3NDMA

Crystal structure of rho-associated protein kinase (rock1) with a potent isoquinolone derivative
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
398
structure length
383
Chain Sequence
MSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEEETFPIPKAFVGNQLPFVGFTYYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substituted 2H-isoquinolin-1-ones as potent Rho-kinase inhibitors: part 3, aryl substituted pyrrolidines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Rho-Associated Protein Kinase (ROCK1)
total genus 108
structure length 383
sequence length 398
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ndmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ndmA01
4AN3A 4KIQA 4N0SA 3QUEA 2R0UA 1XJDA 2YAAA 2QNJA 2BDJA 2YABA 4AT3A 5FEDA 3RAIA 3LPBA 5CEKA 2ZV7A 3GI3A 1PXKA 4WT6A 4CT2A 2VTPA 1OIYA 4FKJA 1LEZA 1Q24A 2J0LA 2C5XA 4FL1A 5HNGA 3G9LX 4WNKA 4AW0A 4PTCA 4IW0A 2ZMDA 4FL2A 3F3VA 4LRMA 4S2ZA 5GJGA 1WBVA 5I9YA 5F9EA 4MYGA 4LV5A 5KHWA 4EUUA 4QYEA 2X9EA 2XKCA 2UZUE 3LXPA 4H1MA 2OJIA 5E9EA 3VJOA 3GNIB 2XUUA 3GB2A 2YZLA 3C0GA 5IA3A 3KN6A 3CJGA 5AP6A 1R0PA 1V1KA 3ACJA 4PMSA 2WMUA 5DG5A 2YISA 1TKIA 5CALA 3BKBA 4F1TA 4QQ5A 4G1WA 4ZZMA 3SW4A 2XEZA 2YM3A 3MVHA 2C0OA 3QX2A 4JT3A 5E92A 5KMKA 2GHMA 5AMNA 1RJBA 4FTNA 4YLJA 2XVDA 3PUPA 4USFA 2GS2A 4I6BA 4IC8A 3FXWA 5KZ0A 1DAWA 4XCUA 4YNEA 2X4FA 4D5KA 2ZM4A 5C8NA 4L8MA 2GS6A 3ORNA 4GMYA 4RJ4A 4ZSLA 2YCFA 5AR2A 3RGFA 4MNEA 3IKAA 3WF6A 4NFMA 2R3GA 4GEOA 3FMMA 4L6QA 4ASXA 4U97A 4ANMA 3H0YA 1LP4A 3I6UA 5EM7A 4RT7A 3MI9A 3VRZA 4BTMA 4UMUA 3ATSA 3E63A 3FEGA 1OL2A 4JR3A 2BPMA 1U59A 5M55A 1XKKA 3CTJA 5HCYA 4GVAA 4EOPA 1KUTA 1F0QA 4CLJA 3EFLA 3PXYA 3ZH8A 2ITQA 2Y4IC 3TTIA 2EB3A 3A7FA 4UEUA 3PJ2A 2WQBA 3CC6A 3S4QA 4CFVA 4CQGA 1YDSE 3M11A 2G2HA 4EOKA 4P90A 4EQUA 2JAMA 4HJOA 4AWIA 5A46A 4CMTA 3CGFA 3FMNA 4TPTA 4HVHA 4MNFA 2F9GA 2O65A 1YHVA 3UVRA 5FDXA 4BCKA 1OM1A 1ZXEA 4HOKA 2VD5A 5AR3A 2O8YA 2PZPA 4FYOA 2WKMA 3FQSA 5HVYA 1LR4A 1Q8ZA 3OWPA 3PXZA 4AGUA 5J8IA 3M42A 2VTNA 4RSSA 4ZTMA 4BDDA 2VX3A 4PQNA 4CFNA 4DH8A 4DFZE 2XNGA 3DBFA 4AW1A 4C8BA 3NX8A 3NAYA 2IO6A 4RJ6A 3KK9A 3FLYA 2WMVA 3EL7A 2BUJA 3DDPA 4TKSA 5AR5A 2UW3A 4V0GB 1YWVA 2YCQA 4U6RA 5FD2A 4D4YA 5HOAA 3VBXA 4D1XA 2J51A 3ORTA 2VTRA 1RQQA 3D14A 2OFUA 4K6ZA 1A06A 3FE3A 2YJRA 4NJ3A 3A7IA 2C6EA 2IVTA 4H39A 4AF3A 1JLUE 3AT2A 4EOJA 5BVEA 4X21A 2O2UA 3F69A 4FTMA 3NW7A 3ZBXA 3I7BA 4HVIA 4LG4A 3TJDA 3W8QA 4BKJA 4UXLA 4QTDA 1YXVA 1PMNA 4G5JA 2FSTX 3HDMA 4CFUA 2JITA 3EQIA 4WA9A 4I6FA 3ZLXA 1ZMVA 1IR3A 1R1WA 3D0EA 3IW6A 1U54A 4BZDA 4XH6A 5EYKA 2ZVAA 1OGUA 4JX3A 2QOLA 1KE8A 3KULB 4L46A 4IZAA 3QWJA 4NTSA 3DTCA 3Q9XA 2QO2A 4BBFA 4RIYA 1GZ8A 2WAJA 4K11A 3Q60A 5KMIA 4M8TA 4XMOA 4MXXA 4U79A 4ERWA 4IXPA 5CZIA 3VW6A 4FX3A 5AUZA 4J71A 4YPDA 5JFVA 1JAMA 4PMTA 1JVPP 2JKOA 5FQDC 2UW9A 2GTMA 3I79A 4QP3A 2BFXA 4FV8A 5I9WA 2YM4A 4ITJA 1Q62A 4H3QA 3QC4A 4A4XA 5CSWA 3IDCA 5TE0A 5HE2A 2W1IA 3TDVA 3BHHA 4XG2A 5L8KA 2YAKA 5JK3A 2BKKA 5BUJA 1CSNA 4BDGA 4I5HA 5LCKA 3ZU7A 3NIZA 4LGDA 4EC9A 4E4LA 2E9OA 5GZ8A 4S30A 2W0JA 2WGJA 5CVGA 3AT4A 5TF9A 4CFMA 2A0CX 4ZLYA 2QODA 2HW6A 3HAVA 1W8CA 3HP5A 4FUXA 4U40A 3C4EA 4XOYA 2IW9A 3S1HA 3LJ0A 4QMSA 3PLAE 2PE1A 5DE2A 3VS6A 4C02A 2Y6OA 3R1YA 5E8ZA 3GUBA 4F7NA 1KV1A 1SVHA 3WZKA 2WTJA 3DK6A 3DBDA 4FKRA 3DGKA 3ENHA 5HLWA 2QCSA 4MXZA 4AZEA 3PLSA 4YPSA 3FMDA 2V7AA 3F3TA 3FZ1A 4F70A 3QTRA 4XG9A 4PTEA 2OZAA 2BRNA 3BBWA 4PP7A 2HAKA 3R7UA 3FZOA 1OL6A 3L9LA 5M4FA 2IVSA 1PJKA 3V5LA 3R7OA 3R9HA 3FAAA 3BE9A 4D2VA 5DMZA 1UNGA 4N6ZA 1K9AA 3EFWA 3UGCA 1YDRE 4YZ9A 2ITZA 3ZEWA 4TTHB 3QGYA 4U44A 4FGBA 4YTFA 4ASDA 1DI9A 3FL5A 2PK9A 3ERKA 5BPYA 3ORZA 3PA3A 2OK1A 3MA3A 4JG6A 1XH9A 1ZOGA 3FMHA 4TYEA 3DBEA 5E1EA 4FSYA 1NVRA 4YSJA 4P2KA 2QOOA 2XYNA 5EYDA 2YIWA 2WMAA 2XJ1A 3ALOA 3EIDA 5CX9A 2WU6A 3WBLA 4AA5A 4FT3A 2OKRA 4DG0E 4FVRA 1SM2A 4M15A 3JS2A 5FGKA 3K5VA 3Q4ZA 3C51A 4PL4A 3BHUA 3S95A 3WZDA 5JFWA 5KMLA 3W18A 2E9NA 1DS5A 4WNPA 4G9RA 3KMWA 2VWWA 4MF1A 3W2SA 4W4XA 4I24A 4CMUA 3SG8A 4XG6A 3FJQE 3JPVA 4QD6A 1PXIA 5EFQA 1PW2A 4NSTA 3EHAA 3P7CA 4O0SA 2XIRA 4ZY4A 1CDKA 4QRCA 2C30A 4DINA 2J7TA 3F5GA 3TNQB 2Z7RA 1YOJA 4PPCA 1QMZA 4ANNA 3W2RA 3OW4A 3TN8A 2GDOA 5CSPA 2H96A 3KMUA 4WBOA 4IFCA 3LCKA 3FL4A 4DCEA 2BAQA 3RWPA 4G3CA 4O7NA 4JRNA 3CD3A 4CV9A 5ANJA 3KVWA 4EK8A 3PVBA 3RZFA 3R7EA 3ZXZA 4BCGA 3R8VA 1Q8UA 4U3ZA 5AM7A 3TZ9A 4N4SA 5B0XA 2RFSA 3OHTA 4BN1A 5DRDA 3VUMA 3C0IA 3LCOA 4JIKA 5A4LA 5KMNA 3VAPA 3BYVA 5BMSA 4ZS0A 2BDFA 2IZRA 3GU4A 4QMUA 3C5IA 5HG5A 4ZJVA 3EQGA 3DFCB 5EKNA 4W4VA 1G5SA 1NT2A 4QQJA 4F7SA 1SNUA 2GNGA 3N51A 1CTPE 2HW7A 5CEMA 2YWPA 3WE4A 3CQEA 2BIYA 4BIDA 4IWQA 2GQGA 2XIYA 3CD8A 4O0VA 3V8TA 3O51A 5LVLA 3G6GA 2WMTA 1SYKA 4FTCA 5DLSA 4NL0A 5CI6A 3N9XA 3VUIA 2R3IA 4ORKA 4OTWA 2C5YA 4A9TA 4ZP5A 1XH7A 3G0FA 4APCA 3FLWA 4RX5A 3QAME 4CTCA 5AX9A 1T45A 1NA7A 4R1VA 4S33A 4C4FA 5IPJA 1Y6AA 3DB6A 3IW4A 3KXHA 3EQFA 3QU0A 4D4RA 4Y8DA 3QL8A 4NWMA 5EDQA 3QUDA 2B1PA 1BX6A 5H8GA 1XHAA 4FSMA 5JGDA 2NRYA 5GJDA 5J9ZA 4UBAA 2G9XA 2WZJA 3Q9YA 1ZY4A 2XNOA 5CAQA 4CRLA 1VR2A 4JS8A 2NNWB 2XMYA 1YQJA 3HMNA 3NNWA 1APME 4BCOA 3SG9A 2GNLA 3MGYA 3D94A 5E4HA 5CF6A 3BI6A 3NYNA 4O7SA 1G8AA 1V0OA 2J50A 4TW9A 1J1CA 5BQ0A 3UO4A 3RM7A 1H25A 3IDPA 3CP9A 3G90X 4L53A 4YJRA 3ZUTA 4AAAA 4AZTA 2PUPA 5GINE 3RP9A 4R7HA 4G3DA 5HO8A 4JRVA 4MXYA 3BWJA 4FF8A 3TV7A 4DFUA 4PX6A 5K9IA 4F64A 3QD0A 4QMOA 1J7IA 5L2IA 4AN9A 3BGZA 3C0HA 3RK5A 2Y7JA 1REJA 3CPCA 3NMUF 2W5BA 2OJFE 1OMWA 4CYJA 2NRUA 4KS7A 1BL6A 2UV2A 3NYVA 4D1SA 1Q3WA 1H07A 4E5AX 5TO8A 2P3GX 3A7HA 2XKDA 4KUJA 4YGAA 4X6RA 2F4JA 3PJCA 4MXAA 4D9UA 5AADA 5J79A 1PXNA 4YZNA 4EH5A 1OPLA 4I21A 2OGVA 4OTHA 4ANBA 2PYWA 4QYGA 3EQRA 3ZO4A 3LMIA 4RC3A 4EOLA 3JR1A 4BTJA 3UVPA 5KUPA 3QA0A 2GCDA 5LVOA 2YFXA 3DPKA 1YXUA 4AN2A 4ENXA 3R1QA 3ATTA 3P9JA 1AD5A 5F1ZA 3N4TA 1H00A 3VULA 4K1BA 1KWPA 1KOAA 2LGCA 4DTKA 1HCKA 3PDTA 1M2QA 5ANGA 5ICPA 3TM0A 3POOA 5DFPA 4NW6A 4U45A 3IO7A 1X8BA 1YHWA 4OTRA 2UZTA 3DDQA 4PTGA 3OOGA 2QR8A 3KRWA 4BCQA 3POZA 4H36A 1IA8A 1YWRA 3QQFA 4YHTA 3HV6A 5JFXA 1KE5A 2UZBA 1YXTA 5TKDA 2EXCX 4DAWA 4HVDA 3O71A 3Q6WA 3PXKA 4RJ8A 3VN9A 5I0BA 4FL3A 2GPHA 4TWPA 2YCSA 5HNIX 5DR9A 5BX0A 4IWOA 4ZMEA 4GJ3A 3TEIA 2X2KA 4O1OA 5ACBC 2W4KA 5CEPA 2OFVA 3LHJA 3MFSA 4TT7A 4DH3A 2UZWE 3WARA 4D55A 3AOXA 5LWMA 4KIOA 4XHKB 5LQFA 5HHWA 2O0UA 1CKIA 2XM9A 4YTIA 2IW8A 4FZ6A 4LQMA 4LRKA 2VTMA 4RGJA 3SDJA 4YJTA 2FUMA 2WQOA 5HD7A 4IJ9A 2GQRA 3NNXA 1YKRA 3GC9A 2X39A 3ANQA 2BZJA 4AT4A 2VNWA 4BWKA 2X7GA 4YSMA 3W2OA 3OEFX 4GW8A 4I1ZA 4XP0A 2XBAA 2XK8A 3K2LA 5HLNA 3NVMB 3ZFYA 2UVXA 4V04A 3PY0A 4AFJA 3NPCA 3Q3BA 4YTHA 5F4NA 2IPXA 3R30A 5EM5A 4EJNA 4RA4A 2UVYA 4AT5A 4GS6A 3P1AA 4BDBA 2C69A 4G6NA 3I0QA 5EM6A 4PMMA 5ACKA 3SXSA 4EH6A 1O6KA 3CQWA 4HPTE 5FRIA 4O96A 2GNFA 1H8FA 1P2AA 4FV4A 4CYIA 1GZNA 2B4SB 2JGZA 3EQPA 3FLNC 4X0MA 1JBPE 3FI3A 4EZ7A 3IW7A 4IAFA 5C1QB 3A99A 2WXVA 1M2PA 3T9IA 4BHNA 1FPUA 4ALVA 2IJMA 1OIQA 4RQVA 4A9YA 2BR1A 4QT1A 3ZC5A 1B6CB 3DV3A 3FI2A 4IAIA 4C7TA 2YEXA 4X2JA 4M68A 5IKWA 3B2WA 1G8SA 1ZARA 2OG8A 1QPEA 5I9ZA 3FKLA 3L9NA 3V01A 2WEVA 5CU4A 4YP8A 3FHRA 5BMMA 3SXFA 3PVWA 2GQSA 4F6SA 3QKMA 3MY0A 3HZTA 3QC9A 3M1SA 3W32A 4JJRA 4E4XA 2PVLA 3QTQA 4QNAA 2J0JA 3PY3A 5FWKK 2QHNA 3DCVA 1WBPA 4JDIA 3R7VA 3W2QA 3S00A 3V5TA 1AQ1A 2VO7A 4TZRA 2HELA 4KKHA 4JX7A 3MFUA 3KRJA 4TYGA 2EVAA 4DFYA 3NNVA 4FTOA 4EBVA 5CANA 5IUGA 4E6DA 4FV1A 3FMEA 3LQ8A 4AXAA 4O7VA 4CCUA 2I40A 4U7ZA 3QYWA 5E8SA 4EONA 1FGIA 3NLBA 3QD3A 4ZTHA 4KKEA 4FSZA 5HX8A 5IISA 4V01A 4OUCA 3TACA 4FKLA 3L1SA 1YVJA 5FTQA 1ZOEA 4FT7A 5B7VA 2CLQA 2WHBA 1Q4LA 1FOTA 4IDTA 5EDPA 5H8EA 3VQUA 2JKMA 4AU8A 5J9LA 2HZNA 3FUPA 3L9MA 3BE2A 3I1AA 2QONA 3OWLA 2VNYA 4QMQA 3TTJA 3HV4A 4AP7A 2XP2A 3DJ6A 3SC1A 3CSVA 3KXZA 5A9UA 4D9TA 2YIXA 5JT2A 2PVKA 3E7VA 4XEYA 2WELA 4M13A 4USEA 4KNBA 3HA6A 3PIZA 2PVFA 3II5A 4KABA 2C5VA 4EH9A 2ERZE 2JIIA 5I3RA 2AUHA 2JIVA 4G2FA 3MH3A 3S0OA 4O7WA 4IACA 3PA5A 2I6LA 5DT4A 2ZAZA 3AG9A 3SAYA 4QMPA 2QG7A 3EQBA 5ANOA 1E1VA 2W7XA 4U80A 4M69A 3ENMA 3TUDA 4F09A 3WIGA 5EK7A 3ORKA 3ZRKA 5CF5A 5M08A 2WMRA 2FGIA 1REKA 1VZOA 4GYGA 3NUUA 4WG5A 4OAUC 2C6MA 4CRSA 3VS3A 4WNOA 3NW6A 4X7QA 3I6WA 5DA3A 4KB8A 3C4WA 3LM0A 4ZTSA 4JXFA 5L8JA 2BHHA 1UU8A 1WBWA 2DYLA 3N4UA 3MVJA 2VX1A 3BU3A 4YHFA 2WQMA 2XJ2A 4YC6A 3RPVA 3UYSA 4DFLA 4AQCA 3QKLA 5C9CA 4MXOA 3Q4TA 3EJ1A 2HYYA 2OXXA 2R3OA 3CJFA 3O0GA 5CT7A 5DRBA 3W2CA 2VN9A 1DAYA 4JNWA 4NFNA 4G34A 3OWKA 4K33A 2OF2A 4QQTA 3PZHA 1STCE 1H1SA 4EK5A 3COMA 3WOWA 3ZRLA 2R4BA 4EOSA 5CU6A 5HTCA 2BRBA 5ITAA 2X8DA 3OMVA 3LMHA 2UZLA 3L8PA 2ONLA 4AACA 4FZDB 4DG2E 5AUYA 4IAAA 5E8VA 4XP3A 2WIHA 2NP8A 4J8MA 1B38A 5DBXA 3SHEA 4RZVA 5FBOA 1KE9A 5CY3A 2CSNA 2UW4A 3UQGA 2REIA 3R22A 2A19B 4FZAB 4RZWA 3H10A 2X2LA 3MTFA 1H1QA 3QD2B 4WUAA 5HD4A 4A9RA 1FQ1B 4JVGA 2ACXA 4TL0A 2Y4IB 5B2KA 3R7GA 4MBLA 1O6LA 5H8BA 5HIEA 1UU3A 5AA9A 4RG0A 1MQ4A 2PE2A 3EKKA 4FKUA 5L2QA 1F3MC 2R3RA 4YZCA 5JQ5A 4ACGA 5CWZA 3MFRA 4FV2A 4J95A 2R3FA 3R73A 4RC4A 2Z60A 4MVFA 2CPKE 3HRBA 4D4SA 2GMXA 3KXNA 4IIRA 1BL7A 4PPAA 4AOJA 4BCFA 5JZJA 2WMQA 3PWDA 5CXHA 3VUTA 4L7SA 2Z7LA 5A4CA 2WB8A 3BLHA 4XJ0A 4EYMA 3RNIA 3A4OX 3C50A 3U9CA 3ZFMA 3DNDA 3MH2A 2EXMA 3O8TA 2J2IB 3AQVA 3DKGA 2V22A 4FG9A 4DN5A 3R6XA 3UNZA 5FM3A 2VO0A 4I0RA 4EZ3A 4XV3A 3D15A 1E1XA 2WTKC 4S31A 5IA5A 5AP1A 5BVWA 2R3KA 3JYAA 4E20A 4LOQA 5AEPA 4GSBA 4OAVB 4ZLOA 4MD8E 4Z7HA 4ANSA 2HOGA 5I9XA 3UIUA 4B8MA 3H4JA 1AGWA 2YJSA 3WIKA 3UO6A 4WD5A 2G15A 3SKCA 4DH1A 3LLAA 2C4GA 5DEYA 4BHZA 3NWWA 3D2IA 2VTIA 4L52A 2F49A 4FE2A 3MH1A 2KULA 3IONA 5FM2A 3UZTA 3OBJA 2P55A 5IEYA 2X2MA 3KULA 1M7NA 5GHVA 4U8ZA 3HV7A 5HGIA 4ZSEA 4NCTC 3BYSA 1GIHA 1H1WA 3MW1A 4FNXA 2ITOA 2X1NA 4UZHA 5AUVA 2RSVA 3KRRA 4I6HA 5D41A 4C38A 1CMKE 2GS7A 2BVAA 2IZTA 4IWDA 5CEQA 3REPA 4DEIA 1H4LA 3KVXA 3HKOA 3JVSA 5E8XA 1PKGA 3PP0A 5CLPA 3FI4A 3Q53A 4LGHA 1GIIA 4O21A 3RCJA 4HYIA 4PL5A 3EFJA 1MRVA 3S2PA 4TRLA 1Z9XA 4A7CA 3NUAA 4PNIA 2C3IB 4GVJA 3GU6A 4QQCA 4NM0A 4WRGA 4BTFA 3QF9A 4ZTNA 1OBDA 3G9NA 3FC1X 5CQUA 4ARKA 3DZQA 4YTCA 5HTIA 3VQHA 5EQYA 3AC2A 4I5CA 5HI2A 4F1MA 4QYYA 1SZMA 4NKAA 3EN7A 4DGLC 5DEWA 3E87A 3K3IA 4H3BA 2DUVA 3COHA 4IX4A 3KEXA 3EZVA 3LXLA 4QTBA 2PE0A 5K4IA 4EKKA 5B2LA 4PDOA 3C4XA 2I0YA 4O22A 3TXOA 4XG8A 2JBOA 5H9BA 3UC4A 4JIAA 4IVCA 3FMJA 4KIPA 1A48A 3F7ZA 4EK6A 4HCVA 2JDRA 3V6RA 2X7FA 1UU9A 4C0TA 3CTHA 3SVVA 2W1EA 2LAVA 2C47A 5I9VA 4E4NA 4IFGA 5IUIA 1XQZA 1ZRZA 4DGNA 4F65A 5C8MA 5CEOA 4EHGA 4CKJA 4CFWA 1P4FA 3SXRA 3DXNA 4ENYA 3DT1A 4L01A 2B9FA 2XNEA 4OTPA 2QOHA 4Z16A 3TKIA 4D58A 4EORA 4LL5A 3OROA 4YZBA 2DQ7X 2ZM1A 3OXTA 2ITPA 3FKOA 5LMBA 3UO5A 4K0YA 3KK8A 2PVNA 3IOPA 2AYPA 3MPAA 3OY1A 4HGEA 2ETKA 3AXWA 4O0UA 3BQRA 3KGAA 3Q5ZA 3F61A 2UZDA 3NIEA 3NUXA 3F5PA 3U8WA 3LCTA 4L00A 5AUXA 2JDTA 4GUEA 2JDOA 2Y9QA 3EZRA 1BUHA 1M2RA 3D9VA 1P4OA 5IH4A 2JD5A 3NRMA 5JEBA 5FBNC 3BHVA 3I60A 4MF0A 4O0TA 2IZUA 2RG5A 4QP1A 2J9MA 1PYEA 3IK3A 4RRVA 3VF9A 1K3AA 3G2FA 1OI9A 4G6OA 3FXZA 4B6LA 1OL5A 4FTTA 3PVGA 4DCAA 3IDBA 5FEQA 2R3NA 3T9TA 4DGGA 5AAEA 3ROCA 4UXQA 4YBKA 4F08A 1UKIA 3BBTB 4QPAA 4EBWA 5K5XA 4LUDA 4O0YA 3EQHA 4UYAA 4AA0A 3WE8A 2B9JA 3V3VA 4RIOA 4FI1A 1J1BA 4GU9A 2UZVA 2UW6A 4EH2A 4EOIA 3C1XA 4G16A 4MH7A 4DE4A 1NW1A 4DTAA 4DLIA 4YBJA 4KS8A 3LXNA 3TKHA 2FH9A 4WIHA 3QRTA 5IH6A 4RVTA 4RIXA 5L6WL 5L6OA 1UWHA 4W8DA 4AA4A 4ITIA 1OIUA 1ND4A 2CMWA 3EFKA 3T3VA 5CT0A 4FTUA 3UDBA 4I41A 2BAKA 3V5JA 5CAOA 4O27B 3QGWA 4BDKA 3E8DA 4K2RA 4V05A 4AZFA 3DLZA 5AFVA 5JFSA 4U3YA 2DS1A 1FBNA 2BKZA 3MDYA 3BRBA 4K18A 5D9HA 4RWLA 2GNHA 4GYIA 3ZC6A 3E8EA 4E26A 4ANLA 4RWIA 2OLCA 3B2TA 3R63A 2W99B 3BLQA 4BCHA 2BILB 2QOCA 2VWXA 4U0IA 3PXRA 5CF4A 5EOLA 4UB7A 4AZVA 4RFYA 2I0EA 2WEIA 1PXOA 3P86A 4RC2A 4H05A 3UOJA 1PMEA 5A4TA 4C4JA 3HL7A 2OXYA 3KC3A 4BYJA 2FB8A 2PMLX 1OBGA 4PY1A 4I5PA 3VWAA 1NXKA 4FIHA 4I6QA 4TWNA 4BDJA 5LVPA 5E8WA 3PSBA 1M17A 4MXCA 5LVNA 3ZZEA 2B7AA 2ESMA 4KBCA 3VW8A 3H9OA 4D2WA 5IF1A 4E73A 3MIYA 2PVMA 3CY3A 1U54B 2PVRA 3LVPA 4E6CA 2J5EA 1JSVA 2CCIA 3W1FA 4X3JA 5HESA 2V7OA 2AC5A 3FC2A 2BMCA 3ZMMA 4BTKA 4DEAA 5B2MA 3OVVA 2QU6A 3AT3A 5DT3A 2ONLC 3TWJA 4ZZOA 4XUFA 5ANIA 3I7CA 4O86A 4EQMA 4G5PA 4QP6A 4S32A 4S34A 3QRKA 4RWKA 3D4QA 5EW9A 4ZK5A 3OY3A 4F99A 4R3CA 1YHSA 1YI4A 4E8AA 1OL1A 2G2FA 5IZFA 3I5NA 5KZIA 3ACKA 2QKWB 3PIYA 3PZEA 2JEDA 3L8XA 3BCEA 2XRUA 3DA6A 2H8HA 2PMOX 4Z9LA 4L67A 5M57A 2I0VA 4YHJA 4C3RA 3ULZA 3ZM9A 5EW8A 4QMTA 3E3PA 3HMMA 5AUWA 3BEGA 3TG1A 4BDFA 1H28A 2ZV2A 4U81A 3T3UA 4CCBA 2R9SA 3GXLA 3AGMA 2FSOX 3PJ1A 1WBNA 4FSUA 3SOAA 3SA0A 4A07A 2YCRA 4BL1A 2VWIA 3QXOA 1XBAA 4RVKA 2VGOA 2RFDA 3CQUA 3CS9A 4HYSA 3G6HA 4XX9A 4Y5HA 4E1ZA 5BVNA 4BGHA 3LFNA 4EHEA 5CAUA 4M66A 5J5SA 3AC4A 4FOBA 4G3GA 3ULIA 4WBBB 4HW7A 4ZLZA 3OT8A 5E7RA 3BHTA 3VHKA 4FIGA 4GK3A 4Q5EA 4LMUA 1R39A 5HORA 4L3JA 1PKDA 3FY0A 3NS9A 4H58A 4I0SA 3FLSA 5AR4A 4BGGA 3HECA 2W1FA 3PTGA 4BI2A 2W1DA 1Y8GA 1IEPA 3SX9A 5LOHA 3QCQA 4TYHB 3CGOA 2VWVA 5CASA 5HZNA 4E7WA 4LM5A 3RINA 4ZTLA 3IS5A 4BC6A 3QUPA 2UZNA 2X9FA 5I4NA 2HXQA 5M4UA 3GC0A 5E8UA 3VUKA 4JAIA 2PPQA 4UX9A 5D12A 4BWPA 3SRVB 4IB5A 5ETCA 3U87A 2QHMA 3MSSA 4L44A 4AE6A 4ZTRA 5DPVA 4BDAA 4BBMA 2HWPA 3JY0A 3QZGA 3SQQA 4CFXA 2R7IA 3VVHA 2WMXA 3QQLA 3WZJA 3RAHA 1WCCA 4DH7A 3ZO1A 3MV5A 4HPUE 4IE9A 3F66A 4NK9A 4ZMFA 1PY5A 2WO6A 5IQIA 2XEYA 2Z02A 4GK2A 4XOZA 3PIXA 3T8OA 3D5XA 1ZYJA 3K54A 3R0TA 4N70A 3TDWA 2YLEA 4YNOA 2YWVA 2F7EE 4BZOA 4KA3A 4BZNA 2HK5A 3FV8A 4BFMA 1OVEA 4EL9A 4IH8A 4F1OA 5J9YA 5JH6A 4IADA 3TIZA 1PMUA 4IVDA 4FKQA 4J53A 3VUHA 4X3FB 4ACDA 4CKRA 4DF3A 1SNXA 4N6YA 4UMQA 5FLFA 2O64A 5LMKC 3MIAA 1P14A 3KF7A 5C01A 5AP4A 3GVUA 1KOBA 1OKWA 4U43A 4GFOA 3G0EA 2R3HA 1H0WA 1PMVA 2XCKA 5CSXA 4OLIA 3DFAA 3DS6A 4CG8A 4NIFB 3KB7A 3F88A 5JZNA 4IJPA 4FODA 4FV3A 4EWHA 5G1XA 1QPJA 4G17A 4BI0A 3A61A 2H34A 4M0ZA 4BDHA 3UOHA 4I4FA 1PRYA 2YM5A 3TZ7A 4FBXA 2R3MA 5IA4A 2XK3A 5HO6A 3ZXTA 3LLTA 4PUZA 4CLIA 3ZLWA 2EUFB 4O38A 1ZMWA 5BNJA 2VTAA 4IAKA 2QOFA 1OUYA 2W1GA 3R2BA 5FG8A 3TNHA 4R78A 1Y91A 1BKXA 1PXPA 2HY0A 3E5AA 2BHEA 3EH9A 3MTLA 3ZRMA 5HE1A 5AUTA 1A9UA 4AFEA 4L42A 5M06A 1F5QA 4WHZA 5BVFA 3JVRA 2X6EA 5TR6A 5KO1A 3R01A 2GSFA 3R9NA 5GNKA 3UPZA 3W55A 3QTUA 3OUKA 5EQEA 5KX8A 3F3ZA 3DBQA 4ERKA 4EQCA 5JGAA 4NH1A 1WAKA 2HY81 1JSTA 4I0TA 4CNHA 4IZYA 4TYIA 3R9OA 4DT8A 5IQFA 2I1MA 3OCBA 2IZSA 3O50A 5IA2A 4YC8A 4A9UA 2O5KA 4F0FA 5JMSA 3W16A 3AC5A 4ZJJA 1ZYLA 4TYJA 5HBHA 4I20A 3G51A 4BRXA 2JDSA 4WO5A 4R3PA 4QP8A 2ZJWA 2VO3A 4F9CA 5IUHA 3QZHA 3R8LA 4Y72A 1W82A 5BVOA 3TL8A 3BV3A 3A8XA 3TNWA 2OJ9A 1TQPA 2C3KA 3GOPA 2WQEA 5F95A 3RBWA 3ZDUA 3NYOA 3FHIA 3H9FA 3D2KA 4M3QA 4Y46A 1IRKA 3VBQA 3TI1A 1OPKA 1Z57A 4PV0A 2HZ4A 2XRWA 4DEBA 4YJPA 2PWLA 3G33A 3PY1A 4FV0A 2FSLX 4BKYA 4UN0C 2WPAA 4C2VA 2VTTA 2Y8OA 3QQKA 2XK7A 1QPDA 2RFEA 3VBTA 4CGAA 1FMOE 4J52A 3GU5A 4FVPA 4USDA 3P0MA 4YZDA 1H26A 4DT9A 3GCQA 3VS5A 4EKLA 4EWQA 2V5QA 3PP1A 5E91A 1Q99A 5BUIA 4YC3A 3D7TB 4O7RA 2YITA 3EOCA 1XH4A 1VYWA 2YDJA 2CGVA 3AD6A 1ZYSA 3R2YA 1Q97A 2J0KA 2VTJA 3AGLA 3TZMA 3LJ2A 3TNPC 1U46A 2PVYA 1PF8A 3UZPA 1GY3A 1L8TA 2ITVA 2OU7A 2PMNX 4R7IA 4YUQA 5I9UA 3FZSA 2PSQA 3QQUA 5HO7A 4ACCA 4BVUA 4FEVA 5FP6A 2CCHA 1WFCA 3A7GA 4HGSA 3VS0A 1NVSA 2PMIA 2YIQA 3RM6A 5L3AA 2QC6A 4MEDA 3OS3A 2A2AA 3Q04A 2P0CA 1KV2A 3BU6A 3MYGA 5CU0A 4K77A 3HVCA 4ZTQA 3TKUA 2GHLA 4GFMA 3R8UA 2IW6A 5AV3A 3MESA 2O63A 4ZAUA 1YOMA 2VGPA 3IW5A 5BUEA 4R7BA 2XF0A 2H9VA 2DWBA 3DZOA 1OB3A 1O9UA 4QTEA 3QRUA 1FMKA 5KE0A 4C4EA 2F2UA 3F3UA 4EOMA 1GJOA 2CN5A 3QYZA 2ITTA 1OPJA 1UNHA 5F94A 3UG1A 3C4CA 4P5ZA 3VRYA 3LFAA 4YO4A 4JDJA 5E8YA 4XBRA 3F82A 2PUNA 3QTSA 5FTGA 4H1JA 3EWHA 4IANA 3OUNB 4FK3A 2OH0E 2BAJA 4IAYA 3R8PA 2G01A 2O3PA 4FICA 3QLGA 3VS1A 3C7QA 1YXSA 2R5TA 3DAEA 3B8QA 3F6XA 3QBNA 1M14A 4KIKA 4Y73A 2QR7A 3PPKA 3O17A 2JFLA 4X2NA 4AE9A 1VYZA 4APPA 4IB0A 4P7EA 4LUEA 2B9HA 1ZZLA 2OICA 4DEHA 4JBVA 3DLSA 4CXAA 1XWSA 2CGWA 3CTQA 3D7ZA 3ZONA 4B7TA 2X7OA 4F9YA 2F7ZE 3GCPA 2IG7A 4IB3A 4FIFA 3HX4A 2X81A 3BX5A 4FKVA 3HLLA 3R21A 4QPMA 2FO0A 3DKOA 3LXKA 4NT4A 3H9RA 1RE8A 4AZSA 5L2WA 2OI4X 3WI6A 3QCSA 4DG3E 3RJCA 3ORIA 4M7IA 3EN9A 4KBAA 4OGRA 4JL9A 5IA0A 5GJFA 3CKXA 4M0YA 5DWRA 3R7IA 3OP5A 4DBNA 2R3PA 4DEGA 4UY9A 3E92A 5D1JA 5CSVA 1WBOA 3BLRA 3ODYX 3ZFXA 5HX6A 4MX9A 3P7BA 1YRPA 2OXDA 4AG8A 3LCSA 4C35A 4IBMA 2P33A 5HE3A 4PF4A 4PP9A 3NYXA 3O96A 3QRJA 4O81A 1PXMA 5T3QA 2YDIA 4RIXB 1ATPE 1J91A 3V5QA 5HBJA 1FVTA 1XO2B 4QYHA 2P4IA 3WZEA 4DBXA 1OKVA 3OD6X 3AMAA 3F5XA 5EOBA 1T46A 1ZLTA 3R1NA 3QTZA 1DM2A 4IZ5A 5FP5A 4HZSA 1NVQA 5AR8A 5IQDA 5BYYA 4L43A 4QTAA 4W9XA 5C4LA 4LOPA 3GCSA 3LM5A 2WOUA 4MQ2A 4D5HA 4NM3A 4EI4A 5IMXA 4GV1A 2FVDA 2HCKA 2WOTA 5IEXA 4O0RA 3F7WA 3R9DA 2XK9A 3C5UA 4RMZA 2YN8A 2OBJA 4QMXA 4RIWB 3DAKA 3QZIA 4GT3A 2XB7A 4KBKA 5CTPA 2C1AA 4PDPA 4F0GA 3DAJA 2CKEA 4OBPA 4O7YA 4BY9E 2YERA 4MBJA 5AP5A 2QO9A 2HWOA 4UALA 4ZY5A 2BDWA 2W06A 3GGFA 4RX8A 1Y6BA 5DGZA 3HRFA 3HNGA 4JBOA 2OZOA 2PVHA 2VRXA 4XG7A 3V8SA 4FIIA 3WYXA 2QI8A 4A06A 4F0IA 2OO8X 3PRIA 2E9VA 3BV2A 1MRUA 3LZBA 4PWNA 4TNDA 4AW2A 3SGCA 3MN3A 3EMGA 2R64A 2RKUA 4NCTA 3VHEA 4GG5A 5EHOA 4FZ7A 1O6YA 3RZBA 2WTWA 3GCVA 4I92A 4IM3A 4CFFA 3W33A 5HU3A 3P79A 2OSCA 4U5JA 1Z5MA 5EH0A 4OTQA 1I44A 4D0XA 4LMNA 3Q2MA 4D2PA 3ORLA 2OF4A 4XRJA 3V6SA 3R1SA 1R3CA 4DFNA 3RPYA 3EL8A 2RGPA 2HENA 3D5UA 4QMWA 3QTIA 4JDKA 4K8AA 2CDZA 4GG7A 2XK4A 3VJNA 4CD0A 3ITZA 4BWXA 2WNTA 4BICA 5GZAA 4J96A 5JQ8A 5HG7A 5C4KA 1UWJA 4FNZA 1Q8TA 3THBA 5EKOA 4V0GA 4RJ7A 4ACMA 4A4OA 3UMWA 2SRCA 3OBGA 4HVSA 3ET7A 2P2IA 2XA4A 1J7LA 4EHZA 1YDTE 3DKCA 1W7HA 3P08A 4BKZA 5FDPA 2PZ5A 4QMLA 5K0XA 1QPCA 4IEBA 4W4YA 4W9WA 2UW7A 4Z7GA 4J99A 4WSQA 1FINA 4F7JA 3DQWA 4YLLA 5CS6A 5CU2A 4RX7A 2PULA 2AC3A 3EYHA 1BMKA 3L8SA 5D7AA 5EYCA 3UOKA 5J7HA 2W4JA 4A9SA 4C2WA 2VTLA 4QMVA 3UYTA 3N4VA 3FDNA 2QU5A 5KKRC 4AUAA 4TXCA 2CKPA 3O23A 3O8UA 2CGXA 4O6LA 2GFCA 5HG8A 3I0OA 3TNIA 1XH8A 3GCUA 4FV7A 3ZSIA 4B99A 4FSWA 4D2TA 2PZIA 3WF5A 1V0PA 3RMFA 5A54A 4L7FA 2XNPA 4FEWA 1GNGA 3QCXA 2EU9A 1IASA 4YMJA 2OW3A 2B54A 2VU3A 2V0DA 4L3LA 4OT6A 3FLQA 4JDHA 5AIRA 3UNJA 3UE4A 2CNUA 4CT1A 4I23A 3G15A 4FKWA 3L8VA 3LJ1A 3IPHA 2VTSA 4YJUA 3FZPA 2G1TA 3JUHA 4X2FA 1PYXA 2PUUA 5DVRA 3K5UA 5M4IA 5M09A 5GIPE 3Q52A 3Q5IA 1I09A 4F63A 2NO3A 5FXRA 5M44A 1EH4A 1GZOA 5IDNA 4BGQA 1OKZA 2Z7SA 4E3CA 2RIOA 5A6NA 2GFSA 3D5WA 3IW8A 4M97A 5AP0A 5AP7A 3ZYAA 1GZKA 2ZV8A 4UV0A 4UWBA 5KBQA 2WU7A 3KQ7A 2YIYA 3Q4CA 2VTHA 3Q9ZA 4AW5A 2F57A 4C3PA 2C68A 3MPMA 2YZAA 5J1VA 3V5PA 4E4MA 3GFEA 4GIIA 2J4ZA 4U41A 4D1ZA 3PE1A 4IMYA 1H08A 2WFYA 5D10A 5LMAA 4DGMA 2OIDA 3KFAA 3W2PA 5L8LA 4ONAA 4RPVA 4HCUA 5EI2A 2V62A 2IWIA 2OJGA 3FI8A 5L2SA 3HMIA 2NPQA 3LQ5A 5L4QA 2ITNA 4O6EA 1OIRA 4OTGA 4GUBA 4WOVA 2J6MA 3SV0A 4J8NA 2FSMX 4O84A 3UIBA 3CLYA 1YW2A 3F5UA 3FSKA 4IZ7A 3ZEPA 1Q61A 1S9JA 3PXFA 4HYHA 4EH4A 4MWIA 4R1YA 3JY9A 3KXGA 1Q8WA 3NNUA 2XKFA 3U6HA 1BYGA 4FVQA 3OWJA 2I7QA 3OCGA 4PRJA 3NR9A 4IVBA 1MRYA 2HZIA 3QHWA 2CN8A 3EN5A 1URCA 2QVSE 5DHJA 3UP2A 3ZO2A 4OBOA 5HU9A 3QQGA 3EYGA 5CU3A 2BRMA 1QCFA 2JIUA 1CKPA 4CQEA 4CSVA 1XH6A 2X6DA 4O83A 4WG4A 1YI3A 1JKLA 4CTBA 4FKIA 2W5AA 2BTRA 3HMPA 3QKKA 4JOAA 3UG2A 4BBEA 3DB8A 1Q41A 4BDIA 4EHVA 3ZOSA 5AV4A 4X3FA 1YXXA 5L6PA 4OR5A 2EB2A 4BCJA 4F6UA 2BRHA 2JAVA 5CSHA 3FBVA 4BIEA 4G31A 2P2HA 3GQLA 5D11A 4OTIA 4HZRA 4RVLA 5E90A 5J1WA 3FPQA 3MJ2A 4IM2A 3F2RA 5HICA 2XCHA 5CI7A 1U4DA 3LKMA 1H27A 2OZAB 3NEWA 4HNFA 4D28A 4YZMA 4LV8A 2WMBA 3WF7A 4FOCA 4PPBA 2J0IA 4GL9A 1OZ1A 5GZ9A 3KMMA 3ZUVA 3F2AA 4KWPA 4Q9ZA 2XJ0A 4FMQA 4AX8A 4GK4A 3ZUUA 5HEZA 4NW5A 4ZJIA 3SRVA 5CF8A 3ZCLA 4X2KA 3UTOA 3LOKA 3R71A 4FK6A 4EJ7A 3NUPA 3U4UA 5M07A 3IQ7A 3BWFA 4JR7A 3NDMA 3Q2JA 3BZ3A 3R83A 2ZDTA 4DEDA 2XZSA 2JKQA 4Z55A 3TV4A 3OCSA 2JLDA 4TYHA 2VAGA 4TN6A 2J90A 4FV6A 3VUGA 4QMYA 3MPTA 5CAPA 2A1AB 1GIJA 4NKSA 2XK6A 4L3PA 5CNNA 4I3ZA 1GOLA 2R2PA 2GNJA 2B53A 4FG7A 4UMPA 5AV1A 4XV1A 1ZY5A 4EOQA 4J98A 4QO9A 2ETRA 3MVMA 2QLUA 2YM6A 3PSCA 2PL0A 1ZYDA 4FTLA 3NAXA 3R8ZA 1FGKA 1U5QA 2VZ6A 2XYUA 2QOKA 4JBQA 4M69B 3ZSHA 4PDYA 5FTOA 2W1CA 5C26A 4ASZA 2HIWA 1XBBA 3OC1A 4DGOA 2FA2A 5C8KA 1WBSA 1XR1A 5CXZA 3A62A 3NGAA 5J95A 4YJSA 5EQPA 2PUIA 4DFBA 3CIKA 4FSRA 3UODA 5E1SA 3PG1A 4YURA 3I4BA 3C4ZA 2ITWA 3HA8A 3LCDA 4G3FA 4RFZA 3RVGA 3E8CA 1S9IA 5H2UA 3U6JA 3P4KA 2BALA 2PZRA 2HXLA 1ERKA 3QQHA 4QOXA 4EEVA 4FIEA 2UW8A 4ID7A 3D5VA 4IHPA 4FTIA 3QTWA 2B52A 3KRLA 5DIAA 3HAMA 1UU7A 1K2PA 2BZHB 4GT4A 4IX5A 1W84A 5ETAA 4F9AA 4JI9A 4F6WA 4BCNA 1H0VA 5HCZA 4EC8A 4GRBA 1DI8A 1CM8A 3HYHA 3LFFA 2JBPA 4CG9A 3UMXA 2ZB1A 3E64A 2W05A 4MK0A 5K3YA 5AAGA 2QOQA 3R28A 4ZY6A 5KMJA 2PVJA 4X3FC 3VF8A 1ZZ2A 2VTOA 4WUNA 5HCXA 4AZWA 2QG5A 1GAGA 3OTVA 3S3IA 3FYKX 3PVUA 4D4VA 4E6QA 3TIYA 3U6IA 4CVAA 4FEXA 4GH2A 4L45A 4ZIMA 3VBVA 2ZM3A 2Q0BA 3ANRA 5KCVA 4F7LA 3FXXA 2XIZA 2Q83A 5T68A 5HG9A 2XH5A 5HNBA 2R0IA 2UVZA 3TUCA 3E3BX 3QTXA 5EG3A 2YIRA 3GQIA 5FEEA 3ZM4A 3KKVA 4C3FA 4EOOA 5FXQA 3OZ6A 1HCLA 3NCZA 5A6OA 4Q5HA 3AC3A 5A14A 4J97A 1VJYA 3E62A 4EH8A 3RKBA 3UQCA 5AAFA 5D7VA 4ASEA 2RF9A 5AP2A 3RNYA 4ITHA 1PXLA 5KMOA 4FUYA 5CAVA 1OKYA 5BYLA 5HIBA 5A4EA 1WVWA 2W17A 2H6DA 2IVUA 5IG1A 1Q3DA 3C9WA 4XP2A 4LOOA 5K4JA 5I3OA 3I5ZA 3SD0A 5CVHA 2W5HA 5DI1A 2RFNA 3IGGA 4WSYA 2PY3A 4IX6A 3UPXA 3OXZA 3RK7A 3K3JA 3KCKA 1XBCA 1W98A 3VBWA 3DU8A 4FGRA 4IM0A 5AA8A 3MVLA 4TNBA 1OL7A 1ZWSA 2CHLA 1H24A 3LW0A 4QP2A 4KD1A 3ELJA 4ANOA 3UNKA 4MD7E 3GEQA 4FKGA 4Y5QA 3FLZA 5ETIA 2G2IA 3ORPA 3DXPA 3V5WA 2GU8A 4CMOA 4I4EA 3TUBA 1SVGA 1Y8YA 3MS9A 1NY3A 2GTNA 3FYJX 4L9IA 3VC4A 4YR8A 5IQAA 2X0GA 4BCPA 3AD5A 3BPRA 4D2SA 3RWQA 1RDQE 3DY7A 5K5NA 4CZYB 4JQ7A 5TT7A 1W0XC 3EKNA 3PWYA 2C6KA 4WKQA 5CENA 2VWBA 3BYMA 4HNIA 3SLSA 3RALA 4XLVA 3P78A 4FSNA 5EYMA 4M14A 2BFYA 4C59A 5IDPA 4I94A 2QD9A 4O1PA 3OF0A 2VO6A 4LFIA 4MBIA 3QRIA 2ETMA 3BGQA 4GT5A 4BCIA 2WD1A 4RLLA 4ZS4A 3UC3A 2RG6A 3DQXA 4QMZA 4UYNA 5AP3A 3RTPA 3U55A 2OIQA 3BYOA 3ZLYA 4EK4A 4RIWA 4O2ZA 2KTYA 5AIKA 3WF9A 5LCJA 4O7TA 1JKSA 3QHRA 2X4ZA 3DBCA 4FT5A 4O7ZA 3UZRA 1TQMA 3CY2A 5J5TA 2F7XE 2EWAA 3O2MA 1LPUA 3CEKA 3A60A 4U9AA 3RPOA 3HP2A 3Q6UA 1Q8YA 3HGKA 1OUKA 3QQJA 1UKHA 3RAKA 4DH5A 1U5RA 1FVVA 4K9YA 3RPRA 2E2BA 5G6VA 2PTKA 4JBPA 3COKA 2CKQA 3UP7A 2EXEA 2XNNA 3BHYA 3LE6A 1BI7A 3RPSA 4LYNA 3QA8A 4QYFA 5KNJA 1JNKA 2XKEA 3H30A 2VWUA 3QZFA 3ORMA 4IQ6A 4Y95A 4AGCA 3G5DA 4UMTA 2OIBA 5BYZA 5AR7A 3TCPA 4Q9SA 1XH5A 1ZOHA 1MP8A 2XIKA 3KXMA 1M52A 3M2WA 4UWYA 4C61A 1PHKA 3DOGA 5LJJA 4JG8A 4NEUA 5ETFA 1URWA 2CNQA 5KKRB 3BIZA 3MH0A 3OOMA 3KREA 3HDNA 2Z2WA 5EI8A 3B8RA 3BQCA 2R3LA 4D2RA 5GIOE 3F9NA 1G3NA 3RAWA 5LMKA 1FVRA 5HVKA 4TY1A 4C57A 4DEEA 3DNEA 3OFMA 3GP0A 4PNKA 3HUBA 3RHKA 5IU2A 4QMNA 4NM5A 4KSPA 4W8EA 5EI6A 1BLXA 4KAOA 3EB0A 1PXJA 2W9ZB 4GU6A 4HGTA 5ANEA 3SW7A 5FUTA 1LEWA 3VNTA 5LVMA 3DJ7A 2B9IA 2QKRA 3DXQA 2VTQA 3PA4A 3HUCA 5HIDA 3V04A 2W1ZA 2VUWA 4MAOA 4C34A 3O7LB 5JKGA 1VEBA 4JAJA 5JN2A 2ITYA 3R00A 4A4LA 3VIDA 1QL6A 5EM8A 5KMMA 5IQGA 4E93A 3QXPA 3AMBA 3O8PA 4CEGA 3HV5A 3QX4A 2XNBA 5A4QA 3QALE 3P7AA 3CKWA 2VWYA 2W9FB 5AM6A 5EHYA 4JQ8A 4R8QA 3MY1A 3BU5A 3AD4A 4GCJA 3ZTXA 2WTVA 3QD4A 4FKSA 4PL3A 2ZYBA 4MD9E 4XG4A 4II5A 4FR4A 4FV5A 5CNOA 4FG8A 3DKFA 4YO6A 3C13A 3QLFA 1IA9A 4C4HA 4BIBA 2A27A 4FTAA 5DR6A 1J3HA 4PDSA 5E8TA 1IAHA 5CZHA 4BR3A 4IB1A 5AX3A 5HQ0A 4RA5A 3VO3A 4C37A 4MCVA 1ZYCA 3AMYA 3MFTA 4FEQA 3NUNA 4M84A 3QCYA 4C4IA 2WTKB 3R04A 5HVJA 4U42A 4BYIA 4RLKA 5CYIA 1KE6A 4FKTA 2CLXA 2ITUA 4FTJA 3OTUA 4HGLA 3HRCA 4C33A 2UZOA 2WMWA 1IAJA 3FMLA 4LL0A 4OT5A 3FQHA 4RX9A 3BGPA 1Y57A 2WQNA 3QWKA 4F4PA 4NYEA 2JKKA 4GKIA 5BVKA 1HOWA 2Z8CA 5DOSA 3TJCA 3D83A 1W83A 3E7OA 3NCGA 3RK9A 3VBYA 3COIA 4RBLA 3VUDA 4UMRA 4M67A 3IOKA 2UUEA 3D7TA 3OW3A 1KE7A 3MJ1A 4FIJA 5JRQA 1H1RA 2IN6A 3ZDIA 4BI1A 4E5WA 4YU2A 5HTBA 5K0KA 4TWOA 4MWHA 3SOCA 2OJJA 1KSWA 1L3RE 2JC6A 1YWNA 2XNMA 3F3WA 4KRDA 4ZSGA 4XS2A 1WZYA 3F2NA 3WZUA 4RQKA 3U54A 2QURA 5DN3A 3BELA 1LUFA 3UJGA 3PPJA 4IX3A 4HYUA 4FKPA 5HKMA 2ERKA 3MB7A 3PG3A 1WMKA 4FTKA 1TVOA 4RJ5A 5HE0A 2JFMA 4NUSA 2WTIA 2YDKA 4B0GA 2CJMA 2F2CB 4ZEGA 3PSDA 5IH5A 2C6OA 5IQBA 2ITXA 5IMEA 3KN5A 5DR2A 3PJ3A 2ZB0A 2C0IA 2CGUA 4P5QA 3FZRA 3PE2A 4IAZA 2XM8A 2J0MB 4EUTA 4IWPA 5JSMA 3KRXA 3P5KA 2ZV9A 5KBRA 1RW8A 2BZIB 1R0EA 4FC0A 4MTAA 3RI1A 4C62A 1YI6A 3ROYA 3ZS5A 4AOTA 4NTTA 5LXMA 1JPAA 5AV2A 2XBJA 4L68A 3CCNA 3MBLA 2C0TA 1SVEA 3LFDA 3PFQA 5EDRA 1P5EA 3Q4UA 3CBLA 5IQEA 4HCTA 4GIHA 1V0BA 4R3RA 3ETAA 5C03A 1R78A 4QMMA 3A2CA 5JRSA 3MB6A 3A8WA 3DTWA 2VWZA 3KA0A 1B39A 3CR0A 2JDVA 4NZWB 5H3QA 2C1BA 2QOBA 4OBQA 3VS4A 4PMPA 5L2TA 3LFSA 4EYJA 3FWQA 3BYUA 4B9DA 1JQHA 3HEGA 4CV8A 4O82A 3AC1A 2QOIA 2ZMCA 4XLIA 4EH7A 4QP7A 2WTDA 1JKKA 2W1HA 4QP9A 2PU8A 2XS0A 3GC7A 4NIFA 1JSUA 2GHGA 4IVAA 4LRJA 4NU1A 3NVKI 5IQHA 3NSZA 2Y6MA 3V51A 2BRGA 4Y85A 1BI8A 4FV9A 4QP4A 5DT0A 1TQIA 1WVYA 3Q9WA 4FTRA 5EHLA 1UVRA 3MWUA 3P23A 4G6LA 5J7BA 3GFWA 3OT3A 2VX0A 4FSTA 3U9NA 3MA6A 5J87A 4KSQA 4FNYA 4O0XA 4NJDA 1M7QA 3W8LA 5HBEA 3C4FA 4DYMA 2PHKA 5DYJA 2YA9A 4BF2A 3KXXA 2UW0A 2C6LA 5HLPA 4DHFA 5AWMA 3LQ3A 5CQWA 3HV3A 3GU8A 3FQEA 3UQFA 4JG7A 4ZXTA 4YLKA 2C3LA 2QQ7A 3AC8A 2BCJA 3ALNA 3E88A 1OITA 4C36A 5M56A 4P4CA 2Y4PA 4LGGA 4FT0A 3H0ZA 3WILA 2PZYA 5C27A 3ZZWA 4EH3A 2V55A 4FTQA 3R9RA 2J5FA 4H3PA 3IGOA 4GJ2A 4J1RA 2W96B 4F9WA 4Z3VA 3NZ0A 3IECA 2OWBA 4F9BA 3NUSA 3Q32A 2C6TA 3ODZX 2YM8A 1JWHA 1JKTA 4UWCA 3UIXA 1ZAOA 4DFXE 3VS7A 3EQCA 4X2GA 4ZZNA 4KIKB 4KKGA 4XV9A 4OW8A 2VV9A 3LIJA 5KHXA 5FXSA 5M53A 4RIYB 2BZKB 2CNVA 5LARA 3GC8A 4UZDA 2C6DA 3QFVA 3KCFA 3DJ5A 2WIPA 3HMOA 4FKOA 3TZ8A 4FNWA 4N57A 4KRCA 4ACHA 4I93A 2C6IA 4ZSAA 3KL8A 4RFMA 3E93A 2OH4A 5I5ZA 1SMHA 5ANDA 3LFBA 4KINA 2IVVA 4BCMA 4E6AA 4FT9A 3PPZA 3WYYA 5IEVA 4FEUA 3EN4A 1UNLA 4O7LA 4C58A 3LFCA 3DK3A 4ALWA 2BIKB 4B8LA 4OTFA 3EN6A 3ZLSA 4MQ1A 4O91A 5M51A 2C5NA 4XV2A 4CZTA 1MUOA 1Q5KA 3FZTA 3LAUA 2QLQA 3KF4A 1H01A 4GKHA 3R02A 4HVGA 1WVXA 5ANKA 4LI5A 2E9UA 3L9PA 5DH3A 3EQDA 5JGBA 3GENA 4DC2A 3OG7A 3CPBA 4ZOGA 3RHXA 5A3XA 3ZSGA 4XYFA 4AOIA 4NM7A 2E9PA 4CZUA 4E5BA 1UA2A 4TWCA 4GFGA 1IG1A 1ZMUA 3U51A 3UOLA 4R5YA 4I5MA 4JLCA 5T6KA 2R3JA 3FY2A 3A7JA 3V8WA 4C4GA 4M12A 4AGWA 5EW3A 2X8EA 4AGDA 5DNRA 3ID6C 2C5OA 2YM7A 2Z7QA 4W4WA 4YJNA 1OECA 3W10A 3TV6A 3GT8A 2UW5A 3E8NA 2YHVA 5AV0A 4X6QC 1YOLA 4ALUA 4FA2A 2ZDUA 3PXQA 4ANQA 1H1PA 4YJOA 2HZ0A 2R3QA 2R7BA 5M4CA 3TT0A 3R8MA 4WNMA 3ZBFA 2WMSA 2RL5A 4DITA 3Q96A 3OEZA 4WG3A 4EK3A 4IDVA 3NW5A 3FKNA 4XNEA 2FYSA 4BDEA 4G9CA 5TOZA 5LWNA 3OXIA 2Q0NA 4R6VA 4DA5A 4RJ3A 4D0WA 2YACA 4CKIA 2GNIA 4FZFB 4QNYA 3R7YA 4WRSA 2BROA 4BDCA 3NUYA 3U4WA 3LFQA 2A4LA 4BB4A 4DTBA 4OTDA 2UZEA 3CXWA 4ZSJA 5AUUA 1UV5A 3JXWA 3DK7A 4R77A 4MHAA 4FYNA 2ZOQA 4AS0A 4B4LA 3FMKA 1J7UA 3BEAA 2YLFA 2CKOA 4QPSA 2X8IA 3GOKA 4RVMA 4JQEA 3FPMA 3O7LD 4I22A 5F20A 1MQBA 3A4PA 2I0HA 2W4OA 3H3CA 4J7BA 5BVDA 3MY5A 3UIMA 5CEIA 3CE3A 5IQCA 4YJQA 2QO7A 4R5SA 4O0WA 3UBDA 3WF8A 4MNEB 4IC7A 3OCTA 2BTSA 3GU7A 5AJQA 4FSQA 3PYYA 1E9HA 4YJVA 3ZO3A 3LFEA 4XRLA 3ZHPC 4EZ5A 3RCDA 2C3JA 3ORXA 4Q2AA 3KU2A 2B55A 1JOWB 3PRFA 3KY2A 4XBUA 2XIXA 5IA1A 3VS2A 4DLJA 3GBZA 3FSFA 3I81A 1WBTA 4O2PA 4XG3A 5CVFA 2B0QA 3PJ8A 2Y0AA 3LMGA 4Y83A 4MKCA 4QTCA 1CKJA 4RWJA 2WTCA 3UVQA 3IG7A 4G3EA
chains in the Genus database with same CATH superfamily
4AN3A 4KIQA 4N0SA 3QUEA 2R0UA 1XJDA 2YAAA 2QNJA 2BDJA 2YABA 4AT3A 5FEDA 3RAIA 3LPBA 5CEKA 2ZV7A 3GI3A 1PXKA 4WT6A 3ML1A 4CT2A 2VTPA 1OIYA 4FKJA 1LEZA 1Q24A 2J0LA 2C5XA 4FL1A 5HNGA 3G9LX 4WNKA 4AW0A 4PTCA 4IW0A 2ZMDA 4FL2A 3F3VA 4LRMA 4S2ZA 5GJGA 1WBVA 5I9YA 5F9EA 4MYGA 4LV5A 5KHWA 4EUUA 4QYEA 2X9EA 2XKCA 2UZUE 3LXPA 4H1MA 2OJIA 5E9EA 3VJOA 3GNIB 2XUUA 3GB2A 2YZLA 4DHZA 3C0GA 5IA3A 3KN6A 3CJGA 5AP6A 1R0PA 1V1KA 3ACJA 4PMSA 2WMUA 4R78A 5DG5A 2YISA 1TKIA 5CALA 3BKBA 4F1TA 4QQ5A 4G1WA 4ZZMA 3SW4A 2XEZA 2YM3A 3MVHA 2C0OA 3QX2A 4JT3A 5E92A 5KMKA 2GHMA 5AMNA 1RJBA 4FTNA 4YLJA 2XVDA 3PUPA 4USFA 2X0PA 2GS2A 4I6BA 4IC8A 3FXWA 5KZ0A 1DAWA 4XCUA 4DDGA 4YNEA 2X4FA 4D5KA 2ZM4A 5C8NA 4L8MA 2GS6A 3ORNA 4GMYA 4RJ4A 4ZSLA 2YCFA 5AR2A 3RGFA 4MNEA 3IKAA 3WF6A 4NFMA 2R3GA 4GEOA 3FMMA 4L6QA 4ASXA 4U97A 4ANMA 3H0YA 1LP4A 3I6UA 5EM7A 4RT7A 3MI9A 3VRZA 4BTMA 4UMUA 3ATSA 3E63A 3FEGA 1OL2A 4JR3A 2BPMA 4MUQA 1U59A 5M55A 1XKKA 3CTJA 5HCYA 4GVAA 4EOPA 1KUTA 1F0QA 4CLJA 3EFLA 3PXYA 3ZH8A 2ITQA 2Y4IC 3TTIA 2EB3A 3A7FA 4UEUA 3PJ2A 2WQBA 3CC6A 3S4QA 4CFVA 4CQGA 1YDSE 3M11A 2G2HA 4EOKA 4P90A 4EQUA 2JAMA 4HJOA 4AWIA 5A46A 4CMTA 3CGFA 3FMNA 4TPTA 4HVHA 4MNFA 2F9GA 2O65A 1YHVA 3UVRA 5FDXA 4BCKA 1OM1A 1ZXEA 4HOKA 2VD5A 5AR3A 2O8YA 2PZPA 4FYOA 2WKMA 3FQSA 5HVYA 1LR4A 1Q8ZA 3OWPA 3PXZA 4AGUA 5J8IA 3M42A 2VTNA 4RSSA 4ZTMA 4BDDA 2VX3A 4PQNA 4CFNA 4DH8A 4DFZE 2XNGA 3DBFA 4AW1A 4C8BA 3NX8A 3NAYA 2IO6A 4RJ6A 3KK9A 3FLYA 2WMVA 3EL7A 2BUJA 3DDPA 4TKSA 5AR5A 2UW3A 4V0GB 1YWVA 2YCQA 4U6RA 1XMLA 5FD2A 4D4YA 5HOAA 3VBXA 4D1XA 2J51A 3ORTA 2VTRA 1RQQA 3D14A 2OFUA 4K6ZA 1A06A 3FE3A 2YJRA 4NJ3A 3A7IA 2C6EA 2IVTA 4H39A 4AF3A 1JLUE 3AT2A 4EOJA 5BVEA 4X21A 2O2UA 3F69A 4FTMA 3NW7A 3ZBXA 3I7BA 4HVIA 4LG4A 3TJDA 3W8QA 4BKJA 4UXLA 4QTDA 1YXVA 1PMNA 4G5JA 2FSTX 3HDMA 4CFUA 2JITA 3EQIA 4WA9A 4I6FA 3ZLXA 1ZMVA 1IR3A 1R1WA 3D0EA 3IW6A 1U54A 4BZDA 4XH6A 5EYKA 2ZVAA 1OGUA 4JX3A 2QOLA 1KE8A 3KULB 4L46A 4IZAA 3QWJA 4NTSA 3DTCA 3Q9XA 2QO2A 4BBFA 4RIYA 1GZ8A 2WAJA 4K11A 3Q60A 5KMIA 4M8TA 4XMOA 4MXXA 4U79A 4ERWA 4IXPA 5CZIA 3VW6A 4FX3A 5AUZA 4J71A 4YPDA 5JFVA 1JAMA 4PMTA 1JVPP 2JKOA 5FQDC 2UW9A 2GTMA 3I79A 4QP3A 2BFXA 4FV8A 5I9WA 2YM4A 4ITJA 1Q62A 4H3QA 3QC4A 4A4XA 5CSWA 3IDCA 5TE0A 5HE2A 2W1IA 1G8KA 3BHHA 4XG2A 3TDVA 5L8KA 2YAKA 5JK3A 2BKKA 5BUJA 1CSNA 4BDGA 4I5HA 5LCKA 3ZU7A 3NIZA 4LGDA 4EC9A 4E4LA 2E9OA 5GZ8A 4S30A 2W0JA 2WGJA 5CVGA 3AT4A 5TF9A 4CFMA 2A0CX 4ZLYA 2QODA 2HW6A 3HAVA 1W8CA 3HP5A 4FUXA 4U40A 3C4EA 4XOYA 2IW9A 3S1HA 3LJ0A 4QMSA 3PLAE 2PE1A 5DE2A 3VS6A 4C02A 2Y6OA 3R1YA 5E8ZA 3GUBA 4F7NA 1KV1A 1SVHA 3WZKA 2WTJA 3DK6A 3DBDA 4FKRA 3DGKA 3ENHA 5HLWA 2QCSA 4MXZA 4AZEA 3PLSA 4YPSA 3FMDA 2V7AA 3F3TA 3FZ1A 4F70A 3QTRA 4XG9A 4PTEA 2OZAA 2BRNA 3BBWA 4PP7A 2HAKA 3R7UA 3FZOA 1OL6A 3L9LA 5M4FA 2IVSA 1PJKA 3V5LA 3R7OA 3R9HA 3FAAA 3BE9A 4D2VA 5DMZA 1UNGA 4N6ZA 1K9AA 3EFWA 3UGCA 1YDRE 4YZ9A 2ITZA 3ZEWA 4TTHB 3QGYA 4U44A 4FGBA 4YTFA 4ASDA 1DI9A 3FL5A 2PK9A 3ERKA 5BPYA 3ORZA 3PA3A 2OK1A 3MA3A 4JG6A 1XH9A 1ZOGA 3FMHA 4TYEA 3DBEA 5E1EA 4FSYA 1NVRA 4YSJA 4P2KA 2QOOA 2XYNA 5EYDA 2YIWA 2WMAA 2XJ1A 3ALOA 3EIDA 5CX9A 2WU6A 3WBLA 4AA5A 2AQXA 3W0OA 4FT3A 2OKRA 4DG0E 4FVRA 1SM2A 4M15A 3JS2A 5FGKA 3W0PA 3K5VA 3Q4ZA 3C51A 4PL4A 3BHUA 3S95A 3WZDA 5JFWA 5KMLA 3W18A 2E9NA 1DS5A 4WNPA 4G9RA 3KMWA 2VWWA 4MF1A 3W2SA 4W4XA 4I24A 4CMUA 3SG8A 4XG6A 3FJQE 3JPVA 4QD6A 1PXIA 5EFQA 1PW2A 4NSTA 3EHAA 3P7CA 4O0SA 2XIRA 4ZY4A 1CDKA 4QRCA 2C30A 4DINA 2J7TA 3F5GA 3TNQB 2Z7RA 1YOJA 4PPCA 1QMZA 4ANNA 3W2RA 3OW4A 3TN8A 2GDOA 5CSPA 2H96A 3KMUA 4WBOA 4IFCA 3LCKA 3FL4A 4DCEA 2BAQA 3RWPA 4G3CA 4O7NA 4JRNA 3CD3A 4CV9A 5ANJA 3KVWA 4EK8A 3PVBA 3RZFA 3R7EA 3ZXZA 4BCGA 3R8VA 1Q8UA 4U3ZA 5AM7A 3TZ9A 4N4SA 5B0XA 2RFSA 3OHTA 4BN1A 5DRDA 3VUMA 3C0IA 3LCOA 4JIKA 5A4LA 5KMNA 3VAPA 3BYVA 5BMSA 4ZS0A 2BDFA 2IZRA 3GU4A 4QMUA 3C5IA 5HG5A 4ZJVA 3EQGA 3DFCB 5EKNA 4W4VA 1G5SA 1NT2A 4QQJA 4F7SA 1SNUA 2GNGA 3N51A 1CTPE 2HW7A 5CEMA 2YWPA 3WE4A 3CQEA 2BIYA 4BIDA 4IWQA 2GQGA 2XIYA 3CD8A 4O0VA 3V8TA 3O51A 5LVLA 3G6GA 2WMTA 1SYKA 4FTCA 5DLSA 4NL0A 5CI6A 3N9XA 3VUIA 2R3IA 4ORKA 4OTWA 2C5YA 4A9TA 4ZP5A 1XH7A 3G0FA 4APCA 3FLWA 4RX5A 3QAME 4CTCA 5AX9A 1T45A 1NA7A 4R1VA 4S33A 4C4FA 5IPJA 1Y6AA 3DB6A 3IW4A 3KXHA 3EQFA 3QU0A 4D4RA 4Y8DA 3QL8A 4NWMA 5EDQA 3QUDA 2B1PA 1BX6A 5H8GA 1XHAA 4FSMA 5JGDA 2NRYA 5GJDA 5J9ZA 4UBAA 2G9XA 2WZJA 3Q9YA 1ZY4A 2XNOA 5CAQA 4CRLA 1VR2A 4JS8A 2NNWB 2XMYA 1YQJA 3HMNA 3NNWA 1APME 4BCOA 3SG9A 2GNLA 3MGYA 3D94A 5E4HA 5CF6A 3BI6A 3NYNA 4O7SA 1G8AA 1V0OA 2J50A 4TW9A 1J1CA 5BQ0A 3UO4A 3RM7A 1H25A 3IDPA 3CP9A 3G90X 4L53A 4YJRA 3ZUTA 4AAAA 4AZTA 2PUPA 5GINE 3RP9A 4R7HA 4G3DA 5HO8A 4JRVA 4MXYA 3BWJA 4FF8A 3TV7A 4DFUA 4PX6A 5K9IA 4F64A 3QD0A 4QMOA 1J7IA 5L2IA 4AN9A 3BGZA 3C0HA 1W2DA 3RK5A 2Y7JA 1REJA 3CPCA 3NMUF 2W5BA 2OJFE 1OMWA 4CYJA 2NRUA 4KS7A 1BL6A 2UV2A 3NYVA 4D1SA 1Q3WA 1H07A 4E5AX 5TO8A 2P3GX 3A7HA 2XKDA 4KUJA 4YGAA 4X6RA 2F4JA 3PJCA 4MXAA 4D9UA 5AADA 5J79A 1PXNA 4YZNA 4EH5A 1OPLA 4I21A 2OGVA 4OTHA 4ANBA 2PYWA 4QYGA 3EQRA 3ZO4A 3LMIA 4RC3A 1OGYA 4EOLA 3JR1A 4BTJA 3UVPA 5KUPA 3QA0A 2GCDA 5LVOA 2YFXA 3DPKA 1YXUA 4AN2A 4ENXA 3R1QA 3ATTA 3P9JA 1AD5A 5F1ZA 3N4TA 1H00A 3VULA 4K1BA 1KWPA 1KOAA 2LGCA 4DTKA 1HCKA 3PDTA 1M2QA 5ANGA 5ICPA 3TM0A 3POOA 5DFPA 4NW6A 4U45A 3IO7A 1X8BA 1YHWA 4OTRA 3TYKA 2UZTA 3DDQA 4PTGA 3OOGA 2QR8A 3KRWA 4BCQA 3POZA 4H36A 1IA8A 1YWRA 3QQFA 4YHTA 3HV6A 5JFXA 4AXFA 1KE5A 2UZBA 3O5AA 1ST4A 1YXTA 5TKDA 2EXCX 4DAWA 4HVDA 3O71A 3Q6WA 3PXKA 4RJ8A 3VN9A 5I0BA 4FL3A 2GPHA 2XAOA 4TWPA 2YCSA 5HNIX 5DR9A 5BX0A 4IWOA 4ZMEA 4GJ3A 3TEIA 2X2KA 4O1OA 5ACBC 2W4KA 5CEPA 2OFVA 3LHJA 3MFSA 4TT7A 4DH3A 2UZWE 3WARA 4D55A 3AOXA 5LWMA 4KIOA 4XHKB 5LQFA 5HHWA 2O0UA 1CKIA 2XM9A 4YTIA 2IW8A 4FZ6A 4LQMA 4LRKA 2VTMA 4RGJA 2A98A 3SDJA 4YJTA 2FUMA 2WQOA 5HD7A 4IJ9A 2GQRA 3NNXA 1YKRA 3GC9A 2X39A 3ANQA 2BZJA 4AT4A 2VNWA 4BWKA 2X7GA 4YSMA 3W2OA 3OEFX 4GW8A 4I1ZA 4XP0A 2XBAA 2XK8A 3K2LA 5HLNA 3NVMB 3ZFYA 2UVXA 4V04A 3PY0A 4AFJA 3UDSA 3NPCA 3Q3BA 4YTHA 5F4NA 2IPXA 3R30A 5EM5A 4EJNA 4RA4A 2UVYA 4AT5A 4GS6A 3P1AA 4BDBA 2C69A 4G6NA 3I0QA 5EM6A 4PMMA 5ACKA 3SXSA 4EH6A 1O6KA 3CQWA 4HPTE 5FRIA 4O96A 2GNFA 1H8FA 1P2AA 4FV4A 4CYIA 1GZNA 2B4SB 2JGZA 3EQPA 3FLNC 4X0MA 1JBPE 3FI3A 4EZ7A 3IW7A 4IAFA 5C1QB 3A99A 2WXVA 1M2PA 3T9IA 4BHNA 1FPUA 4ALVA 2IJMA 1OIQA 4RQVA 4A9YA 2BR1A 4QT1A 3ZC5A 1B6CB 3DV3A 3FI2A 4IAIA 4C7TA 3W0MA 2YEXA 4X2JA 4M68A 5IKWA 3B2WA 1G8SA 1ZARA 2OG8A 1QPEA 5I9ZA 3KIOC 3FKLA 3L9NA 3V01A 2WEVA 5CU4A 4YP8A 3FHRA 5BMMA 3SXFA 3PVWA 2GQSA 4F6SA 3QKMA 3MY0A 3HZTA 3QC9A 3M1SA 3W32A 4JJRA 4E4XA 2PVLA 3QTQA 4QNAA 2J0JA 3PY3A 5FWKK 2QHNA 3DCVA 1WBPA 4JDIA 3R7VA 3W2QA 3S00A 3V5TA 1AQ1A 2VO7A 4TZRA 2HELA 4KKHA 4JX7A 3MFUA 3KRJA 4TYGA 2EVAA 4DFYA 3NNVA 4FTOA 4EBVA 5CANA 5IUGA 4E6DA 4FV1A 3FMEA 3LQ8A 4AXAA 4O7VA 4CCUA 2I40A 4U7ZA 3QYWA 5E8SA 4EONA 1FGIA 3NLBA 3QD3A 4ZTHA 4KKEA 4FSZA 5HX8A 5IISA 4V01A 4OUCA 3TACA 4FKLA 3L1SA 1YVJA 5FTQA 1ZOEA 4FT7A 5B7VA 2CLQA 2WHBA 1Q4LA 2ZFYA 1FOTA 4IDTA 5EDPA 5H8EA 3VQUA 2JKMA 4AU8A 5J9LA 2HZNA 3FUPA 3L9MA 3BE2A 3I1AA 2QONA 3OWLA 2VNYA 4QMQA 3TTJA 3HV4A 4AP7A 2XP2A 3DJ6A 3SC1A 3CSVA 3KXZA 5A9UA 4D9TA 2YIXA 5JT2A 2PVKA 3E7VA 4XEYA 2WELA 4M13A 4USEA 4KNBA 3HA6A 3PIZA 2PVFA 3II5A 4KABA 2C5VA 4EH9A 2ERZE 2JIIA 5I3RA 2AUHA 2JIVA 4G2FA 3MH3A 3S0OA 4O7WA 4IACA 3PA5A 2I6LA 5DT4A 2ZAZA 3AG9A 3SAYA 4QMPA 2QG7A 3EQBA 5ANOA 1E1VA 2W7XA 4U80A 4M69A 3ENMA 3TUDA 4F09A 3WIGA 5EK7A 3ORKA 3ZRKA 5CF5A 5M08A 2WMRA 2FGIA 1REKA 1VZOA 4GYGA 3NUUA 4WG5A 4OAUC 3TMOA 2C6MA 4CRSA 3VS3A 4WNOA 3NW6A 4X7QA 3I6WA 5DA3A 4KB8A 3C4WA 3LM0A 4ZTSA 4JXFA 5L8JA 2BHHA 1UU8A 1WBWA 2DYLA 3N4UA 3MVJA 2VX1A 3BU3A 4YHFA 2WQMA 2XJ2A 4YC6A 3RPVA 3UYSA 4DFLA 4AQCA 3QKLA 5C9CA 4MXOA 3Q4TA 4AXDA 3EJ1A 2HYYA 2OXXA 2R3OA 3CJFA 3O0GA 5CT7A 5DRBA 3W2CA 2VN9A 1DAYA 4JNWA 4NFNA 4G34A 3OWKA 4K33A 2OF2A 4QQTA 3PZHA 1STCE 1H1SA 4EK5A 3COMA 3WOWA 3ZRLA 2R4BA 4EOSA 5CU6A 5HTCA 2BRBA 5ITAA 2X8DA 3OMVA 3LMHA 2UZLA 3L8PA 2ONLA 4AACA 4FZDB 4DG2E 5AUYA 4IAAA 5E8VA 4XP3A 2WIHA 2NP8A 4J8MA 1B38A 5DBXA 3SHEA 4RZVA 5FBOA 1KE9A 5CY3A 2CSNA 2UW4A 3UQGA 2REIA 3R22A 2A19B 4FZAB 4RZWA 3H10A 2X2LA 3MTFA 1H1QA 3QD2B 4WUAA 5HD4A 4A9RA 1FQ1B 4JVGA 2ACXA 4TL0A 2Y4IB 5B2KA 3R7GA 4MBLA 1O6LA 5H8BA 5HIEA 1UU3A 5AA9A 4RG0A 1MQ4A 2PE2A 3EKKA 4FKUA 5L2QA 1F3MC 2R3RA 4YZCA 5JQ5A 4ACGA 5CWZA 3MFRA 4FV2A 4J95A 2R3FA 3R73A 4RC4A 2Z60A 4MVFA 2CPKE 3HRBA 4D4SA 2GMXA 3KXNA 4IIRA 1BL7A 4PPAA 4AOJA 4BCFA 5JZJA 2WMQA 3PWDA 5CXHA 3VUTA 4L7SA 2Z7LA 5A4CA 2WB8A 3BLHA 4XJ0A 4EYMA 3RNIA 3A4OX 3C50A 3U9CA 3ZFMA 3DNDA 3MH2A 2EXMA 3O8TA 2J2IB 3AQVA 3DKGA 2V22A 4FG9A 4DN5A 3R6XA 3UNZA 5FM3A 2VO0A 4I0RA 4EZ3A 4XV3A 3D15A 1E1XA 2WTKC 4S31A 5IA5A 5AP1A 5BVWA 2R3KA 3JYAA 4E20A 4LOQA 5AEPA 4GSBA 4OAVB 4ZLOA 4MD8E 4Z7HA 4ANSA 2HOGA 5I9XA 3UIUA 4B8MA 3H4JA 1AGWA 2YJSA 3WIKA 3UO6A 4WD5A 2G15A 3SKCA 4DH1A 3LLAA 2C4GA 5DEYA 4BHZA 3NWWA 3D2IA 2VTIA 4L52A 2F49A 4FE2A 3MH1A 2KULA 3IONA 5FM2A 3UZTA 4O4BB 3OBJA 2P55A 5IEYA 2X2MA 3KULA 1M7NA 5GHVA 4U8ZA 3HV7A 5HGIA 4ZSEA 4NCTC 3BYSA 1GIHA 1H1WA 3MW1A 4FNXA 2ITOA 2X1NA 4UZHA 5AUVA 2RSVA 3KRRA 4I6HA 5D41A 4C38A 1CMKE 2GS7A 2BVAA 2IZTA 4IWDA 5CEQA 3REPA 4DEIA 1H4LA 3KVXA 3HKOA 3JVSA 5E8XA 1PKGA 3PP0A 5CLPA 3FI4A 3Q53A 4LGHA 1GIIA 4O21A 3RCJA 4HYIA 4PL5A 3EFJA 1MRVA 3S2PA 4TRLA 1Z9XA 4A7CA 3NUAA 4PNIA 2C3IB 4GVJA 3GU6A 4QQCA 4NM0A 4WRGA 4BTFA 3QF9A 4ZTNA 1OBDA 3G9NA 3FC1X 5CQUA 4ARKA 3DZQA 4YTCA 5HTIA 3VQHA 5EQYA 3AC2A 4I5CA 5HI2A 4F1MA 3PFYA 4QYYA 1SZMA 4NKAA 3EN7A 4DGLC 5DEWA 3E87A 3K3IA 4H3BA 2DUVA 3COHA 4IX4A 3KEXA 3EZVA 3LXLA 3P5JC 4QTBA 2PE0A 5K4IA 4EKKA 5B2LA 4PDOA 3C4XA 2I0YA 4O22A 3TXOA 4XG8A 2JBOA 5H9BA 3UC4A 4JIAA 4IVCA 3FMJA 4KIPA 1A48A 3F7ZA 4EK6A 4HCVA 2JDRA 3V6RA 2X7FA 1UU9A 4C0TA 3CTHA 3SVVA 2W1EA 2LAVA 2C47A 5I9VA 4E4NA 4IFGA 5IUIA 1XQZA 1ZRZA 4DGNA 4F65A 5C8MA 5CEOA 4EHGA 4CKJA 4CFWA 1P4FA 3SXRA 3DXNA 4ENYA 3DT1A 4L01A 2B9FA 2XNEA 4DDIA 4OTPA 2QOHA 4Z16A 3TKIA 4D58A 3BL9A 4EORA 4LL5A 3OROA 4YZBA 2DQ7X 2ZM1A 3OXTA 2ITPA 3FKOA 5LMBA 3UO5A 4K0YA 3KK8A 2PVNA 3IOPA 2AYPA 3MPAA 3OY1A 4HGEA 2ETKA 3AXWA 4O0UA 3BQRA 3KGAA 3Q5ZA 3F61A 2UZDA 3NIEA 3NUXA 3F5PA 3U8WA 3LCTA 4L00A 5AUXA 2JDTA 4GUEA 2JDOA 2Y9QA 3EZRA 1BUHA 1M2RA 3D9VA 1P4OA 5IH4A 2JD5A 3NRMA 5JEBA 5FBNC 3BHVA 3I60A 4MF0A 4O0TA 2IZUA 2RG5A 4QP1A 2J9MA 1PYEA 3IK3A 4RRVA 3VF9A 1K3AA 3G2FA 1OI9A 4G6OA 3FXZA 4B6LA 1OL5A 4FTTA 3PVGA 4DCAA 3IDBA 5FEQA 2R3NA 3T9TA 4DGGA 5AAEA 3ROCA 4BJJA 4UXQA 4YBKA 4F08A 1UKIA 3BBTB 4QPAA 4EBWA 5K5XA 4LUDA 4O0YA 3EQHA 4UYAA 4AA0A 3WE8A 2B9JA 3V3VA 4RIOA 4FI1A 1J1BA 4GU9A 2UZVA 2UW6A 4EH2A 4EOIA 3C1XA 4G16A 4MH7A 4DE4A 1NW1A 4DTAA 4DLIA 4YBJA 4KS8A 3LXNA 3TKHA 2FH9A 4WIHA 3QRTA 5IH6A 4RVTA 4RIXA 5L6WL 5L6OA 1UWHA 4W8DA 4AA4A 4ITIA 1OIUA 1ND4A 2CMWA 3EFKA 3T3VA 5CT0A 4FRFA 4FTUA 3UDBA 4I41A 2BAKA 3V5JA 5CAOA 4O27B 3QGWA 4BDKA 4BJJB 3E8DA 4K2RA 4V05A 4AZFA 3DLZA 5AFVA 5JFSA 4U3YA 2DS1A 1FBNA 2BKZA 3MDYA 3BRBA 4K18A 5D9HA 4RWLA 2GNHA 4GYIA 3ZC6A 3E8EA 4E26A 4ANLA 4RWIA 4FJVA 2OLCA 3B2TA 3R63A 2W99B 3W0NA 3BLQA 4BCHA 2BILB 2QOCA 2VWXA 4U0IA 3PXRA 5CF4A 5EOLA 4UB7A 4AZVA 4RFYA 2I0EA 2WEIA 1PXOA 3P86A 4RC2A 4H05A 3UOJA 1PMEA 5A4TA 4C4JA 3HL7A 2OXYA 3KC3A 4BYJA 2FB8A 2PMLX 1OBGA 4PY1A 4I5PA 3VWAA 1NXKA 4FIHA 4I6QA 4TWNA 4BDJA 5LVPA 5E8WA 3PSBA 1M17A 4MXCA 5LVNA 3ZZEA 2B7AA 2ESMA 4KBCA 3VW8A 3H9OA 4D2WA 5IF1A 4E73A 3MIYA 2PVMA 3CY3A 1U54B 2PVRA 3LVPA 4E6CA 2J5EA 1JSVA 2CCIA 3W1FA 4X3JA 5HESA 2V7OA 2AC5A 3FC2A 2BMCA 3ZMMA 4BTKA 4DEAA 5B2MA 3OVVA 2QU6A 3AT3A 5DT3A 2ONLC 3TWJA 4ZZOA 4XUFA 5ANIA 3I7CA 4O86A 4EQMA 4G5PA 4QP6A 4S32A 4S34A 3QRKA 4RWKA 3D4QA 5EW9A 4ZK5A 3OY3A 4F99A 4R3CA 1YHSA 1YI4A 4E8AA 1OL1A 2G2FA 5IZFA 3I5NA 5KZIA 3PUFC 3ACKA 2QKWB 3PIYA 3PZEA 2JEDA 3L8XA 3BCEA 2XRUA 3DA6A 2H8HA 2PMOX 4Z9LA 4L67A 5M57A 2I0VA 4YHJA 4C3RA 3ULZA 3ZM9A 5EW8A 4QMTA 3E3PA 3HMMA 5AUWA 3BEGA 3TG1A 4BDFA 1H28A 2ZV2A 4U81A 3T3UA 4CCBA 2R9SA 3GXLA 3AGMA 2FSOX 3PJ1A 1WBNA 4FSUA 3SOAA 3SA0A 4A07A 2YCRA 4BL1A 2VWIA 3QXOA 1XBAA 4RVKA 2VGOA 2RFDA 3CQUA 3CS9A 4HYSA 3G6HA 4XX9A 4Y5HA 3BL7A 4E1ZA 5BVNA 4BGHA 3LFNA 4EHEA 5CAUA 4M66A 5J5SA 3AC4A 4FOBA 4G3GA 3ULIA 4WBBB 4HW7A 4ZLZA 3OT8A 5E7RA 3BHTA 3VHKA 4FIGA 4GK3A 4Q5EA 4LMUA 1R39A 5HORA 4L3JA 1PKDA 3FY0A 3NS9A 4H58A 4I0SA 3FLSA 5AR4A 4BGGA 3HECA 2W1FA 3PTGA 4BI2A 2W1DA 1Y8GA 1IEPA 3SX9A 5LOHA 3QCQA 4TYHB 3CGOA 2VWVA 5CASA 5HZNA 4E7WA 4LM5A 3RINA 4ZTLA 3IS5A 4BC6A 3QUPA 2UZNA 2X9FA 5I4NA 2HXQA 5M4UA 3GC0A 5E8UA 3VUKA 4JAIA 2PPQA 4UX9A 5D12A 4BWPA 3SRVB 4IB5A 5ETCA 3U87A 2QHMA 3MSSA 4L44A 4AE6A 4ZTRA 5DPVA 4BDAA 4BBMA 2HWPA 3JY0A 3QZGA 3SQQA 4CFXA 2R7IA 3VVHA 2WMXA 3QQLA 3WZJA 3RAHA 1WCCA 4DH7A 3ZO1A 3MV5A 4HPUE 4IE9A 3F66A 4NK9A 4ZMFA 1PY5A 3BLAA 2WO6A 5IQIA 2XEYA 2Z02A 4GK2A 4XOZA 3PIXA 3T8OA 3D5XA 1ZYJA 3K54A 3R0TA 4N70A 3TDWA 2YLEA 4YNOA 2YWVA 2F7EE 4BZOA 4KA3A 4BZNA 2HK5A 4LDTA 4AQKA 3FV8A 4BFMA 1OVEA 4EL9A 4IH8A 4F1OA 5J9YA 5JH6A 4IADA 3TIZA 1PMUA 4IVDA 4FKQA 4J53A 3VUHA 4X3FB 4ACDA 4CKRA 4DF3A 1SNXA 4N6YA 4UMQA 5FLFA 2O64A 5LMKC 4I6LA 3MIAA 1P14A 3KF7A 5C01A 3VONA 5AP4A 3GVUA 1KOBA 1OKWA 4U43A 4GFOA 3G0EA 2R3HA 1H0WA 1PMVA 2XCKA 5CSXA 4OLIA 3DFAA 3DS6A 4CG8A 4NIFB 3KB7A 3F88A 5JZNA 4IJPA 4FODA 4FV3A 4EWHA 5G1XA 1QPJA 4G17A 4BI0A 3A61A 2H34A 4M0ZA 4BDHA 3UOHA 4I4FA 1PRYA 2YM5A 3TZ7A 4FBXA 2R3MA 5IA4A 2XK3A 5HO6A 3ZXTA 3LLTA 4PUZA 4CLIA 3ZLWA 2EUFB 4O38A 1ZMWA 5BNJA 2VTAA 4IAKA 2QOFA 1OUYA 2IEWA 2W1GA 3R2BA 5FG8A 3TNHA 1Y91A 1BKXA 1PXPA 2HY0A 3E5AA 2BHEA 3EH9A 3MTLA 3ZRMA 5HE1A 5AUTA 1A9UA 2X0OA 4AFEA 4L42A 5M06A 1F5QA 4WHZA 5BVFA 3JVRA 2X6EA 5TR6A