R7EA 5HLNA 3ZMMA 1H1SA 2OGVA 2CLXA 4QT1A 2ITNA 3V5PA 4YBJA 3SA0A 2EUFB 3QXOA 3BQRA 1YI6A 2QR8A 2WIHA 3HVCA 2HZNA 3TACA 3MPTA 4F9BA 4IQ6A 1PXJA 3E93A 3GXLA 4ANBA 4XX9A 4AE6A 1LEWA 2XNGA 4O7SA 1KE9A 4XP2A 4MQ1A 3W0RA 3KU2A 3MW1A 2BUJA 2JITA 3CJFA 3V5QA 4RZVA 5AADA 3KXXA 3MN3A 4FTMA 4ZSGA 3HUCA 5TT7A 4XYFA 3DXQA 3C0IA 3QUEA 5C01A 4M8TA 4RA4A 4U43A 1J3HA 3ZO4A 4C61A 3GU5A 5FTQA 2YITA 4PPBA 4KIKB 2B4SB 3C4CA 3WIGA 1TFFA 2GFSA 1UKIA 4D9TA 3EQBA 4FOCA 4V04A 2PSQA 4XG4A 4H36A 3B2TA 4O6LA 4CFUA 5BUIA 3FL5A 3UO5A 2XIKA 3WZUA 3UZRA 1ZOEA 5I9XA 3TWJA 3W2RA 3RWQA 2X6DA 2JGZA 5IA4A 2F2UA 5HNGA 2VD5A 3QTIA 3SX9A 3ZO2A 5J5SA 2Z02A 5EYCA 1CTPE 5GIPE 4JQ7A 3PXZA 1WAKA 1XMMA 3NMUF 3IQ7A 1V0PA 4U3ZA 3W0PA 3E8EA 3G6HA 2O65A 4MH7A 2YIRA 1O6KA 4YO6A 2G1TA 4HCVA 5EOLA 4RJ5A 1Q61A 2ITVA 3CIKA 1A9UA 4IVDA 4L53A 3PRFA 4XV9A 4Y85A 2BROA 5AV2A 5FG8A 4CXAA 3QRJA 4O1OA 4QP7A 5CSXA 3R83A 4CFMA 3TNQB 3DPKA 4AN2A 4QQCA 2W1ZA 2W17A 2E2BA 2WTWA 5EDPA 5L3AA 3IW6A 3V51A 4ASDA 3F7ZA 4HYUA 4DGOA 5J1VA 4MXCA 4DHIB 4I0RA 1MRYA 4EOOA 1K3AA 5FXRA 2QOLA 5FM3A 5CEMA 5DN3A 3FLZA 2GQGA 3CPCA 4X3FA 2R3HA 3PSCA 4X2FA 4FNZA 2F4JA 2I0VA 4JJRA 2BDJA 3DTWA 2OIBA 1KUTA 4D1ZA 3GB2A 5J7BA 1YWVA 3FXZA 2QKRA 2EXMA 3DB8A 3Q5ZA 4FTUA 4JLCA 4O6EA 3VBYA 2GU8A 5TO8A 3VS6A 4BKZA 1PXIA 1KV1A 2JDSA 3U54A 2PWLA 3PA5A 4J99A 4IBMA 4V0GB 3AD4A 4ITHA 1KE5A 4YNOA 4O1PA 5D1JA 2ZMCA 5AV1A 4RIWB 3LMHA 4ENYA 1TQIA 5CU4A 1OZ1A 3A99A 3FKNA 2A1AB 4I5HA 2XA4A 1WBWA 4HVGA 3TDVA 4HCUA 5FEDA 2P55A 3Q6UA 3CC6A 4FICA 3UP7A 4LGDA 1G8SA 4GT5A 2OFUA 4YHFA 4RFYA 2R5TA 4D0WA 4UYAA 3EQRA 3IG7A 2F49A 3VJOA 4IM0A 3O8TA 2WTCA 2YEXA 3BV3A 4W4VA 5EM7A 1H01A 5KMIA 1UNGA 1SVEA 3TZ8A 5KMJA 1IR3A 3AD6A 4AXFA 2HZIA 2R3NA 3KMUA 1M7NA 4UZDA 2WTKB 3FLNC 3G6GA 4XBRA 5E8UA 3VUHA 4ZLZA 4GVJA 4FL1A 4NCTA 3ELJA 3K5UA 4G16A 1UWHA 4UMPA 1XHAA 2JFLA 2REIA 4ALVA 4WG4A 4ZSLA 3GU8A 4YJTA 3VBWA 3C9WA 4I24A 3AGLA 3MSSA 4S32A 5HD7A 3PIZA 3GCQA 4J1RA 5LARA 3WBLA 3TUCA 4XG9A 5BYZA 5FBOA 2VTTA 2EB2A 3FZ1A 3WF9A 5GIOE 5JK3A 5KMMA 4M69A 4AAYA 2OFVA 4ZTSA 3KMWA 2C0IA 4QYHA 1JQHA 3PJ8A 2XCKA 4DGLC 3NFFB 1XH6A 4PNIA 4GFGA 4OT5A 4XUFA 4Y5QA 4QEBA 4UWBA 3ZLWA 3TNPC 3TCPA 5KBQA 4Y83A 3W18A 3BL9A 1MRUA 3V8SA 3DQWA 4MXZA 3U55A 2RFDA 1L8TA 4G9RA 4MWHA 5EI6A 2WXVA 3NSZA 1OGYA 3BU6A 4FL3A 3THBA 2CGUA 3G0EA 3NFGB 2XVDA 1Q8WA 3PIYA 4Q2AA 2XBAA 5AUYA 1JOWB 2UZBA 3RALA 4C37A 5IQDA 2PZRA 4MAOA 2CKQA 3G0FA 1SNXA 5AEPA 2PE0A 3COHA 4FF8A 3LOKA 3DBDA 4KIPA 2Z60A 5ANGA 3F2NA 3QC9A 2G2FA 4L43A 1SYKA 5EQEA 2CJMA 3ZSIA 1WBVA 2YM6A 2UZEA 3QTRA 2P2HA 5CSVA 3VF8A 4IE9A 4BDKA 3RM7A 2GNLA 2WTVA 3NS9A 4IX3A 3VS5A 4NM0A 5FEEA 4PNKA 2W1CA 3GCVA 5M4CA 3Q9XA 2BAJA 1WBOA 2YJSA 3HV6A 1U46A 3C13A 5DR6A 3VBXA 5DOSA 2C5XA 4LFIA 2J2IB 3CEKA 4OBOA 2JIUA 4YZMA 4FA2A 5IU2A 5M56A 2CN5A 3OWKA 4IMYA 4JDIA 2HENA 3EFKA 4M97A 1WVXA 3CXWA 4RA5A 1IASA 2IVTA 3DAJA 3N51A 3PY3A 3QWKA 2PZYA 4MD8E 5HG8A 4HPUE 1JAMA 4NWMA 4BDFA 1O9UA 3R8VA 3A8WA 3C5UA 4E5AX 1IG1A 2ZDTA 2X2KA 1MQBA 4EOMA 3SW7A 5LVMA 3IO7A 4BYIA 4F64A 4M14A 4WG3A 5AUZA 1Q4LA 3EH9A 3GGFA 3JPVA 4UMTA 5FWKK 5BX0A 4OAVB 3OW3A 2WGJA 1L3RE 1R0PA 4IB0A 4BYJA 3NNWA 2WMTA 4GVAA 2OJJA 3QXPA 3OWJA 3IK3A 4NZWB 2WQOA 3ENMA 4YPSA 5IQEA 3ZC6A 3SVVA 2X1NA 1K2PA 1Y57A 4JS8A 5BUJA 3ZUVA 5ETIA 3VS4A 3D14A 3R63A 3LCKA 2JKOA 5DG5A 5I9UA 5ANKA 3COKA 3H30A 1HCKA 4BCKA 5FP6A 5F4NA 4A9UA 1VEBA 4XLIA 4KINA 3BE9A 4N6YA 4DITA 2A2AA 2WU6A 4KS7A 4ZSJA 4L3LA 3MS9A 5HLPA 4RLKA 4C4EA 3K54A 2FH9A 2R3JA 2C5OA 5GHVA 1M2PA 1GZ8A 3UYTA 5AP4A 2JDRA 4L3JA 3WOWA 5CAUA 4KABA 4DGGA 2E9NA 2VTIA 4F4PA 3OTVA 5ANIA 4ASZA 4KIKA 2YERA 4M12A 2P4IA 2XNPA 4M3QA 3EN5A 3ITZA 3ORNA 5D9HA 2CCHA 3WZJA 4AT3A 4BZNA 3R8LA 1FMOE 2PMLX 3MESA 3ZBFA 4F65A 3FMMA 4KD1A 4E4LA 4LYNA 2LAVA 1UNLA 4GSBA 3DXPA 4BF2A 2RF9A 4FIGA 3NGAA 3MTFA 2WMUA 2XK4A 4KWPA 3I79A 4IZAA 3FSFA 4NW5A 4WNKA 2UW5A 2IVUA 3DLSA 5HO8A 3KEXA 4BDHA 4FIJA 4FSTA 2UZDA 3PJ3A 4DT9A 1W2DA 5BPYA 3D9VA 3KFAA 4I5CA 4M13A 3P5KA 4QMSA 3LMIA 2AUHA 2WTKC 2BR1A 4WNMA 4JBPA 5G1XA 1K9AA 4AQKA 3F2AA 5K5NA 1H00A 2PL0A 3LM0A 4X2JA 1WBPA 2PVRA 3I6WA 4OTWA 4ERWA 5EG3A 5EKNA 2OJGA 1G8JA 5IEXA 4B6LA 3OD6X 3CQEA 3RPOA 4ZTMA 3VBTA 3TZMA 1PF8A 3FYJX 4XP3A 2UUEA 3TIZA 1URWA 3QUPA 4WNPA 3W8QA 5KMKA 3UZTA 1G8AA 4DT8A 3O5AA 1RJBA 3LM5A 2G2HA 2Y6MA 3MDYA 3ODZX 2A0CX 1GIIA 4UYNA 3T3UA 2W5BA 3L9MA 4WA9A 4DE4A 3RTPA 2CLQA 4FNWA 1TQMA 4QYGA 5CVHA 4WO5A 4AGCA 3HGKA 3DCVA 4ANLA 5D12A 5IA2A 4M7IA 2J90A 4TYJA 3MVLA 3O71A 4YNEA 5CAPA 3R1NA 2CMWA 4G17A 3DAKA 1XH9A 4O0VA 3UIXA 3CD3A 2OU7A 3H0YA 1NVSA 3QKKA 4AN9A 4BDIA 1JNKA 4V0GA 5J87A 4QTDA 3IECA 4RIWA 4Z9LA 3NVKI 2GDOA 1H24A 4GJ2A 5EM6A 2BRBA 3DV3A 1URCA 3WF7A 3E63A 3O17A 3PPZA 3FMKA 1B6CB 3BI6A 3FXXA 4ZSEA 2A4LA 3BPRA 3BHTA 2R4BA 3FAAA 3K3JA 4R3RA 3SXRA 4Q5HA 2DS1A 1I44A 3C4WA 1H4LA 4ONAA 2UW7A 3KGAA 4DHFA 4JI9A 4NSTA 4UZHA 1SM2A 3BGQA 3U9CA 4EEVA 3KREA 3IOPA 3NYVA 3RAHA 2QD9A 4NIFA 4EC8A 2G01A 4YUQA 5HO7A 2R3PA 1PXNA 2CGWA 2UZNA 2VTAA 2J7TA 4QMTA 4R77A 4OR5A 4NW6A 3IGGA 3RK9A 3LFSA 3QCXA 4OTRA 4EOSA 4GT4A 5BVOA 1W83A 5M44A 3RM6A 3A7FA 3EQIA 3FXWA 4QMLA 4EH5A 2B0QA 1TQPA 3OUNB 5L6WL 4CSVA 3LIJA 5I0BA 3GU4A 1IAJA 2IG7A 5IQIA 4DA5A 4IAYA 3FC2A 4HCTA 4JOAA 5HX8A 3DTCA 5CEQA 3PZEA 4RZWA 5L2IA 2XANA 5E9EA 3A2CA 2YIWA 4PF4A 1OGUA 4TTHB 3KXGA 1FQ1B 2QOQA 3OVVA 4FT0A 4IWPA 4XV1A 4CNHA 4E5WA 3R21A 4OTGA 2PUPA 2X2MA 3BYMA 4KNBA 1XQZA 1CKPA 5JEBA 4FNYA 4A9YA 4G6LA 4OTIA 2F9GA 3BRBA 3WZKA 4TWOA 5B2KA 3ZONA 3U51A 3WYYA 4FIIA 4UX9A 3OG7A 4FMQA 1PXOA 3BHHA 4QPSA 4JG7A 4O81A 3TTIA 1Q62A 4YO4A 1U4DA 4G9CA 4ANSA 1CDKA 2WKMA 2W0JA 1LEZA 3E92A 4PTGA 4WNOA 4C2VA 5IQAA 2GNGA 2W99B 3KC3A 5ANOA 3PRIA 2VU3A 5LXMA 3UJGA 4NKSA 3L9NA 4FSWA 3ZLXA 5BMMA 2QI8A 5HZNA 4RVMA 4CZUA 3EFJA 5CLPA 4O7YA 3L8XA 2R7IA 2XRWA 1BI7A 3LFNA 3EN6A 4FTNA 3LE6A 3HUBA 4F1MA 2XUUA 4QP6A 2J9MA 5EI2A 4E6QA 4EH8A 3HDMA 4HYIA 2GS7A 3ZDIA 3GBZA 4O4DA 5KKRC 1GAGA 3FY0A 2X4FA 2DYLA 5GZ8A 2W9ZB 1SNUA 3BKBA 3PYYA 4C36A 3DOGA 2NP8A 3RAWA 4D58A 3LCSA 4M15A 2C3JA 2XM8A 1R3CA 2ZYBA 4GV1A 4XG8A 2YIQA 4YZBA 4D5HA 3ROCA 3D5UA 5L4QA 5DI1A 3EJ1A 2UZOA 4NH1A 3R9NA 1YHWA 2R0IA 2Z8CA 5A4CA 4DBNA 3OF0A 2BZIB 1FGIA 3ERKA 4FKQA 4JRVA 5HE1A 4YTIA 4WHZA 5IQHA 5CT0A 1H08A 2E9OA 1J7LA 2C3LA 2JKQA 4IM3A 4KS8A 3V6SA 3DJ7A 3JYAA 3VUIA 3HLLA 5KBRA 5FDXA 3P1AA 1PW2A 4WBOA 4A4LA 3GC0A 3SW4A 3A60A 4EOJA 2B7AA 3DKFA 4JT3A 4N4SA 5CI6A 3OBJA 3MFSA 2BFYA 4AW5A 4BCPA 2W4JA 3NUNA 4TWCA 3QF9A 3TV7A 4EHVA 2JC6A 3QQJA 3QRKA 3VBQA 2P33A 3E87A 3V01A 3LFCA 2QU5A 3RK5A 3QAME 2W9FB 3PVUA 3QA0A 4RIXA 5E8XA 3RI1A 3W2SA 3F2RA 3QFVA 3R04A 5HVKA 2WOUA 5I9WA 4QMQA 5ACKA 2NNWB 4U3YA 4YLKA 5EOBA 3PG3A 3TTJA 3KRWA 4DBXA 2WQMA 4HVDA 4G5JA 3RZBA 1Y8GA 5JZNA 4MQ2A 5IUGA 1G3NA 3BV2A 4J52A 3F88A 3FV8A 3SV0A 2GSFA 2XMYA 3AKLA 3W0QA 2ZM1A 4CLIA 4EK3A 3CQWA 1SMHA 2XK7A 4NFNA 5HE2A 5M4UA 4X3FB 3RCDA 1ZYCA 3S95A 3QWJA 1QPCA 5CSPA 3QHWA 2HWPA 4H1MA 2Z7RA 2C6MA 3EL8A 4FC0A 4LRJA 4ACMA 3PG1A 4BDJA 5BVNA 2ITWA 5K9IA 1A06A 4KRCA 2CGVA 3VRZA 4JG6A 1YXXA 4RPVA 3FI4A 4PL5A 4RX5A 2Z2WA 2CKEA 3WZEA 3F69A 4YTCA 3H10A 2SRCA 2QR7A 3ORPA 3BYUA 5M4IA 5FRIA 4LV8A 3CQUA 4HGEA 3POZA 4EBWA 3TUDA 3AMYA 5AWMA 5C03A 4E1ZA 3QKLA 4CYJA 1OMWA 4E20A 4B8MA 3FHRA 1Q24A 4CLJA 4BIBA 1ND4A 2Q0NA 4JAJA 4H58A 1NA7A 4CTBA 1YQJA 2W5HA 5CAVA 3TNWA 4FBXA 3BWJA 4RIOA 4C2WA 4FZ7A 2F2CB 2XH5A 3MH0A 4RIYB 2IF8A 3AT4A 4MX9A 2QKWB 4EOIA 1ST0A 4RWJA 4G34A 4ALUA 2HELA 2YN8A 5A6NA 2VWUA 2XNEA 3FKOA 1WVWA 2BILB 4NM5A 5AX9A 4FV9A 4BGHA 5D10A 3ZLSA 5HCXA 4JMQA 3DBQA 1E9HA 4KSPA 3JR1A 3P23A 5K0KA 5ANDA 2XJ1A 3PXKA 3VUKA 3CY3A 3OY1A 3W2QA 4BCGA 4AAAA 5BQ0A 2UV2A 2PVJA 3NNUA 2BRMA 4FKLA 4HNIA 3BELA 4K2RA 4AACA 2XALA 3RGFA 1AQ1A 2OG8A 4EH7A 5KHXA 3EHAA 2C3KA 3LAUA 5CU3A 5D41A 2CPKE 5H3QA 2YLEA 4BB4A 5CF8A 4FKWA 3GUBA 4MHAA 2UW9A 3FZTA 3GQIA 5AP1A 5AP7A 3R7UA 3ZFMA 3W0OA 3W33A 1WCCA 5BMSA 4YJSA 4AUAA 5IMEA 2ZFYA 2F7ZE 4BCJA 1JLUE 4IX4A 5C4KA 2RFNA 1UU8A 4QD6A 1ZYDA 5L2TA 1YWRA 2FB8A 4D28A 5L2WA 4F1TA 2FYSA 2JAMA 3V5WA 4AA0A 3AMAA 4O7LA 5LMBA 4IFGA 3R0TA 3A8XA 3ZS5A 2I1MA 3MV5A 3OFMA 2FSLX 1FPUA 2JFMA 2IPXA 4EWQA 4CRSA 4A9TA 3NVMB 3PDTA 4L01A 2RIOA 4Q9SA 4UY9A 3ZSHA 4C7TA 4FTRA 2IVSA 2W4OA 4GS6A 4AOTA 3I81A 3ORKA 2QOBA 2FSOX 2XIRA 3QKMA 4TWNA 1R0EA 2G15A 3AG9A 5AUTA 5JRQA 4CQEA 2W5AA 1Q8ZA 4UBAA 3UIBA 3H9OA 3MIYA 2YM7A 3KCKA 2C4GA 1H1RA 4BDAA 4CEGA 2H6DA 4J71A 5A4LA 2WMWA 4I23A 5IPJA 4Y5HA 2YFXA 3PJ1A 2QC6A 4IAAA 4YURA 2GCDA 2WOTA 4W4WA 3NX8A 2VO7A 4PDPA 1XKKA 4XMOA 3BLAA 1W98A 1GY3A 4ZTRA 4DEEA 4ZY5A 2R3IA 3EFWA 2O5KA 4Y8DA 1KE8A 1ZXEA 2IZRA 2VWZA 3TV6A 5CQUA 3FMNA 5GJDA 1TZDA 4A7CA 4LMNA 3C4XA 4YHJA 4APCA 3HMIA 4KKEA 4E4NA 3LMGA 3TKHA 1XH8A 5CF5A 4Z3VA 3KF4A 3C7QA 3S0OA 1PJKA 3V8TA 1KE6A 4ZTNA 4AXDA 2W06A 3LCTA 2RGPA 4JX3A 4AGWA 3W10A 4HW7A 3D83A 4CVAA 4HNFA 2A98A 1O6LA 3FPQA 4BCNA 4FV3A 2H34A 1H25A 4QMMA 2DQ7X 2IW9A 3SRVB 2W7XA 5L8KA 4E8AA 3NDMA 3RINA 2XP2A 3VBVA 3BEGA 4XRLA 5FLFA 3ZRMA 3PXYA 4FGRA 4O7NA 2QOKA 5EYKA 4AS0A 1FMKA 2C6EA 1WMKA 2WMVA 4GIHA 4YPDA 3QZIA 4UV0A 3VQHA 3Q2JA 4C58A 4C3RA 1PMVA 4O2PA