3RINA

P38 kinase crystal structure in complex with small molecule inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Indolin-2-one p38(alpha) inhibitors I: design, profiling and crystallographic binding mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rinA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rinA01
1G8AA 3FLWA 4U45A 4L01A 4G6LA 1Z5MA 3F7WA 4J1RA 4O2PA 4WA9A 4RZVA 3ZTXA 5H3QA 1KE8A 4DTAA 4F64A 4EH8A 1H1RA 3GC0A 5CTPA 4Z16A 4F6UA 5HQ0A 3KGAA 4C4IA 5J87A 2I0EA 4FV9A 1YI6A 3TJDA 4AT3A 3DJ5A 3ZEWA 2FSOX 2CGWA 4ACHA 1ERKA 5EK7A 4JIAA 4FVQA 5KMOA 4FSUA 4O84A 3ETAA 4JLCA 3WZKA 2WIPA 3QTRA 4FSYA 3AC4A 3TV7A 3MY0A 3V5PA 2FSTX 4CMOA 4NFNA 3CR0A 1JNKA 4QP7A 4NU1A 4UMRA 3BCEA 4CQEA 2RFEA 3SW4A 1S9IA 1UU3A 5D11A 4CT1A 4YJSA 1ZYDA 3AC1A 2OGVA 3PSDA 4A06A 4YMJA 3OCSA 3PWYA 3F88A 4UMQA 4AN2A 4DTKA 4RIYA 4CLJA 3R1SA 5M4UA 3F5XA 5M4IA 4QNYA 5IQFA 2BROA 3TZ8A 4LGDA 3G5DA 2VRXA 4RWLA 2X4FA 5I9WA 2ETMA 2X8DA 3UOLA 5L8LA 3Q2JA 3GU4A 3SG9A 1UU9A 5TT7A 4BCIA 4E73A 1PHKA 2W1GA 4LL5A 3TTIA 5CXZA 3DTWA 1XH4A 3DB6A 3TL8A 3HV6A 2OF2A 3MA3A 1YQJA 1H4LA 3KF7A 3V8SA 2B9FA 3IDPA 3OTVA 4JBPA 5IISA 4D4YA 5GZAA 5B2LA 2WMXA 3SV0A 2BRGA 3UJGA 3GEQA 4C4FA 4OBPA 2CNUA 2GTMA 3I4BA 5AR8A 4GUBA 3FEGA 4CCBA 5AIRA 3TZMA 3HAVA 3CJFA 5HOAA 3HDNA 4BTKA 3FHIA 4U41A 3HRFA 4HYUA 4NCTC 5KMMA 2ITOA 3I0OA 3OWJA 4FT5A 4G34A 4W4YA 3U8WA 2WTJA 5EKOA 3LFAA 4BCMA 5CANA 2YFXA 4KKHA 4M7IA 4IQ6A 1PXNA 3LQ8A 2WD1A 4IZ7A 4GT3A 2Y4IC 4X2GA 5DEYA 3IW5A 3F2NA 4E5WA 3COMA 2C0TA 3Q5ZA 4V0GB 5LVLA 3IPHA 5L6WL 3RCJA 1UA2A 1AGWA 4KAOA 3PVBA 5HEZA 3UP7A 4EYJA 3EKNA 5HCXA 4LGGA 3PXKA 2XKCA 4J96A 5K9IA 3KXNA 4GK3A 2WMWA 3G6HA 4HYSA 4O86A 1XR1A 2UV2A 4K11A 2C30A 4AE6A 3EFJA 2HWPA 3TUBA 4ZP5A 2X9FA 3LFDA 3MB6A 3TIZA 5C9CA 3VUMA 3R7YA 3NZ0A 3PG1A 5DFPA 3BRBA 3ZM9A 2Y4PA 2X2KA 2FGIA 1H28A 2Z2WA 4I21A 5CNOA 4JQ7A 2GFSA 4LOOA 3EN6A 2RG5A 2UZTA 4WNOA 4JG7A 4U43A 4FEVA 4XG7A 4G1WA 4QP8A 1LUFA 3VUTA 5FP5A 3VW8A 4LI5A 3TI1A 5AV4A 1H0VA 2HCKA 2Q0BA 1JLUE 4HPTE 4O0UA 5IA3A 3PG3A 2XNOA 2VTAA 2C6MA 4S34A 1NVSA 1OKZA 4XRJA 3TKIA 1U46A 3Q53A 4DFBA 3DJ7A 3SA0A 3ELJA 1MRVA 4DH7A 3LHJA 4FTNA 5DT4A 4EI4A 4F7NA 3MFTA 4X3FC 3WYYA 3AMAA 3RP9A 4CTCA 4E26A 2KULA 4OAUC 2O3PA 4IHPA 4Y85A 3NSZA 4J97A 5AV2A 3FPMA 3I81A 1WVXA 5EDPA 4ZSGA 4I4EA 3NDMA 5E9EA 4C3FA 5GINE 4IJPA 3Q2MA 1ZYCA 5E90A 4BTMA 4ONAA 4DCAA 3DZQA 5CU2A 4FMQA 3FV8A 5HE2A 2XZSA 1TQMA 2ZB0A 4X2NA 4BI1A 5DMZA 4DH5A 2PSQA 5EHOA 1J3HA 4JS8A 2E9OA 1TQIA 5FEEA 4CFFA 2OICA 4I6FA 3I7BA 4I0RA 4QMUA 3C5IA 4E5AX 5TO8A 1A06A 4FV3A 3CBLA 4IZ5A 3W2PA 4RZWA 4DT9A 3IK3A 4HYHA 4YJOA 3OFMA 1WBVA 3QD2B 5HIBA 4RJ7A 4P5ZA 3UNZA 4QMVA 3ZO1A 4QP4A 4ASEA 4NT4A 3L9PA 4K18A 5EYCA 4L7SA 3OXTA 4O0XA 4CLIA 4DEEA 4L43A 3V5TA 2UVXA 4FKRA 2AC5A 4QTBA 3KMWA 3W55A 3AD5A 4GYIA 2Z7SA 4D1XA 1O6KA 4LYNA 4LRMA 3P23A 3IKAA 4YPDA 4IAFA 3NUPA 4DGLC 3U4UA 4F63A 3U6HA 4IFCA 3RVGA 4O1PA 4ZOGA 3HECA 2R3JA 5IUHA 2VX1A 5DT3A 1YWRA 3Q60A 2X2MA 4RWJA 3OCGA 3W8LA 3MVJA 1SNXA 2PMIA 3UVRA 3FLNC 1Q8UA 1QPJA 4JBVA 5KZ0A 4RWKA 5EM8A 1R39A 3I6WA 4EK8A 4YZDA 4FGBA 2OFVA 3F3ZA 3QRJA 4M66A 4DFYA 2J7TA 3QLGA 4EBVA 2XUUA 2FO0A 1U5QA 4RFZA 5J95A 4KIQA 1URCA 5JMSA 2XM9A 4YGAA 4RBLA 2G1TA 1W7HA 2R0IA 1BL6A 1M14A 3N4VA 5IEYA 3O17A 2PVMA 1AQ1A 5K5XA 2R64A 1OL1A 1V0BA 4TPTA 4YC8A 3JR1A 3MPMA 2OI4X 3EN5A 4QPAA 4DEDA 4FG7A 5D41A 1KE9A 4I6QA 2ITYA 3EMGA 4JI9A 4LL0A 2NO3A 4YTHA 4YJRA 3TDVA 2E2BA 5AM7A 4A4OA 3ZLXA 5GZ8A 1PW2A 5AWMA 5B0XA 4EZ3A 2G9XA 1XH9A 4TWOA 3W2CA 3E62A 2REIA 4WRGA 3QF9A 1TVOA 4FT9A 4LRKA 4XOYA 2OXDA 3H4JA 3D7TA 3O8PA 3VS4A 4DCEA 4UXLA 3WILA 5C1QB 5J7HA 5J5SA 2Y0AA 4AX8A 2JGZA 4QP9A 4FUXA 3EQDA 4RX8A 3LPBA 4TW9A 1XBBA 4RJ3A 3KXMA 3R00A 2R3OA 3H0YA 2HY81 4FSTA 4D2WA 5DRBA 4C2VA 3UODA 3VBVA 5I5ZA 4L44A 3N4TA 4PQNA 4BWXA 4FV7A 2CKPA 2VTSA 4OW8A 3FSFA 3SLSA 5LMKC 4XLIA 2YCFA 1B39A 2WB8A 3SD0A 3U55A 3VIDA 3TDWA 3F61A 1YXUA 3I6UA 4F0FA 4F1TA 4RJ5A 1WMKA 4MKCA 2WTKC 4U7ZA 3C50A 2QOOA 2ZMDA 5AAGA 2BKZA 2YACA 5HVJA 4BIDA 1LR4A 3EHAA 3LJ1A 3M42A 4GJ2A 3TNPC 3OT8A 2WPAA 4EWQA 1A9UA 4OTFA 1KSWA 2XVDA 4QYFA 5A4CA 2HOGA 3LFSA 2AC3A 3QD3A 4IMYA 3WIGA 2GQGA 3ZS5A 4ZZMA 4FK6A 4XV3A 1NW1A 3A7GA 1GIJA 2QCSA 4AW5A 4HYIA 1ZMWA 4A07A 1SM2A 2W9FB 3ZM4A 4E4MA 3HZTA 3DXQA 2O65A 5EQYA 5ETAA 3ORZA 4IB0A 3VQHA 3VJNA 4YP8A 3DDQA 5K5NA 1FOTA 4CMTA 2YA9A 5HD4A 4UZHA 3FY0A 4N6ZA 3C0HA 5CS6A 3ZLYA 5FTQA 2XEZA 4DGOA 5CXHA 3DLZA 3FMNA 3DOGA 4W9XA 3RAWA 2W4JA 2LGCA 4RGJA 4DEGA 2W9ZB 4ZSLA 3DNDA 3QCQA 3R04A 1IR3A 2XNGA 3QXPA 4H3QA 4RJ4A 4F6WA 4ZTHA 3UIXA 3QC4A 2PZIA 4B8MA 1JPAA 5AJQA 3VF9A 3DDPA 2QOLA 4OUCA 4OAVB 2RGPA 4ANSA 4AT5A 4G9RA 3UOKA 5AUUA 3QQHA 4QMQA 2IWIA 3ZZEA 1OUYA 2XP2A 1OPLA 3MTLA 5AADA 4DBXA 2QC6A 2J4ZA 3TXOA 4C3RA 3HL7A 3MESA 4LOPA 1UWJA 3WE8A 4BVUA 3NAYA 3ZXTA 2C6TA 5EW9A 3A7IA 4K0YA 5DEWA 4L3JA 5EW3A 2XJ1A 3RPSA 5BUEA 3KN5A 1PXMA 3D5UA 4UB7A 2CGVA 4FTMA 5CVFA 5CZIA 3S1HA 5HLNA 3C0GA 2UZUE 1H25A 1J1CA 4NM3A 1OKYA 4WD5A 3RPRA 1JWHA 4KNBA 4O0YA 5KBQA 1PYXA 5CQWA 4KWPA 3HV5A 3D2IA 3JVSA 3ZO3A 3LMIA 3MH2A 1JBPE 3QGYA 3PYYA 4QYGA 3K2LA 3RAHA 4BC6A 4EEVA 1P5EA 2E9NA 4XCUA 2HK5A 4W8DA 5KUPA 5I9XA 3UE4A 2VTMA 3NUXA 1M17A 3UMWA 4FTAA 3D2KA 2JEDA 1PMEA 3PXZA 3R7OA 3VULA 3AT2A 5JGBA 4JRNA 4XP3A 2R7IA 3OG7A 3DQXA 5KBRA 4UMUA 4HGEA 4S33A 2JIIA 4X3JA 3BIZA 4YSMA 4YUQA 2PVJA 4LUDA 4XV9A 3IONA 1W8CA 3EYHA 3FXWA 5IA1A 3B8QA 4C4EA 4IZYA 2J0KA 4N57A 4ACDA 4QYEA 3F6XA 3QA0A 4RJ6A 3PY1A 4ACCA 3BYOA 4IDVA 3FLQA 3RHXA 5CWZA 1FQ1B 4QD6A 3DK3A 3FZOA 3FLYA 1B6CB 2J5FA 4NCTA 3SRVB 5TR6A 2GNFA 5AX9A 4DHFA 5JZJA 1SYKA 2ZV2A 3EQIA 1E9HA 2WFYA 4EC8A 5KKRB 3QTSA 4IBMA 4IW0A 1H1QA 5IU2A 1W83A 4QP3A 4AOIA 1Y6BA 1REJA 3TM0A 4PP9A 2RKUA 3O0GA 3PA4A 4IWPA 2UZVA 1YDSE 2RIOA 2C0OA 3FZTA 1Q62A 3RK9A 4RFMA 4H58A 4YJUA 3KEXA 4EH5A 4XRLA 5A54A 4GFMA 4KRCA 4FZ6A 3RTPA 2YIRA 3QKLA 1IASA 1Q8ZA 3AC8A 1GNGA 3MH0A 5C03A 1JSTA 3ZDUA 4EH9A 3CQUA 5A46A 4KIOA 4BCHA 4O7RA 3KMUA 4X21A 5HGIA 5CEMA 2A19B 3NYXA 4O7TA 5C27A 5J7BA 3D5WA 2W05A 3G6GA 2Z8CA 4IAAA 4MXOA 3GI3A 2BDWA 2UW6A 5FTGA 4RVTA 2QR7A 2R0UA 5J9YA 1P4OA 5E7RA 4HOKA 4BR3A 3GC9A 3IS5A 4D2TA 3H9OA 4R78A 1YXXA 4Q2AA 3H30A 4OTPA 5FGKA 4O7VA 4IVBA 1HCKA 4RQVA 3GQIA 3QYWA 1DI8A 3I60A 3NNUA 2XKFA 3R9OA 4FSNA 4GKIA 4Y8DA 1Q8WA 2CLXA 3PJCA 3GCQA 4G17A 5DLSA 5I3RA 1IA8A 2ZDTA 5HLPA 4X3FA 1FGKA 3O2MA 2VV9A 4D2SA 3HA6A 2FVDA 4F09A 3OF0A 2QONA 2OO8X 4XUFA 4N6YA 3TTJA 4FODA 4W4WA 2VO7A 4ASZA 2RFNA 5EM7A 3FAAA 2QO7A 1YI4A 2NRUA 4F9AA 3PP1A 2CKOA 4FNZA 2JKMA 2C5OA 2EB2A 4JDHA 2YM5A 3RM6A 3GU8A 3Q96A 4PDSA 4N70A 4FKTA 4LMUA 4QQCA 3FMHA 4D4RA 3UZRA 1E1VA 3PJ3A 3BGQA 4YO4A 3DBQA 3QTUA 1UU8A 5EOBA 2OU7A 2C68A 3MS9A 2VAGA 5FM2A 4FG8A 4QQTA 5E8SA 4YU2A 5CAVA 5LQFA 2EU9A 2FB8A 4MVFA 3THBA 1X8BA 3LFFA 4IB5A 3FPQA 1I44A 3IW8A 1IAHA 2PE0A 2VU3A 2GMXA 4M8TA 4S31A 5IMXA 2XBJA 1YDTE 4ANBA 3PWDA 1KOBA 4GVJA 4QYYA 4AWIA 2HENA 1EH4A 1UKIA 4QNAA 2XRWA 4IZAA 5I9VA 1M2QA 4UWCA 3ZONA 3ZSGA 4CFUA 2O5KA 3Q4CA 5IMEA 4E7WA 4E6CA 4NYEA 3FXZA 4JOAA 3KK8A 2YN8A 4APPA 3MIAA 3UO6A 4TKSA 3MDYA 2WQEA 3R6XA 3ET7A 4IIRA 4O7SA 4KIKA 4FT7A 5JFVA 4QP6A 1W0XC 2OJIA 4D4VA 3EQHA 1R3CA 4O0VA 1ZXEA 4RT7A 2WEVA 4E4LA 4EOLA 1DM2A 2IVSA 3LFCA 5JQ5A 1ZY4A 4U79A 4G3GA 4BKJA 2JDRA 3HX4A 4IC7A 4MXZA 2PZ5A 3QA8A 2CGUA 2UW5A 5HTCA 4PTCA 3ZOSA 5JN2A 1MRYA 2J0LA 2XYUA 3H9RA 5G6VA 3FBVA 2OH4A 4M15A 4C58A 4IC8A 4NFMA 2GQSA 5M51A 3PIZA 3DKGA 2V0DA 5JKGA 5IDPA 5AR5A 4A9UA 4C34A 2F7XE 4NW6A 3V5LA 3UZTA 4RFYA 3HNGA 4UZDA 3OOGA 1ZWSA 3WARA 3UO5A 3VS3A 2IPXA 1T45A 1AD5A 4NUSA 3PXYA 4QP1A 4YHTA 2OIBA 4IB1A 1S9JA 2IZUA 2YLEA 4AG8A 5BUIA 3QLFA 4AZTA 4G3FA 3DAEA 3EJ1A 3EQRA 5IH5A 4DAWA 3RPOA 4CKRA 2PUIA 4U3YA 3BZ3A 3ZO4A 4KSQA 3ANRA 2VX3A 5E8XA 4YO6A 4CRLA 3BWFA 4OT6A 1STCE 4WT6A 2XNMA 4UN0C 3A62A 4JXFA 4HJOA 2C6LA 3AMBA 4QOXA 4FSRA 2XIRA 2UW8A 4JDIA 4DGMA 3QX2A 3QZHA 3I79A 3BQCA 4JQ8A 3ACKA 5I3OA 2BKKA 5K0XA 4GRBA 4EOSA 3C4XA 3RWPA 1RDQE 3FL5A 2YJSA 2QKRA 3CLYA 2BPMA 4C02A 5ANGA 4DEAA 5CU6A 4CFMA 1Q61A 4LMNA 5LMKA 4U8ZA 4Z7GA 3FKNA 2A4LA 4B4LA 4O22A 4EC9A 3G51A 5A4EA 4QMSA 4E8AA 2WTDA 4O7ZA 4OTRA 4OTWA 5HD7A 4U9AA 2ZM1A 3EFLA 5HX8A 3MJ1A 3FXXA 3ENMA 2WTVA 1WBTA 2UZOA 3PXRA 4EH3A 1R0EA 2C3JA 4I20A 4E4XA 1XO2B 2OZOA 4M13A 1M2RA 4U42A 1JKSA 4O21A 1PMUA 4FKJA 3C9WA 4FV8A 3A61A 5H2UA 5HHWA 3RZBA 2PK9A 5FDPA 4FTUA 3FKOA 4IM3A 2OXYA 4O6LA 3NUNA 4O7WA 4Z9LA 4G3CA 3Q4ZA 3QTQA 3VNTA 2JKQA 3GXLA 3RI1A 2UUEA 3UIUA 4EK5A 3F9NA 4F0GA 5CAPA 4QMZA 3NAXA 3VS1A 3AQVA 5BYLA 3QTZA 1RW8A 3GBZA 3UO4A 4BHNA 1WVYA 1IAJA 2YDIA 1HCLA 5HNIX 4M69A 4ZZOA 4ZS0A 3FY2A 3C4EA 4WG4A 5C8KA 3RNYA 4TWNA 3Q9WA 4JX3A 3U9NA 3TKUA 4EHGA 3KULA 5FD2A 5I9YA 3BELA 2H9VA 5JK3A 2Y9QA 3HDMA 2X81A 2W7XA 3C7QA 2YIYA 4KBKA 4EWHA 2O8YA 4MXAA 4I3ZA 1YRPA 3TN8A 4AE9A 5DR2A 4DN5A 1H24A 4O1OA 3ZRLA 1YDRE 3GENA 2W1IA 2QHMA 4ITHA 2VTQA 1JKKA 5HI2A 3OUKA 4MD9E 5JSMA 3OROA 5M08A 3RPVA 3BHHA 4D58A 3D15A 4AACA 3PIYA 3W1FA 4ALUA 2UW0A 3MJ2A 1DS5A 4JBQA 4Y5QA 4AZFA 2F7ZE 4OTDA 2YAAA 4B9DA 5AX3A 2YM8A 4D9TA 3RAIA 2O64A 4F9WA 4JR3A 3MIYA 4FTCA 4QTAA 4FZDB 5M55A 1YOJA 4H1MA 4NIFA 3UQGA 3P7AA 2ZYBA 4PY1A 5ETFA 3UG2A 1M7NA 3Q4UA 1XH5A 2XIKA 4MCVA 3P79A 2YM7A 5I9UA 2VZ6A 4IAIA 3KC3A 3R7GA 4OT5A 4RVMA 4R5SA 2C5VA 2R3MA 2C3IB 2XS0A 5IQEA 3RKBA 2IVTA 3BU5A 3ZFYA 4FV6A 4C3PA 3L8XA 2Y8OA 1GIIA 2B53A 4IVAA 5AP1A 5KX8A 3UPZA 3OXZA 4NZWB 2C3KA 1FPUA 2ZV8A 4BFMA 4IAZA 4N4SA 4ALVA 1Q97A 5LVNA 1OB3A 1UVRA 2WZJA 4WOVA 4BB4A 3MTFA 4FUYA 5A6OA 1VZOA 2HXQA 4KRDA 5D9HA 5FP6A 3TV6A 3MVHA 4ANLA 1YXTA 4TZRA 4GFOA 4L42A 5FLFA 2YERA 2VD5A 1PY5A 2W1FA 3I0QA 4GU6A 4NM0A 3EN9A 1ZRZA 3ZC6A 3OWPA 4A4LA 2WTCA 4K1BA 4D5KA 4BGHA 3QTXA 2X1NA 4UYNA 2WKMA 3SKCA 1G5SA 4EONA 3E7VA 4MTAA 3IG7A 4C33A 4FE2A 4BZNA 1BX6A 4PNIA 2C6OA 3UMXA 4FT3A 3ENHA 4BDHA 3WF6A 3DBCA 3Q5IA 4C8BA 5BVOA 2J90A 1Q99A 3OEFX 4EOOA 4ZTRA 3MPAA 3SHEA 2BZHB 4IAKA 1JAMA 3FKLA 2WAJA 2GDOA 3K5UA 3FMDA 3GFEA 4MF1A 4U81A 3ZUUA 2XCHA 4KS7A 4WNPA 2VGPA 4GL9A 4AF3A 4DE4A 4QMXA 2R3NA 1CTPE 3ORXA 4XLVA 2X7FA 2XK9A 2C3LA 4APCA 2PVRA 5EYDA 4C0TA 2F7EE 3ORPA 4L53A 5CASA 4P5QA 4YZNA 5L4QA 1FVRA 4BTFA 2IVUA 4EJ7A 5AIKA 4DEBA 2YCSA 4I5HA 5IDNA 4ENXA 3WBLA 3PDTA 3NUYA 2XH5A 2C1AA 2FSLX 4U97A 5JT2A 5IQGA 3HEGA 3R2BA 4K6ZA 4UY9A 3UDBA 5FXRA 5J1VA 2VO3A 2GFCA 5C4LA 1ZZLA 2YHVA 4CTBA 1KUTA 4FOBA 4G5PA 3UIMA 3V8TA 3UNKA 3EZVA 5AMNA 4FV5A 5M06A 2WU6A 3WF7A 2ZM3A 4NJ3A 5CAUA 1QPEA 3NUUA 3AG9A 4O7YA 2WEIA 4ANNA 3QXOA 4ZTSA 3AD6A 2WMUA 5BQ0A 5E91A 1U5RA 4R7IA 4FIFA 4PUZA 3JUHA 4KKGA 2WIHA 2XB7A 3CCNA 4YPSA 5CEQA 1IA9A 4F7JA 3KRWA 4XS2A 1WBOA 4YTIA 4BCGA 1E1XA 5L2IA 3R7EA 4TWPA 3DAKA 4YLLA 5CEKA 4CD0A 2XYNA 3KRXA 4BDDA 4BIEA 4ZAUA 2B9IA 3KKVA 3MV5A 3PXQA 1J7UA 4BBFA 3KRRA 3MY5A 3ALNA 3EFKA 2YDJA 3FHRA 2B9HA 4FZ7A 4G5JA 4H3PA 4XBRA 3HV7A 4TYHB 4LRJA 5JFXA 2BTSA 5HO8A 4R3PA 3EZRA 3HKOA 3BE2A 4M68A 3VO3A 4DLIA 2IZTA 3DNEA 3QRUA 3AC2A 4QMMA 4X0MA 2J9MA 4ZJVA 2F9GA 2F2CB 2GHGA 4HVGA 2XKEA 4IX3A 4PTEA 4M3QA 5FWKK 3QYZA 4RVLA 5KO1A 1OKVA 4PV0A 3PVWA 3KN6A 4NWMA 1TKIA 1FMOE 2EXCX 3DA6A 3GCSA 4FGRA 5DR9A 4DH3A 5E8TA 5EI6A 4QMOA 2FSMX 3W2SA 2OH0E 4CZUA 4MAOA 4EOMA 4YZBA 1JQHA 1ZMUA 4FC0A 3E63A 4DBNA 4QT1A 4AGUA 2W99B 5DE2A 4FIGA 4MNEA 4JR7A 2J0MB 3OVVA 4S32A 3WZUA 3CEKA 3GU5A 3COKA 3FLZA 2QOFA 3W16A 4EJNA 5FDXA 4FSZA 3PRFA 4Q9ZA 3F7ZA 3PZHA 4W4XA 5ETIA 3QD0A 2VTOA 2XK4A 2OJ9A 3LXLA 3TT0A 2J0JA 4NTSA 3E5AA 2JAVA 3P0MA 4J99A 4XG4A 4C7TA 3KL8A 3UVQA 2BZKB 5ANKA 5J9ZA 3O71A 3MB7A 3Q32A 4JIKA 3O7LB 4I1ZA 4WSYA 3ZFMA 5JH6A 1REKA 3L8VA 2GHMA 2BR1A 2X6DA 3OY3A 2ITUA 3POOA 4K8AA 5GIPE 3K54A 2FYSA 4GFGA 4F65A 3E7OA 3DS6A 4YBJA 2RF9A 3DCVA 4GIHA 4R1YA 2B55A 4RLKA 3ZC5A 2YM6A 1UNLA 1Y8GA 1CDKA 3R28A 3RMFA 1JSVA 3S3IA 1YXSA 3D5VA 3PLSA 3KXXA 2HZIA 1XBCA 3WF9A 3BBTB 4I94A 2DWBA 3MWUA 4R8QA 2OXXA 4E6QA 5CI7A 2XIXA 3SXRA 5FM3A 4DFLA 3R8LA 2WU7A 5A6NA 5B2KA 2W4OA 3QHRA 3E3BX 4QMPA 2XM8A 4DFXE 5BYZA 4AGWA 4BWKA 3H10A 2C5YA 5BX0A 4WRSA 4L67A 4O96A 1J1BA 3ORLA 4LQMA 4DG0E 5DYJA 4FI1A 5K3YA 5KHXA 4LG4A 4QO9A 4BL1A 1BI8A 2R3KA 1QMZA 3BHYA 3DT1A 3LXNA 5F94A 4O7LA 3TIYA 4JQEA 4FICA 5M53A 5GHVA 1XQZA 2Y4IB 1KWPA 4YZ9A 3SAYA 4DYMA 1KE6A 1OKWA 1SNUA 2P33A 4BCFA 2R4BA 1V1KA 2QD9A 1V0OA 4HGTA 2IW6A 5AR2A 3QHWA 2PVHA 5EM6A 4B99A 3UIBA 1XH7A 4L8MA 5HG7A 3ZH8A 4FSWA 5C8MA 2ITVA 3NYOA 4CMUA 3R9HA 2EXEA 3IOPA 5TKDA 1WCCA 2C69A 3ZFXA 4BF2A 3RWQA 4K77A 3RZFA 3LJ0A 5HCZA 1WBNA 2VO6A 2C6IA 2JC6A 4F9YA 4U44A 3NR9A 5BVDA 2WOUA 5JFSA 3F2RA 4FV0A 4QP2A 3I5ZA 4AA0A 3FLSA 2GTNA 3BPRA 3QZGA 4D9UA 3F5GA 5AP7A 3U6IA 4V0GA 4IDTA 4E1ZA 4E20A 4PMSA 3FDNA 2BAKA 2EXMA 2ETKA 2ESMA 2BHHA 5T6KA 3VN9A 5JFWA 3U9CA 4N0SA 3CC6A 3GCUA 5AA8A 2CNQA 3BGPA 5BVFA 4PTGA 5A3XA 1PXLA 3ZMMA 3DXPA 4FYNA 1Q3WA 3LFQA 2QOQA 3G9LX 2GNIA 3CP9A 3DKCA 4QPMA 3D5XA 4O7NA 5KMIA 3TV4A 5FQDC 3EFWA 2X8EA 4J71A 3COIA 5FXQA 4GKHA 3R8ZA 5AFVA 4BCQA 3HYHA 3DJ6A 2CN8A 3H3CA 5DHJA 4WG5A 4YNEA 5AEPA 4ZMFA 3DKOA 3ZLWA 4FG9A 4E5BA 2P0CA 3DBDA 4FSMA 2VX0A 4MD7E 1LP4A 2XK7A 5AP2A 2O2UA 4AZWA 3LQ3A 4P4CA 4G3EA 3LCSA 2F4JA 3P1AA 4AGDA 2NP8A 1Q41A 2DS1A 2Y6MA 1ZOHA 3EL7A 2RFDA 3F5UA 3HRCA 5DIAA 1Z9XA 3FQHA 4QYHA 4OBQA 4AXAA 5K4JA 4QMTA 4CFXA 2QG7A 3KA0A 3JY9A 3PVUA 4RWIA 5EDQA 5F9EA 4ARKA 3IW7A 2XRUA 2OSCA 4H36A 5J9LA 1KV1A 3SXSA 4BDBA 4FNYA 4TL0A 4L00A 4Q5HA 2ITPA 2R3RA 5TE0A 3QC9A 1H1SA 3R1YA 4ZLYA 4ZY4A 2PHKA 4FX3A 4L9IA 4F4PA 3EYGA 5AA9A 4I5MA 1PMVA 1J7IA 2DQ7X 4U6RA 4XG9A 4DTBA 3PRIA 3TJCA 3EQCA 2GS7A 2PVKA 2AYPA 3OHTA 4BGGA 4C62A 4IX4A 4I23A 4P2KA 4XX9A 4CV8A 3LVPA 4PL3A 1K2PA 4J7BA 4XHKB 4CFVA 1PXJA 3MYGA 3GC8A 3M1SA 3ZRMA 1UU7A 1RQQA 3B2WA 3Q04A 2UW3A 2C5XA 3GU6A 3QKKA 2YAKA 4RIXB 1CKPA 4ANOA 5CEPA 5CF8A 2WGJA 3MH3A 4L6QA 1CKIA 3DK6A 2BIKB 4IWDA 3PY0A 3UQCA 5KE0A 3GCPA 4USFA 5LWMA 4GIIA 3PXFA 4FTTA 4K33A 5EYKA 2GS6A 4EUTA 2J6MA 5J79A 3PTGA 2XK8A 4GW8A 3VUIA 5M07A 2WNTA 4AW1A 3CKXA 3ROYA 5D7AA 4YURA 2ITWA 2QOKA 3U6JA 1Y57A 3FJQE 3TZ9A 3R01A 5AP0A 5CU3A 2HWOA 2HZ0A 1PKGA 5EH0A 3RBWA 4C38A 4IXPA 4M84A 3NEWA 3LZBA 3G15A 3E92A 1Q3DA 3EB0A 3IW6A 4G6OA 3TNWA 2VO0A 3FMKA 4FKWA 4FKQA 4YJVA 3SOAA 4M97A 5IQHA 4UEUA 4HCUA 2C6DA 4D5HA 3DY7A 4D28A 3AC5A 4PL4A 2G2IA 2BZIB 3ODYX 3Q6WA 4EOJA 4CZTA 4ANQA 4JNWA 4AA4A 2JKKA 2C6EA 2ZJWA 3QX4A 5K4IA 4GUEA 5IA2A 3ZHPC 1CKJA 1OMWA 2R3IA 2OZAA 3VAPA 4CZYB 4I6HA 1F3MC 4EL9A 2PULA 3LM0A 2I0YA 4WNKA 2OFUA 4JVGA 2DYLA 3SVVA 3ZSHA 1OGUA 2VWYA 4FSQA 3UZPA 5CQUA 3DK7A 4BDJA 2XJ2A 4TYJA 2CHLA 4FTIA 1UNGA 4Y95A 1OM1A 1SVGA 2I6LA 4TWCA 5M56A 2QODA 3DAJA 2F57A 2PE1A 2PZPA 3OT3A 3F82A 4V01A 4A9TA 4F7SA 5HIEA 1F5QA 2BAJA 4P90A 2NNWB 3UOJA 4O83A 5H8EA 3VQUA 3LFNA 3LXKA 1R0PA 2XNPA 3CGFA 4JAJA 3A2CA 3ORTA 3T9TA 4GT5A 4WO5A 5D10A 4ACGA 2VWIA 2C0IA 2QOIA 2UZBA 5AP5A 4L3PA 5LVPA 2JKOA 2WTKB 2BVAA 5DH3A 3NNVA 4EOQA 3KCKA 1Q8YA 2BRMA 5CZHA 3C5UA 4LOQA 2QU6A 5ITAA 2ITXA 3VUKA 3R7VA 3LMGA 1QL6A 4ZS4A 2I0HA 2HZ4A 3AD4A 1PXIA 3P08A 2ZOQA 4QQJA 4XV2A 4X6QC 4BI2A 1QPDA 4MXCA 4MNFA 3QZFA 1NXKA 1VR2A 3FSKA 3MA6A 4YBKA 1BKXA 3WI6A 4DH8A 4DFUA 4V05A 5FBNC 1P2AA 4DINA 3IGGA 3PY3A 5DRDA 5HNBA 3NNWA 3DFCB 3PVGA 4FEWA 1U54B 1OECA 1MRUA 2BUJA 2ERKA 1RE8A 2UZDA 2PVNA 5HU3A 3GT8A 1ATPE 4NM7A 4YJQA 3CJGA 2YZLA 4AQCA 4I92A 4UX9A 3NCGA 4RIWB 3RGFA 3CSVA 2W96B 4FYOA 2X2LA 5AM6A 1LPUA 4C37A 1BLXA 2W1CA 5E4HA 3R73A 2RL5A 2UW9A 5L6OA 2YLFA 3L9LA 1GZKA 3PPZA 3L9NA 4QQ5A 1OIUA 4FZAB 5CSVA 2I40A 3BHTA 3LW0A 3T9IA 3V3VA 2WMBA 4KABA 2PUPA 2J5EA 2GPHA 3LCKA 3VUGA 2W5AA 2G2FA 4U80A 3UGCA 4IACA 4RC2A 4BBEA 2I7QA 2WOTA 3EQGA 4XEYA 4C59A 3V5QA 1GY3A 3ATTA 3PJ8A 5IEXA 1ZOEA 3R1QA 4F9BA 4FEQA 4RX7A 3NVMB 2QO2A 3O50A 3AT4A 3KRJA 1GZOA 4R7BA 3R9NA 2H6DA 3QFVA 3E8NA 1FMKA 2GCDA 3P4KA 2JFLA 3NYNA 3NNXA 4DGNA 2WHBA 1OL5A 4FTQA 4FVPA 2IW9A 3D7ZA 2OG8A 3EIDA 1BMKA 2VTIA 3VS7A 2YWVA 2HW7A 4CEGA 4ZZNA 3LLAA 3OBGA 1KOAA 2GNLA 2J51A 2YM3A 4L68A 2BIYA 1YHSA 5HO6A 2BFXA 5EI8A 3LXPA 5AUTA 3S00A 1YOLA 3E8EA 3JS2A 4QMYA 3ZBXA 4Y72A 5EDRA 3U54A 1MQ4A 4H05A 4XP0A 3KCFA 3F3UA 3HP2A 3QAME 4J95A 1JSUA 5FBOA 5JQ8A 4BKZA 1CMKE 4KA3A 4F9CA 4FK3A 3E64A 3RPYA 4B8LA 4O81A 4IE9A 3A8XA 5DG5A 4O38A 4BICA 3HUCA 1APME 2P4IA 3CS9A 1Z57A 3S95A 4JX7A 4F1OA 2QVSE 4KSPA 4W8EA 5DPVA 4JAIA 2JIUA 4RIYB 5L2WA 5J1WA 2CPKE 1O9UA 1JVPP 2C5NA 1Q4LA 2XIYA 4TN6A 4I5PA 4CCUA 3W8QA 3R7IA 2GQRA 4UMPA 3EN4A 2WMVA 4F99A 2OJGA 5CVGA 5ACBC 1CM8A 2XJ0A 3S4QA 1SVEA 3ZEPA 3R8MA 5E92A 3MVLA 3DBFA 3BLHA 3QBNA 2GNGA 3QQKA 3BI6A 3MN3A 3HMMA 3O51A 2VWWA 4OLIA 5EW8A 2RSVA 4DITA 2ZV9A 2IW8A 4XMOA 4ORKA 4PPCA 4RX9A 5ICPA 1CSNA 4I93A 2OIDA 3R22A 4OTQA 5AV1A 4AZEA 5ETCA 1FBNA 2B9JA 4BZDA 3R1NA 3SRVA 5HICA 2P2IA 3OZ6A 3WZEA 2V5QA 4WKQA 3WIKA 3ORKA 5AAEA 2JDSA 2XKDA 3KVWA 3FI4A 2GNHA 3V6SA 4DH1A 3F5PA 3FZRA 3KY2A 2CLQA 3MPTA 4BCJA 4KIPA 3QKMA 1OBGA 2I1MA 2QOCA 3PPJA 1KE5A 3P9JA 5CEOA 2VN9A 2WQBA 3CKWA 4FKOA 4IWOA 5H9BA 3ZXZA 3QQGA 2XK3A 1JOWB 5IQIA 4PPBA 2W0JA 3UNJA 2CCHA 3B8RA 4YTFA 2JD5A 4NEUA 5LCJA 1QCFA 3SOCA 4C2WA 2QOBA 3H9FA 4TT7A 4UBAA 5FTOA 1XKKA 2CN5A 3DB8A 4BDAA 2WQOA 4AAAA 5IPJA 5HCYA 4ZK5A 2NPQA 4AFEA 1OITA 4FV4A 5DBXA 4M0YA 5HE0A 3A7HA 2R3PA 2YDKA 3VBTA 4PMTA 2E9UA 5LCKA 4D2VA 4GEOA 2WMSA 1PRYA 3HP5A 3PJ2A 4DEHA 4EOKA 4YTCA 4FKSA 2Y6OA 2XNBA 2G15A 1G8SA 4FT0A 4XG2A 3FC2A 3O8TA 3HMPA 3NW7A 3SQQA 3VS2A 4R77A 3KFAA 3AGMA 3BYMA 4BDKA 2WMTA 1H27A 5H8BA 4Y73A 4O0WA 1PJKA 3BYVA 4FZFB 4JDJA 4M12A 3VRYA 3P86A 5CF5A 3NIEA 5LJJA 3HVCA 4Y83A 4EQUA 4RLLA 4U40A 3LQ5A 5HX6A 5ANOA 2G01A 3VRZA 3UVPA 2V22A 2BRBA 2IN6A 5T3QA 3Q4TA 2HYYA 5IQCA 3L8PA 2YCQA 4YSJA 3V5JA 4TXCA 4FR4A 5IUIA 4BN1A 5HVKA 2UZLA 1YWNA 1ZOGA 1R1WA 4EBWA 1I09A 3MBLA 3TNQB 5KCVA 3S2PA 3ULZA 3EQFA 4O2ZA 3JY0A 2WELA 3HGKA 4IX6A 1IEPA 2O63A 2CGXA 3LLTA 1H1PA 3SC1A 3T3VA 4F0IA 1ND4A 2R3HA 3BBWA 4AFJA 3A7FA 5JRQA 4YC3A 5DWRA 1KE7A 3FZSA 3GFWA 4S2ZA 3DTCA 3DQWA 3O96A 3DV3A 4M67A 2JBOA 2GHLA 5E8VA 4AN3A 5BVNA 4FIJA 5C26A 2HY0A 4YLKA 3EL8A 4YC6A 5C01A 4UYAA 5CU4A 4RQKA 5AR3A 4PMPA 5HBJA 5CSPA 3NUAA 2PUNA 2GNJA 2OW3A 4E6AA 3R7UA 4ERWA 3MVMA 4MH7A 1LEZA 3L8SA 4IAYA 2CSNA 4KKEA 5CEIA 4PL5A 4O0RA 4XH6A 2R3FA 3NYVA 4I0TA 4HW7A 3VBYA 5CSWA 4MXXA 2C4GA 1FVTA 3F69A 3Q52A 3GQLA 4H3BA 3CTJA 2XBAA 3RHKA 2B52A 4QTEA 3GP0A 3TEIA 4XNEA 3VHKA 4HCVA 1YI3A 3S0OA 4AA5A 4UMTA 4G9CA 3CPBA 5HG5A 4HPUE 4I4FA 5AAFA 4C4JA 5KMJA 1BL7A 3SXFA 5GJGA 5HZNA 5M57A 4RPVA 3HUBA 3N9XA 3C0IA 3OW3A 3HLLA 3CQWA 4XJ0A 2QKWB 4TYIA 4MK0A 1H26A 5CVHA 3OWLA 1JKTA 5IH4A 5LARA 3QCXA 2H34A 3K5VA 5AUYA 2QG5A 4FKGA 2V7OA 4HGSA 5ANJA 4CV9A 5AV0A 3MFRA 4EHVA 4BDFA 4FA2A 2WMAA 2PMNX 1WFCA 2BRHA 4YZCA 2C47A 1OIQA 1VYWA 3L9MA 4I6BA 1VEBA 3ZU7A 4PNKA 4GYGA 4EOPA 3QTWA 2JBPA 1ZYJA 4RA5A 1ZARA 4TRLA 4A4XA 3PSCA 5A4TA 3ATSA 5CLPA 2JITA 2X7OA 2CNVA 2R3GA 3KU2A 4IJ9A 3HRBA 1GZ8A 1LEWA 4YR8A 3BV3A 1H07A 2H8HA 4NKAA 4ACMA 4BDCA 4ZSAA 4MHAA 3D7TB 5BUJA 3GU7A 3W2OA 2ACXA 3BQRA 2OK1A 2VNWA 4IX5A 4PPAA 4BZOA 4EK4A 3T3UA 2BMCA 2YM4A 3FYJX 5AUXA 3QQUA 4FTKA 4ALWA 4J53A 4K9YA 1U59A 1YXVA 3CTQA 4AOTA 3A7JA 3M11A 2P55A 5FG8A 5EYMA 5DOSA 2P2HA 2X7GA 3GC7A 3OOMA 3U87A 4AZVA 4GVAA 3RM7A 4FKPA 5L2TA 4DA5A 2A27A 4FKIA 2EWAA 4U3ZA 5H8GA 2GU8A 4I0SA 3DBEA 1O6YA 1DI9A 3FZ1A 3A4PA 3HAMA 5KMKA 2IO6A 5HTBA 2OWBA 2E9VA 3ORIA 1J91A 4HVIA 3ZRKA 3AGLA 5TOZA 3R9DA 2XEYA 3V8WA 1PKDA 1OL7A 4ZEGA 3BEGA 4Y5HA 4BHZA 5IF1A 3ERKA 3N51A 3FL4A 4IH8A 3KB7A 1UWHA 3WZDA 2HZNA 2VNYA 4FTJA 4PDYA 1SZMA 4G2FA 1R78A 1VYZA 4UV0A 3FQSA 3D94A 3VBWA 2QLUA 4A7CA 5BYYA 2VTRA 5HU9A 4R5YA 4AZSA 3IECA 3NVKI 3QALE 5CALA 5HESA 3FZPA 4MYGA 3WYXA 5IQDA 1Q5KA 2B1PA 4ZIMA 3POZA 5ANIA 4JJRA 3OCTA 3U51A 4AT4A 3OD6X 5EOLA 5M09A 2UZNA 2W1ZA 1V0PA 4CNHA 3ULIA 1W98A 2Y7JA 5J5TA 3IDCA 3QRIA 1PMNA 1PYEA 2PVYA 3OWKA 4R7HA 1IRKA 3D4QA 2DUVA 3IQ7A 4XG3A 4A9RA 4RC3A 4KBAA 1BYGA 3QU0A 5DVRA 3C51A 5AV3A 3FI3A 4JG6A 1GAGA 4GK2A 4U5JA 3ZZWA 3DLSA 2VWBA 3R63A 4HNFA 5DN3A 2W5HA 4CRSA 4Z3VA 2ITZA 2XIZA 3GNIB 3V5WA 5HLWA 5CSXA 2A1AB 1URWA 2KTYA 2BALA 3AC3A 4O6EA 3LMHA 5CENA 3MFUA 2PY3A 4DFZE 2W17A 3D14A 4USDA 1NY3A 2IG7A 5L2QA 5CNNA 3EN7A 3II5A 4WUAA 4D55A 4EQMA 3H0ZA 5CI6A 1UV5A 5LWNA 3ACJA 2F49A 3TCPA 1A48A 2R5TA 3UOHA 4BTJA 5LVMA 2QO9A 3VVHA 4C61A 3F3VA 2PVFA 4MBLA 4RIOA 5TF9A 3CQEA 1L8TA 2YCRA 3ZO2A 5IH6A 3WE4A 3QWJA 1Q24A 1XH8A 2FUMA 4H39A 2IJMA 4BDGA 4F70A 2PMOX 4JDKA 4QMNA 4TTHB 4EUUA 4KINA 3G2FA 4RA4A 4NH1A 2C6KA 3BU3A 3QQFA 4JL9A 2XF0A 4F7LA 4KD1A 2PZRA 3BHUA 4D2PA 5CAOA 3NW5A 3KF4A 3LM5A 3KQ7A 4WUNA 3NWWA 3U4WA 1MQBA 5F20A 3IOKA 2VTNA 3Q9YA 4C35A 3BEAA 3F66A 3NRMA 1XJDA 4MBJA 4O91A 2LAVA 3VC4A 4RSSA 2AUHA 3E3PA 3G33A 4CFNA 2WXVA 4DLJA 2W5BA 4CYJA 5DI1A 2RG6A 4RJ8A 4C36A 3UBDA 4PWNA 4QTCA 3BGZA 4ZJJA 3VWAA 4BKYA 1OBDA 1WBPA 4HCTA 2ZAZA 1H08A 4LFIA 4GMYA 5IQAA 4EK6A 2XNNA 5DNRA 5FEQA 2OZAB 4IM0A 4EQCA 4D0XA 4UXQA 3W32A 2CKQA 4ENYA 3LAUA 3KRLA 5JZNA 2ZVAA 4YJNA 3VS6A 2VWVA 1OUKA 2XMYA 4EKKA 3Q9ZA 5KMNA 1Y91A 4GT4A 4IADA 3IW4A 4G3DA 4OGRA 5D7VA 5E1EA 2VGOA 2BFYA 5J8IA 4DG3E 2X6EA 3OP5A 4MQ1A 1P14A 3HMOA 1OI9A 3JVRA 4FTLA 3R0TA 2Z7LA 5HKMA 3SW7A 3R9RA 2QQ7A 4FIEA 1DAYA 1T46A 5CT7A 5D1JA 3ODZX 4XV1A 5EHYA 5HNGA 3ZBFA 4E3CA 2QU5A 2YEXA 4K2RA 4YNOA 3IO7A 2X39A 4D4SA 5KKRC 4R6VA 5IUGA 1VJYA 2PU8A 1OIYA 5T68A 5HORA 3I7CA 3NCZA 3RK7A 1ZLTA 2R2PA 5LXMA 5DA3A 1FGIA 4PF4A 4ZLOA 3OMVA 5CAQA 4QMWA 4RRVA 2XNEA 4FOCA 3QRKA 5EM5A 5HBHA 3LCOA 4O0TA 4CQGA 4YLJA 4FL2A 3UC3A 2X0GA 1DAWA 1YVJA 4M0ZA 2UVYA 3SDJA 5GZ9A 2PZYA 5HG8A 4GK4A 2PYWA 3VUDA 4FBXA 4ZSJA 2WMRA 1TQPA 3EQPA 2VTLA 4X3FB 4FF8A 4ZLZA 4FKVA 4L3LA 3RCDA 4EH4A 3NPCA 3VBQA 4FKUA 4J8NA 4PDPA 5I0BA 1J7LA 4F08A 3FYKX 3D0EA 4OTHA 4AP7A 2UW4A 3R02A 3OW4A 4EH7A 3R8UA 4Q9SA 4BYIA 4YJTA 5KHWA 4CG9A 3R83A 4ERKA 5EFQA 2IZSA 1NA7A 4E4NA 3GOKA 3BV2A 2PPQA 1ZYSA 1XH6A 2ONLA 2PVLA 3JYAA 2BTRA 4OTIA 5HE3A 3ORMA 2VTHA 4ZMEA 2XA4A 4II5A 4XBUA 2V55A 4IB3A 4M14A 4TYHA 2UZEA 4FEUA 2R9SA 3AXWA 3MY1A 3BYSA 3BE9A 1WZYA 3K3JA 4CSVA 1YHVA 2W1HA 4BWPA 5L3AA 1GIHA 3IGOA 2UW7A 5CX9A 3E88A 4LM5A 3VJOA 4AW0A 3OBJA 3Q6UA 3OUNB 4IVCA 2R3QA 3G0EA 4OTGA 2BZJA 2HELA 3O23A 4D0WA 4AUAA 5E8ZA 4ZTMA 4BCNA 3NMUF 2GS2A 4O82A 2YIWA 4BY9E 1WBSA 1RJBA 5I4NA 3I1AA 3PP0A 5LVOA 2NRYA 3BU6A 5M44A 3BYUA 3C4WA 4DF3A 2ZMCA 4GG5A 1ZAOA 4ANMA 4ASXA 1OPJA 3TUCA 1Y8YA 4KIKB 3R2YA 3QCSA 5HG9A 2OLCA 2ZM4A 4O27B 4ZY6A 3IDBA 3W10A 2JFMA 4HVDA 4RVKA 4R1VA 3ZYAA 3E8DA 1Y6AA 3CE3A 5EKNA 1GOLA 4V04A 2ERZE 3AOXA 2W1EA 5KNJA 5L2SA 2BDJA 4JBOA 3PSBA 2Q0NA 2ZDUA 5A9UA 4DT8A 5HTIA 2HXLA 4RMZA 3SX9A 3T8OA 2BILB 2V62A 5HE1A 5FXSA 3B2TA 3GOPA 2JIVA 4RX5A 3N4UA 1YKRA 4PMMA 3W2QA 4XYFA 5FUTA 3ZSIA 3CY2A 1XWSA 3CD3A 4EZ5A 2H96A 3A8WA 3A60A 4P7EA 3QQJA 3NGAA 4FV1A 3CXWA 3ORNA 5F4NA 1BUHA 4YHFA 3TKHA 5L8KA 3FMEA 3ZCLA 5C4KA 5E8WA 4HZSA 4GV1A 3LIJA 3MSSA 2UVZA 3PPKA 2I0VA 2OF4A 4NM5A 3KXZA 4R3RA 5ANDA 4AW2A 4B6LA 1GJOA 3UPXA 2HW6A 3D9VA 3CGOA 3QZIA 2UZWE 1OL2A 1H8FA 4FL3A 3DXNA 3EOCA 5IKWA 2XK6A 3EWHA 5KZIA 3MI9A 2WTIA 1Q8TA 2VWZA 4X2FA 4BBMA 5IA5A 4USEA 2Q83A 3P5KA 5M4CA 3QRTA 3JXWA 4NJDA 5BVEA 4C4GA 5A4LA 1IG1A 2R7BA 4A9YA 4BIBA 3D83A 4YHJA 4LV5A 1NVRA 4L7FA 3NLBA 4I5CA 4ID7A 4HNIA 4XG6A 5E8YA 4XP2A 4AN9A 5E1SA 4TYGA 3BHVA 3GUBA 3ID6C 2B7AA 3VHEA 4F6SA 4Z55A 2X8IA 3QTIA 4MX9A 4FEXA 2ZV7A 3C4CA 4GG7A 2PE2A 3VBXA 4MQ2A 1YW2A 4NK9A 5JGAA 3PZEA 2QURA 4IVDA 4LUEA 3UQFA 2ITNA 3ZUTA 3WOWA 4FV2A 5AP4A 2B0QA 5G1XA 3FC1X 2Z7RA 5BVWA 4AGCA 4NSTA 4UWBA 4MEDA 1MP8A 3VF8A 3F3TA 4DC2A 5B7VA 2BHEA 4AU8A 4CYIA 5GJDA 2B4SB 3KREA 4UALA 3DZOA 5F1ZA 2QNJA 3V01A 5EQPA 4BDEA 5BVKA 4BYJA 3BKBA 1M2PA 1W82A 4GSBA 3KK9A 3LCTA 5FRIA 4ZTNA 4CGAA 3OXIA 4WBOA 2BRNA 2QLQA 4S30A 5CY3A 3R8VA 1B38A 1M52A 2VTPA 4GJ3A 2CDZA 4IEBA 4PDOA 3R8PA 2F2UA 4WIHA 3V6RA 1H00A 4CXAA 3UYSA 2YIXA 2QI8A 2Z02A 1BI7A 4BCOA 4A9SA 4M69B 2OIQA 3M2WA 3QUEA 5AP6A 4PP7A 4ITJA 4PX6A 5E8UA 1FINA 2QR8A 1H0WA 3OTUA 4FNWA 3ROCA 4D2RA 3KULB 2R3LA 5D12A 1QPCA 1OPKA 3QD4A 2E9PA 1K3AA 5L8JA 2W1DA 3I5NA 4HZRA 4FL1A 4HVHA 5I9ZA 5IEVA 4B7TA 3OC1A 1YWVA 3PA5A 4I22A 5C8NA 3SG8A 3REPA 2OJFE 3LJ2A 5AR7A 4ZTQA 4ZY5A 4BGQA 2ITQA 4DG2E 1PXPA 5ACKA 2VTJA 3HV4A 3RK5A 4EH2A 3LCDA 3OY1A 4HGLA 3FWQA 4EORA 1WVWA 4EHEA 4KS8A 4G16A 3HA8A 5LOHA 4CKJA 3Q9XA 5DT0A 4I41A 5M4FA 4UWYA 3UP2A 1YOMA 3TNIA 5CF4A 4LGHA 2JLDA 3P7CA 3C4ZA 3E8CA 4YJPA 3CPCA 2VTTA 2ZB1A 4FIHA 4L45A 4XG8A 3CD8A 3CIKA 4ITIA 4KBCA 4NIFB 4NKSA 2OBJA 2QHNA 3NIZA 4QMLA 3WZJA 3QCYA 1OIRA 3RINA 3TG1A 4CVAA 3BLQA 4YZMA 3FMJA 3HMIA 3PE1A 4IWQA 5HO7A 4Z7HA 5B2MA 1H1WA 5F95A 3F2AA 3BX5A 4FIIA 4GCJA 4L52A 5IA0A 4XOZA 4D1SA 5K0KA 4G31A 3TACA 4QPSA 2YISA 2SRCA 2IVVA 5EI2A 2Z7QA 4JRVA 5A4QA 4Y46A 5FEDA 4MD8E 1UNHA 5GNKA 4KUJA 3PJ1A 3QGWA 4RIXA 4EH6A 2IZRA 3G0FA 5BMMA 3R71A 3VUHA 3ZLSA 3ALOA 5DGZA 1H01A 2CMWA 2ITTA 1O6LA 4GH2A 4AOJA 2XCKA 3EH9A 4EYMA 5GIOE 2V7AA 3ANQA 3NW6A 4MF0A 4R3CA 2O0UA 2CJMA 1L3RE 3BLRA 2CCIA 4ZXTA 3WF8A 3O8UA 4BCPA 3QWKA 1OL6A 4WNMA 3W2RA 3C4FA 3CY3A 3MH1A 4JG8A 4JT3A 3RALA 2YITA 3V51A 4C57A 1PXOA 4CG8A 4X6RA 4AS0A 3QL8A 5AR4A 3G9NA 4ZTLA 3PLAE 4C4HA 3R21A 4O0SA 2YIQA 3A99A 5CYIA 3OCBA 4DEIA 3DU8A 4E93A 4I24A 3FE3A 3R30A 3AMYA 2PMLX 3QUDA 5LMBA 5AUVA 5GJFA 4FVRA 1NT2A 3P7BA 1GZNA 3PE2A 4MWHA 1WAKA 2JDOA 3TNHA 4G6NA 3A4OX 4BDIA 2HIWA 3QUPA 3L1SA 5IZFA 3F3WA 4NTTA 5ANEA 2RFSA 3O7LD 4GS6A 1ZYLA 5HIDA 3UC4A 1U4DA 3BWJA 2W4KA 4MXYA 4QTDA 4WHZA 2GSFA 5IG1A 1F0QA 4WSQA 4PRJA 3TWJA 5IA4A 4EOIA 3ZUVA 2JDTA 3TUDA 1HOWA 4U0IA 3NX8A 3DGKA 5AUWA 1NVQA 2YZAA 3P78A 4RG0A 2HAKA 2EVAA 1KV2A 3OS3A 4OBOA 3JPVA 4F1MA 4NW5A 3C13A 5CT0A 4RC4A 2A2AA 1JKLA 3EQBA 4L46A 4D1ZA 3DFAA 3LFBA 1MUOA 3OEZA 1W84A 2YJRA 5HBEA 2J2IB 2J50A 3CTHA 5DR6A 3ITZA 4TNDA 2OJJA 2CKEA 3DPKA 3E87A 5BMSA 2C1BA 4GU9A 2X4ZA 3NS9A 2ETRA 4BCKA 4HVSA 2WTWA 3UYTA 3MGYA 3LKMA 2VWXA 5L6PA 2WQNA 3FMMA 3GB2A 2G2HA 4EZ7A 3E93A 4IFGA 1SVHA 4B0GA 2YWPA 3KXGA 4X2JA 1XBAA 5JEBA 4KB8A 4DGGA 4IM2A 4FKLA 3NUSA 4H1JA 1WBWA 4J98A 2Z60A 3KVXA 5AP3A 4LV8A 4MBIA 3PUPA 2X9EA 4W4VA 1SMHA 2EUFB 3RJCA 1XHAA 3Q3BA 4E6DA 5CU0A 5BPYA 3W33A 3FI8A 1G3NA 3GGFA 5EHLA 1PXKA 4TY1A 4QRCA 3KXHA 3PA3A 4Q5EA 5LMAA 3TZ7A 4J8MA 4FNXA 2JDVA 2J0IA 5BNJA 1ZMVA 2BCJA 2PTKA 4X7QA 3UG1A 3UTOA 3VS5A 3HMNA 3W18A 3RAKA 3WF5A 3ZDIA 1U54A 2P3GX 2OKRA 5CSHA 4BRXA 3FUPA 2VWUA 3LOKA 3PFQA 2PWLA 4WBBB 5AUZA 5JRSA 4CT2A 3PIXA 3FMLA 5HVYA 3GVUA 3C1XA 3QQLA 2EB3A 4J52A 1M7QA 3GCVA 4RIWA 2JAMA 2BAQA 4TYEA 3G90X 4X2KA 1OVEA 2PUUA 3EKKA 1P4FA 4NL0A 2A0CX 2BDFA 3LFEA 2PL0A 4MWIA 4EK3A 1PF8A 3VW6A 2FH9A 4IANA 3V04A 3SGCA 1K9AA 4W9WA 4ASDA 2ONLC 4FTRA 4CKIA 5A14A 3RNIA 5CF6A 4TNBA 2B54A 2VUWA 4DFNA 2W06A 4FTOA 3FQEA 1OZ1A 3MFSA 4ZJIA 3COHA 4MNEB 4WG3A 4CFWA 2WQMA 1FVVA 5EG3A 1ZZ2A 3KMMA 5JGDA 3FI2A 4EHZA 3VS0A 2WMQA 2QOHA 3MW1A 1UKHA 5EQEA 4OR5A 3LE6A 5KMLA 3K3IA 4ZSEA 1ZY5A 3DKFA 1YHWA 2FA2A 2WO6A 3AT3A 4BI0A 3HV3A 5IQBA 2YABA 4EKLA
chains in the Genus database with same CATH superfamily
1G8AA 3FLWA 4U45A 4L01A 4G6LA 1Z5MA 3F7WA 4J1RA 4O2PA 4WA9A 4RZVA 3ZTXA 5H3QA 1KE8A 4DTAA 4F64A 4EH8A 1H1RA 3GC0A 5CTPA 4Z16A 4F6UA 5HQ0A 3KGAA 4C4IA 5J87A 2I0EA 4FV9A 1YI6A 3TJDA 4AT3A 3DJ5A 3ZEWA 2FSOX 2CGWA 4ACHA 1ERKA 5EK7A 4JIAA 4FVQA 5KMOA 4FSUA 4O84A 3ETAA 4JLCA 3WZKA 2WIPA 3QTRA 4FSYA 3AC4A 3TV7A 3MY0A 3V5PA 2FSTX 4CMOA 4NFNA 3CR0A 1JNKA 4QP7A 4NU1A 4UMRA 3BCEA 4CQEA 2RFEA 3SW4A 1S9IA 1UU3A 5D11A 4CT1A 4YJSA 1ZYDA 3AC1A 2OGVA 3PSDA 4A06A 4YMJA 3OCSA 3PWYA 3F88A 4UMQA 4AN2A 4DTKA 4RIYA 4CLJA 3R1SA 5M4UA 3F5XA 5M4IA 4QNYA 5IQFA 2BROA 3TZ8A 4LGDA 3G5DA 2VRXA 4RWLA 2X4FA 5I9WA 2ETMA 2X8DA 3UOLA 5L8LA 3Q2JA 3GU4A 3SG9A 1UU9A 5TT7A 4BCIA 4E73A 1PHKA 2W1GA 4LL5A 3TTIA 5CXZA 4DHZA 3DTWA 1XH4A 3DB6A 3TL8A 3HV6A 2OF2A 3MA3A 1YQJA 1H4LA 3KF7A 3V8SA 2B9FA 3IDPA 3OTVA 4JBPA 5IISA 4D4YA 5GZAA 5B2LA 2WMXA 3SV0A 2BRGA 3UJGA 3GEQA 4C4FA 4OBPA 2CNUA 2GTMA 3I4BA 5AR8A 4GUBA 3FEGA 4CCBA 5AIRA 3TZMA 3HAVA 3CJFA 5HOAA 3HDNA 4BTKA 3FHIA 4U41A 3HRFA 4HYUA 4NCTC 5KMMA 2ITOA 3I0OA 3OWJA 4FT5A 4G34A 4W4YA 3U8WA 2WTJA 5EKOA 3LFAA 4BCMA 5CANA 2YFXA 4KKHA 4M7IA 4IQ6A 1PXNA 3LQ8A 2WD1A 4IZ7A 4GT3A 2Y4IC 4X2GA 5DEYA 3IW5A 3F2NA 4E5WA 3COMA 2C0TA 3Q5ZA 4V0GB 5LVLA 3IPHA 5L6WL 3RCJA 1UA2A 1AGWA 4KAOA 3PVBA 5HEZA 3UP7A 4EYJA 3EKNA 5HCXA 4LGGA 3PXKA 2XKCA 4J96A 5K9IA 3KXNA 4GK3A 2WMWA 3G6HA 4HYSA 4O86A 1XR1A 2UV2A 4K11A 2C30A 4AE6A 3EFJA 2HWPA 3TUBA 4ZP5A 2X9FA 3LFDA 3MB6A 3TIZA 5C9CA 3VUMA 3R7YA 3NZ0A 3PG1A 5DFPA 3BRBA 3ZM9A 2Y4PA 2X2KA 2FGIA 1H28A 2Z2WA 4I21A 5CNOA 3NFFB 4JQ7A 2GFSA 4LOOA 3EN6A 2RG5A 2UZTA 4WNOA 4JG7A 4U43A 4FEVA 4XG7A 4G1WA 4QP8A 1LUFA 3VUTA 5FP5A 3VW8A 4LI5A 3TI1A 5AV4A 1H0VA 2HCKA 2Q0BA 1JLUE 4HPTE 4O0UA 5BV3A 5IA3A 3PG3A 2XNOA 2VTAA 2C6MA 4S34A 1NVSA 1OKZA 4XRJA 3TKIA 1U46A 3Q53A 4DFBA 3DJ7A 3SA0A 3ELJA 1MRVA 4DH7A 3LHJA 4FTNA 5DT4A 4EI4A 4F7NA 3MFTA 4X3FC 3WYYA 3AMAA 3RP9A 4CTCA 4E26A 2KULA 4OAUC 2O3PA 4IHPA 4Y85A 3NSZA 4J97A 5AV2A 3FPMA 3I81A 1WVXA 5EDPA 4ZSGA 4I4EA 3NDMA 5E9EA 4C3FA 5GINE 4IJPA 3Q2MA 1ZYCA 5E90A 4BTMA 4ONAA 4DCAA 3DZQA 5CU2A 4FMQA 3FV8A 5HE2A 2XZSA 1TQMA 2ZB0A 4X2NA 4BI1A 5DMZA 4DH5A 2PSQA 5EHOA 1J3HA 4JS8A 2E9OA 1TQIA 5FEEA 4CFFA 2OICA 4I6FA 3I7BA 4I0RA 4QMUA 3C5IA 4E5AX 5TO8A 1A06A 4FV3A 3CBLA 4IZ5A 3W2PA 2IF8A 4RZWA 4DT9A 3IK3A 4HYHA 4YJOA 3OFMA 1WBVA 3QD2B 5HIBA 4RJ7A 4P5ZA 3UNZA 4QMVA 3ZO1A 4QP4A 4ASEA 4DDGA 4NT4A 3L9PA 4K18A 5EYCA 4L7SA 3OXTA 4O0XA 4CLIA 1TFFA 4DEEA 4L43A 3V5TA 2UVXA 4FKRA 2AC5A 4QTBA 3KMWA 3W55A 3AD5A 4GYIA 2Z7SA 4D1XA 1O6KA 4LYNA 4LRMA 3P23A 3IKAA 4YPDA 4IAFA 3NUPA 4DGLC 3U4UA 4F63A 3U6HA 4IFCA 3RVGA 4O1PA 4ZOGA 3HECA 2R3JA 5IUHA 2VX1A 5DT3A 1YWRA 3Q60A 2X2MA 4RWJA 3OCGA 3W8LA 3MVJA 1SNXA 2PMIA 3UVRA 3FLNC 1Q8UA 1QPJA 4JBVA 5KZ0A 4RWKA 5EM8A 1R39A 3I6WA 4EK8A 4YZDA 4FGBA 2OFVA 3F3ZA 3QRJA 4M66A 4DFYA 1OGYA 2J7TA 3QLGA 4EBVA 2XUUA 2FO0A 1U5QA 4RFZA 5J95A 4KIQA 1URCA 5JMSA 2XM9A 4YGAA 4RBLA 2G1TA 1W7HA 2R0IA 1BL6A 1M14A 3N4VA 5IEYA 3O17A 2PVMA 1AQ1A 5K5XA 2R64A 1OL1A 1V0BA 4TPTA 4YC8A 3JR1A 3MPMA 2OI4X 3EN5A 4QPAA 4DEDA 4FG7A 5D41A 1KE9A 4I6QA 3VONA 2ITYA 3EMGA 4JI9A 4O4FA 4LL0A 2NO3A 4YTHA 4YJRA 3TDVA 2E2BA 5AM7A 4A4OA 3ZLXA 5GZ8A 1PW2A 5AWMA 5B0XA 4EZ3A 2G9XA 1XH9A 4TWOA 3W2CA 3E62A 2REIA 4WRGA 3QF9A 1TVOA 4FT9A 4LRKA 4XOYA 2OXDA 3H4JA 3D7TA 3O8PA 3VS4A 4DCEA 4UXLA 3WILA 5C1QB 5J7HA 5J5SA 2Y0AA 4AX8A 2JGZA 4QP9A 4FUXA 3EQDA 4RX8A 3LPBA 4TW9A 1XBBA 4RJ3A 3KXMA 3R00A 2R3OA 3H0YA 2HY81 4FSTA 4D2WA 5DRBA 4C2VA 3UODA 3VBVA 5I5ZA 4L44A 3N4TA 4PQNA 4BWXA 4FV7A 2CKPA 2VTSA 4OW8A 3FSFA 3SLSA 5LMKC 4XLIA 2YCFA 1B39A 2WB8A 3SD0A 3U55A 3VIDA 3TDWA 3F61A 1YXUA 3I6UA 4F0FA 4F1TA 4RJ5A 4BJJA 1WMKA 4MKCA 2WTKC 4U7ZA 3C50A 2QOOA 2ZMDA 5AAGA 2BKZA 2YACA 5HVJA 4BIDA 1LR4A 3EHAA 3LJ1A 3M42A 4GJ2A 3TNPC 3OT8A 2WPAA 4EWQA 1A9UA 4OTFA 1KSWA 2XVDA 4QYFA 5A4CA 2HOGA 3LFSA 2AC3A 3QD3A 4IMYA 3WIGA 2GQGA 3ZS5A 4ZZMA 4FK6A 4XV3A 1NW1A 3A7GA 1GIJA 2QCSA 4AW5A 4HYIA 1ZMWA 4A07A 1SM2A 2W9FB 3ZM4A 4E4MA 3HZTA 3DXQA 2O65A 5EQYA 5ETAA 3ORZA 4IB0A 3VQHA 3VJNA 4YP8A 3DDQA 5K5NA 1FOTA 4CMTA 2YA9A 5HD4A 4UZHA 3FY0A 4N6ZA 3C0HA 5CS6A 3ZLYA 5FTQA 2XEZA 4DGOA 5CXHA 3DLZA 3FMNA 3DOGA 4W9XA 3RAWA 2W4JA 2LGCA 4RGJA 4DEGA 2W9ZB 4ZSLA 3DNDA 3QCQA 3R04A 1IR3A 2XNGA 3QXPA 4H3QA 4RJ4A 4F6WA 4ZTHA 3UIXA 3QC4A 2PZIA 4B8MA 1JPAA 5AJQA 3VF9A 3DDPA 2QOLA 4OUCA 4OAVB 2RGPA 4ANSA 4AT5A 4G9RA 3UOKA 5AUUA 3QQHA 4QMQA 2IWIA 3ZZEA 1OUYA 2XP2A 1OPLA 3MTLA 5AADA 4DBXA 2QC6A 2J4ZA 3TXOA 4C3RA 3HL7A 3MESA 4LOPA 1UWJA 3WE8A 4BVUA 3NAYA 4FRFA 3ZXTA 2C6TA 5EW9A 3A7IA 4K0YA 5DEWA 4L3JA 5EW3A 2XJ1A 3RPSA 5BUEA 3KN5A 1PXMA 3D5UA 4UB7A 2CGVA 4FTMA 5CVFA 5CZIA 3S1HA 5HLNA 3C0GA 2UZUE 1H25A 1J1CA 4NM3A 1OKYA 4WD5A 3RPRA 1JWHA 4KNBA 4O0YA 5KBQA 1PYXA 5CQWA 4KWPA 3KIOC 3HV5A 3D2IA 3JVSA 3ZO3A 3LMIA 3MH2A 1JBPE 3QGYA 3PYYA 4QYGA 3K2LA 3RAHA 4BC6A 4EEVA 1P5EA 2E9NA 4XCUA 2HK5A 4W8DA 5KUPA 5I9XA 3UE4A 2VTMA 3NUXA 1M17A 3UMWA 4FTAA 3D2KA 2JEDA 1PMEA 3PXZA 3R7OA 3VULA 3AT2A 5JGBA 2X0QA 4JRNA 4XP3A 2R7IA 3OG7A 3DQXA 5KBRA 4UMUA 4HGEA 4S33A 2JIIA 4X3JA 3BIZA 4YSMA 4YUQA 2PVJA 4LUDA 4XV9A 3IONA 1W8CA 3EYHA 3FXWA 5IA1A 3B8QA 4C4EA 4IZYA 2J0KA 4N57A 4ACDA 4QYEA 3F6XA 3QA0A 4RJ6A 3PY1A 4ACCA 3BYOA 4IDVA 3FLQA 3RHXA 5CWZA 1FQ1B 4QD6A 3DK3A 3FZOA 3FLYA 1B6CB 2J5FA 4NCTA 3SRVB 5TR6A 2GNFA 5AX9A 4DHFA 5JZJA 1SYKA 2ZV2A 3EQIA 1E9HA 2WFYA 4EC8A 5KKRB 3QTSA 4IBMA 4IW0A 1H1QA 5IU2A 1W83A 4QP3A 4AOIA 1Y6BA 1REJA 3TM0A 4PP9A 2RKUA 3O0GA 3PA4A 4IWPA 2UZVA 1YDSE 2RIOA 2C0OA 3FZTA 1Q62A 3RK9A 4RFMA 4H58A 4YJUA 3KEXA 4EH5A 4XRLA 5A54A 4GFMA 4KRCA 4FZ6A 3RTPA 2YIRA 3QKLA 1IASA 1Q8ZA 3AC8A 1GNGA 3MH0A 5C03A 1JSTA 3ZDUA 4EH9A 3CQUA 5A46A 4KIOA 4BCHA 4O7RA 3KMUA 4X21A 5HGIA 5CEMA 2A19B 3NYXA 4O7TA 5C27A 5J7BA 3D5WA 2W05A 3G6GA 2Z8CA 4IAAA 4MXOA 3GI3A 2BDWA 2UW6A 5FTGA 4RVTA 2QR7A 2R0UA 5J9YA 1P4OA 5E7RA 4HOKA 4BR3A 3GC9A 3IS5A 4D2TA 3H9OA 4R78A 1YXXA 4Q2AA 3H30A 4OTPA 5FGKA 4O7VA 4IVBA 1HCKA 4RQVA 3GQIA 3QYWA 1DI8A 3I60A 3NNUA 2XKFA 3R9OA 4FSNA 4GKIA 4Y8DA 1Q8WA 2CLXA 3PJCA 3GCQA 4G17A 5DLSA 5I3RA 1IA8A 2ZDTA 5HLPA 4X3FA 1FGKA 3O2MA 2VV9A 4D2SA 3HA6A 2FVDA 4O4DA 4F09A 3OF0A 2QONA 2OO8X 4XUFA 4N6YA 3TTJA 4FODA 4W4WA 2VO7A 4ASZA 2RFNA 5EM7A 3FAAA 2QO7A 1YI4A 2NRUA 4F9AA 3PP1A 2CKOA 4FNZA 2JKMA 2C5OA 2EB2A 4JDHA 2YM5A 3RM6A 3GU8A 3Q96A 4PDSA 3AKLA 4N70A 4FKTA 4LMUA 4QQCA 3FMHA 4D4RA 3UZRA 1E1VA 3PJ3A 3BGQA 4YO4A 3DBQA 3QTUA 1UU8A 5EOBA 2OU7A 2C68A 3MS9A 2VAGA 5FM2A 4FG8A 4QQTA 5E8SA 4YU2A 5CAVA 5LQFA 2EU9A 2FB8A 4MVFA 3THBA 1X8BA 3LFFA 4IB5A 3FPQA 1I44A 3IW8A 1IAHA 2PE0A 2VU3A 2GMXA 4M8TA 4S31A 5IMXA 2XBJA 1YDTE 4ANBA 3PWDA 1KOBA 4GVJA 4QYYA 4QDEA 4AWIA 2HENA 1EH4A 1UKIA 4QNAA 2XRWA 4IZAA 5I9VA 1M2QA 4UWCA 3ZONA 3ZSGA 4CFUA 2O5KA 3Q4CA 5IMEA 4E7WA 4E6CA 4NYEA 3FXZA 4JOAA 3KK8A 2YN8A 4APPA 3MIAA 3UO6A 4TKSA 3MDYA 2WQEA 3R6XA 3ET7A 4IIRA 4O7SA 4KIKA 4FT7A 5JFVA 4QP6A 1W0XC 2OJIA 4D4VA 4AXDA 3EQHA 1R3CA 4O0VA 1ZXEA 4RT7A 2WEVA 4E4LA 4EOLA 1DM2A 2IVSA 3LFCA 5JQ5A 1ZY4A 4U79A 4G3GA 4BKJA 2JDRA 3HX4A 4IC7A 4MXZA 2PZ5A 3QA8A 2CGUA 2UW5A 5HTCA 4PTCA 3ZOSA 5JN2A 1MRYA 2J0LA 2XYUA 3H9RA 5G6VA 3FBVA 2OH4A 4M15A 4C58A 4IC8A 4NFMA 2GQSA 5M51A 3PIZA 3DKGA 2V0DA 5JKGA 5IDPA 5AR5A 4A9UA 4C34A 2F7XE 4NW6A 3V5LA 3UZTA 4RFYA 3HNGA 4UZDA 3OOGA 1ZWSA 3WARA 3UO5A 3VS3A 2IPXA 1T45A 1AD5A 4NUSA 3PXYA 4QP1A 4YHTA 1VLRA 2OIBA 4IB1A 1S9JA 2IZUA 2YLEA 4AG8A 5BUIA 3QLFA 4AZTA 4G3FA 3DAEA 3EJ1A 3EQRA 5IH5A 4DAWA 3RPOA 4CKRA 2PUIA 4U3YA 3BZ3A 3ZO4A 4KSQA 3ANRA 2VX3A 5E8XA 4YO6A 4CRLA 3BWFA 4OT6A 1STCE 4WT6A 2XNMA 4UN0C 3A62A 4JXFA 4HJOA 2C6LA 3AMBA 4QOXA 4FSRA 2XIRA 2UW8A 4JDIA 4DGMA 3QX2A 3QZHA 3I79A 3BQCA 4JQ8A 3ACKA 5I3OA 2BKKA 5K0XA 4GRBA 4EOSA 3C4XA 3RWPA 1RDQE 3FL5A 2YJSA 2QKRA 3CLYA 2BPMA 4C02A 5ANGA 4DEAA 5CU6A 4CFMA 1Q61A 4LMNA 3BLAA 5LMKA 4U8ZA 4Z7GA 3FKNA 2A4LA 4B4LA 4O22A 4EC9A 3G51A 5A4EA 4QMSA 4E8AA 2WTDA 4O7ZA 4OTRA 4OTWA 5HD7A 4U9AA 2ZM1A 3EFLA 5HX8A 3MJ1A 3FXXA 3ENMA 2WTVA 1WBTA 2UZOA 3PXRA 4EH3A 1R0EA 2C3JA 4I20A 4E4XA 3P5JC 1XO2B 2OZOA 4M13A 1M2RA 4U42A 1JKSA 4O21A 1PMUA 4FKJA 3C9WA 4FV8A 3A61A 5H2UA 5HHWA 3RZBA 2PK9A 5FDPA 4FTUA 3FKOA 4IM3A 2OXYA 4I6LA 4O6LA 3NUNA 4O7WA 4Z9LA 4G3CA 3Q4ZA 3QTQA 3VNTA 2JKQA 3GXLA 3RI1A 2UUEA 3UIUA 4EK5A 3F9NA 4F0GA 5CAPA 4QMZA 3NAXA 3VS1A 3AQVA 5BYLA 3QTZA 1RW8A 3GBZA 3UO4A 4BHNA 1WVYA 1IAJA 2YDIA 1HCLA 5HNIX 4M69A 4ZZOA 4ZS0A 3FY2A 3C4EA 4WG4A 5C8KA 3RNYA 4TWNA 3Q9WA 4JX3A 3U9NA 3TKUA 4EHGA 3KULA 5FD2A 5I9YA 3BELA 2H9VA 5JK3A 2Y9QA 3HDMA 2X81A 2W7XA 3C7QA 2YIYA 4KBKA 4EWHA 2O8YA 4MXAA 4I3ZA 1YRPA 3TN8A 4AE9A 5DR2A 4DN5A 1H24A 4O1OA 3ZRLA 1YDRE 3GENA 4QDVA 2W1IA 2QHMA 4ITHA 2VTQA 1JKKA 5HI2A 3OUKA 4MD9E 5JSMA 3OROA 5M08A 3RPVA 3BHHA 4D58A 3D15A 4AACA 3PIYA 3W1FA 4ALUA 2UW0A 3MJ2A 1DS5A 4JBQA 4Y5QA 4AZFA 2F7ZE 4OTDA 2YAAA 4B9DA 5AX3A 2YM8A 4D9TA 3RAIA 2O64A 4F9WA 4JR3A 3MIYA 4FTCA 4QTAA 4FZDB 5M55A 1YOJA 4H1MA 4NIFA 3UQGA 3P7AA 2ZYBA 4PY1A 5ETFA 3UG2A 1M7NA 3Q4UA 1XH5A 2XIKA 4MCVA 3P79A 2YM7A 5I9UA 2VZ6A 4IAIA 3ML1A 3KC3A 3R7GA 4OT5A 4RVMA 4R5SA 2C5VA 2R3MA 2C3IB 2XS0A 5IQEA 3RKBA 2IVTA 3BU5A 3ZFYA 4FV6A 4C3PA 3L8XA 2Y8OA 1GIIA 2B53A 4IVAA 5AP1A 5KX8A 3UPZA 3OXZA 4NZWB 2C3KA 1FPUA 2ZV8A 4BFMA 4IAZA 4N4SA 4ALVA 1Q97A 5LVNA 1OB3A 1UVRA 2WZJA 4WOVA 4BB4A 3MTFA 4FUYA 5A6OA 1VZOA 2HXQA 4KRDA 5D9HA 5FP6A 3TV6A 3MVHA 4ANLA 1YXTA 4TZRA 4GFOA 4L42A 5FLFA 2YERA 2VD5A 1PY5A 2W1FA 3I0QA 4GU6A 4NM0A 3EN9A 1ZRZA 3ZC6A 3OWPA 4A4LA 2WTCA 4K1BA 4D5KA 4BGHA 3QTXA 2X1NA 4UYNA 2WKMA 3SKCA 1G5SA 4EONA 3E7VA 4MTAA 3IG7A 4C33A 4FE2A 4BZNA 2X0PA 1BX6A 4PNIA 2C6OA 3UMXA 4FT3A 3ENHA 4BDHA 3WF6A 3DBCA 3Q5IA 4C8BA 5BVOA 2J90A 2XARA 1Q99A 3OEFX 4EOOA 4ZTRA 3MPAA 3SHEA 2BZHB 4IAKA 1JAMA 3FKLA 2WAJA 2GDOA 3AKKA 3K5UA 3FMDA 3GFEA 4MF1A 4U81A 3ZUUA 2XCHA 4KS7A 4WNPA 4AXEA 2VGPA 4GL9A 4AF3A 4DE4A 4QMXA 2R3NA 1CTPE 3ORXA 4XLVA 2X7FA 2XK9A 2C3LA 4APCA 2PVRA 5EYDA 4C0TA 2F7EE 3ORPA 4L53A 5CASA 4P5QA 4YZNA 5L4QA 1FVRA 4BTFA 2IVUA 4EJ7A 5AIKA 4DEBA 2YCSA 4I5HA 5IDNA 4ENXA 3WBLA 3PDTA 3NUYA 2XH5A 2C1AA 2FSLX 4U97A 5JT2A 5IQGA 3HEGA 3R2BA 4K6ZA 4UY9A 3UDBA 5FXRA 5J1VA 2VO3A 2GFCA 5C4LA 1ZZLA 2YHVA 4CTBA 1KUTA 4FOBA 4G5PA 3UIMA 3V8TA 3UNKA 3EZVA 5AMNA 4FV5A 5M06A 2WU6A 3WF7A 2ZM3A 4NJ3A 5CAUA 4AXCA 1QPEA 3NUUA 3SGCA 3AG9A 4O7YA 2WEIA 4ANNA 3QXOA 4ZTSA 3AD6A 2WMUA 5BQ0A 5E91A 1U5RA 4R7IA 4FIFA 4PUZA 3JUHA 4KKGA 2WIHA 2XB7A 3CCNA 4YPSA 5CEQA 1IA9A 4F7JA 3KRWA 4XS2A 1WBOA 4YTIA 4BCGA 1E1XA 5L2IA 3R7EA 4TWPA 3DAKA 4YLLA 5CEKA 4CD0A 2XYNA 3KRXA 4BDDA 4BIEA 4ZAUA 2B9IA 3KKVA 3MV5A 3PXQA 1J7UA 4BBFA 3KRRA 3MY5A 3ALNA 3EFKA 2YDJA 3FHRA 2B9HA 4FZ7A 4G5JA 4H3PA 4XBRA 1XMMA 2A98A 3HV7A 4TYHB 4LRJA 2IEWA 5JFXA 2BTSA 5HO8A 4R3PA 3EZRA 3HKOA 3BE2A 4M68A 3VO3A 4DLIA 2IZTA 3DNEA 3QRUA 3AC2A 4QMMA 4X0MA 2J9MA 4ZJVA 2F9GA 2F2CB 2GHGA 4HVGA 2XKEA 4IX3A 4PTEA 4M3QA 5FWKK 3QYZA 4RVLA 5KO1A 1OKVA 4PV0A 3PVWA 3KN6A 4NWMA 1TKIA 1FMOE 2EXCX 3DA6A 3GCSA 4FGRA 5DR9A 4DH3A 5E8TA 5EI6A 4QMOA 2FSMX 3W2SA 2OH0E 4CZUA 4MAOA 4EOMA 4YZBA 1JQHA 1ZMUA 4FC0A 3E63A 4DBNA 4QT1A 4AGUA 2W99B 5DE2A 4FIGA 4MNEA 4JR7A 2J0MB 3OVVA 4S32A 3WZUA 3CEKA 3GU5A 3COKA 3FLZA 2QOFA 3W16A 4EJNA 5FDXA 4FSZA 3PRFA 4Q9ZA 3F7ZA 3PZHA 4W4XA 5ETIA 3QD0A 2VTOA 2XK4A 2OJ9A 3LXLA 3TT0A 2J0JA 4NTSA 3E5AA 2JAVA 3P0MA 4J99A 4XG4A 4C7TA 3KL8A 3UVQA 2BZKB 5ANKA 5J9ZA 3O71A 3MB7A 3Q32A 4JIKA 3O7LB 4I1ZA 4WSYA 3ZFMA 1TZDA 5JH6A 1REKA 3L8VA 2GHMA 2BR1A 2X6DA 3OY3A 2ITUA 3POOA 4K8AA 5GIPE 3K54A 2FYSA 4GFGA 4F65A 3E7OA 3DS6A 4YBJA 2RF9A 3DCVA 4GIHA 4R1YA 2B55A 4RLKA 3ZC5A 2YM6A 1UNLA 1Y8GA 1CDKA 3R28A 3RMFA 1JSVA 3S3IA 1YXSA 3D5VA 3PLSA 3KXXA 2HZIA 1XBCA 3WF9A 3BBTB 4I94A 2DWBA 3MWUA 4R8QA 2OXXA 4E6QA 5CI7A 2XIXA 3SXRA 5FM3A 4DFLA 3R8LA 2WU7A 5A6NA 5B2KA 2W4OA 3QHRA 3E3BX 4QMPA 2XM8A 4DFXE 5BYZA 4AGWA 4BWKA 3H10A 2C5YA 5BX0A 4WRSA 4L67A 4O96A 1J1BA 3ORLA 4LQMA 4DG0E 5DYJA 4FI1A 5K3YA 5KHXA 4LG4A 4QO9A 4BL1A 1BI8A 2R3KA 1QMZA 3BHYA 3DT1A 3LXNA 5F94A 4O7LA 3TIYA 4JQEA 4FICA 5M53A 5GHVA 1XQZA 2Y4IB 1KWPA 2XAOA 4YZ9A 3SAYA 4DYMA 1KE6A 1OKWA 1SNUA 2P33A 4BCFA 2R4BA 1V1KA 2QD9A 1V0OA 4HGTA 2IW6A 5AR2A 3QHWA 2PVHA 5EM6A 4B99A 3UIBA 1XH7A 4L8MA 5HG7A 3ZH8A 4FSWA 5C8MA 2ITVA 3NYOA 4CMUA 4DDIA 3R9HA 2EXEA 3IOPA 5TKDA 1WCCA 2C69A 3ZFXA 4BF2A 3RWQA 4K77A 3RZFA 3LJ0A 5HCZA 1WBNA 2VO6A 2C6IA 2JC6A 4F9YA 4U44A 3NR9A 5BVDA 2WOUA 5JFSA 3F2RA 4FV0A 4QP2A 3I5ZA 4AA0A 3FLSA 2GTNA 3BPRA 3QZGA 4D9UA 3F5GA 5AP7A 3U6IA 3O5AA 4V0GA 4IDTA 4E1ZA 4E20A 4PMSA 3FDNA 2BAKA 2EXMA 2ETKA 2ESMA 2BHHA 5T6KA 3VN9A 5JFWA 3U9CA 4N0SA 3CC6A 3GCUA 5AA8A 2CNQA 1W2FA 3BGPA 5BVFA 4PTGA 5A3XA 1PXLA 3ZMMA 3DXPA 4FYNA 1Q3WA 3LFQA 2QOQA 3G9LX 2GNIA 3CP9A 3DKCA 4QPMA 3D5XA 4O7NA 5KMIA 3TV4A 5FQDC 3EFWA 2X8EA 4J71A 3COIA 5FXQA 4GKHA 3R8ZA 5AFVA 4BCQA 3HYHA 3DJ6A 2CN8A 3H3CA 5DHJA 4WG5A 4YNEA 5AEPA 4MUQA 4ZMFA 3DKOA 3ZLWA 4FG9A 4E5BA 2P0CA 3DBDA 4FSMA 2VX0A 4MD7E 1LP4A 3BL7A 2XK7A 5AP2A 2O2UA 4AZWA 3LQ3A 4P4CA 4G3EA 3LCSA 2F4JA 3P1AA 4AGDA 2NP8A 1Q41A 2DS1A 2Y6MA 1ZOHA 3EL7A 2RFDA 3F5UA 3HRCA 5DIAA 1Z9XA 3FQHA 4QYHA 4OBQA 4AXAA 5K4JA 4QMTA 4CFXA 2QG7A 3KA0A 3JY9A 3PVUA 4RWIA 5EDQA 5F9EA 4ARKA 3IW7A 2XRUA 2OSCA 4H36A 5J9LA 1KV1A 3SXSA 4BDBA 4FNYA 4TL0A 4L00A 4Q5HA 2ITPA 2R3RA 5TE0A 3QC9A 1H1SA 3R1YA 4ZLYA 4ZY4A 2PHKA 4FX3A 4L9IA 4F4PA 3EYGA 5AA9A 4I5MA 1PMVA 1J7IA 2DQ7X 4U6RA 4XG9A 4DTBA 3PRIA 3TJCA 3EQCA 2GS7A 2PVKA 2AYPA 3OHTA 4BGGA 4C62A 4IX4A 4I23A 4P2KA 4XX9A 4CV8A 3LVPA 4PL3A 1K2PA 4J7BA 4XHKB 4CFVA 1PXJA 3MYGA 3GC8A 3M1SA 3ZRMA 1UU7A 1RQQA 3B2WA 3Q04A 2UW3A 2C5XA 3GU6A 3QKKA 2YAKA 4RIXB 1CKPA 4ANOA 5CEPA 5CF8A 2WGJA 3MH3A 4L6QA 1CKIA 3DK6A 2BIKB 4IWDA 3PY0A 3UQCA 5KE0A 3GCPA 4DHIB 4USFA 5LWMA 4GIIA 3PXFA 4FTTA