3NDMA

Crystal structure of rho-associated protein kinase (rock1) with a potent isoquinolone derivative
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
398
structure length
383
Chain Sequence
MSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEEETFPIPKAFVGNQLPFVGFTYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Rho-Associated Protein Kinase (ROCK1)
publication title Substituted 2H-isoquinolin-1-ones as potent Rho-kinase inhibitors: part 3, aryl substituted pyrrolidines.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 383
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ndmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ndmA01
2XJ1A 4C34A 2YM6A 2BKZA 2J9MA 1ZY5A 2QOIA 4JT3A 3U6IA 1PXOA 2WIHA 4EUUA 4RG0A 4DC2A 2XP2A 2NNWB 1Z5MA 5HI2A 1O6LA 2UVZA 3PY3A 4Z3VA 2HWOA 1OZ1A 4RWLA 3UOKA 5IH4A 2BIYA 1GJOA 4J96A 3V51A 1ND4A 3VBTA 3K5UA 4J99A 2B0QA 4YJSA 2O65A 5CNNA 3TZ8A 4QMOA 3HMMA 3TNIA 4JBOA 4EJNA 4AG8A 2O64A 1IASA 1G8AA 4HVIA 4H58A 5E1SA 4I0SA 3UZRA 2WMVA 5CT7A 4J52A 3P4KA 3TJCA 3Q04A 4CCUA 5CAQA 4EKLA 3ORLA 4ZJVA 2BFYA 4AA5A 4H05A 2Q0NA 4YJVA 2OU7A 2XK6A 4HZSA 2JKQA 4S32A 3RHKA 3G2FA 4D1XA 4EZ7A 2XNBA 3NR9A 1Z57A 2OXYA 3CQUA 5HTBA 5A4TA 3ACKA 3F3VA 3HRFA 3E8NA 3MA6A 3RK5A 5JRSA 5AAEA 4G5PA 2IWIA 2ACXA 2ZMDA 3R8PA 4FKVA 4DFLA 4IZYA 3VRZA 2EXCX 4JDIA 2WIPA 3G0FA 5HD7A 4BN1A 4JAJA 5FEQA 3DFCB 3DKCA 4UMQA 4C4JA 4L9IA 3IONA 2VTIA 3RGFA 3PXQA 5DPVA 1SMHA 1NXKA 4BDJA 4GK4A 2QCSA 4C4IA 5EM5A 3VUKA 3VJOA 4QTBA 3OCGA 1P5EA 3AC2A 3MH2A 3OC1A 4AQCA 4D58A 4IE9A 2QC6A 2W1CA 5IA4A 4IAFA 4AGCA 1MRUA 4L67A 4BWPA 2Q83A 3ULZA 1KE5A 4RSSA 3GXLA 4XLVA 5FXQA 4CT2A 4LI5A 4Y73A 2VX1A 4FYNA 3HUCA 2WQMA 2Y7JA 3SDJA 4K11A 5IA5A 3CY2A 2BRHA 5M56A 5CI7A 1Q3WA 3LJ1A 1JSTA 2UZNA 4J53A 2UW8A 2VNWA 2C6MA 1JBPE 2W1HA 3LFAA 5E7RA 3ZDUA 4MD8E 3LKMA 4AOTA 4AX8A 2JKOA 1DI9A 1OGUA 2CCHA 2VTSA 4QNYA 4E8AA 4C7TA 2O8YA 4NWMA 4EHEA 4FZFB 3D5VA 4PY1A 1EH4A 2W9ZB 5EI8A 4EWHA 3EQDA 3H9RA 3R83A 3OMVA 3U9NA 4D2VA 1KE8A 1M2RA 4HVDA 3TUDA 2OH0E 4JAIA 1UU9A 4HGTA 1SYKA 4LOPA 1IAHA 2H34A 5FRIA 3PRFA 2OF2A 3U51A 3G15A 1YRPA 3KCKA 4IAZA 4AZTA 5CVGA 3MESA 1J91A 3FE3A 4F65A 2G2IA 5KHXA 3HX4A 5ANJA 3WZUA 5B7VA 4CKIA 3VUHA 5L4QA 1URWA 5JGBA 3ZLWA 4G2FA 4EK3A 5HO8A 2F2CB 4I6BA 3SOAA 3FL5A 4XEYA 5EYMA 3R6XA 2W1GA 2EU9A 4OAUC 3OTVA 4QTEA 3RVGA 4BDKA 3Q5ZA 4GH2A 4TWNA 5CZIA 2BDJA 2RF9A 2JFLA 2VTPA 5ACKA 4EQMA 5KCVA 4BZOA 2QOQA 4JDJA 2PUPA 4GT3A 5AP0A 3CPBA 4LM5A 4X6QC 3LXNA 4FGBA 1WBWA 3VS3A 4FTNA 3LVPA 3GT8A 3EQFA 3KXZA 4NL0A 1JQHA 3EN6A 1H24A 1TQIA 2XK8A 3PIZA 4L3JA 3O2MA 4NM0A 5AV0A 2WTWA 4YC3A 3C4ZA 4I23A 5L8JA 5AP7A 4ITHA 4G6NA 2ESMA 1ZYJA 3SX9A 4O0RA 3ZLYA 5CF6A 3F5XA 3VJNA 4WBOA 4QMMA 2HY0A 4PPCA 5KE0A 3V5JA 2VRXA 3QTSA 1WZYA 3QA0A 4O0WA 1JPAA 4QO9A 4FKSA 4IX3A 4DFXE 4F7NA 3QZGA 3RNYA 4FEXA 3AOXA 1M14A 2WTKB 3KMWA 2QI8A 3Q4CA 2Z60A 4HCVA 4XJ0A 3R9HA 4BGGA 1YI4A 2X7FA 1HOWA 1GAGA 3FXXA 1V0PA 3QQLA 2W0JA 4TYIA 4S33A 4GW8A 3QFVA 4FTQA 3WIKA 1H25A 4ENXA 3R7VA 4D2RA 5BPYA 3MI9A 2XK7A 5HE1A 3E3BX 4ZSEA 1H28A 3IS5A 3REPA 3KXNA 4CZUA 3KFAA 3DOGA 3G9LX 3R7YA 3QZIA 3W18A 5HCXA 3E64A 4BGQA 4USFA 4H3PA 4QRCA 3MFSA 2P0CA 4B0GA 5M07A 3QTZA 3ZUVA 1FMOE 1OIQA 4MTAA 2C30A 4FVPA 3THBA 1UV5A 4AGUA 3BU3A 3CEKA 4M0YA 1FINA 2OJIA 2XKFA 3R9NA 4CV8A 5AMNA 4AZSA 4AW1A 4BKYA 2PSQA 2UUEA 3FWQA 2VWWA 4A9SA 3EFLA 2JDTA 1H1PA 1XH8A 4CFXA 1NVSA 3S1HA 2VWBA 2X2KA 5B2KA 5HX8A 3R21A 4XOYA 2RIOA 4D9UA 3DQXA 3UODA 2JD5A 5LXMA 4R3PA 4IX6A 5AX9A 3ROCA 3T9TA 4CRLA 1P4FA 3I60A 3BBWA 3H10A 4FKWA 5CY3A 4E26A 3UGCA 1XJDA 3ZO2A 4EK8A 2QOCA 3KU2A 3F3ZA 5J8IA 4QMQA 3UP7A 4AA0A 1OKVA 4QMPA 3CSVA 1ZYCA 3R1YA 2HZ4A 3LCKA 4C33A 3UOJA 4ERWA 3QTUA 5CU4A 3BLQA 3NW6A 4JBQA 5I3RA 2GQGA 4L6QA 4NK9A 4X7QA 4KNBA 1OL7A 4D1ZA 4C4FA 5AP4A 2QO7A 3WE8A 2YIWA 3QTRA 2GCDA 4D55A 4F6SA 1BUHA 4E6CA 5DH3A 3AGMA 4O84A 4RIWA 2IZSA 3AMYA 3TEIA 4QOXA 2W7XA 4BCHA 2BZIB 3PY1A 2PZ5A 3OY3A 4TYGA 2CGXA 4JLCA 3SLSA 4OW8A 5JH6A 1SNUA 1YOJA 2GPHA 4O2ZA 4FV1A 4FNYA 4FA2A 3F61A 3VS7A 4XG4A 3ZZWA 3FLWA 3DXPA 2IVUA 4PTGA 4MCVA 1SVGA 4EOLA 4U8ZA 3FXWA 4KBAA 5AP2A 1UNLA 1W7HA 3LCOA 3PPZA 4WNOA 2IVSA 3DJ6A 2ZV8A 1R3CA 3DK6A 4QMNA 1CKIA 4FR4A 4MBIA 4K0YA 2X9EA 1YOMA 4BC6A 4YURA 2JAVA 3C4WA 3FV8A 3ORKA 4IACA 4Y83A 4BDBA 4GK3A 4C02A 4F1OA 3PZEA 2PWLA 1NY3A 1CSNA 2WOUA 3RKBA 2X39A 2V22A 3VUDA 5B0XA 3I7BA 4IVDA 5IQCA 4BB4A 3ZFYA 4QPAA 2O3PA 2H96A 2J0KA 2WU7A 4XV9A 1KUTA 4RWKA 4Q9SA 4EZ3A 5H8EA 2VTTA 4R7BA 3QTWA 3A8XA 2J5EA 4KS7A 2EXMA 4FX3A 4ZTRA 2YCSA 1OM1A 5HOAA 1ZARA 4E5AX 4NJDA 5HG7A 3SXRA 3CTHA 4WKQA 4IVAA 3KRXA 2VWZA 4FL3A 2EWAA 3OCBA 5CAVA 4FV6A 4M8TA 2VO0A 4IWQA 3RJCA 4WIHA 3PG3A 5L8KA 4RIXA 2R3HA 3BEGA 4D4RA 4DINA 2J50A 4I6HA 5TKDA 2QOLA 2XYNA 1Y8YA 2C1BA 3BPRA 3S95A 2VZ6A 4DGOA 3NCGA 4I21A 4YSMA 4E6DA 1JSUA 1MP8A 4EONA 2XIZA 2QKWB 1GIJA 2G9XA 3MBLA 2CGVA 5M44A 2BVAA 1ZLTA 2CN5A 4C0TA 3O7LB 4IHPA 3QXOA 3SOCA 1Q62A 2JDOA 4BCFA 4RT7A 3DGKA 4AT4A 3L8PA 5J95A 4WNPA 5FWKK 4L00A 3VF8A 4HYIA 4MVFA 3R9OA 4GVAA 4OGRA 1R0PA 4F9YA 5KMNA 4GYGA 2G15A 5DRDA 4RZVA 1YXUA 3CBLA 3LFDA 1JWHA 2JITA 3VULA 3GNIB 4M84A 4AE6A 3PUPA 5HNBA 5HBEA 1S9IA 3I5NA 4KBKA 5DFPA 2KULA 3O7LD 4LRKA 4KABA 3IGGA 3VS1A 3ZO4A 2C69A 4RVLA 2PTKA 2X8DA 2C3KA 2ITZA 2OIBA 2WNTA 3E88A 3GCVA 3LJ0A 4X21A 3SXFA 3VW6A 3L8XA 3QCYA 4OTRA 3V04A 5F9EA 2WMRA 3UOLA 3C4CA 3Q9WA 3MGYA 2W17A 3CE3A 4FKIA 4G5JA 4NTTA 4XP3A 4KSPA 2H8HA 4JR7A 3FLZA 3I5ZA 2J51A 3GQLA 2V7AA 5FP5A 3UQGA 3FMKA 3ORMA 4P7EA 4A4XA 4EQCA 2Z7RA 3HMIA 1SNXA 3MFTA 3EN7A 3KN5A 5EW3A 3UYTA 3TWJA 3C4XA 2X9FA 4MQ1A 4O96A 1PXIA 4YP8A 3W10A 3ZSIA 4USDA 3GUBA 3UZPA 2J90A 2R3RA 1WBVA 4CV9A 1X8BA 3QA8A 5JFWA 3U87A 3WZJA 4GUBA 4PWNA 2PMLX 2OJJA 4RC3A 4F09A 3BQCA 2PVYA 3DAEA 3NX8A 2PMOX 2XIYA 1YDTE 2EB2A 4XNEA 3S2PA 5EDRA 4R77A 4RVMA 5J1WA 3FQHA 3W33A 2XMYA 4C35A 3HRBA 2VX0A 3G9NA 4BDIA 2QU6A 1V0BA 4ONAA 4RJ3A 3PZHA 4CFVA 3F2RA 3F88A 1REKA 2CLXA 1WBTA 2R7BA 3HLLA 3Q6WA 5IPJA 2OJGA 5E1EA 4C3RA 4C2VA 1ERKA 4QQ5A 4RJ5A 2P33A 4ID7A 4JI9A 4JBPA 4JG7A 4O27B 3BLHA 3T8OA 3UC4A 2GMXA 4WO5A 3OOMA 4XMOA 4UWBA 4N6ZA 4L45A 1CKJA 4ACMA 1J1BA 4M66A 4TWPA 3S4QA 4MF1A 3R7IA 4DT8A 2BDFA 4YPDA 2FSLX 4NEUA 5CEIA 1AGWA 1XBAA 2CN8A 1WBOA 2UZEA 3FMNA 3HNGA 5CEPA 2R3JA 1A06A 4IM0A 4CYIA 2FUMA 2BCJA 3BRBA 3IK3A 1FGIA 5L8LA 3OTUA 5EHYA 3HECA 5D9HA 5CF5A 4YMJA 2W4KA 5FXRA 5LCJA 3F6XA 4H3BA 3ZRLA 3MVLA 3NNWA 3TNPC 2JIUA 1KSWA 3PPJA 4FG7A 3GP0A 4I22A 4ZK5A 2E9VA 4RX8A 1MQBA 1YQJA 1ZOEA 3GU6A 4OR5A 4YTIA 3PJ1A 3T3UA 4UMRA 5DLSA 4XV3A 4CTCA 1AD5A 4NCTC 4UB7A 3AD6A 3NYOA 3O71A 3R22A 3BV2A 3I6UA 5DMZA 2Y0AA 1KE9A 5EHLA 5TR6A 4DH1A 2VWIA 1U4DA 3PG1A 4DCEA 4PDYA 1WVWA 2PVKA 3UBDA 3QD3A 3LMIA 5HCZA 4GK2A 1XBCA 4U97A 2I0HA 3PYYA 3LXPA 2HXQA 4FICA 4ZIMA 5AX3A 4RX5A 3FC2A 4F0GA 4YJUA 5A4LA 2PZYA 2OW3A 3H0ZA 3B2WA 2XB7A 3COMA 4BVUA 1W98A 5IEYA 3FI8A 5EQYA 2CSNA 3BWJA 1REJA 2Y6MA 1DAWA 1R1WA 3R04A 4YZ9A 5DVRA 4RA5A 3PP0A 4Y95A 5GZ8A 2I0VA 3O96A 3OHTA 3ZTXA 4EWQA 1YWRA 5TE0A 1ZYSA 2AYPA 3DQWA 3ZH8A 3CGFA 4ITIA 4F70A 4D4YA 4RC2A 3NSZA 2BROA 4JOAA 4U42A 3VUGA 4JL9A 5E4HA 3EKNA 4EUTA 2FH9A 3FYJX 4LQMA 5HG5A 2RFEA 5AUVA 3VBYA 2GNGA 3HVCA 4KAOA 4QTDA 1I44A 2WHBA 3C1XA 5K0XA 5CYIA 4BFMA 1VZOA 4KBCA 3QZFA 2QLQA 3FKOA 4IW0A 4FKPA 4RVTA 5EW8A 5K5NA 2ZDTA 2WEIA 1FQ1B 3FJQE 2ZM1A 3BIZA 3QD0A 2V5QA 3D5XA 4QPMA 1GNGA 2X1NA 4BI1A 4AS0A 3EB0A 3HA8A 4BL1A 5ETCA 1U5RA 4ZY6A 2UZLA 3TKIA 2QONA 2GDOA 4FV2A 2UZDA 1O6YA 2W1FA 4F9CA 3TNWA 3MH3A 5HORA 1VJYA 4JX7A 2W1DA 2PUUA 4R6VA 3ZUTA 3D7TA 4I4FA 3ZO3A 5JGDA 4NKAA 3UE4A 4XS2A 5CSXA 4BCQA 3QQHA 5EDPA 2RG6A 3LQ5A 4FIEA 4KIQA 1G8SA 4C57A 4GCJA 3VS6A 4X3JA 4OTWA 4I0RA 4JS8A 4X0MA 1OL1A 5E8SA 1IA8A 1Q61A 4W4VA 2YEXA 3MPMA 3R7UA 4OUCA 2R3NA 2C0OA 4PPBA 4DFYA 3QWKA 2JLDA 4RJ8A 2QOHA 3VBQA 3WILA 2RL5A 3LZBA 2YCQA 3F3WA 4QNAA 4U44A 4X2GA 2O0UA 4WG5A 4O7YA 5C9CA 4BCMA 5HTIA 3Q9YA 4MK0A 5JZNA 3SG8A 5D12A 3UO6A 2XM8A 4YC8A 2Z7SA 5C1QB 3DTWA 4FEUA 4DE4A 3K54A 4JQEA 3C5IA 5K4JA 3RK7A 3QKLA 3R8UA 2QO9A 4V0GA 4X6RA 4EBVA 3ORIA 4Y85A 3OROA 4BTKA 1UU7A 4NUSA 2W4JA 1NA7A 3ATSA 2V55A 1KOBA 3G0EA 4IB5A 2BALA 5CLPA 5AR5A 3EYHA 3KREA 2BTSA 5JQ5A 3O51A 4GU9A 4EC9A 2WKMA 3G5DA 5IMEA 3OW4A 4BCJA 2A19B 2JDVA 2JIVA 1QMZA 3D9VA 5TO8A 4L43A 4RJ4A 5CEMA 3L8VA 5KMJA 1AQ1A 1PKGA 2VD5A 5E8VA 3MJ1A 5HEZA 2XIKA 4DFZE 2ZV7A 5FLFA 4QMWA 5DRBA 3LQ8A 3E8EA 5DOSA 5DYJA 3D14A 4DLIA 3NYXA 4RIOA 3NIZA 5C03A 5HGIA 2IVVA 5KMLA 4X2KA 4HVSA 3LCSA 4WT6A 3W2QA 3I6WA 4XLIA 3RAWA 4O7NA 2C6DA 3RM6A 2OBJA 3CPCA 5HX6A 4ANMA 5HO6A 3DBFA 3EIDA 2FSMX 2ITVA 4A4OA 4X2NA 4FTMA 2XK9A 5EOLA 4ANSA 4J7BA 4ZSJA 5GIPE 3ULIA 3MSSA 3AD4A 2X8IA 2XNPA 3OS3A 1Q24A 5IUHA 4XG6A 4D4SA 3PWYA 5FG8A 5CEKA 3QQKA 2I7QA 1E9HA 4P5ZA 4L42A 4F1MA 4AGWA 4NH1A 4UMTA 3E8DA 2GS6A 3MPAA 3Q4TA 4C4EA 3BKBA 3Q2JA 3JXWA 3NDMA 3PJ3A 5BYYA 3ACJA 1SM2A 4PL5A 1FOTA 2X8EA 3KMMA 3LAUA 4I6QA 2IJMA 5L6PA 4DHFA 2DQ7X 3AMAA 5L2TA 2R9SA 2OZAA 1J1CA 3BGQA 4ZJJA 4NYEA 3DDQA 4FKQA 3RZFA 3VBWA 5CXZA 3ZHPC 4PMPA 2UW7A 3IW6A 3PA3A 4KRDA 5J9ZA 2BUJA 2HWPA 3FZTA 4FV5A 4GMYA 3PJCA 5M09A 5EQPA 3BGZA 4ZEGA 5A3XA 2FA2A 2C5YA 1OPJA 5CU2A 3F2NA 2R0UA 4DBNA 1A9UA 5HD4A 3P7AA 2VO7A 3LFCA 4FSZA 5FTOA 2J0JA 4O0YA 4QMYA 2R4BA 3IQ7A 4ZTHA 4ZMFA 3R9RA 4YJPA 4OTIA 3PVGA 4BWXA 2YDIA 4A07A 2PVRA 2A1AB 3AC4A 4HYSA 3E5AA 2G2HA 3AQVA 4Q5HA 4DEDA 4PTEA 4EK5A 2FSTX 3KRRA 2F2UA 4O0TA 3PDTA 4EK4A 3W2PA 5HE3A 3QQUA 2C6OA 4TN6A 1PF8A 5E92A 1GZOA 3U9CA 3PXRA 3QRTA 4N4SA 4FOCA 5CQUA 4GT4A 3RMFA 1B38A 4XG9A 1YHWA 5FTGA 2C5NA 1XH9A 4GUEA 4X2FA 2F4JA 4O7RA 4EH2A 3IW8A 4O21A 5DT3A 2NP8A 3Q5IA 3EOCA 4V04A 4IADA 4BGHA 3W1FA 5JSMA 1J7IA 4ACDA 4FT0A 1H01A 1OB3A 2LGCA 2WQOA 3PJ8A 4UXLA 1GIHA 3H9OA 3UNKA 3ZFXA 1IG1A 3FQEA 4J98A 4PUZA 2BZHB 4F9BA 3F82A 3MIAA 4C3FA 3DDPA 3UVPA 4A4LA 4G3DA 2E9OA 5KMMA 5LVMA 5I9XA 2OLCA 3DY7A 3P79A 4JXFA 3HDMA 5LARA 4FIHA 2RFNA 2W1EA 5KMKA 2P2HA 4RIWB 1YXSA 5BX0A 3FZPA 5GZAA 2VUWA 2ZV9A 3NUXA 2BAJA 4GFOA 5AUZA 2JIIA 5IEXA 4RA4A 2V62A 2X6EA 2QOBA 5AP3A 2PMIA 2PUIA 4V01A 5D10A 3Q9ZA 1O9UA 2ITXA 3TG1A 4ASXA 4TZRA 4DH8A 4G34A 3FKLA 4QP8A 4QMLA 4UZHA 3V8SA 2CJMA 2XS0A 3MVJA 3GBZA 1SZMA 4PX6A 2B4SB 2XNNA 3QU0A 2G2FA 2BRMA 1YXXA 3NZ0A 2GHMA 5HKMA 2B53A 2R3MA 1Y6AA 2QR7A 3EYGA 3BYSA 4DH3A 2WMUA 3HEGA 4NFNA 4YJQA 2JKKA 2C3IB 3CXWA 3RPVA 4AXAA 2DUVA 2YLFA 3GVUA 5HVJA 3ZRMA 2H6DA 2XK4A 2QVSE 4PMMA 3RPRA 3IO7A 3JR1A 3NLBA 4XG7A 4ZAUA 4ANLA 1IEPA 2UZVA 2WQBA 3P78A 3WIGA 4MXZA 3OD6X 2OH4A 3MB7A 4FSTA 4KB8A 1FVVA 4XCUA 3R8LA 2BPMA 4JJRA 4RIXB 3SRVA 3UC3A 4F64A 4UALA 3VVHA 5HVKA 3I0QA 2ITOA 2OFUA 2PHKA 4FUXA 4TYHA 3TDVA 3UG2A 1FVTA 4HNFA 4XX9A 2E9NA 3UO5A 2XYUA 1OIYA 3D5UA 3EJ1A 4N70A 1RDQE 3F7ZA 5A14A 3KQ7A 3RAIA 2YM3A 4DF3A 2OJFE 3E87A 2UV2A 3NW7A 5I0BA 2RSVA 3KF4A 3LIJA 3PVBA 4E73A 5KNJA 1BKXA 4D0XA 3CTJA 3E63A 1WVXA 3GCPA 4K8AA 4AZVA 3DKOA 3F5GA 4AFEA 3DKGA 5FP6A 5DR2A 5KMOA 3NUUA 3DLZA 1OL2A 5F20A 4CFWA 3R1NA 2JKMA 4PMSA 3FI2A 4HCUA 3IDPA 2E2BA 4NM7A 4U43A 4FKOA 2PVJA 2YIYA 3FSFA 4AZFA 5AV4A 2ITNA 3MFUA 1YHSA 2VGOA 1PXLA 5HE2A 3DNDA 2REIA 2UZUE 3HV5A 2C5OA 3ANQA 2FYSA 1H07A 3R7EA 5M08A 2R7IA 4TTHB 4GFMA 4A9UA 3QD2B 3GC8A 2Y6OA 3MN3A 3OCTA 3VC4A 4AZWA 3ENHA 5KMIA 5J1VA 2YM5A 3RAKA 3PXFA 4K18A 2BFXA 3UOHA 5K4IA 5IQDA 3AMBA 3FI4A 4LMNA 1XO2B 2YHVA 5DI1A 3RPYA 4F7LA 1KE7A 3RBWA 4Z7GA 4FNXA 3ODYX 3BWFA 2Z02A 3PFQA 3R8ZA 4HW7A 1H1QA 5HNGA 4HVGA 3G6HA 4IJ9A 4WNKA 5JEBA 3EN9A 4YZMA 2UZBA 4C59A 3F9NA 4ZJIA 5A4EA 4BWKA 4CLIA 4DLJA 2C6KA 5H8GA 5IH6A 4FSMA 3TJDA 4CFNA 5HU9A 1YVJA 3C51A 3W32A 5A46A 3AC5A 3DK7A 1GOLA 3HMNA 4R1VA 2C6EA 3C5UA 3NEWA 2PY3A 2HZNA 4JIKA 2JFMA 4KKHA 4HPTE 4O83A 4WA9A 3V5PA 3POZA 2X6DA 3SD0A 5L2QA 3V01A 4HYHA 3ALNA 3JUHA 1WBPA 4ZS0A 3KK8A 1ATPE 4O81A 4XH6A 4FTLA 2HZ0A 3VNTA 4GG5A 2XIXA 1BI8A 4OBQA 4YU2A 2HELA 2F7EE 3CY3A 3CQWA 4ANOA 4BZDA 2ITYA 3MV5A 3FEGA 4EOMA 1UU8A 2PL0A 3QQGA 4DFNA 5EQEA 5HBJA 3QRKA 3QUEA 1M7NA 3DAJA 2X4FA 3ANRA 4XP2A 5C8NA 2BRBA 2UW3A 5J5TA 2OK1A 3CC6A 3OBJA 3CJFA 2C5XA 2F7XE 2UZWE 4TRLA 4YLKA 3AC8A 2UZOA 1UVRA 5GJDA 3WF8A 4QP1A 4Q5EA 2OG8A 3EFJA 4LL5A 1OECA 3LMGA 4RJ6A 5L2SA 4DA5A 2HIWA 5DNRA 2P4IA 3BEAA 1OVEA 5I3OA 2CKOA 1U59A 1JAMA 2H9VA 2IO6A 4M69A 4FTIA 4P4CA 3EHAA 4P2KA 4QQJA 4A9RA 4EH4A 4EOSA 3GC7A 3ZC5A 1QL6A 4FBXA 4W4YA 4R7IA 4ZOGA 3WI6A 4WUAA 5L2IA 4C8BA 2PZIA 3FC1X 4CMUA 2FO0A 4EZ5A 3QZHA 3NWWA 4W8EA 3G90X 4CMTA 3GOKA 3KULA 5HICA 4FV8A 5EYKA 3LQ3A 4DTAA 3LM0A 1W82A 3KY2A 5L6WL 2WB8A 1OKZA 4ZTSA 4BCKA 5CASA 4YTCA 1H26A 2PULA 5HG9A 3F5PA 4LFIA 3DXNA 4FEWA 4M3QA 4MXXA 2GTNA 3AT4A 4BYJA 2UW9A 2J5FA 5BUEA 2X2LA 2XCKA 5CU0A 2JGZA 3QRIA 4K1BA 2OIDA 4YHTA 4BCIA 4P5QA 3HV7A 1UNGA 2VO3A 3UG1A 4IWDA 1KWPA 4CTBA 2A27A 1OUKA 1PMEA 3PXKA 4D4VA 5IA3A 5IMXA 4TPTA 4BCGA 4UBAA 4WNMA 3WBLA 2EB3A 1OL5A 5KKRC 3MY0A 1J3HA 3TIYA 3OXIA 3QWJA 5EW9A 4HZRA 3N4UA 4EHVA 3UIBA 3O8UA 5HIEA 4CXAA 3FXZA 2W99B 5AIKA 1VYZA 1LR4A 3EFKA 3EQCA 3KA0A 3ET7A 4KIKA 5AV3A 3SGCA 4XHKB 4DEEA 5AUTA 1Q41A 3LFNA 4D1SA 2KTYA 3D15A 1BLXA 4Y46A 5EK7A 4ZY4A 3F3TA 4NTSA 2Z7QA 3UMWA 4O7VA 4Z55A 2P2IA 2W06A 2BZJA 3A2CA 4J71A 4ZZMA 4EOQA 4U45A 1BMKA 5TF9A 2VWVA 4PTCA 2F49A 3EQPA 4HYUA 4PDOA 4YO6A 4D2WA 1O6KA 5E91A 1TVOA 4YJRA 4PNKA 5BMSA 3NGAA 4ENYA 4MNFA 5IQBA 4MXCA 4CSVA 1YHVA 3EN5A 4MWIA 1OL6A 4AWIA 1TKIA 3HKOA 4IMYA 4DYMA 2NO3A 3K2LA 2FB8A 4QQCA 3G6GA 2OSCA 2C3LA 5M51A 4FSYA 3ZEWA 2PUNA 3Q6UA 5BVNA 2X4ZA 3Q32A 4FTKA 5KBRA 2ZOQA 4LG4A 4XG3A 1XHAA 3D7TB 1OPKA 4O38A 3ZUUA 4YSJA 4KUJA 3LOKA 4AN3A 5EM8A 5F94A 4AT5A 3ZU7A 5FUTA 3Q53A 2G01A 2WEVA 3UIMA 2VWYA 2YM7A 2OKRA 3HAMA 3PPKA 3T9IA 4O86A 4EJ7A 1GY3A 3DZOA 4CVAA 5J9YA 5AFVA 5H3QA 3MPTA 1NVRA 2UZTA 5AR4A 4ZZOA 4EOPA 3IDBA 3TUBA 4YUQA 2PE1A 3QGYA 3IGOA 4FTJA 3DU8A 5CI6A 1STCE 3NW5A 3GC9A 4FIFA 5IQEA 1VEBA 5GJGA 5AR8A 1XH7A 2QOOA 1JKLA 2YAAA 4L3LA 1OITA 3R7OA 3LW0A 4BF2A 3S3IA 2YM4A 5IQAA 4EQUA 5CAOA 4YBJA 2XVDA 4UMUA 3Q2MA 3QD4A 1H08A 3DS6A 3HV4A 1BYGA 5AP6A 4E1ZA 3W2RA 2GNLA 3GFEA 3R8VA 2BAQA 3RM7A 4BHNA 3QUDA 5E8YA 5E90A 5M4FA 3MH0A 3EL7A 5AR2A 3VO3A 2CNVA 3PTGA 4GS6A 2NRYA 5HIBA 2YWVA 3TZMA 5I9YA 1VR2A 4O7LA 3DBEA 1L3RE 2W96B 3BYVA 4OT6A 4A06A 5ANIA 3O8TA 2YISA 4RX9A 3ATTA 3O23A 2UW5A 3HP5A 5BVEA 4UX9A 4C4GA 1LEWA 4J97A 3E3PA 3VS0A 4DAWA 2PVHA 3ZBXA 2W5HA 2UVYA 5ANGA 4F08A 2VU3A 4ZLOA 3BCEA 4UZDA 3UPZA 4TYEA 4EYJA 3ORTA 5EI2A 5HO7A 3CCNA 3PLAE 4BDDA 3BHTA 3VS5A 4K33A 4RFZA 5FBOA 4GFGA 3NIEA 4F4PA 5FXSA 1UU3A 4MD9E 5ICPA 5JFXA 1WMKA 2B9JA 2W4OA 2R3LA 4U3ZA 3U8WA 2NPQA 4FT9A 4M14A 4BTFA 2HW6A 4BIDA 3ZXTA 1JLUE 5LVNA 3E62A 4YNOA 4BHZA 2J0LA 4F99A 4PF4A 3OEZA 4QYEA 2R3IA 2XH5A 2Y8OA 5ANEA 3BYOA 5E8WA 3CLYA 3COKA 1DAYA 3ZFMA 2Y4IC 2OGVA 4G16A 4QQTA 3ERKA 4I5CA 3TTJA 4IEBA 3BE9A 4LUDA 5E8TA 4IB3A 2BKKA 4GIIA 3L9LA 4E6QA 3NPCA 4WSQA 4BCPA 4ZTNA 4FEQA 4LUEA 4B7TA 3SAYA 1W84A 4KRCA 3GU5A 3N51A 3U4UA 2ITQA 4F7JA 3TTIA 2XKEA 4YJNA 3TV4A 3N4TA 3Q96A 3GCSA 4WG4A 4APPA 1H1RA 3A62A 4FT5A 4DGMA 2I40A 4O0UA 2I0EA 4FTAA 1XKKA 3BHYA 2WPAA 4PP7A 4CGAA 4XYFA 4AACA 1H1WA 4C36A 5IF1A 2Z7LA 4MWHA 1K9AA 3QRUA 3WZEA 4CLJA 2HW7A 4G3FA 2WELA 3MH1A 4TYJA 5DG5A 5H9BA 5HIDA 3FQSA 5H2UA 2R3PA 4MH7A 2C1AA 4BY9E 4OTQA 4IZ5A 5BUIA 3BELA 3H9FA 4GV1A 5M57A 2BTRA 2QG7A 5G1XA 4LOQA 1L8TA 2HAKA 1DS5A 2WMWA 3QC9A 5TT7A 4AW5A 3SXSA 3NUNA 3V5QA 3NUPA 2ZAZA 3FMJA 4MAOA 1FGKA 3WF6A 4CRSA 4EHGA 1RW8A 3NNVA 3GENA 3OP5A 3T3VA 4BZNA 2WO6A 3NYNA 3OUKA 3RI1A 4C62A 4QMTA 3GB2A 1G3NA 5BYZA 3TUCA 5IQHA 1WBNA 4F0FA 4K9YA 4M0ZA 4G6LA 3AT3A 4BDEA 4QTAA 4LGDA 5JGAA 4WRGA 4FVRA 5C27A 1B6CB 1OMWA 3BBTB 1F5QA 4WBBB 5GIOE 1OIRA 4TNDA 5L6OA 3LMHA 4O7TA 4AU8A 4FSUA 3CIKA 4TWOA 3TKHA 2GNFA 2WMBA 3A60A 3II5A 3UNJA 3ORNA 3QKKA 4O1PA 4HPUE 3AG9A 4LRMA 3KKVA 1MRYA 2GNHA 3HV6A 5HQ0A 2CPKE 4YHFA 5HU3A 2XEYA 3A61A 4GJ3A 3UVRA 4BI2A 2E9PA 5A6NA 3P7BA 2W1ZA 3ID6C 3PA5A 4CQGA 2OI4X 4EBWA 3QLFA 1J7UA 3FMEA 5D1JA 1PY5A 3PIXA 4IWOA 5HZNA 2XK3A 3FZOA 4XBUA 5I9VA 2UW4A 2OJ9A 4FV3A 3RCJA 4BIBA 4MKCA 2FSOX 4IZAA 4YHJA 5K0KA 5J5SA 3R9DA 5AV1A 3EKKA 4JDKA 3A4PA 2R3QA 5M4CA 4FV4A 2RFDA 5IEVA 5IQGA 5I4NA 4EH6A 5HLWA 2WFYA 4ALVA 4CMOA 4MF0A 3TI1A 3SA0A 3I0OA 5HESA 4DN5A 2UVXA 3UMXA 1OBDA 5HE0A 2PK9A 3UJGA 4AW2A 3QC4A 3QHRA 4GJ2A 5CWZA 4GKHA 3BI6A 1S9JA 2Z2WA 3NCZA 4D5HA 4WG3A 3A7FA 3I4BA 3P08A 4IIRA 3DA6A 3KCFA 1WAKA 2HXLA 2O63A 3VUIA 2QR8A 4LRJA 5BYLA 2VO6A 3F66A 5AR3A 2JBPA 4TYHB 3R2YA 3V5TA 4YLJA 3HL7A 3AXWA 4MXOA 3RWQA 2GHLA 3QKMA 3OXZA 2OXXA 4LV5A 3QGWA 4NW6A 4XRJA 3RAHA 4HVHA 4N57A 3GU8A 2J7TA 3JS2A 2AC3A 5FDPA 4L3PA 3ZC6A 3SV0A 3KF7A 4ANQA 1R78A 5DN3A 4BTJA 4J95A 5IZFA 4DCAA 5LJJA 3EQIA 4RPVA 2XJ2A 3F2AA 2OICA 3KK9A 4FSNA 2GNJA 1H8FA 4D2TA 1YI6A 4GT5A 2IZTA 3NNXA 2QODA 4NKSA 1OI9A 3DBCA 4EH5A 3EZVA 2J4ZA 1UWJA 2DWBA 5BVWA 4E93A 3LLAA 5AWMA 5EOBA 4BICA 3KRJA 2XNEA 4U40A 3JY0A 3PVWA 4O0XA 4OTPA 2QOKA 2V7OA 3QF9A 5LCKA 3RINA 3TT0A 4EOIA 4FZDB 4ORKA 3D2IA 2W05A 5C8MA 4BDGA 4E3CA 3A4OX 2W9FB 5BVFA 1KOAA 3QYWA 5CVFA 4LYNA 4U0IA 4RJ7A 4W9XA 2QD9A 1K3AA 3IW7A 1T45A 2WTDA 2P55A 3P9JA 4MQ2A 4RWIA 4XP0A 5CSHA 3E7OA 3MVHA 5AUWA 4BDFA 2EVAA 5FTQA 5IUIA 1Q5KA 1JNKA 4BDAA 4F1TA 3SW7A 4AP7A 2O5KA 2CMWA 3DK3A 3OXTA 4HOKA 4QYHA 5KHWA 1H27A 4O82A 2YM8A 3M11A 1OKWA 3OEFX 3R28A 4RMZA 4JDHA 1IRKA 3QBNA 2JBOA 3MDYA 2XKCA 3C9WA 3FZRA 4IX4A 4ASEA 5TOZA 1ZWSA 5A4QA 5T3QA 1ZZ2A 3MY5A 1HCKA 3QX4A 4JBVA 4BBEA 2XZSA 5M53A 3CGOA 4C58A 5JFSA 4O6LA 3V8TA 2BRNA 2IZRA 4D5KA 1WFCA 2PZPA 3A7JA 3VHEA 3MFRA 3L8SA 3V5WA 5CSPA 3PA4A 5CAPA 1QCFA 2QHNA 1JKKA 4L8MA 4S34A 5CTPA 3QCXA 3ZO1A 4E20A 1P14A 2ZB0A 3EL8A 1XH6A 5J7HA 4WOVA 4ZLYA 2P3GX 1Y6BA 3E92A 4O2PA 4YTFA 3S0OA 4NW5A 2YACA 3V3VA 2A4LA 4YZBA 4GIHA 4BCNA 4PL4A 1XR1A 3MB6A 5HVYA 5KUPA 2WXVA 2OO8X 4BBMA 5JKGA 4O1OA 4B8LA 4EHZA 4Y5HA 4BYIA 4IAAA 4TKSA 2ZM3A 5GHVA 3SW4A 4HJOA 5DHJA 2Q0BA 3S00A 3DT1A 4AN2A 5CVHA 3RPOA 4LV8A 2WAJA 4FC0A 2B55A 4FK3A 5IG1A 5A6OA 4UN0C 4E5BA 1YWVA 4YBKA 3ROYA 4F6UA 3OUNB 4S30A 3VWAA 3Q3BA 4C37A 4D9TA 2GFCA 1RQQA 4I6FA 4S2ZA 4M69B 4Z7HA 2PVNA 5DT4A 4DTKA 1LUFA 2Y9QA 2GTMA 3FI3A 3M1SA 4FIIA 4YLLA 4ZS4A 4BTMA 1PYXA 3F5UA 1PMNA 1QPJA 4QMVA 4RBLA 5LOHA 2FGIA 4OLIA 2JDSA 1IR3A 1YOLA 3KEXA 3CR0A 5HG8A 3TV6A 4E5WA 4ZLZA 3O50A 4DEGA 1ZMWA 1Z9XA 5LVOA 3DLSA 1M17A 3HAVA 5FD2A 4XOZA 4YZNA 4CEGA 4CZTA 1ZYDA 4JRNA 4DGNA 4UYNA 3D0EA 2JC6A 4U41A 2I1MA 2XJ0A 2DYLA 3NAXA 4IM3A 3OG7A 1U5QA 3DB6A 5EYCA 3R1QA 4R1YA 5AJQA 4W4WA 4EH3A 2VWXA 4ITJA 3VRYA 4BI0A 5L3AA 3IW4A 4UYAA 3QQJA 4JQ8A 4EK6A 3MTLA 2PVMA 4M13A 3ORXA 5ANOA 2WTVA 3GQIA 3CKXA 4ZZNA 1PMUA 3V5LA 2IPXA 2JDRA 4RIYA 3ORZA 4ACCA 4H36A 5K5XA 5IUGA 1YXTA 5M06A 3K3JA 4I94A 1PW2A 4EC8A 4FSWA 4XV2A 2F9GA 3B8RA 3TACA 1YWNA 4ACGA 4RFYA 5H8BA 1V1KA 4EL9A 4BIEA 5BVDA 1ZOGA 4FTOA 4G6OA 5IKWA 3PE1A 4RLLA 3FMMA 4OBOA 3PJ2A 4KIKB 4IFGA 1Q8TA 5M55A 1WCCA 2C4GA 5DT0A 3ELJA 2PVLA 4MD7E 4B9DA 4ZSAA 1PMVA 3Q4UA 3FBVA 5ETFA 2R5TA 4K6ZA 2GU8A 1CM8A 3HYHA 3JPVA 1URCA 2C3JA 4FG9A 5AADA 3DZQA 4GRBA 4NU1A 5FM2A 4CYJA 4UMPA 3JY9A 3OBGA 4FT7A 2ETRA 3RP9A 3QAME 4IZ7A 4M68A 5IISA 1MQ4A 4U9AA 3V6RA 4R8QA 3B8QA 3DJ7A 4IX5A 3CP9A 3W2SA 4FKRA 1BX6A 2XBJA 3P5KA 3DFAA 1YI3A 3OVVA 2HCKA 3R8MA 5BVKA 1Q3DA 1QPDA 2C0TA 4JNWA 3NUAA 4XG8A 5AEPA 4EH7A 3O8PA 2BRGA 5E8UA 4OAVB 4F7SA 3KL8A 4FZ6A 4CZYB 3P7CA 3L9MA 3TNQB 2B7AA 5D11A 2W5BA 4Z16A 4W9WA 4QP2A 5E8ZA 4IB1A 1W8CA 2QURA 2O2UA 3D83A 5K3YA 4FL1A 4WRSA 4U79A 3LFSA 1QPCA 5HHWA 1NT2A 4AA4A 4EEVA 3UNZA 4I5HA 1Y8GA 3QRJA 1MRVA 5G6VA 1UKHA 5KO1A 3OWKA 2AC5A 3FHIA 2R3FA 4E4NA 3WYXA 5AUYA 3LFBA 1BL7A 4XV1A 5EDQA 5AUUA 4O7WA 2XF0A 3VUMA 4TT7A 4K77A 4C61A 5EFQA 2C6LA 4U3YA 2YIQA 4RFMA 3N4VA 4DEBA 3BHHA 2Z8CA 4FZAB 1UKIA 5CU3A 4U7ZA 4OT5A 3DJ5A 4OTDA 4QT1A 4DG3E 3NVKI 4JIAA 3OWLA 4II5A 3P86A 4GU6A 4W4XA 3DKFA 4J8MA 4TXCA 4FE2A 2LAVA 2PMNX 3MIYA 4M15A 5D7AA 4I0TA 1CMKE 4NM3A 1ZMVA 3ENMA 4Z9LA 5KKRB 4MNEA 2NRUA 3IKAA 3CJGA 3G51A 3RTPA 3W8QA 3WOWA 2HENA 4X3FC 1XH5A 2VGPA 3TZ9A 3RK9A 2CKPA 2CCIA 2X7OA 3HRCA 2DS1A 3PY0A 2QLUA 1U54A 2GHGA 3TKUA 1OUYA 4OTFA 4FTUA 3PIYA 4PP9A 2WMXA 3D4QA 4K2RA 3NNUA 2BIKB 2PZRA 3TL8A 3BU5A 3MWUA 3UPXA 3VN9A 1IAJA 5EI6A 1UWHA 3R2BA 5EKOA 3W55A 4FV0A 4BKJA 1R0EA 3NAYA 3PVUA 4D2PA 3W2CA 1GZKA 3BQRA 5B2MA 4L52A 2X0GA 1ZRZA 3ZZEA 4JR3A 3FSKA 2WOTA 5AAGA 1SVHA 2JAMA 1H4LA 1LPUA 4FSRA 1WBSA 1VYWA 4YPSA 2YDKA 3GCQA 4IANA 4L68A 2HZIA 4B4LA 3L9NA 5DBXA 4BBFA 3ZLXA 4ASDA 4RWJA 3ZMMA 4I20A 3ETAA 3MY1A 2CDZA 4QMUA 3VS4A 1W0XC 1Y91A 4L7SA 5AP5A 3EQHA 3P1AA 5EM7A 3FPQA 3PWDA 4QPSA 3KRWA 5JRQA 2GS2A 4CFMA 3EQRA 5DE2A 1NW1A 1UNHA 3EN4A 5HTCA 4O7ZA 4RGJA 2RFSA 2YERA 3IPHA 4RC4A 4U80A 3DBDA 4I3ZA 4JG8A 4QYYA 5LWMA 4O0VA 2RGPA 5KZ0A 3HUBA 1PRYA 4LL0A 3BGPA 4ANBA 4UEUA 2OIQA 3NS9A 3NUYA 5CENA 3QXPA 2R2PA 3WZKA 2CKEA 4FV9A 3JVSA 4I5MA 4FSQA 2XNOA 3WARA 4QYGA 1ZYLA 2WU6A 5CQWA 3P23A 2GQRA 4FUYA 2IW8A 3WF7A 4DGLC 3GC0A 2YAKA 3CD8A 4BR3A 4X3FA 1I09A 1YDSE 4GEOA 4UWCA 4DITA 4NIFA 2WQEA 2VTLA 5FEEA 2WD1A 4MEDA 4FGRA 3B2TA 2VNYA 3BHUA 2XBAA 1RJBA 2B1PA 1CKPA 3FAAA 4FZ7A 3LCTA 3UZTA 2R0IA 2WTJA 1Y57A 3W2OA 1XH4A 4BCOA 5LVPA 3UVQA 3UYSA 3L1SA 3C0IA 3BU6A 4HGSA 5DEYA 4JX3A 4IAIA 4I41A 4QP6A 5F1ZA 4GL9A 3VW8A 4ZP5A 4XRLA 4QP3A 5I9ZA 4X2JA 5CSVA 5CNOA 3R0TA 4IC8A 5AUXA 3TIZA 3U4WA 4UWYA 3VIDA 3FZSA 4CCBA 5BUJA 4AOJA 2CNUA 4UXQA 2YN8A 2QO2A 2ZJWA 3HA6A 3R1SA 3C0GA 1JKSA 3O0GA 4MBLA 2WZJA 4IH8A 2UW6A 4MXYA 5CU6A 5HCYA 4CD0A 2XKDA 4M12A 5IDPA 3N9XA 4YNEA 3K5VA 3TZ7A 5AA9A 1OPLA 3DV3A 1CTPE 2QNJA 5FDXA 3NMUF 1FPUA 4ZTQA 1Q4LA 3HDNA 5J9LA 4G9RA 3C4FA 2ERZE 5FEDA 4ZSLA 4KSQA 1Q99A 5FBNC 2BAKA 2XCHA 5DA3A 3WF9A 3WE4A 2VAGA 5FQDC 3WZDA 3PXZA 1W83A 2CHLA 1GZ8A 4FKGA 3W8LA 3EZRA 1ZMUA 3BYUA 4IWPA 4IJPA 4L46A 4ZTMA 2Y4IB 3BZ3A 5T68A 1KE6A 2HK5A 3AT2A 3POOA 5F4NA 3BHVA 5C4KA 4L44A 5IA2A 4UY9A 4PL3A 3A8WA 3PSCA 2C6IA 4IBMA 5BMMA 2PVFA 2BILB 2R3OA 4HCTA 1M7QA 4N0SA 5C4LA 2YCRA 1Q8UA 5J79A 3DPKA 3VBVA 2WMSA 3QQFA 4I24A 2WQNA 2IW6A 3KN6A 4B6LA 3TDWA 5JT2A 5AM6A 3ZM9A 4FMQA 4PPAA 2PE0A 3I81A 4PNIA 4JVGA 2VN9A 2IN6A 3QCQA 2C5VA 4Q9ZA 5IQFA 3M42A 4I93A 4WD5A 4GVJA 1ZAOA 3U55A 3I79A 2WTCA 5GZ9A 3ALOA 4FV7A 2YZLA 4IM2A 3M2WA 2VTAA 2HYYA 4O0SA 4D0WA 3UQCA 2BR1A 2JEDA 4FEVA 3QALE 5C26A 4R78A 3QTXA 3OY1A 4G3CA 3CTQA 4WSYA 3BE2A 2CKQA 4I5PA 4JQ7A 4BKZA 5AV2A 4CG8A 3VUTA 5IA1A 4G3EA 2XIRA 4FYOA 3TNHA 3ODZX 1K2PA 4Y5QA 3GI3A 4DG0E 5JK3A 2IZUA 4JG6A 1WVYA 4M67A 1PXMA 3QTIA 3R02A 4AUAA 3C50A 3PSDA 3ZOSA 1TQPA 5ITAA 4QMXA 3VQHA 3EMGA 2I0YA 3LFFA 4OTGA 3U54A 2R3GA 5AP1A 1PXJA 4OTHA 1M2PA 2QHMA 2ITTA 2VTJA 2HOGA 2WTKC 4KWPA 5AAFA 4YO4A 1KV2A 2XRUA 2WMQA 2J6MA 4L53A 4AT3A 4H39A 2XNGA 5JQ8A 4L01A 3WYYA 1YXVA 3FLNC 3HP2A 3ZXZA 4TL0A 4IAKA 3UTOA 3AGLA 4ANNA 2YITA 4AZEA 4CKJA 3DTCA 4HGEA 4F9AA 5AA8A 2ETKA 5KBQA 5IH5A 4DTBA 3CD3A 1TQMA 2R64A 2B52A 3KVXA 2YJSA 2ZB1A 2X7GA 4TNBA 4CG9A 3BV3A 2C47A 3A7GA 4V0GB 1YKRA 3V8WA 5I5ZA 3O17A 4LGGA 4YZDA 1XBBA 4NZWB 5CALA 5LWNA 4PDSA 3QUPA 1F3MC 4QYFA 2XRWA 2YLEA 3H3CA 4FTRA 3GFWA 5F95A 5GNKA 2SRCA 4PRJA 4APCA 1OBGA 2ITPA 4IAYA 4FKLA 3RNIA 3ZRKA 2VTQA 3FLSA 4G31A 4IDVA 2ZV2A 3FYKX 1T46A 2A2AA 3ZCLA 4DGGA 4MYGA 2QKRA 3OT8A 1OIUA 5JN2A 2C68A 2B54A 3F3UA 1PYEA 2OWBA 3MTFA 4IFCA 3KB7A 2C6TA 5BVOA 5JMSA 5LMKC 4FG8A 5FM3A 1NVQA 3HGKA 3VAPA 3FLQA 3H0YA 3ZONA 3D5WA 5CSWA 3KC3A 3IECA 5DGZA 4CFUA 4QTCA 1A48A 1Q8YA 4DFBA 2R3KA 4IDTA 2YJRA 3C13A 4ZTLA 3UO4A 4C3PA 4EYMA 1G5SA 3NVMB 4Y72A 3E7VA 3FY2A 4ZSGA 2RKUA 4I4EA 4LGHA 4LMUA 5M4UA 4LOOA 3EH9A 4FTTA 5ACBC 4Q2AA 3MJ2A 3FZ1A 1IA9A 4FTCA 4TY1A 3TXOA 3R63A 5JZJA 1B39A 3COHA 3FDNA 5DR6A 1Q8ZA 4GYIA 4O22A 1CDKA 1BL6A 3GCUA 3QYZA 5CT0A 2PE2A 2GSFA 2ETMA 3VHKA 1XWSA 2Y4PA 4KA3A 3FPMA 4FKJA 5J7BA 3A7IA 3MS9A 1RE8A 2GFSA 1GIIA 4EOOA 3EQGA 1FBNA 2YA9A 4G17A 5LQFA 2IVTA 3OZ6A 1ZOHA 1PKDA 2ZDUA 4PMTA 1E1VA 2ITUA 3MVMA 3LFEA 4IXPA 3UDBA 2OZAB 4QP7A 1H00A 2YIRA 5ETIA 5A4CA 4PDPA 4MHAA 1LP4A 3OF0A 4R7HA 4FOBA 3GOPA 4Y8DA 4H1JA 2C0IA 1ZZLA 3FUPA 2CLQA 3ZS5A 3GEQA 5KZIA 3VF9A 2EXEA 3VQUA 5CANA 3RCDA 3KXHA 2XM9A 4YJOA 3RALA 4YR8A 5CS6A 5JFVA 3P0MA 4F9WA 3PSBA 2CGUA 4RVKA 4F6WA 3FY0A 3KRLA 1F0QA 5CXHA 2G1TA 2GNIA 4CNHA 3A99A 1PHKA 3Q9XA 5HBHA 2WTIA 3IOPA 4AE9A 1M2QA 4E6AA 3OFMA 3DBQA 1JOWB 5EHOA 5EH0A 2ZVAA 4FNZA 4G1WA 5DEWA 4NSTA 4USEA 4ASZA 3D7ZA 4EKKA 4XUFA 3QTQA 4JRVA 3HV3A 5AR7A 3FMDA 5LMAA 5LMKA 2BMCA 3OOGA 5DIAA 5CAUA 3KMUA 4RX7A 5CEOA 3FL4A 5LVLA 2BHHA 4C38A 5D7VA 1P2AA 4QMZA 3LPBA 1BI7A 3G33A 3ZDIA 5BNJA 5CZHA 4WHZA 3PLSA 2B9FA 3PP1A 4U81A 5EKNA 2WMAA 2E9UA 4KIPA 2XA4A 4KKEA 3MA3A 1H1SA 4RIYB 3RPSA 3WF5A 3R30A 3DNEA 3VS2A 2QU5A 4ZY5A 3KVWA 2PU8A 3RZBA 1P4OA 1R39A 4I1ZA 5I9WA 3H30A 1JSVA 1QPEA 3QL8A 4U6RA 4FIJA 4O6EA 3Q60A 1OKYA 4E7WA 3NYVA 4FI1A 3QX2A 1MUOA 1FMKA 3OT3A 2ZMCA 2BDWA 2ZYBA 2OXDA 4AF3A 2AUHA 4TW9A 2VTNA 5ETAA 4CKRA 3RWPA 4TWCA 2RG5A 3IOKA 4XBRA 4F0IA 3LHJA 2YABA 4R3RA 5I9UA 4ARKA 1YDRE 1APME 1UA2A 2IG7A 3LXLA 2XEZA 2ZM4A 1YW2A 5L2WA 4GKIA 5CF8A 4DH7A 4GG7A 4AN9A 4DFUA 3W16A 1JKTA 3EWHA 4H1MA 3LCDA 3FHRA 2WMTA 4FT3A 4B99A 3KGAA 4E4XA 3EQBA 1KV1A 3SKCA 4FNWA 3QHWA 3ORPA 4PQNA 4YC6A 5CX9A 4EH8A 2QG5A 4DEIA 5IDNA 2V0DA 4HNIA 3PXYA 2IW9A 4CFFA 4D28A 5KX8A 2GQSA 3IG7A 2CNQA 4O91A 2EUFB 3QCSA 3E93A 3GU7A 2VV9A 4ZXTA 3L9PA 1U46A 4IVCA 1DM2A 3BX5A 4FK6A 2J0IA 4DEAA 4N6YA 3UIXA 4W8DA 3A7HA 3QLGA 5LMBA 2PYWA 3GGFA 5C01A 2ONLC 5EG3A 3HZTA 3FMHA 3I7CA 2J2IB 3OWPA 2QQ7A 3DCVA 1XQZA 3AC3A 4MXAA 4UV0A 3SRVB 4AAAA 4CT1A 5A9UA 4R5SA 2W1IA 3IDCA 3LXKA 3D94A 4YGAA 5ANKA 2X2MA 2ERKA 2VTRA 4FKTA 3LFQA 2BZKB 1FVRA 2I6LA 2YZAA 4PV0A 3R71A 3C0HA 2F57A 2BHEA 3DB8A 3SC1A 4GSBA 4NJ3A 3TN8A 4NCTA 1Q97A 4FKUA 4YTHA 4D2SA 3PRIA 3COIA 5AM7A 2QOFA 4F63A 2ITWA 1M52A 4J8NA 5DR9A 4L7FA 3OWJA 4IB0A 4KS8A 3E8CA 4RQKA 5M4IA 4G3GA 4MBJA 4G9CA 1PXKA 2YDJA 3R7GA 4ERKA 4ZMEA 4C4HA 3DAKA 4ACHA 4B8MA 4RQVA 5ANDA 4MNEB 1ZXEA 4QP4A 2VX3A 1GZNA 2A0CX 2WGJA 2YWPA 3D2KA 3CQEA 4V05A 3AC1A 5J87A 3ZM4A 3R01A 5CF4A 4J1RA 3MYGA 5T6KA 5A54A 2VTMA 3HMOA 4R5YA 4FODA 3ZEPA 4AW0A 5HLNA 4XG2A 1U54B 4H3QA 3HMPA 4E4MA 4BDCA 3IW5A 4CQEA 2XUUA 5HNIX 4ALUA 3FMLA 3VBXA 3SHEA 3ZSHA 5IQIA 2B9IA 4KD1A 3OW3A 4FIGA 4M97A 3C7QA 4P90A 5IA0A 1PXNA 4KINA 4KIOA 4ALWA 4RRVA 1J7LA 3UP2A 3R00A 5FGKA 4O7SA 5E8XA 3EFWA 4RZWA 2VTHA 3V6SA 5EM6A 3F7WA 4IVBA 4KKGA 4M7IA 3TCPA 3SVVA 1JVPP 4DH5A 1LEZA 2HY81 5B2LA 2OZOA 4C2WA 4EOKA 5C8KA 2VTOA 4YJTA 4DG2E 3BLRA 4EORA 4IC7A 3CS9A 2OFVA 3RHXA 2YFXA 4FF8A 3R73A 1PJKA 3DXQA 3U6HA 3MW1A 2ONLA 1H0WA 4NFMA 4EOJA 4EH9A 5EYDA 5E9EA 3F69A 3UIUA 5DWRA 3KXXA 2PPQA 3H4JA 3TM0A 3FLYA 4A9YA 2VWUA 4S31A 2W5AA 1E1XA 2B9HA 3ZLSA 3SG9A 5GINE 4A7CA 2OF4A 3ITZA 4AFJA 3JYAA 2GS7A 4MX9A 4QP9A 3KXGA 4AOIA 3AD5A 1SVEA 3K3IA 3LM5A 3Q52A 5D41A 1ZY4A 3TV7A 5K9IA 4DBXA 1V0OA 4WUNA 2XNMA 3ZYAA 5BQ0A 1DI8A 2J0MB 5CEQA 3UQFA 4A9TA 3NUSA 3OCSA 3U6JA 3LLTA 3JVRA 4X3FB 3ZSGA 4I92A 3NRMA 3BYMA 4YZCA 3KXMA 2UW0A 4NIFB 3GU4A 3Q4ZA 4QD6A 5AIRA 1PXPA 2CGWA 4E4LA 4AGDA 4HGLA 4OBPA 3SQQA 4BDHA 3PE2A 4FL2A 4FVQA 4DEHA 3FKNA 3KULB 4QMSA 2FVDA 4EI4A 4NT4A 4DT9A 2X81A 1HCLA 1Q8WA 4U5JA 5HLPA 2YIXA 3I1AA 5GJFA 2F7ZE 5IU2A 3LE6A 4IQ6A 3LJ2A 4R3CA 1H0VA 3ZBFA 3C4EA 4RLKA 2YCFA 4NM5A 3CKWA 4BRXA
chains in the Genus database with same CATH superfamily
2XJ1A 4C34A 2YM6A 2BKZA 2J9MA 1ZY5A 2QOIA 4JT3A 3U6IA 1PXOA 2WIHA 4EUUA 4RG0A 4DC2A 2XP2A 2NNWB 1Z5MA 5HI2A 1O6LA 2UVZA 3PY3A 4Z3VA 3PUFC 2X0QA 2HWOA 1OZ1A 4RWLA 3UOKA 5IH4A 2BIYA 1GJOA 4J96A 3V51A 1ND4A 3VBTA 3K5UA 4J99A 2B0QA 1XMLA 4YJSA 2O65A 5CNNA 3TZ8A 4QMOA 3HMMA 3TNIA 4JBOA 4EJNA 4AG8A 2O64A 1IASA 1G8AA 4HVIA 4H58A 5E1SA 4I0SA 3UZRA 2WMVA 5CT7A 4J52A 3P4KA 3TJCA 3Q04A 4CCUA 5CAQA 4EKLA 3ORLA 4ZJVA 2BFYA 4AA5A 4H05A 2Q0NA 4YJVA 2OU7A 2XK6A 4HZSA 2JKQA 4S32A 3RHKA 3G2FA 4D1XA 4EZ7A 2XAOA 2XNBA 3NR9A 1Z57A 2OXYA 3CQUA 5HTBA 5A4TA 3ACKA 3F3VA 3HRFA 3E8NA 3MA6A 3RK5A 5JRSA 5AAEA 4G5PA 2IWIA 2ACXA 2ZMDA 3R8PA 4FKVA 4DFLA 4IZYA 3VRZA 2EXCX 4JDIA 2IF8A 2WIPA 3G0FA 5HD7A 4BN1A 4JAJA 5FEQA 3DFCB 3DKCA 4UMQA 4C4JA 4L9IA 3IONA 2VTIA 2XARA 3RGFA 3PXQA 5DPVA 1SMHA 1NXKA 4BDJA 4GK4A 2QCSA 4C4IA 5EM5A 3VUKA 3VJOA 4QTBA 3OCGA 1P5EA 3AC2A 3MH2A 3OC1A 4AQCA 4D58A 4IE9A 2QC6A 2W1CA 5IA4A 4IAFA 4AGCA 1MRUA 4L67A 4BWPA 2Q83A 3ULZA 1KE5A 4RSSA 3GXLA 4XLVA 5FXQA 4CT2A 4LI5A 4Y73A 2VX1A 4FYNA 3HUCA 2WQMA 2Y7JA 3SDJA 4K11A 5IA5A 3CY2A 2BRHA 5M56A 5CI7A 1Q3WA 3LJ1A 1JSTA 2UZNA 4J53A 2UW8A 2VNWA 2C6MA 1JBPE 2W1HA 3LFAA 5E7RA 3ZDUA 4MD8E 3LKMA 4AOTA 4AX8A 2JKOA 1DI9A 1OGUA 2CCHA 2VTSA 4QNYA 4E8AA 4C7TA 2O8YA 4NWMA 4EHEA 4FZFB 3D5VA 4PY1A 1EH4A 2W9ZB 5EI8A 4EWHA 3EQDA 3H9RA 3R83A 3OMVA 3U9NA 4D2VA 1KE8A 1M2RA 4HVDA 3TUDA 2OH0E 4JAIA 1UU9A 4HGTA 1SYKA 4LOPA 1IAHA 2H34A 5FRIA 3PRFA 2OF2A 3U51A 3G15A 1YRPA 3KCKA 4IAZA 4AZTA 5CVGA 3MESA 1J91A 3FE3A 4F65A 2G2IA 5KHXA 3HX4A 5ANJA 3WZUA 5B7VA 4AXFA 4CKIA 3VUHA 5L4QA 1URWA 5JGBA 3ZLWA 4G2FA 4EK3A 5HO8A 2F2CB 4I6BA 3SOAA 3FL5A 4XEYA 5EYMA 3R6XA 2W1GA 2EU9A 4OAUC 3OTVA 4QTEA 3RVGA 4BDKA 3Q5ZA 4GH2A 4TWNA 5CZIA 2BDJA 2RF9A 2JFLA 2VTPA 5ACKA 4EQMA 4AAYA 5KCVA 4BZOA 2QOQA 4JDJA 2XANA 2PUPA 4GT3A 5AP0A 3CPBA 4LM5A 4X6QC 3LXNA 4FGBA 1WBWA 3VS3A 4QEBA 4FTNA 3LVPA 3GT8A 3EQFA 3KXZA 4NL0A 1JQHA 3EN6A 1H24A 1TQIA 2XK8A 3PIZA 4L3JA 3O2MA 4NM0A 5AV0A 2WTWA 4YC3A 3C4ZA 4I23A 5L8JA 5AP7A 4ITHA 4G6NA 2ESMA 1ZYJA 3SX9A 4O0RA 3ZLYA 5CF6A 3F5XA 3VJNA 4WBOA 4QMMA 2HY0A 4PPCA 5KE0A 3V5JA 2VRXA 3QTSA 4LV7A 1WZYA 3QA0A 4O0WA 1JPAA 4QO9A 4FKSA 4IX3A 4DFXE 4F7NA 3QZGA 3RNYA 4FEXA 3AOXA 1M14A 2WTKB 3KMWA 2QI8A 3Q4CA 2Z60A 4HCVA 4XJ0A 3R9HA 4BGGA 1YI4A 2X7FA 1HOWA 1GAGA 3FXXA 1V0PA 3QQLA 2W0JA 4TYIA 4S33A 4GW8A 3QFVA 4FTQA 3WIKA 1H25A 4ENXA 3R7VA 4D2RA 5BPYA 3MI9A 2XK7A 5HE1A 3E3BX 4ZSEA 1H28A 3IS5A 3REPA 3KIOC 3KXNA 4CZUA 3KFAA 3DOGA 3G9LX 3R7YA 3QZIA 3W18A 5HCXA 3E64A 4BGQA 4USFA 4H3PA 4QRCA 3MFSA 2P0CA 4B0GA 5M07A 3QTZA 3ZUVA 1FMOE 1OIQA 4MTAA 2C30A 4FVPA 3THBA 1UV5A 4AGUA 3BU3A 3CEKA 4M0YA 1FINA 2OJIA 2XKFA 3R9NA 4CV8A 5AMNA 4AZSA 4AW1A 4BKYA 2PSQA 2UUEA 3FWQA 2VWWA 3BL9A 4A9SA 3EFLA 2JDTA 1H1PA 1XH8A 4CFXA 1NVSA 3S1HA 2VWBA 2X2KA 5B2KA 5HX8A 3R21A 4XOYA 2RIOA 4D9UA 3DQXA 3UODA 2JD5A 5LXMA 4R3PA 4IX6A 5AX9A 3ROCA 3T9TA 4CRLA 1P4FA 3I60A 3BBWA 3H10A 4FKWA 5CY3A 4E26A 3UGCA 1XJDA 3ZO2A 4EK8A 2QOCA 3KU2A 3F3ZA 5J8IA 4QMQA 3UP7A 4AA0A 1OKVA 4QMPA 3CSVA 1ZYCA 3R1YA 2HZ4A 3LCKA 4C33A 3UOJA 4ERWA 3QTUA 5CU4A 3BLQA 3NW6A 4JBQA 5I3RA 1W2CA 2GQGA 4L6QA 4NK9A 4X7QA 4KNBA 1OL7A 4D1ZA 4C4FA 4MUQA 5AP4A 2QO7A 3WE8A 2YIWA 3QTRA 2GCDA 4D55A 4F6SA 1BUHA 4E6CA 5DH3A 3AGMA 4O84A 4RIWA 2IZSA 3AMYA 3TEIA 4QOXA 2W7XA 4BCHA 2BZIB 3PY1A 2PZ5A 3OY3A 4TYGA 2CGXA 4JLCA 3SLSA 4OW8A 5JH6A 1SNUA 1YOJA 2GPHA 4O2ZA 4FV1A 4FNYA 4FA2A 3F61A 3VS7A 4XG4A 3ZZWA 3FLWA 3DXPA 2IVUA 4PTGA 4MCVA 1SVGA 4EOLA 4U8ZA 3FXWA 4KBAA 5AP2A 1UNLA 1W7HA 3LCOA 3PPZA 4WNOA 2IVSA 3DJ6A 2ZV8A 1R3CA 3DK6A 4QMNA 1CKIA 4FR4A 4MBIA 4K0YA 2X9EA 1YOMA 4O4BB 4BC6A 2JAVA 3C4WA 3FV8A 3ORKA 4IACA 4Y83A 4BDBA 4GK3A 4YURA 4C02A 3W0OA 4F1OA 3PZEA 2PWLA 1NY3A 1CSNA 2WOUA 3RKBA 2X39A 2V22A 3VUDA 5B0XA 3I7BA 4IVDA 5IQCA 4BB4A 3ZFYA 4QPAA 2O3PA 2H96A 2J0KA 2WU7A 4XV9A 1KUTA 4RWKA 4Q9SA 4EZ3A 5H8EA 2VTTA 4R7BA 3QTWA 3A8XA 2J5EA 4KS7A 2EXMA 4FX3A 4ZTRA 2YCSA 1OM1A 5HOAA 1ZARA 4E5AX 4NJDA 5HG7A 3SXRA 3CTHA 4WKQA 4IVAA 3KRXA 2VWZA 4FL3A 2EWAA 3OCBA 5CAVA 4FV6A 4M8TA 2VO0A 4IWQA 3RJCA 4WIHA 3PG3A 5L8KA 4RIXA 2R3HA 3BEGA 4D4RA 4DINA 2J50A 4I6HA 5TKDA 2QOLA 2XYNA 1Y8YA 2C1BA 3BPRA 3S95A 2VZ6A 4DGOA 3NCGA 4I21A 4YSMA 4E6DA 1JSUA 1MP8A 4EONA 2XIZA 2XALA 2QKWB 1GIJA 2G9XA 3MBLA 2CGVA 5M44A 2BVAA 1ZLTA 2CN5A 4C0TA 3O7LB 4IHPA 3QXOA 3SOCA 1Q62A 2JDOA 4BCFA 4RT7A 3DGKA 4AT4A 3L8PA 5J95A 4WNPA 5FWKK 4L00A 3VF8A 4HYIA 4MVFA 3R9OA 4GVAA 2X0OA 4OGRA 1R0PA 4F9YA 5KMNA 4GYGA 2G15A 5DRDA 4RZVA 1YXUA 3CBLA 3LFDA 1JWHA 2JITA 3VULA 3GNIB 4M84A 4AE6A 3PUPA 5HNBA 5HBEA 1S9IA 3I5NA 4KBKA 5DFPA 2KULA 3O7LD 4LRKA 4KABA 3IGGA 3VS1A 3ZO4A 2C69A 4AXEA 4RVLA 2PTKA 2X8DA 2C3KA 2ITZA 2OIBA 2WNTA 3E88A 3GCVA 3LJ0A 4X21A 3SXFA 3VW6A 3L8XA 3W0SA 3QCYA 4OTRA 3V04A 5F9EA 2WMRA 3UOLA 3C4CA 3Q9WA 3MGYA 2W17A 3CE3A 4FKIA 4G5JA 4NTTA 4XP3A 4KSPA 2H8HA 4JR7A 3FLZA 3I5ZA 2J51A 3GQLA 2V7AA 5FP5A 3UQGA 3FMKA 3ORMA 4P7EA 4A4XA 4EQCA 2Z7RA 3HMIA 1SNXA 3MFTA 3EN7A 3KN5A 5EW3A 3UYTA 3TWJA 3C4XA 2X9FA 4MQ1A 4O96A 1PXIA 4YP8A 3W10A 3ZSIA 4USDA 3GUBA 3UZPA 2J90A 2R3RA 1WBVA 4DHZA 4CV9A 1X8BA 3QA8A 5JFWA 3U87A 3WZJA 4GUBA 4PWNA 2PMLX 2OJJA 4RC3A 4F09A 3BQCA 2PVYA 3DAEA 3NX8A 2PMOX 2XIYA 1YDTE 2EB2A 4XNEA 3S2PA 5EDRA 4R77A 4RVMA 5J1WA 3FQHA 3W33A 2XMYA 4C35A 3HRBA 2VX0A 3G9NA 4BDIA 2QU6A 1V0BA 4ONAA 4RJ3A 3PZHA 4CFVA 3F2RA 3F88A 1REKA 2CLXA 1WBTA 2R7BA 3HLLA 3Q6WA 5IPJA 2OJGA 5E1EA 4C3RA 4C2VA 1ERKA 4QQ5A 4RJ5A 2P33A 4ID7A 4JI9A 4JBPA 4JG7A 4O27B 3BLHA 3T8OA 3UC4A 2GMXA 4WO5A 3OOMA 4XMOA 4UWBA 4N6ZA 4L45A 1CKJA 4ACMA 1J1BA 4M66A 4TWPA 3S4QA 4MF1A 3R7IA 4DT8A 2BDFA 4YPDA 2FSLX 4NEUA 5CEIA 1AGWA 1XBAA 2CN8A 1WBOA 2UZEA 3FMNA 3HNGA 5CEPA 2R3JA 1A06A 4IM0A 4CYIA 2FUMA 2BCJA 3BRBA 3IK3A 1FGIA 5L8LA 3OTUA 5EHYA 3HECA 5D9HA 5CF5A 4YMJA 2W4KA 5FXRA 5LCJA 3F6XA 4H3BA 4FJVA 3ZRLA 4LDTA 3MVLA 3NNWA 3TNPC 2JIUA 1KSWA 3PPJA 4FG7A 3GP0A 4I22A 4ZK5A 2E9VA 4RX8A 1MQBA 1YQJA 1ZOEA 3GU6A 4OR5A 4YTIA 3PJ1A 3T3UA 4UMRA 5DLSA 4XV3A 4CTCA 1AD5A 4NCTC 4UB7A 3AD6A 3NYOA 3O71A 3R22A 3BV2A 3I6UA 5DMZA 2Y0AA 1KE9A 5EHLA 5TR6A 4DH1A 2VWIA 1U4DA 3PG1A 4DCEA 4PDYA 3W0PA 1WVWA 2PVKA 3UBDA 3QD3A 3LMIA 5HCZA 4GK2A 1XBCA 4U97A 2I0HA 3PYYA 3LXPA 2HXQA 4FICA 4ZIMA 5AX3A 4RX5A 3FC2A 4F0GA 4YJUA 5A4LA 2PZYA 2OW3A 3H0ZA 3B2WA 2XB7A 3COMA 4BVUA 1W98A 5IEYA 3FI8A 5EQYA 2CSNA 3BWJA 1REJA 2Y6MA 1DAWA 1R1WA 3R04A 4YZ9A 5DVRA 4RA5A 3PP0A 4Y95A 5GZ8A 2I0VA 3PFYA 3O96A 3OHTA 3ZTXA 4EWQA 4O4EA 1YWRA 5TE0A 1ZYSA 2AYPA 3DQWA 3ZH8A 3CGFA 4ITIA 4F70A 4D4YA 4RC2A 3NSZA 2BROA 4JOAA 4U42A 3VUGA 4JL9A 5E4HA 3EKNA 4EUTA 2FH9A 3FYJX 4LQMA 5HG5A 2RFEA 5AUVA 3VBYA 2GNGA 3HVCA 4KAOA 4QTDA 1I44A 2WHBA 3C1XA 5K0XA 5CYIA 4BFMA 1VZOA 4KBCA 3QZFA 2QLQA 3FKOA 4IW0A 4FKPA 4RVTA 5EW8A 5K5NA 2ZDTA 2WEIA 1FQ1B 3FJQE 2ZM1A 3BIZA 3QD0A 2V5QA 3D5XA 4QPMA 1GNGA 2X1NA 4BI1A 4AS0A 3EB0A 3HA8A 4BL1A 5ETCA 1U5RA 4ZY6A 2UZLA 3TKIA 2QONA 2GDOA 4FV2A 2UZDA 1O6YA 2W1FA 4F9CA 3TNWA 3MH3A 5HORA 1VJYA 4JX7A 2W1DA 2PUUA 4R6VA 3ZUTA 3D7TA 4I4FA 3ZO3A 5JGDA 4NKAA 3UE4A 4XS2A 5CSXA 4BCQA 3QQHA 5EDPA 2RG6A 3LQ5A 4FIEA 4KIQA 1G8SA 4C57A 4GCJA 3VS6A 4X3JA 4OTWA 4I0RA 4JS8A 4X0MA 1OL1A 5E8SA 1IA8A 1Q61A 4W4VA 2YEXA 3MPMA 3R7UA 4OUCA 2R3NA 2C0OA 4PPBA 4DFYA 3QWKA 2JLDA 4RJ8A 2QOHA 3VBQA 3WILA 2RL5A 3LZBA 2YCQA 3F3WA 4QNAA 4U44A 4X2GA 2O0UA 4WG5A 4O7YA 5C9CA 4BCMA 5HTIA 3Q9YA 4MK0A 5JZNA 3SG8A 5D12A 3UO6A 2XM8A 4YC8A 2Z7SA 5C1QB 3DTWA 4FEUA 4DE4A 3K54A 4JQEA 3C5IA 5K4JA 3RK7A 3QKLA 3R8UA 2QO9A 4V0GA 4X6RA 4EBVA 3ORIA 4Y85A 3OROA 4BTKA 1UU7A 4NUSA 2W4JA 1NA7A 3ATSA 2V55A 1KOBA 3G0EA 4IB5A 2BALA 5CLPA 5AR5A 3EYHA 3KREA 2BTSA 5JQ5A 3O51A 4GU9A 4EC9A 2WKMA 3G5DA 5IMEA 3OW4A 4BCJA 2A19B 2JDVA 2JIVA 1QMZA 3D9VA 5TO8A 4L43A 4RJ4A 5CEMA 3L8VA 5KMJA 1AQ1A 1PKGA 2VD5A 5E8VA 3MJ1A 5HEZA 2XIKA 4DFZE 2ZV7A 5FLFA 4QMWA 5DRBA 3LQ8A 3E8EA 5DOSA 5DYJA 3D14A 4DLIA 3NYXA 4RIOA 3NIZA 5C03A 5HGIA 2IVVA 5KMLA 4X2KA 4HVSA 3LCSA 4WT6A 3W2QA 3P5JC 3I6WA 4XLIA 3RAWA 4O7NA 2C6DA 3RM6A 2OBJA 3CPCA 5HX6A 4ANMA 5HO6A 3DBFA 3EIDA 2FSMX 2ITVA 3W0MA 4A4OA 4X2NA 4FTMA 2XK9A 5EOLA 4ANSA 4J7BA 4ZSJA 5GIPE 3ULIA 3MSSA 3AD4A 2X8IA 2XNPA 3OS3A 1Q24A 5IUHA 4XG6A 4D4SA 3PWYA 5FG8A 5CEKA 3QQKA 2I7QA 1E9HA 4P5ZA 4L42A 4F1MA 4AGWA 4NH1A 4UMTA 3E8DA 2GS6A 3MPAA 3Q4TA 4AQKA 4C4EA 3BKBA 3Q2JA 3JXWA 3NDMA 3PJ3A 5BYYA 3ACJA 1SM2A 4PL5A 1FOTA 2X8EA 3KMMA 3LAUA 4I6QA 2IJMA 5L6PA 4DHFA 2DQ7X 3AMAA 5L2TA 2R9SA 2OZAA 1J1CA 3BGQA 4ZJJA 4NYEA 3DDQA 4FKQA 3RZFA 3VBWA 5CXZA 3ZHPC 4PMPA 2UW7A 3IW6A 3PA3A 4KRDA 5J9ZA 2BUJA 2HWPA 3FZTA 4FV5A 4GMYA 3PJCA 5M09A 2AEGA 5EQPA 3BGZA 4ZEGA 5A3XA 2FA2A 2C5YA 1OPJA 5CU2A 3F2NA 2R0UA 4DBNA 1A9UA 5HD4A 3P7AA 2VO7A 3LFCA 4FSZA 5FTOA 2J0JA 4O0YA 4QMYA 2R4BA 3IQ7A 4ZTHA 4ZMFA 3R9RA 4YJPA 4OTIA 3PVGA 4BWXA 2YDIA 4A07A 2PVRA 2A1AB 3AC4A 4HYSA 3E5AA 2G2HA 3AQVA 4Q5HA 4DEDA 4PTEA 4EK5A 2FSTX 3KRRA 2F2UA 4O0TA 3PDTA 4EK4A 3W2PA 5HE3A 3QQUA 2C6OA 4TN6A 1PF8A 5E92A 1GZOA 3U9CA 3PXRA 3QRTA 4N4SA 4FOCA 5CQUA 4GT4A 3RMFA 1B38A 4XG9A 1YHWA 5FTGA 2C5NA 1XH9A 4GUEA 4X2FA 2F4JA 4O7RA 4EH2A 3IW8A 4O21A 5DT3A 2NP8A 3Q5IA 3EOCA 4V04A 4IADA 4BGHA 3W1FA 5JSMA 1J7IA 4ACDA 1G8JA 4FT0A 1H01A 1OB3A 2LGCA 2WQOA 3PJ8A 4UXLA 1GIHA 3H9OA 3UNKA 3ZFXA 1IG1A 3FQEA 4J98A 1W2FA 4PUZA 2BZHB 4F9BA 3F82A 3MIAA 4C3FA 3DDPA 3UVPA 4A4LA 4G3DA 2E9OA 5KMMA 5LVMA 5I9XA 2OLCA 3DY7A 3P79A 4JXFA 3HDMA 5LARA 4FIHA 2RFNA 2W1EA 5KMKA 2P2HA 4RIWB 1YXSA 5BX0A 3FZPA 5GZAA 2VUWA 2ZV9A 3NUXA 2BAJA 4GFOA 5AUZA 2JIIA 5IEXA 4RA4A 2V62A 2X6EA 2QOBA 5AP3A 2PMIA 2PUIA 4V01A 5D10A 3Q9ZA 1O9UA 2ITXA 3TG1A 4ASXA 4AXCA 4TZRA 4DH8A 4G34A 3FKLA 4QP8A 4QMLA 4UZHA 3V8SA 2CJMA 2XS0A 3MVJA 3GBZA 1SZMA 4PX6A 2B4SB 2XNNA 3QU0A 2G2FA 2BRMA 1YXXA 3NZ0A 2GHMA 5HKMA 2B53A 2R3MA 1Y6AA 2QR7A 3EYGA 3BYSA 4DH3A 2WMUA 3HEGA 4NFNA 4YJQA 2JKKA 2C3IB 3CXWA 3ML1A 3RPVA 4AXAA 2DUVA 2YLFA 3GVUA 5HVJA 3ZRMA 2H6DA 2XK4A 2QVSE 4PMMA 3RPRA 3IO7A 3JR1A 3NLBA 4XG7A 4ZAUA 4ANLA 1IEPA 2UZVA 2WQBA 3P78A 3WIGA 4MXZA 1W2DA 3OD6X 2OH4A 3MB7A 4FSTA 4KB8A 1FVVA 4XCUA 3R8LA 2BPMA 4JJRA 4RIXB 3SRVA 3UC3A 4F64A 4UALA 3VVHA 5HVKA 3I0QA 2ITOA 2OFUA 2PHKA 4FUXA 4TYHA 3TDVA 3UG2A 1FVTA 4HNFA 4XX9A 2E9NA 3UO5A 2XYUA 1OIYA 3D5UA 3EJ1A 4N70A 1RDQE 3F7ZA 5A14A 3KQ7A 3RAIA 2YM3A 4DF3A 2OJFE 3E87A 2UV2A 3NW7A 5I0BA 2RSVA 3KF4A 3LIJA 3PVBA 4E73A 5KNJA 1BKXA 4D0XA 3CTJA 3E63A 4C62A 1WVXA 3GCPA 4K8AA 4AZVA 3DKOA 3F5GA 4AFEA 3DKGA 5FP6A 5DR2A 5KMOA 3NUUA 3DLZA 1OL2A 5F20A 4CFWA 3R1NA 2JKMA 4PMSA 3FI2A 4HCUA 3IDPA 2E2BA 4NM7A 4U43A 4FKOA 2PVJA 2YIYA 3FSFA 4AZFA 5AV4A 2ITNA 3MFUA 1YHSA 2VGOA 1PXLA 5HE2A 3DNDA 2REIA 2UZUE 3HV5A 2C5OA 3ANQA 2FYSA 1H07A 3R7EA 5M08A 2R7IA 4TTHB 4GFMA 4A9UA 3QD2B 3GC8A 2Y6OA 3MN3A 3OCTA 3VC4A 4AZWA 3ENHA 5KMIA 5J1VA 2YM5A 3RAKA 3PXFA 4K18A 2BFXA 3UOHA 5K4IA 5IQDA 3AMBA 3FI4A 4LMNA 1XO2B 2YHVA 5DI1A 3RPYA 4F7LA 1KE7A 3RBWA 4Z7GA 4FNXA 3ODYX 3BWFA 2Z02A 3PFQA 4QDVA 3R8ZA 4HW7A 1H1QA 5HNGA 4HVGA 3G6HA 4IJ9A 4WNKA 5JEBA 3EN9A 4YZMA 2UZBA 4C59A 3F9NA 4ZJIA 5A4EA 4BWKA 4CLIA 4DLJA 2C6KA 5H8GA 5IH6A 4FSMA 3TJDA 4CFNA 5HU9A 1YVJA 3C51A 3W32A 5A46A 3AC5A 3DK7A 1GOLA 3HMNA 4R1VA 2C6EA 3C5UA 3NEWA 2PY3A 2HZNA 4JIKA 2JFMA 4KKHA 4HPTE 4O83A 4WA9A 3V5PA 3POZA 2X6DA 3SD0A 5L2QA 3V01A 4HYHA 3UDTA 3ALNA 3JUHA 1WBPA 4ZS0A 3KK8A 1ATPE 4O81A 4XH6A 4FTLA 2HZ0A 3VNTA 4GG5A 2XIXA 1BI8A 4OBQA 4YU2A 2HELA 2F7EE 4FRFA 3CY3A 3CQWA 4ANOA 4BZDA 2ITYA 3MV5A 3FEGA 4EOMA 4DDGA 1UU8A 2PL0A 3QQGA 4DFNA 5EQEA 5HBJA 3QRKA 3QUEA 1M7NA 3DAJA 2X4FA 3ANRA 4XP2A 5C8NA 2BRBA 2UW3A 5J5TA 2OK1A 3CC6A 3OBJA 3CJFA 2C5XA 2F7XE 2UZWE 4TRLA 4YLKA 3AC8A 2UZOA 1UVRA 5GJDA 3WF8A 4QP1A 4Q5EA 2OG8A 3EFJA 4LL5A 1OECA 3LMGA 4RJ6A 5L2SA 4DA5A 2HIWA 5DNRA 2P4IA 3BEAA 1OVEA 5I3OA 2CKOA 1U59A 1JAMA 2H9VA 2IO6A 4M69A 4FTIA 4P4CA 3EHAA 4P2KA 4QQJA 4A9RA 4EH4A 4EOSA 3GC7A 3ZC5A 1QL6A 4FBXA 4W4YA 4R7IA 4ZOGA 3WI6A 4WUAA 5L2IA 4C8BA 2PZIA 3FC1X 4CMUA 2FO0A 4EZ5A 3QZHA 3NWWA 4W8EA 3G90X 4CMTA 3GOKA 3KULA 5HICA 4FV8A 5EYKA 3LQ3A 4DTAA 3LM0A 1W82A 3KY2A 5L6WL 2WB8A 1OKZA 4ZTSA 4BCKA 5CASA 4YTCA 1H26A 2PULA 5HG9A 3F5PA 4LFIA 3DXNA 4FEWA 4M3QA 4MXXA 2GTNA 3AT4A 4BYJA 2UW9A 2J5FA 5BUEA 2X2LA 2XCKA 5CU0A 2JGZA 3QRIA 4K1BA 2OIDA 4YHTA 4BCIA 4P5QA 3HV7A 1UNGA 2VO3A 3UG1A 4IWDA 1KWPA 4CTBA 2A27A 1OUKA 1PMEA 3PXKA 4D4VA 5IA3A 5IMXA 4TPTA 4BCGA 4UBAA 4WNMA 3WBLA 2EB3A 1OL5A 5KKRC 3MY0A 1J3HA 3TIYA 3OXIA 3QWJA 4I6LA 5EW9A 4HZRA 3N4UA 4EHVA 3UIBA 3O8UA 5HIEA 4CXAA 3FXZA 4O4FA 2W99B 5AIKA 1VYZA 1LR4A 3EFKA 3EQCA 3KA0A 3ET7A 4KIKA 5AV3A 1XMMA 3SGCA 4XHKB 4DEEA 5AUTA 1Q41A 3LFNA 4D1SA 2KTYA 3D15A 1BLXA 4Y46A 5EK7A 4ZY4A 3F3TA 4NTSA 2Z7QA 3UMWA 4O7VA 4Z55A 2P2IA 2W06A 2BZJA 3A2CA 4J71A 4ZZMA 4EOQA 4U45A 1BMKA 5TF9A 2VWVA 4PTCA 4DHJA 2F49A 3EQPA 4HYUA 4PDOA 4YO6A 4D2WA 1O6KA 5E91A 1TVOA 4YJRA 4PNKA 5BMSA 3NGAA 4ENYA 4MNFA 5IQBA 4MXCA 4CSVA 1YHVA 3EN5A 4MWIA 1OL6A 4AWIA 1TKIA 3HKOA 4IMYA 4DYMA 2NO3A 3K2LA 2FB8A 4QQCA 3G6GA 2OSCA 2C3LA 5M51A 4FSYA 3ZEWA 2PUNA 3Q6UA 5BVNA 2X4ZA 3Q32A 4FTKA 5KBRA 2ZOQA 4LG4A 4XG3A 1XHAA 3D7TB 1OPKA 4O38A 3ZUUA 4YSJA 4KUJA 3LOKA 4AN3A 5EM8A 5F94A 4AT5A 3ZU7A 5FUTA 3Q53A 2G01A 2WEVA 3UIMA 2VWYA 2YM7A 2OKRA 3HAMA 3PPKA 3T9IA 4O86A 4EJ7A 1GY3A 3DZOA 4CVAA 5J9YA 4BJJB 5AFVA 5H3QA 3MPTA 1NVRA 2UZTA 5AR4A 4ZZOA 4EOPA 3IDBA 3TUBA 4YUQA 2PE1A 3QGYA 3IGOA 4FTJA 3DU8A 5CI6A 1STCE 3NW5A 3GC9A 4FIFA 5IQEA 1VEBA 5GJGA 5AR8A 1XH7A 2QOOA 1JKLA 2YAAA 4L3LA 1OITA 3R7OA 3LW0A 4BF2A 3S3IA 2YM4A 5IQAA 4EQUA 5CAOA 4YBJA 2XVDA 4UMUA 3Q2MA 3QD4A 1H08A 3DS6A 3HV4A 1BYGA 5AP6A 4E1ZA 3W2RA 2GNLA 3GFEA 3R8VA 2BAQA 3RM7A 4BHNA 3QUDA 5E8YA 5E90A 5M4FA 3MH0A 3EL7A 5AR2A 3VO3A 2CNVA 3PTGA 4GS6A 2NRYA 5HIB