3RINA

P38 kinase crystal structure in complex with small molecule inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Indolin-2-one p38(alpha) inhibitors I: design, profiling and crystallographic binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rinA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rinA01
5F94A 3PSBA 4ZY6A 4FICA 2UZTA 4TPTA 4ZJJA 4A7CA 4BCOA 3SW4A 1UU9A 4TXCA 4YJNA 4DGGA 3TNWA 2DUVA 4DEEA 5FQDC 1ZXEA 1OGUA 2GHGA 4EYMA 5TE0A 5L2QA 4FUXA 3QD2B 4KD1A 4S34A 2BRMA 4V05A 3V5PA 4DEIA 4JJRA 4D58A 1VYWA 2UVXA 3MFSA 4DITA 4RSSA 3AC8A 4KABA 3LAUA 2QLUA 4BDHA 4EHZA 3EKNA 2J0JA 5HG5A 3UTOA 2P33A 3VUIA 4G3GA 3EQPA 4AXAA 4A9SA 3TV4A 3HAVA 5HIBA 3U4UA 2W9FB 3UZPA 4O0YA 3M11A 5FDPA 2R5TA 3Q53A 3I7BA 4EZ5A 4XNEA 4X7QA 5BMSA 4EOKA 3OROA 1WVYA 4HCTA 5E8ZA 3GC8A 3RK9A 4ANQA 4AZEA 3A4PA 3T8OA 4YC6A 4NUSA 4B7TA 4ITJA 3CD3A 3PZEA 4II5A 2OXYA 1L8TA 2R2PA 5KMKA 1OPLA 4LV5A 1UU7A 1NVQA 1FVRA 4XV9A 5AR8A 1QPJA 4EORA 3EQCA 5B7VA 3IONA 5C03A 2F49A 5CAVA 4AG8A 1JKSA 2BRNA 5EQPA 1PRYA 4FT9A 1VYZA 4UALA 3VJOA 5ANOA 5CTPA 5CXHA 3LJ2A 4TWPA 2V7OA 5EFQA 2RG5A 4L3JA 4NW5A 4P7EA 3Q5ZA 4KKEA 4M14A 3DDQA 4DGOA 2C6EA 1JSUA 2Z2WA 3FXXA 4F1TA 2Y4PA 4QNAA 2VWWA 4YMJA 5J7BA 3UNJA 5IUIA 4ZY4A 4I5HA 3LOKA 4F6UA 1I44A 2J0MB 3CS9A 5AFVA 3B8QA 2YM8A 5LMKC 3C1XA 2CCIA 3F5XA 4CMTA 2REIA 3OF0A 3CCNA 3C0IA 3REPA 2PVKA 4CV8A 3WOWA 1K2PA 1PYEA 2VNYA 3OXTA 1Y8YA 2C6LA 1PJKA 2CGVA 3ORZA 4EOMA 5M55A 4N6ZA 2W05A 4XCUA 5I4NA 3IECA 4CMUA 2PVJA 5CSWA 5EM6A 5M4CA 4MK0A 4QMMA 4A4XA 4BCKA 1B39A 3D5UA 2J6MA 4YPDA 3DGKA 4PNIA 3R7YA 3RCDA 4YURA 3GUBA 4ZTSA 5FXSA 5EQYA 4BDKA 2OF2A 5HTBA 3FKNA 1OL6A 4EYJA 3EFKA 4EC9A 4XS2A 4Y95A 3MW1A 4GJ2A 4NJ3A 4V0GB 1M7NA 2OJJA 2PVNA 3FI2A 3PYYA 3ZLXA 2W1FA 2KTYA 3FL4A 5AV1A 3OUKA 4I5MA 5JN2A 3T3VA 3BELA 4LUDA 4IX6A 2VTPA 4U3YA 2VTRA 2RFDA 4JX3A 2P2HA 3O8PA 4ALVA 3R1YA 1WBOA 2XVDA 5TO8A 4UBAA 2WTWA 1J91A 3EFJA 3FMMA 4OTGA 4AA0A 3ZRMA 1RW8A 1OECA 5IQDA 5HX6A 3KN5A 1KE9A 4IDVA 2X4ZA 4IJPA 4WG4A 5IQCA 1Y57A 2QR7A 3DS6A 4ZLZA 4J52A 3HV6A 5K4IA 3Q4UA 5AR2A 4RC4A 1CKPA 4FTLA 2FH9A 2X7GA 3TTIA 2QCSA 3PFQA 4CFVA 2G15A 4YJVA 5L6WL 2J0KA 4GT5A 4IX3A 4RIYA 4FV3A 3LM0A 3K5UA 1FVTA 3UQGA 4PNKA 5C8NA 3E8DA 1NXKA 4I0RA 3WIGA 5K0XA 2WQOA 5CT0A 3DJ7A 3QD3A 4N57A 4RIOA 5FEQA 3KQ7A 3OEFX 3IG7A 5HNIX 4FZ7A 3UO6A 2XNNA 3F66A 4RJ8A 4F1OA 4GMYA 3RZFA 3GOKA 1ZLTA 2WEVA 4QMYA 3F5GA 4XJ0A 5ETAA 1BKXA 1BLXA 2YDIA 1PYXA 1KE5A 2PL0A 1Q24A 4JQ8A 3C13A 4EK3A 1Y6BA 4G6LA 3R63A 4M0ZA 4PTGA 4WHZA 5A3XA 3V51A 3VS1A 5ETIA 5LVOA 4RVLA 4RWIA 4YO4A 2F2CB 4MHAA 2X8IA 4A4OA 4OAUC 3ENMA 2XIRA 3EFLA 5IPJA 3CQUA 3NNVA 5KE0A 4R7IA 3ZO1A 4E6AA 2WMXA 3Q4ZA 3Q96A 4LGDA 4MTAA 1FVVA 4FTNA 2YIWA 3F2AA 3UJGA 4B4LA 2PSQA 4DINA 3R71A 5CSPA 3K3JA 5I3OA 5AV0A 4ZTHA 5IA2A 1FBNA 4K9YA 3HRBA 4UEUA 4XBRA 3IK3A 1W83A 5D1JA 2C47A 2YCFA 2XNBA 4QT1A 4U40A 3VN9A 4ENYA 3TJDA 3DCVA 4CFXA 3SVVA 3Q9XA 3FMHA 2R4BA 4IEBA 4DLIA 4NKAA 3R9OA 5CZIA 2I40A 2QURA 1PHKA 3R01A 4WRGA 1YI3A 3D0EA 1JPAA 2PHKA 2YJSA 4QMZA 3H0ZA 5IU2A 1JKTA 2OWBA 2ESMA 1PXMA 3EQHA 4FF8A 3OEZA 4U97A 3EIDA 4ZJIA 5GJDA 1LP4A 2QOIA 3QQLA 4FKGA 3QZFA 1V0OA 3PXYA 3MJ1A 4FYNA 5DGZA 5E7RA 3VRYA 4RGJA 5B2MA 3FZ1A 3MPTA 3KF7A 5M08A 3NDMA 2PZPA 1ERKA 4K33A 2RIOA 2OH4A 4MWIA 3MH1A 4AGCA 4L8MA 3IGGA 1O9UA 3GC0A 2CJMA 1TQPA 3DZQA 3IQ7A 4CVAA 3TKIA 2W1DA 4W4YA 3V8WA 5B2KA 4FKJA 2WXVA 3EN6A 4XG3A 4CFWA 3ZUUA 1WBNA 3D2KA 1R3CA 2BAJA 2C3IB 3AC1A 1Q61A 3G2FA 3HUCA 4K18A 3SKCA 4DFXE 5KMNA 3ALOA 3Q2MA 3DZOA 3MH2A 1PXLA 3MIAA 3QZIA 2E9NA 2O2UA 4PP9A 4OTPA 4Q9SA 3TUCA 3R8VA 1IEPA 4AW1A 4E6CA 4YLKA 3KMMA 3NIEA 4HCVA 3UVRA 4ANMA 3ANRA 1M52A 2A27A 4F09A 2EB2A 4YZCA 3FLYA 4QO9A 4XYFA 4AA5A 4BI2A 3D9VA 2O0UA 5T6KA 2XEZA 2ITWA 2BKZA 3MVJA 4O7LA 4AN3A 3EYHA 2QHNA 4ID7A 3Q6WA 3P7BA 4I1ZA 4XG8A 3P78A 3W10A 2OIQA 3ZEPA 3ZO4A 2BUJA 5A6OA 1ZYDA 4F7NA 4C4FA 3OHTA 4QTAA 3AC5A 4I0SA 4CYIA 1OZ1A 5GZ8A 4FTQA 3T3UA 5BVKA 4FNZA 1QCFA 3GCVA 3SDJA 4RQKA 3DAKA 3BIZA 3FMJA 3V8SA 2VWZA 4QTEA 4GT4A 1IG1A 2YEXA 4AE6A 5GJFA 2UZBA 3ZZWA 3ZM9A 3OTVA 3S95A 2YZAA 4FBXA 4O0TA 4C2WA 3NUPA 2YDKA 2XKFA 4MQ2A 5HX8A 2F7XE 4C7TA 2Q0NA 4I21A 2ZV2A 2VO3A 2ITQA 2Q83A 4W9XA 4ASXA 4NWMA 3ULZA 4RJ6A 3COHA 3F88A 5AJQA 4HZRA 3NRMA 3DKCA 3NYOA 5KX8A 5K0KA 2R7IA 1SYKA 2IPXA 3RWQA 4HVHA 3F3TA 4F7LA 3D94A 3MA3A 1M2PA 4BHZA 2XS0A 3PP1A 3AD6A 3S1HA 4NH1A 4OLIA 5D41A 4Z55A 4KKGA 5EOBA 3ZXTA 4E5BA 4GYGA 3A7FA 4WBOA 1XBAA 5JEBA 2VWXA 3SRVA 4CKRA 5DMZA 2J7TA 4AT4A 5FDXA 4FG8A 1P2AA 3FQHA 4QYEA 3MSSA 1BMKA 4TWNA 2W1HA 4LYNA 4M7IA 5GNKA 4BCHA 3DFAA 5HO7A 4FT0A 5DWRA 3W2CA 4FKRA 3NAXA 2I6LA 2Y4IB 3IKAA 3TJCA 4E20A 2OO8X 3KA0A 4EK4A 4MNEA 3W1FA 5LCJA 3ORPA 3ZLSA 4EZ3A 4BCQA 4NTSA 2BIYA 2XNPA 3R7IA 2YWPA 3GU8A 2GNFA 5L2SA 3Q6UA 2X8EA 5E91A 1ZAOA 3C5UA 4DEBA 2GS2A 5ANDA 5CT7A 4RA5A 1Z5MA 1YWRA 5CASA 2C30A 3KL8A 4RIYB 2YWVA 3BX5A 4XOZA 3VC4A 1GIHA 2UVYA 3JS2A 4RJ3A 2QOKA 4QRCA 5CLPA 5IUHA 5AR4A 4C59A 3ORXA 2IG7A 3C4FA 3QTXA 1VR2A 2BZJA 3FE3A 2J0LA 2IZUA 2OW3A 4XHKB 3PY0A 5AP6A 4FTOA 4ZJVA 2QOCA 3FSKA 4IANA 4B0GA 4CRSA 4NU1A 2HELA 4E5WA 2CNVA 3A7JA 3ATSA 4YNEA 3R28A 4WG5A 3NUSA 2GMXA 2B4SB 3CKWA 4IJ9A 3NAYA 4ZTRA 5IDNA 3BZ3A 1YOMA 2VZ6A 3TEIA 3GNIB 4OR5A 1OPJA 3R0TA 3RK5A 4ACMA 4PMPA 3LIJA 2VX3A 3ZFXA 3U51A 3RINA 3P5KA 5LWNA 4L46A 2HWOA 3OS3A 5DR6A 5JGAA 4QP4A 3KCFA 4HYSA 3KN6A 2XIKA 4G5PA 5C01A 1FPUA 2PULA 4O84A 3AGLA 3HMIA 5IH6A 4IAFA 4RZVA 3LFNA 4PF4A 4QMWA 4TW9A 1HCLA 4ASDA 4U42A 3LXLA 4I3ZA 4YHTA 4APPA 2PVYA 2CCHA 3W16A 3HA6A 4CZTA 5L3AA 4Y72A 2OFUA 1V0BA 3NSZA 5HTIA 2ZV7A 3R8ZA 3QXOA 4R78A 4G34A 3QCYA 3R7EA 3NX8A 4BL1A 5JZNA 2C3JA 3OD6X 3RNIA 3DAJA 1W7HA 3QLFA 3QWKA 1WAKA 4YTHA 3ZFYA 5M4UA 3OY3A 5IEXA 2QO2A 5FD2A 5J95A 3RPRA 4BWKA 4LGGA 3CBLA 4IAIA 2PYWA 4FX3A 1VZOA 1YRPA 2HZNA 3DKFA 4RX7A 4EOPA 2WTVA 4O96A 4USEA 4C61A 3OT3A 2PPQA 3NEWA 4K77A 4JS8A 3LHJA 4IX5A 1PXIA 1XH6A 3B2TA 4XV1A 5EOLA 4UMTA 2WB8A 4R7HA 5BMMA 1IA8A 5E8TA 3BYUA 1W82A 2NRUA 4F4PA 5KKRB 2VTIA 4FTJA 2OZOA 4C34A 3S3IA 1JSTA 2X7FA 5AIRA 4NK9A 1LEZA 2CLXA 5C9CA 4FI1A 3BCEA 2GNJA 3HDNA 4QPMA 3BYOA 3HGKA 3FBVA 3ROCA 5CEKA 2ZV8A 3HP2A 1WVWA 3MBLA 2PY3A 2XNMA 4DH5A 4AT5A 2J90A 3PPZA 3W33A 4OTDA 4USFA 3Q3BA 4JIKA 3NCZA 2HW7A 3VBWA 5H3QA 2C3KA 5H9BA 1Q97A 3ZONA 4FSUA 3OCTA 3PXKA 4L6QA 4TNBA 3HRCA 5AP5A 3WZJA 4LRJA 3FQSA 4AGDA 4AW0A 3ZLYA 2ITOA 3KMUA 2BTSA 3K5VA 4U41A 4ASEA 5HG7A 4C57A 3UIUA 3PTGA 4A9UA 4BKJA 4C02A 3NVKI 3ORKA 3FZTA 5ANJA 5FP6A 4IWDA 4BN1A 5BX0A 4JRNA 3VS7A 4M13A 3HLLA 4RWKA 2JKKA 3WF6A 4TYIA 4Z16A 1CTPE 1OUYA 2IZRA 1J7UA 1GOLA 4O7NA 4TRLA 3NYVA 4KS7A 4RRVA 5AR7A 4EH9A 3FMDA 3JVSA 4ZZNA 2VWUA 3D14A 3R9HA 5I5ZA 2JGZA 5AP0A 3VBXA 3CTHA 5DOSA 5L4QA 5DPVA 4ZEGA 5HIDA 3A61A 2R3HA 2XB7A 4WO5A 3RPYA 3TWJA 1IA9A 2G1TA 5J5SA 5L2IA 2R3LA 2R3IA 4AZFA 3MI9A 3THBA 2RG6A 3QC9A 4BI1A 3AMYA 5M4FA 4L9IA 4GG7A 5EKOA 3PA3A 5HI2A 2RFEA 4DYMA 1MUOA 5CU0A 1IASA 4UZHA 5HESA 2JIVA 5D12A 3D7ZA 1RE8A 3PUPA 2QU6A 4FKVA 4X3FC 5JRSA 3GOPA 5T3QA 4LOPA 4ARKA 2CKPA 4HGLA 2V22A 5FGKA 5CF4A 1PMNA 3SA0A 3GCSA 3ANQA 4V01A 2XKDA 1W98A 3HZTA 1WBVA 3E92A 5CI6A 1H1PA 2IW9A 3VS6A 2FA2A 5JFXA 3MESA 2WMAA 5H2UA 4G3FA 2O5KA 5J8IA 1RQQA 4FGBA 4U44A 4MNEB 2PU8A 3AGMA 5CANA 5DEWA 4W4XA 4UMQA 4ANOA 4D55A 4QMPA 1PXJA 4RLLA 3HX4A 3PWDA 2YITA 4J96A 5IQHA 4FTCA 2R3GA 5FEEA 4O7SA 3WF7A 2XK3A 3BHVA 3H10A 3RP9A 2B7AA 4D4YA 1JLUE 3HP5A 4PDOA 4JBPA 4AA4A 5CVFA 5IQFA 2OK1A 1MP8A 2PE2A 3KC3A 4MD8E 4UWBA 3FI3A 4U80A 2BCJA 5JFWA 2PZRA 2UZOA 4MX9A 5DRDA 2WQMA 2E9OA 4ZSJA 4ACHA 3G90X 5IEYA 5HBEA 4I41A 2RFSA 2ZMDA 4J1RA 4RWLA 5HKMA 4D0WA 4AACA 3DU8A 3IW8A 3L8VA 4FKTA 4DTBA 3R02A 3IPHA 4KIQA 2XUUA 4JT3A 3G0FA 2R0UA 4PRJA 1JQHA 2DYLA 4JBVA 1FQ1B 4Y73A 4RZWA 3GQLA 4DLJA 2C6MA 4YU2A 2PMIA 4O0UA 1EH4A 5JKGA 4EZ7A 4FZAB 3P9JA 4DN5A 1YVJA 5IQIA 4DE4A 2CN8A 3ALNA 5E92A 1Y8GA 3V3VA 2VO7A 2VTTA 5HVKA 2XKEA 1XHAA 5HD4A 2UW3A 2WGJA 4X2GA 5E8XA 4K2RA 3G9LX 3KK8A 4FSTA 1X8BA 2UZLA 4FSWA 3W8LA 3U87A 4IWQA 4B8LA 5CVHA 3HECA 5CQUA 4AF3A 2YZLA 3PA5A 3RNYA 5AUYA 3EFWA 3VBQA 1LUFA 3LFAA 1ZZ2A 1LR4A 3LVPA 4O7YA 5E8YA 4CCBA 1STCE 1WMKA 4RIXA 2OLCA 5E1EA 2GTMA 4D4VA 1U54A 3LKMA 5K9IA 4EH3A 3FHIA 3FPQA 3RALA 2QVSE 4I4EA 4OT6A 3GC9A 2QONA 2PVFA 4XG9A 5D7AA 1UU3A 3MTFA 4I5CA 2C6DA 2WIHA 3ELJA 4ACCA 4M66A 2OJ9A 5KMLA 4EH7A 2WTJA 3C0GA 3SHEA 4YJPA 5EYDA 4H58A 5LVPA 3C4ZA 4MF0A 5IKWA 3ORTA 3VJNA 2WNTA 5EG3A 2GS6A 2PWLA 1CKIA 1OIUA 2WTKC 2XK9A 4V04A 4X21A 4C4EA 4D2RA 2XA4A 3UMXA 3G33A 3ROYA 3FZRA 5IQEA 3CC6A 3PXFA 3TZMA 4Y83A 1H1QA 2ONLA 4X2FA 2PK9A 4B8MA 5FWKK 4RVMA 2O8YA 3E93A 2G2HA 3CE3A 4D2SA 3BLQA 3H9OA 4WNPA 5CAPA 4APCA 2W4KA 4QPAA 3OFMA 3EKKA 2XYUA 4QYGA 3KEXA 1JOWB 5CEQA 3BU6A 3GXLA 4YTIA 3S2PA 4KS8A 2ZB1A 4FV1A 3UIBA 3ZTXA 1A48A 3NYXA 2ZM1A 3LCSA 3I0QA 3B8RA 3V04A 1PF8A 5J79A 4I92A 4J53A 4XG7A 4DG0E 4BY9E 2GFSA 4BKYA 3VAPA 3C4XA 3HVCA 5A54A 4KWPA 4FK3A 5BUEA 4EOIA 1ZWSA 5GZ9A 3PVUA 3MS9A 3Q5IA 1XR1A 2W4OA 2YABA 4S30A 1MRYA 4O38A 4D0XA 3PDTA 4MKCA 4BGHA 2WHBA 1R78A 5TOZA 4C4GA 1FMKA 1UWHA 2B0QA 5AX3A 3EN4A 4OW8A 5HNBA 4BDEA 3WZDA 4BCMA 4CG9A 1MRVA 5JT2A 4NIFA 4U8ZA 4TTHB 3UQFA 5FP5A 1BL7A 1OIRA 1Q4LA 2GQGA 3NYNA 2I7QA 3UQCA 2C0IA 2GFCA 2WTCA 2W1ZA 3QZHA 4W8EA 2XH5A 4EHVA 4L42A 1UNHA 4HVDA 5A4LA 4A07A 2HXQA 4J7BA 4AN9A 5L2WA 4PY1A 1NVSA 2W9ZB 4BIBA 4RIWB 3DBFA 4NW6A 2IVSA 3OW3A 2YA9A 2Y0AA 3LXNA 3O50A 3O7LB 4DAWA 3P0MA 5IG1A 4DFUA 1WZYA 3V5WA 4HGTA 1UU8A 3UODA 2WMWA 5EDQA 5FXQA 3VUHA 1E1VA 3ENHA 2CKEA 5AUUA 4GFMA 2H9VA 2PUUA 5IQGA 1ZY4A 4A9YA 1UWJA 4LL0A 2OU7A 2UW5A 3UOHA 4IVBA 5EK7A 2ITUA 4FKLA 4EH2A 3OXZA 4XUFA 5ANEA 3T9TA 2Z02A 2PZIA 3C51A 5E9EA 4IACA 4JBQA 4HVSA 4IVDA 1H25A 1OIYA 3DJ5A 4EBWA 3PIYA 1M2RA 3LQ5A 4CYJA 3KU2A 3OT8A 5I9WA 5G6VA 3MIYA 2R3NA 1GIJA 4K11A 2G2FA 4O21A 4E4NA 1PMUA 3BKBA 5JMSA 4FV6A 5L8JA 3R8LA 5HNGA 1UA2A 3WBLA 3MPAA 4G3CA 1H00A 3HV3A 2BTRA 5HE2A 5EYKA 3UPZA 1Y91A 3A62A 5FEDA 2G9XA 4UXQA 3ZS5A 1R0EA 3DKGA 5F95A 2FYSA 2LAVA 3EYGA 4FUYA 2WU7A 3TNHA 4D5HA 3UOKA 4HPUE 5IA5A 3ZH8A 4X6QC 4JR7A 5KMOA 3DTCA 3NS9A 4NL0A 5CAOA 1OL2A 5I9ZA 4FV9A 1Z57A 4EH8A 2F57A 4I5PA 3GFEA 4O91A 4D2TA 4FR4A 4KINA 3CKXA 5EQEA 3GC7A 3FZPA 1KE7A 4DHFA 3TZ8A 1F3MC 4QMOA 2FGIA 3BYSA 4NFMA 2I0EA 4NM5A 4D5KA 2O63A 3HUBA 2C0OA 2CLQA 3EZRA 4QMVA 1OL5A 4YC3A 5AWMA 3TIYA 2VTQA 3DY7A 3JY0A 1WVXA 3RGFA 2VTAA 3QTQA 5IH4A 2X6DA 5FTGA 3R04A 5JZJA 1ZYCA 3U6JA 1JBPE 5CF8A 3MFUA 1H26A 2OJFE 1XJDA 4NCTC 3JY9A 4RC3A 5DT4A 3BHHA 2GNLA 2XM8A 1H0VA 2AYPA 2YM5A 3R2BA 3W2SA 4NSTA 3FYKX 4CV9A 1XBCA 4TYEA 2A0CX 5AV2A 4DH3A 4LG4A 3UG2A 4RIXB 4CG8A 1H0WA 2BFXA 3A8WA 3OP5A 5CU4A 2E9PA 3NW5A 1U54B 4W4WA 3BQRA 1HOWA 1Q8UA 3A4OX 2QKRA 4E7WA 2XNEA 3PSDA 4U5JA 5HU9A 3O7LD 4BCIA 5LMKA 2JDRA 3U9NA 3FLWA 1GIIA 3DK6A 1WBTA 3CD8A 4ZIMA 4BBEA 1L3RE 3UOLA 3VW8A 4C0TA 3DOGA 5AAFA 3WIKA 2KULA 4O27B 4K6ZA 3LPBA 4JG7A 1GZKA 3ZZEA 5EKNA 3RJCA 3DLSA 3N9XA 4EQCA 3MWUA 3PG1A 3IS5A 4G2FA 3SV0A 4FTMA 3RM6A 3ZDUA 2CN5A 2ITTA 5B2LA 4PP7A 3Q52A 3DBDA 2ERZE 2YM4A 5A46A 2XRWA 4MXAA 2Y9QA 5DVRA 3ZEWA 3CJGA 4X6RA 4ZMFA 2GS7A 2XMYA 4O81A 2ZDTA 2FSTX 3R2YA 2VTJA 2W5BA 3KRWA 4FNWA 2VWIA 3MY5A 4GK2A 3RAKA 1J1BA 3LFEA 3PY3A 4P4CA 1YOLA 3EWHA 1M7QA 3FI4A 4I22A 4BDCA 3AT3A 5EM8A 5L6OA 4L7FA 5DRBA 5K5XA 3AMBA 5IQBA 1GZOA 2ETRA 4G9CA 2B9HA 4QYHA 2C0TA 3BE2A 4WSQA 4J71A 3KULB 2Z7RA 2EXCX 4CFNA 3LMIA 4D4RA 1JSVA 3U54A 3KRJA 3KXNA 3H30A 3LQ3A 4ERKA 1W0XC 2UW0A 2ZM3A 5BVNA 3DJ6A 4DTAA 2VGOA 5DR2A 5HIEA 4JVGA 2CPKE 3CTJA 5DG5A 2WAJA 3I1AA 5DHJA 5M4IA 4BWPA 4EQUA 1F5QA 2BKKA 3FMEA 5M53A 3QQKA 3BI6A 4IAYA 4H39A 4NIFB 4BDJA 1J1CA 4DGMA 4YR8A 1YKRA 1UVRA 3P86A 3FY2A 3VNTA 3W2QA 4Y5QA 2JD5A 4ZAUA 1G3NA 3BGZA 2IO6A 4FL2A 5EDPA 1YDRE 3ZRLA 3PRFA 4FEQA 2J2IB 3UG1A 4N6YA 4IB1A 4UV0A 1UV5A 4E4XA 3HRFA 4MBIA 3R7OA 5BYLA 4QQJA 3V5TA 4QYFA 2YHVA 3VF8A 4N0SA 2XRUA 2P3GX 2XJ2A 3AC2A 3MTLA 3OOMA 4KNBA 4RVKA 4WA9A 4L7SA 3FDNA 3F9NA 3HKOA 2PZYA 4D1SA 3QTZA 2ZM4A 3KVWA 4GG5A 4A4LA 2WOTA 3E8CA 4GUBA 1BI8A 5K4JA 5L8KA 5AMNA 3UZTA 5DBXA 1HCKA 4F7JA 3K54A 3ID6C 3TCPA 4IFGA 5HQ0A 4QP9A 2FB8A 3DFCB 3NW6A 2XIYA 4GVAA 3QYZA 5DT0A 1O6YA 3ODYX 4IWPA 1SVGA 1ZYLA 2W4JA 5D11A 3D5WA 5AP4A 4U3ZA 4M97A 4AZSA 3ZMMA 3NUAA 4EBVA 4FZDB 2A2AA 3KFAA 3R8MA 3UVQA 4MEDA 2BDJA 3POZA 2CGWA 3LFFA 4RPVA 2HZ0A 2R3MA 2YM7A 2B9IA 4CLIA 3NVMB 1OUKA 3F5PA 1P5EA 1K9AA 2WMRA 3P23A 3UO4A 2BZIB 3HV5A 4RJ4A 5E8WA 4M67A 5J5TA 4JNWA 2GU8A 5AP2A 2VU3A 4QP7A 4EJNA 5KO1A 1P14A 4DH8A 3G6GA 4GK3A 4BIEA 5FXRA 3Q04A 4WNMA 3G51A 4XOYA 3ZO2A 5CAQA 3FLQA 4L45A 3CTQA 2C69A 2UW4A 2RGPA 3QTWA 3CP9A 5D9HA 2W1GA 5AV3A 3CR0A 1FGIA 1B38A 1ZARA 2UZDA 4Z7GA 2UVZA 4JQ7A 4JG8A 3QD4A 1DM2A 4G16A 3SD0A 2FSLX 2ZYBA 4AU8A 4FIIA 3R1QA 3F3WA 1KSWA 5DH3A 1ZOEA 3QBNA 1O6LA 2XF0A 4JAIA 2VTLA 2WOUA 4IW0A 4RA4A 3FKOA 3VUMA 5LXMA 5M57A 1CMKE 4H36A 3SLSA 3UPXA 4FT5A 3QD0A 4FSRA 2XBAA 4O7RA 3KB7A 4UMUA 2X39A 2YIRA 3QL8A 4E26A 3PWYA 3L9LA 2HYYA 5M07A 4XG6A 5KMIA 4RLKA 5LMBA 2HY0A 4BVUA 5HLWA 5LJJA 5E4HA 2XK4A 2HW6A 4H1MA 2Y8OA 1BL6A 5AM7A 2XNOA 4JR3A 3DK7A 1OBGA 3FEGA 3QC4A 2JLDA 2WMQA 4EKKA 5EW3A 4IH8A 5HTCA 2J5EA 4IB5A 4QTDA 3WYYA 1APME 1ATPE 1YOJA 4FG7A 3EL7A 3QCQA 4I93A 1H4LA 3N51A 4O1PA 2EU9A 5ANIA 4IBMA 3A60A 3C0HA 3AMAA 4GU6A 3KK9A 4KSPA 2YACA 4DG3E 5CEMA 1ZOHA 4FSQA 3MVMA 5JQ5A 3L8XA 3ZBXA 2QI8A 3D5VA 1FINA 3TN8A 4L43A 5BYZA 2QOFA 4IB0A 3R9DA 2IZTA 2QNJA 3TI1A 3S00A 5ACBC 2XEYA 4IVCA 1YHSA 4ZS0A 4EK8A 5HLNA 5J1WA 2ZJWA 2I0VA 2FUMA 2BRHA 5EH0A 5BVOA 2JFLA 4JOAA 2ITZA 5HO8A 2PUPA 3QUDA 5HBJA 5A4TA 2CHLA 1S9JA 3UNKA 1NT2A 3DNEA 4FSMA 3CGFA 4MD7E 3NUYA 1VJYA 4D9UA 3GU6A 4E8AA 3BWJA 4L53A 2RFNA 3K2LA 5TR6A 2JDTA 5KMMA 1CDKA 4F6WA 3Q9WA 3A99A 3FKLA 5EI6A 1KV2A 4CRLA 4EI4A 5HG9A 5ANGA 3ZSIA 3KMWA 4EOQA 3VRZA 2XP2A 2QG5A 4AW2A 3KF4A 2E9VA 4HPTE 4PMMA 2UV2A 5EI2A 1V0PA 4CGAA 1UNGA 5C8KA 5GIPE 3ET7A 2HZIA 4FTKA 2RKUA 2XIZA 4PQNA 4QP8A 4U79A 4FKIA 4R3RA 3RPOA 4ANNA 3FQEA 3GEQA 3R7VA 3LM5A 5I9YA 3DXQA 3BEAA 4AZWA 3UMWA 5DYJA 3SG9A 4M69A 1DI9A 3L9NA 5EM5A 3VUDA 4KKHA 1JAMA 4L00A 2CGUA 4FZFB 3FLZA 3Q9ZA 4KRDA 5IDPA 3VBYA 4FIEA 2OIBA 4MXOA 3ULIA 4F0IA 5CALA 3HV4A 3RTPA 4BI0A 3TTJA 4ZY5A 2WZJA 3Q4TA 4MNFA 1O6KA 4ASZA 2SRCA 3MJ2A 3O51A 3ZC5A 2JKQA 2GTNA 4RWJA 5CU6A 3PJ8A 3R8PA 3VHEA 4Z3VA 3FI8A 1E1XA 3QRIA 4FG9A 3SXRA 4HCUA 4GRBA 1OVEA 4AOIA 4U0IA 3F69A 3DBEA 3QTRA 3ZU7A 1U59A 1OB3A 4GKIA 4DBNA 4WT6A 2HIWA 3C7QA 1YHVA 4E73A 5IISA 2QHMA 2X4FA 3NPCA 3BYVA 3V6SA 3P4KA 4B9DA 3QWJA 4I94A 4OBQA 1Q8YA 3AG9A 4R3PA 5BPYA 3N4UA 2XM9A 4H1JA 4FSZA 2GHMA 4JX7A 5DE2A 5HD7A 3RPSA 5KHXA 4E6QA 4I4FA 5D7VA 5A6NA 4YSJA 3E7OA 3V6RA 4EUTA 2WQEA 1U5QA 4FT7A 2CSNA 2B1PA 4PL4A 4E4MA 3TUBA 1OPKA 2R3OA 5IQAA 1IRKA 3NNXA 3VS5A 2B55A 3RKBA 4YJQA 4YZDA 4Y85A 5JQ8A 2X2MA 2VTSA 4FSNA 1RDQE 5ACKA 2WEIA 3L9PA 4H3PA 4KRCA 4OBOA 4DEDA 3A2CA 4UWCA 5EHYA 1WBSA 2YN8A 5FTQA 4BTFA 3QA8A 4Y46A 4C4JA 5CAUA 4U6RA 3OCBA 4EKLA 5LQFA 3DK3A 3E63A 3PJ2A 2OJIA 4N70A 4C3RA 3LXKA 3R7UA 1PXOA 4EONA 3SAYA 1M17A 2G01A 4IXPA 4L52A 2YCQA 4U45A 4BB4A 1YXUA 2PVLA 3WF5A 3CQEA 3S4QA 4BTJA 3QXPA 4HW7A 2VGPA 5HE3A 3ZFMA 3RAWA 4TL0A 3SQQA 3A7HA 3EOCA 4QMLA 3F2NA 4XRJA 2GPHA 4C33A 1OIQA 2OFVA 2W1CA 3D4QA 3V5JA 3U8WA 2RL5A 2YIYA 3KRLA 2VO6A 1AQ1A 3BEGA 4FODA 3E64A 5ETCA 2DQ7X 3QQGA 1GJOA 3VS4A 3R6XA 3ZLWA 3KVXA 4GCJA 4S2ZA 3UC3A 3QQHA 5M06A 3WYXA 4PX6A 5HG8A 3T9IA 4RIWA 3E3BX 2HENA 3OBGA 1YW2A 2W96B 4JRVA 3QUEA 1YWVA 4JXFA 2C5OA 4FV0A 4U9AA 4K1BA 5KUPA 4AZVA 5M51A 4OUCA 5AP1A 3FWQA 4BFMA 2VRXA 1T45A 3EHAA 3EN9A 4OTQA 3UNZA 4CNHA 2XCHA 1KWPA 3ACJA 4YJTA 4IAZA 5AUVA 5FM3A 2GDOA 2Z60A 3CEKA 4BDAA 3VQHA 3RMFA 4TN6A 1Z9XA 4FYOA 4YJUA 1QPDA 4EL9A 4YHJA 4P2KA 2QC6A 3BBTB 4LMNA 4LL5A 5BNJA 4D2VA 4GKHA 4EJ7A 4KBCA 3EH9A 3SGCA 5AIKA 1QL6A 3O71A 4ZSEA 2EXMA 1U46A 2VTNA 1YDSE 2PMLX 2UZEA 4CXAA 2R9SA 4TY1A 5CWZA 4DC2A 3I6WA 4XX9A 4KBKA 2BDFA 3E88A 2IVUA 4GH2A 3EN7A 4CTBA 5C26A 3TIZA 4XP2A 4AAAA 5CF6A 2PVRA 4RG0A 3MVHA 2BHEA 2LGCA 3VULA 1GZ8A 3QU0A 3TACA 4YUQA 2XK6A 3LFBA 3F6XA 4G5JA 4G31A 1Q99A 3EQIA 4XRLA 5CEOA 3ZHPC 2PUIA 2C5YA 5AUXA 3VS0A 4BDBA 4BGGA 4J8NA 3FXWA 5HCYA 2HAKA 4X3FA 3NUXA 3VF9A 1IAJA 3MY0A 4L44A 1YXVA 3ZC6A 4UMRA 1FOTA 3H4JA 2CGXA 4BBFA 4TYHA 1H1RA 4YC8A 3DT1A 3O8UA 3IOKA 4GSBA 1NY3A 2G2IA 4DTKA 2QR8A 3DAEA 5CENA 2WQNA 4GW8A 5EI8A 4XG2A 2PE0A 3IOPA 3N4TA 1YI6A 4BIDA 1ZRZA 1XKKA 2UZNA 4MBJA 5DN3A 5E90A 4IIRA 4AGWA 2VV9A 1U5RA 3D2IA 3F82A 3RZBA 1YQJA 2JFMA 3CLYA 3QRJA 3PXQA 5KNJA 4FSYA 4DG2E 3DQWA 2IVVA 4F9YA 2H8HA 5ETFA 3NMUF 4PPBA 4NYEA 2PMNX 4MBLA 2YM6A 2O65A 4QMUA 3GFWA 4PPCA 3DNDA 4ANSA 3RHKA 4FTAA 2GCDA 3UIMA 3KCKA 4RX5A 2JBPA 5KBRA 3BE9A 5I9UA 4JIAA 2X2KA 5FBOA 3WZKA 2YM3A 5K5NA 4JL9A 4QP3A 4M69B 4Y5HA 4ZSAA 4GL9A 3VW6A 4CKJA 5LWMA 4ZTQA 4IX4A 4L68A 1Q41A 5HCZA 4F65A 1PW2A 5M56A 1DAWA 3OWLA 4EUUA 4OAVB 4BR3A 1PXKA 4X0MA 5FUTA 2X9FA 4YPSA 5HEZA 4D9TA 4U81A 4MCVA 2XIXA 1XH9A 4KA3A 4GS6A 5L6PA 5F4NA 3DB8A 1YDTE 4FKSA 4MWHA 3KRXA 4QOXA 4IM2A 4RT7A 4Z7HA 4NTTA 3G6HA 1UKIA 3WF8A 3GVUA 4CFUA 4RC2A 2CNUA 4FIGA 4I23A 5DEYA 2Z7LA 2WU6A 2OICA 3FPMA 2C5NA 4CSVA 5HZNA 4CFMA 4QD6A 3F61A 4BCJA 3S0OA 2C5XA 5TT7A 4AZTA 1WBWA 3VWAA 4G9RA 3PXZA 3O96A 2QOOA 4KBAA 1F0QA 2WTDA 3EN5A 3TZ7A 3QLGA 4QP6A 2VX0A 2IJMA 4W9WA 3QGYA 5BUIA 2F9GA 1BI7A 5E1SA 5AAEA 4UYAA 4IHPA 2C6TA 3RVGA 3R30A 4FVRA 4RBLA 4PDYA 4DGNA 2W7XA 3IGOA 3ZYAA 1OMWA 4MH7A 4YJSA 4R3CA 5CS6A 3VBTA 2WPAA 3KREA 1YXTA 3UP7A 3PA4A 3PPJA 3TT0A 1A06A 5A4QA 2ZDUA 4FVQA 1GY3A 5EYCA 4ZMEA 5AR5A 4HOKA 3KULA 4I6FA 3I81A 2FVDA 3QCSA 3QF9A 1G5SA 2X7OA 4PDSA 1M14A 4E1ZA 3NNWA 2XYNA 2QD9A 5ICPA 2WQBA 3QTIA 1TVOA 4WBBB 4B6LA 5J9YA 3QQUA 3GU5A 2JAMA 2ZVAA 4R77A 3TDVA 1Q8ZA 1PKDA 1OI9A 3FAAA 3QHWA 4QMTA 3L1SA 2VWYA 2ACXA 5TF9A 3ZSHA 4D2PA 3TM0A 4NT4A 1H27A 2QOQA 3W8QA 4MF1A 5DNRA 1PXNA 4GU9A 4EOSA 2R3QA 3R21A 4QP1A 4ITHA 3MN3A 2C5VA 4JBOA 3UDBA 2OI4X 2V5QA 3BYMA 3HYHA 4AOTA 4K8AA 4UB7A 4C36A 1YWNA 4AWIA 5GINE 5CI7A 5DLSA 4FV2A 4IC7A 2PMOX 4PL5A 3MV5A 3WZEA 3EB0A 2BPMA 2Q0BA 4J98A 4LI5A 4RX8A 4S33A 3PPKA 4FT3A 2J4ZA 4F70A 4IDTA 4FGRA 3P7CA 4P90A 4G6NA 1MRUA 4C37A 2OH0E 4Q2AA 4ANBA 2BILB 3PXRA 4XP0A 2H34A 4USDA 1OBDA 5FM2A 3FZOA 1G8SA 4IM0A 4KIOA 1NW1A 3HMOA 2WFYA 4DFLA 3ERKA 3C4EA 3ODZX 3F7ZA 4GUEA 2C3LA 2OSCA 4M15A 3MDYA 4PTEA 4KAOA 3M2WA 2B52A 3RI1A 4UMPA 5IEVA 4NZWB 1ZMWA 2IW6A 4G6OA 3OCSA 3ORNA 4J95A 1SNXA 4IZ7A 4D1ZA 3FYJX 3TXOA 4AS0A 4J99A 4DFNA 4NM3A 2V0DA 2Y7JA 3EZVA 4L3PA 2ZOQA 2WMSA 4O22A 4B99A 4CZUA 3LJ1A 4J8MA 2HY81 2GQRA 4M68A 2OZAA 4MXYA 1QPCA 4TT7A 3LCKA 3I60A 4OTHA 4BTKA 1ZOGA 2BZKB 4KUJA 4F9AA 3CXWA 3DQXA 5C1QB 5C4KA 2R7BA 5CVGA 3KY2A 3EQDA 2HK5A 4LOOA 4BCNA 3G15A 3OMVA 4ACGA 2J51A 1H24A 3GCQA 1KUTA 3FLNC 4MAOA 4MXXA 4O6LA 4M0YA 4X3FB 5FTOA 2BIKB 3GU4A 5CNNA 3EMGA 3MFRA 2ITXA 2RSVA 4TYHB 4UX9A 4GV1A 4GT3A 1WBPA 4BCFA 4IAAA 5CU2A 3MH0A 3NGAA 4O7WA 5DA3A 5FBNC 3KGAA 4NM7A 4EWHA 3JPVA 4HYUA 4E4LA 4EEVA 3UVPA 4O83A 4U43A 4FV4A 3O8TA 2OG8A 2UZUE 4FNYA 4GFOA 4EOJA 4XMOA 4BZDA 5AA8A 4BYJA 4H05A 4RQVA 3COMA 5G1XA 2XJ0A 4F0FA 4EOOA 2J5FA 3E8NA 4LGHA 3ATTA 2Y4IC 5F20A 3PVGA 3R73A 2VWVA 3IW7A 4I20A 3MY1A 4FV7A 5J9ZA 4GK4A 1DAYA 2OBJA 2H96A 3VVHA 4DEGA 4LRKA 4I0TA 2ITPA 3AT4A 3PJCA 4DF3A 2F2UA 2CMWA 4QP2A 1OKVA 2AC3A 3DB6A 3OWPA 3QTSA 3UE4A 2YLEA 2UW9A 4FKQA 3VQUA 4XV2A 2I0HA 3V5QA 1SNUA 5CXZA 3SOAA 3OVVA 4LUEA 2UZVA 5AEPA 4FIJA 3AT2A 4L3LA 3IW4A 3E5AA 3ORIA 5IMXA 4F6SA 1IAHA 3FZSA 5GIOE 3DTWA 1SZMA 3FMNA 3LCOA 4DCAA 4BDFA 1PY5A 4CLJA 4O7VA 3C5IA 4NFNA 4Y8DA 1YXSA 2UUEA 3EQRA 5T68A 3VIDA 4F99A 4NM0A 4O0SA 1AD5A 4QTBA 4H3QA 5IMEA 1MQ4A 4O7TA 3QHRA 5AP7A 2ITYA 4RMZA 4AFJA 5JFSA 4QMXA 2R0IA 3PIXA 4HZSA 2B9JA 4ZSGA 1S9IA 4IE9A 4ENXA 2EXEA 2A19B 3SX9A 3QQFA 4FTTA 5AR3A 5J9LA 5EHOA 5CU3A 3LQ8A 1H28A 4YBJA 4LRMA 3DBQA 4TYJA 3WILA 4QMSA 4WIHA 4W4VA 2BALA 4NCTA 2OF4A 4A9TA 3IDCA 3AC3A 3I7CA 5LVLA 5L8LA 5I3RA 5HO6A 5L2TA 5FLFA 2YFXA 2C1BA 4PUZA 4JAJA 2Z8CA 3OZ6A 4M3QA 4AW5A 3BLHA 3V8TA 3BBWA 1PKGA 3QX4A 3LFQA 3GQIA 2EWAA 5AAGA 3ORMA 4DGLC 4FC0A 2HOGA 3UO5A 4FK6A 4IFCA 4BZOA 2VNWA 3VUKA 3SG8A 2BDWA 2X6EA 3E87A 3QALE 4FV8A 4LFIA 5HBHA 2XZSA 2QLQA 4AOJA 4GYIA 4P5QA 4CZYB 2X8DA 5JK3A 2OJGA 3II5A 1A9UA 2ITVA 5K3YA 2VUWA 2E9UA 4R1YA 4YZBA 4C35A 4YBKA 4TNDA 4U7ZA 2JEDA 3W55A 3OY1A 3HMNA 4EH4A 5A9UA 3Q2JA 3LZBA 4L01A 1ZYSA 4BTMA 3EL8A 2WD1A 3QX2A 5HORA 1E9HA 5C27A 4A9RA 2WTKB 4IQ6A 1AGWA 1H8FA 2AUHA 3OTUA 3DV3A 3QUPA 4PMSA 2RF9A 3OUNB 4G17A 5CQWA 5AUWA 3UZRA 4IM3A 2YIQA 3CIKA 3H3CA 3R1SA 3D7TB 2OIDA 5KKRC 4X2JA 1TKIA 3TUDA 2V7AA 5BVWA 3ZDIA 4D4SA 5JH6A 3ZO3A 2PE1A 3TDWA 1REJA 5DFPA 4ZZOA 3ZOSA 4MYGA 4R5SA 2JAVA 4X2NA 1ZMUA 1OM1A 5GJGA 3P79A 4MD9E 2VTOA 4WUAA 3QRKA 2YJRA 4CQGA 2ZV9A 3CY2A 5CF5A 3F3UA 2PZ5A 5HOAA 2W1IA 4DA5A 4FE2A 1XH4A 3FSFA 3EQFA 4BKZA 1PMEA 1W8CA 3OWJA 2EB3A 4IZAA 4FKUA 3WF9A 2CDZA 4LQMA 4WOVA 2QODA 2VO0A 3ETAA 4WKQA 5AP3A 2R3FA 4EK5A 4LM5A 3FXZA 4PL3A 4ZZMA 3LXPA 2C4GA 5EW8A 4JI9A 3PG3A 4WD5A 4IZ5A 2BRBA 2YCRA 4HYIA 3UBDA 5CSVA 4FA2A 3DA6A 4XBUA 4ACDA 3CGOA 2OZAB 1BUHA 4FIFA 4D28A 2PTKA 1P4OA 4OBPA 4EH6A 2CKOA 5J7HA 2DS1A 2Z7QA 3QTUA 2UW7A 5HLPA 3ZM4A 5EDRA 3QGWA 5LARA 3NCGA 3PLSA 4IVAA 4S31A 5HE0A 4EH5A 4HNFA 5A14A 4HYHA 3OW4A 4C8BA 4N4SA 3GCUA 5LMAA 3ZXZA 1H1WA 3KXGA 2E2BA 4CD0A 3MPMA 3ZBFA 5HU3A 4ZOGA 1RJBA 5J1VA 4FKOA 2GNGA 5DT3A 3BV2A 3L8SA 3NLBA 4AUAA 5IA3A 3C4WA 3DPKA 3QRUA 2UZWE 3EQGA 5BYYA 2QU5A 4WG3A 2YAAA 3LFCA 4XV3A 5F9EA 3AD4A 3L8PA 4E3CA 2V55A 1BX6A 3PVWA 4FTRA 3RAHA 3F7WA 4G3EA 3LMHA 3ZCLA 3AC4A 3MVLA 2IVTA 4O6EA 2GSFA 3FC2A 4TWCA 4YSMA 4DT8A 3DLZA 4EK6A 2VTMA 1UKHA 4Q5HA 3H0YA 5HCXA 4BF2A 4BWXA 3L9MA 4DCEA 4DFYA 2Y6OA 1PXPA 5KHWA 4JDIA 3C50A 3M42A 2J50A 3GI3A 4KIKA 1CM8A 3I4BA 1CSNA 4UWYA 4C2VA 3U55A 3UC4A 4IZYA 3TNPC 3WARA 2XJ1A 4YJRA 1ZMVA 4L67A 3C9WA 3HMPA 1SVEA 1K3AA 4NEUA 4CFFA 2JKOA 3DXNA 4BGQA 1DS5A 2ZB0A 2OKRA 4QMNA 4KSQA 3ZUTA 3HNGA 1YI4A 4ZTMA 2C6KA 2QOHA 4C4IA 2VD5A 2F7ZE 3R1NA 4UN0C 4JQEA 5FRIA 4WNKA 4XEYA 4BCGA 2WMUA 4GIHA 2HCKA 2Y6MA 3P1AA 4FVPA 3E3PA 3TG1A 5CSHA 1JKLA 4GJ3A 5CX9A 3UYSA 3IDPA 2J0IA 4C38A 3I79A 2B53A 4FKWA 4M8TA 2YERA 5CSXA 3HEGA 3D5XA 2HWPA 1PMVA 1U4DA 3PJ3A 2R3KA 3W2PA 4O7ZA 4ZS4A 2VX1A 4F1MA 5JRQA 3DKOA 4DH7A 2O3PA 5AX9A 2W0JA 3PP0A 3HAMA 3QA0A 4UXLA 4WSYA 2OXXA 1R39A 1H01A 1TQIA 5H8EA 1J7IA 4NJDA 3CSVA 1Q8WA 2C6OA 2JDSA 4CQEA 2BVAA 3VUGA 2JDOA 3A7GA 4FEXA 1CKJA 2F7EE 3ZSGA 3CJFA 3QKMA 4PWNA 4BCPA 4RJ7A 1ZYJA 3D83A 4ZLYA 4CCUA 4UYNA 4PMTA 5EM7A 3PJ1A 3I5NA 4IWOA 4YO6A 1UNLA 1URWA 1SVHA 1XH8A 2WO6A 4F9WA 3COIA 1XBBA 4FTIA 2XK8A 1MQBA 3BHTA 3BU5A 4MXCA 5EHLA 2XNGA 2WTIA 2QOLA 3CQWA 2OGVA 4I6BA 5EYMA 4TYGA 5HHWA 3VUTA 2QG7A 4J97A 3W32A 3JR1A 4O82A 2BRGA 4OTIA 2YISA 1FMOE 3MFTA 3O23A 3PVBA 4K0YA 4AE9A 2NO3A 5JGDA 3BHYA 2Z7SA 4EOLA 3A8XA 4I24A 5DR9A 2PVMA 3SC1A 3W2OA 4FEWA 4OT5A 3PRIA 5C8MA 1QMZA 4F08A 2X81A 2O64A 4R7BA 3BHUA 3U4WA 3LE6A 1SM2A 5CEIA 4IC8A 3H9FA 1LPUA 2IZSA 2VWBA 2R3RA 1SMHA 2IN6A 3GCPA 3LLTA 1IR3A 4W8DA 3UYTA 4DFZE 3KXHA 3OWKA 3NNUA 3PIZA 3JYAA 3TNQB 3R9RA 2NPQA 1Y6AA 2QO9A 5I9VA 2CKQA 3PSCA 5CZHA 4F9CA 4HGEA 3PY1A 3D15A 3LFSA 3NW7A 4F63A 5KMJA 2BAQA 4LV8A 3E8EA 4FKPA 2QOBA 3U6IA 3BGPA 2XK7A 3AOXA 3IO7A 3VHKA 4BC6A 3O17A 5JFVA 4DT9A 4UY9A 4HNIA 4XP3A 1KOAA 3Q32A 4FV5A 4O86A 3QCXA 4AN2A 3AXWA 2AC5A 1XQZA 4C58A 4BDIA 3B2WA 3NIZA 2JBOA 3IDBA 3RAIA 4ERWA 3HV7A 4GEOA 4I6HA 4M12A 4O0WA 5HVYA 4YJOA 4Q5EA 4ZXTA 1XO2B 5DIAA 5KZ0A 5KZIA 5GZAA 1KE6A 3RWPA 3PZHA 2H6DA 4E93A 2VTHA 3G0EA 1H08A 2CNQA 2YDJA 3QYWA 4IB3A 2GNHA 3BWFA 3N4VA 3ACKA 3HA8A 3NWWA 4OGRA 2W5HA 4P5ZA 2PUNA 4MXZA 1QPEA 3BGQA 3M1SA 3MB6A 1R1WA 2FSOX 4QYYA 1NVRA 3BU3A 5IUGA 1GZNA 5IH5A 1Q62A 4M84A 2ZMCA 4EHEA 3FLSA 3JXWA 4Q9ZA 4YZNA 4AGUA 2WELA 2HZ4A 4EQMA 5LOHA 2IW8A 3LLAA 3BRBA 5LVMA 3F3VA 3FMLA 4JDKA 3LMGA 3GGFA 4R6VA 5CYIA 3E7VA 3NZ0A 3HL7A 3QRTA 2BMCA 5JGBA 2B54A 3Q4CA 1R0PA 1T46A 3Q9YA 4O1OA 5E8UA 2GQSA 4ZTNA 5H8GA 4YHFA 4F0GA 5HVJA 4DEHA 1G8AA 2XCKA 2ERKA 3GENA 4R8QA 4EWQA 2WMBA 4QQTA 3COKA 2DWBA 4QTCA 2B9FA 3FJQE 4ZSLA 1W84A 4O2ZA 3FHRA 4FNXA 4PV0A 3KXZA 3EQBA 2GHLA 4HJOA 3FY0A 4CT2A 5CEPA 1H1SA 2A1AB 3LFDA 5D10A 4O0RA 2YIXA 5IZFA 3G9NA 4YP8A 1Q3DA 2NP8A 2P2IA 2OXDA 1OL7A 3GU7A 3R7GA 4FL1A 3JVRA 1LEWA 3QKLA 4AP7A 2NRYA 4C4HA 5ITAA 3WZUA 5I0BA 3UP2A 3QAME 4JDJA 1BYGA 4KIKB 2A4LA 4YZMA 4BICA 4C3PA 4CKIA 1VEBA 1NA7A 3KXMA 4OTRA 4DH1A 3CPBA 5BVEA 2X1NA 2XKCA 4CTCA 4KIPA 5GHVA 4QNYA 3OCGA 4ZK5A 3FUPA 5LVNA 2BROA 1Q8TA 3RBWA 4O2PA 3MB7A 3HDMA 1B6CB 3H9RA 3DBCA 4F7SA 3IW6A 2JDVA 4LMUA 4R1VA 4YLLA 1J7LA 1I09A 2UW6A 4YZ9A 4FEVA 3WE4A 3AD5A 4ALUA 4G1WA 2JC6A 3MH3A 4FOCA 3W2RA 4PTCA 3SRVB 2BFYA 1FGKA 3PLAE 3U6HA 5IA1A 1JVPP 3CPCA 4JG6A 3TV6A 3PE1A 2VN9A 3HMMA 2W5AA 2C1AA 3BV3A 3C4CA 4JLCA 4XLVA 5TKDA 4WRSA 3FV8A 4F9BA 4YTFA 5BVFA 4UZDA 4AFEA 4EC8A 4O0VA 2XBJA 4WUNA 4C3FA 3WE8A 1XWSA 3ZUVA 3I0OA 4BBMA 5AM6A 1DI8A 1TQMA 1REKA 1OL1A 3RHXA 3DXPA 3QQJA 4AQCA 2HXLA 4KB8A 3TZ9A 5CNOA 2FO0A 5M09A 1GNGA 1JNKA 4ONAA 2BAKA 3JUHA 2J9MA 5ANKA 3GP0A 1H07A 2P0CA 1Q5KA 4WNOA 3NUUA 4FTUA 3RM7A 3GT8A 1WCCA 4Z9LA 3SW7A 4QPSA 4XG4A 5EW9A 5AUZA 2BR1A 3FC1X 4YLJA 2BHHA 2W99B 4YTCA 3I6UA 3K3IA 1M2QA 3A7IA 5KCVA 2FSMX 2R64A 3G5DA 4HVIA 4EHGA 1ZZLA 3EJ1A 2ETMA 3BLRA 4GFGA 4BHNA 2R3JA 1J3HA 4QQCA 3LCDA 4G3DA 3OBJA 3TKUA 3MGYA 3RCJA 4FOBA 3POOA 4DBXA 4IADA 5FG8A 1XH5A 3BPRA 2EVAA 2QO7A 2C68A 5E8SA 3R00A 3O0GA 1V1KA 3FL5A 4CT1A 2W17A 5CY3A 4BDDA 5AA9A 4X3JA 4ANLA 2ONLC 4FMQA 4HGSA 3RK7A 4V0GA 3QFVA 2ITNA 3R83A 2WMTA 4AT3A 3GB2A 4D2WA 5A4CA 3F2RA 1URCA 2IWIA 4RVTA 5AADA 3TKHA 2VAGA 2F4JA 5DI1A 3F3ZA 5AV4A 3E62A 1OITA 3IW5A 3TNIA 3NUNA 4S32A 5IA4A 5I9XA 3UOJA 3R8UA 3TL8A 3QZGA 4TWOA 4F64A 2P55A 2I0YA 4RFZA 5B0XA 3MYGA 4ZLOA 3U9CA 4BZNA 4QQ5A 4E5AX 4TKSA 5BUJA 3OOGA 4GVJA 4A06A 4HVGA 5AUTA 4RX9A 5BVDA 3DDPA 4X2KA 2GNIA 3I5ZA 3RPVA 5KBQA 4OTFA 3FMKA 1KV1A 2YLFA 4FZ6A 2WMVA 2PVHA 4H3BA 4IMYA 4O0XA 4BRXA 4CMOA 4QMQA 1Q3WA 4RFMA 5M44A 2P4IA 3TV7A 2QKWB 3VO3A 4YGAA 4ZP5A 5IA0A 4BDGA 2JKMA 4LOQA 4DEAA 2YAKA 4NKSA 1KE8A 2X9EA 1YXXA 2W06A 3PE2A 5HE1A 2JITA 3LJ0A 3SOCA 1GAGA 2WKMA 3UIXA 1ZY5A 2ETKA 4TZRA 4PDPA 1OKWA 3O2MA 2NNWB 3QKKA 4RFYA 3MA6A 4D1XA 5LCKA 4R5YA 4PPAA 3VS3A 4GIIA 2WIPA 4I6QA 3P08A 3UGCA 5HICA 5JSMA 3VS2A 4FEUA 3ITZA 3Q60A 3OG7A 2JIUA 2UW8A 4XH6A 3ZRKA 5BQ0A 4DFBA 2YCSA 5A4EA 3BQCA 5H8BA 4BYIA 3ORLA 3R22A 4ALWA 4AX8A 5C4LA 1KOBA 3OC1A 3P7AA 1WFCA 3LCTA 3F5UA 3D7TA 4C62A 4CEGA 4E6DA 4IAKA 4RJ5A 5F1ZA 4ZTLA 5HGIA 3AQVA 3NR9A 3V5LA 3WI6A 4YNOA 1ND4A 4OTWA 3KRRA 3KXXA 3VBVA 2X0GA 4FL3A 4XLIA 3CY3A 3R9NA 3SXSA 3W18A 4FIHA 4MVFA 2I1MA 2C6IA 3LW0A 1XH7A 1JKKA 4JDHA 5J87A 2EUFB 1OKYA 4MQ1A 3OXIA 2JIIA 1OKZA 2QQ7A 5E8VA 3SXFA 3GBZA 3V01A 2ZAZA 4ORKA 2W1EA 2R3PA 2V62A 3KKVA 1P4FA 5IF1A 4ITIA 1JWHA 1YHWA 2BZHB 2X2LA
chains in the Genus database with same CATH superfamily
5F94A 3PSBA 4ZY6A 4FICA 2UZTA 4TPTA 4ZJJA 4A7CA 4BCOA 3SW4A 1UU9A 4TXCA 4YJNA 4DGGA 3TNWA 2DUVA 4DEEA 5FQDC 1ZXEA 1OGUA 2GHGA 4EYMA 5TE0A 5L2QA 4FUXA 3QD2B 4KD1A 4S34A 2BRMA 4V05A 3V5PA 4DEIA 4JJRA 4D58A 1VYWA 2UVXA 3MFSA 4DITA 4RSSA 3AC8A 4KABA 3LAUA 2QLUA 4BDHA 4EHZA 3EKNA 2J0JA 5HG5A 3UTOA 2P33A 3VUIA 4G3GA 3EQPA 4AXAA 4A9SA 3TV4A 3HAVA 5HIBA 3U4UA 2W9FB 3UZPA 4O0YA 3M11A 5FDPA 2R5TA 3Q53A 3I7BA 4EZ5A 4XNEA 4X7QA 5BMSA 4EOKA 3OROA 1WVYA 4HCTA 5E8ZA 3GC8A 3RK9A 4ANQA 4AZEA 3A4PA 3T8OA 4YC6A 4NUSA 4B7TA 4ITJA 3CD3A 3PZEA 4II5A 2OXYA 1L8TA 2R2PA 5KMKA 1OPLA 4LV5A 1UU7A 1NVQA 1FVRA 4XV9A 5AR8A 1QPJA 4EORA 3EQCA 5B7VA 3IONA 5C03A 2F49A 5CAVA 4AG8A 1JKSA 2BRNA 5EQPA 1PRYA 4FT9A 1VYZA 4UALA 3VJOA 5ANOA 4BJJB 5CTPA 5CXHA 3LJ2A 4TWPA 2V7OA 5EFQA 2RG5A 4L3JA 4NW5A 4P7EA 3Q5ZA 4KKEA 4M14A 3DDQA 4DGOA 2C6EA 1JSUA 2Z2WA 3FXXA 4F1TA 2Y4PA 4QNAA 2VWWA 4YMJA 5J7BA 3UNJA 5IUIA 4ZY4A 4I5HA 4O4FA 3LOKA 4F6UA 1I44A 2J0MB 3CS9A 5AFVA 3B8QA 2YM8A 5LMKC 3C1XA 2CCIA 3F5XA 4CMTA 2REIA 3OF0A 3CCNA 3C0IA 3REPA 2PVKA 4CV8A 3WOWA 1K2PA 1PYEA 2VNYA 3OXTA 1Y8YA 2C6LA 1PJKA 2CGVA 3ORZA 4EOMA 5M55A 4N6ZA 2W05A 4XCUA 5I4NA 3IECA 4CMUA 2PVJA 5CSWA 5EM6A 5M4CA 4MK0A 4QMMA 4A4XA 4BCKA 1B39A 3D5UA 2J6MA 4YPDA 3DGKA 4PNIA 3R7YA 3RCDA 4YURA 3GUBA 4ZTSA 5FXSA 5EQYA 4BDKA 2OF2A 5HTBA 3FKNA 1OL6A 4EYJA 3EFKA 4EC9A 4XS2A 4Y95A 3MW1A 4GJ2A 4NJ3A 4V0GB 1M7NA 2OJJA 2PVNA 3FI2A 3PYYA 3ZLXA 2W1FA 2KTYA 3FL4A 5AV1A 3OUKA 4I5MA 5JN2A 3T3VA 3BELA 4LUDA 4IX6A 2VTPA 4U3YA 2VTRA 2RFDA 4JX3A 2P2HA 3O8PA 4ALVA 3VONA 3R1YA 1WBOA 2XVDA 5TO8A 4UBAA 2WTWA 1J91A 3EFJA 3FMMA 4OTGA 4AA0A 3ZRMA 1RW8A 1OECA 5IQDA 5HX6A 3KN5A 1KE9A 4IDVA 2X4ZA 4IJPA 4WG4A 5IQCA 1Y57A 2QR7A 3DS6A 4ZLZA 4J52A 3HV6A 5K4IA 3Q4UA 5AR2A 4RC4A 1CKPA 4FTLA 2FH9A 2X7GA 3TTIA 2QCSA 3PFQA 4CFVA 2G15A 4YJVA 5L6WL 2J0KA 4GT5A 4IX3A 4RIYA 4FV3A 3LM0A 3K5UA 1FVTA 3UQGA 4PNKA 5C8NA 3E8DA 1NXKA 4I0RA 3WIGA 5K0XA 2WQOA 5CT0A 3DJ7A 3QD3A 4N57A 4RIOA 5FEQA 3KQ7A 3OEFX 3IG7A 5HNIX 4FZ7A 3UO6A 2XNNA 3F66A 4RJ8A 4F1OA 4GMYA 3RZFA 3GOKA 1ZLTA 2WEVA 4QMYA 3F5GA 4XJ0A 5ETAA 1BKXA 1BLXA 2YDIA 1PYXA 1KE5A 2PL0A 1Q24A 4JQ8A 3C13A 4EK3A 1Y6BA 4G6LA 3R63A 4M0ZA 4PTGA 4WHZA 5A3XA 3V51A 3VS1A 5ETIA 5LVOA 4RVLA 4RWIA 4YO4A 2F2CB 4MHAA 2X8IA 4A4OA 4OAUC 3ENMA 2XIRA 1TZDA 3EFLA 5IPJA 3CQUA 3NNVA 5KE0A 4R7IA 3ZO1A 4E6AA 2WMXA 3Q4ZA 1TFFA 3Q96A 4LGDA 4MTAA 1FVVA 4FTNA 2YIWA 3F2AA 3UJGA 4B4LA 2PSQA 4DINA 3R71A 5CSPA 3K3JA 5I3OA 5AV0A 4ZTHA 5IA2A 1FBNA 4K9YA 3HRBA 4UEUA 4XBRA 3IK3A 1W83A 5D1JA 2C47A 2YCFA 2XNBA 4QT1A 4U40A 3VN9A 4ENYA 3TJDA 3DCVA 4CFXA 3SVVA 3Q9XA 3FMHA 2R4BA 4IEBA 4DLIA 4NKAA 3R9OA 5CZIA 2I40A 2QURA 1PHKA 3R01A 4WRGA 1YI3A 3D0EA 1JPAA 2PHKA 2YJSA 4QMZA 3H0ZA 5IU2A 1JKTA 2OWBA 2ESMA 1PXMA 3EQHA 4FF8A 3OEZA 4U97A 3EIDA 4ZJIA 5GJDA 1LP4A 2QOIA 3QQLA 4FKGA 3QZFA 1V0OA 3PXYA 3MJ1A 4FYNA 5DGZA 5E7RA 3VRYA 4RGJA 5B2MA 3FZ1A 3MPTA 3KF7A 5M08A 3NDMA 2PZPA 1ERKA 4K33A 2RIOA 2OH4A 4MWIA 3MH1A 4AGCA 4L8MA 3IGGA 1O9UA 3GC0A 2CJMA 1TQPA 3DZQA 3IQ7A 4CVAA 3TKIA 2W1DA 4W4YA 3V8WA 5B2KA 4FKJA 2WXVA 3EN6A 4XG3A 4CFWA 3ZUUA 1WBNA 3D2KA 1R3CA 2BAJA 2C3IB 3AC1A 1Q61A 3G2FA 3HUCA 4K18A 3SKCA 4DFXE 5KMNA 3ALOA 3Q2MA 3DZOA 3MH2A 1PXLA 3MIAA 3QZIA 2E9NA 2O2UA 4PP9A 4OTPA 4Q9SA 3TUCA 3R8VA 1IEPA 4AW1A 4E6CA 4YLKA 3KMMA 3NIEA 4HCVA 3UVRA 4ANMA 3ANRA 1M52A 2A27A 4F09A 2EB2A 4YZCA 3FLYA 4QO9A 4XYFA 4AA5A 4BI2A 3D9VA 2O0UA 5T6KA 2XANA 2XEZA 2ITWA 2BKZA 3MVJA 4O7LA 4AN3A 3EYHA 2QHNA 4ID7A 3Q6WA 3P7BA 4I1ZA 4XG8A 3P78A 3W10A 2OIQA 3ZEPA 3ZO4A 2BUJA 5A6OA 1ZYDA 4F7NA 4C4FA 3OHTA 4QTAA 3AC5A 4I0SA 4CYIA 1OZ1A 5GZ8A 4FTQA 3T3UA 5BVKA 4FNZA 1QCFA 3GCVA 3SDJA 4RQKA 3DAKA 3BIZA 3FMJA 3V8SA 2VWZA 4QTEA 4GT4A 1IG1A 2YEXA 4AE6A 5GJFA 2UZBA 3ZZWA 3ZM9A 3OTVA 4O4DA 3S95A 2YZAA 4FBXA 4O0TA 4C2WA 4QDEA 3NUPA 2YDKA 2XKFA 4MQ2A 5HX8A 2F7XE 4C7TA 2Q0NA 4I21A 2ZV2A 2VO3A 2ITQA 2Q83A 4W9XA 4ASXA 4NWMA 3ULZA 4RJ6A 3COHA 3F88A 5AJQA 4HZRA 3NRMA 3DKCA 3NYOA 5KX8A 3BL7A 5K0KA 2R7IA 1SYKA 2IPXA 3RWQA 4HVHA 3F3TA 4JMQA 4F7LA 3D94A 3MA3A 1M2PA 4BHZA 2XS0A 3PP1A 3AD6A 3S1HA 4NH1A 4OLIA 5D41A 4Z55A 1ST4A 4KKGA 5EOBA 3ZXTA 4E5BA 4GYGA 3A7FA 4WBOA 1XBAA 5JEBA 2VWXA 3SRVA 4CKRA 5DMZA 3AKJA 2J7TA 4AT4A 5FDXA 4FG8A 1P2AA 3FQHA 4QYEA 3MSSA 1BMKA 4TWNA 2W1HA 4LYNA 4M7IA 5GNKA 4BCHA 3DFAA 5HO7A 4FT0A 5DWRA 3W2CA 4FKRA 3NAXA 2I6LA 2Y4IB 3IKAA 3TJCA 4E20A 2OO8X 3KA0A 4EK4A 4MNEA 3W1FA 5LCJA 3ORPA 3ZLSA 4EZ3A 4BCQA 4NTSA 2BIYA 2XNPA 3R7IA 2YWPA 3GU8A 2GNFA 5L2SA 3Q6UA 2X8EA 5E91A 1ZAOA 3C5UA 4DEBA 2GS2A 2XAOA 5ANDA 5CT7A 4RA5A 1Z5MA 1YWRA 5CASA 2C30A 3KL8A 4RIYB 2YWVA 3BX5A 4XOZA 3VC4A 1GIHA 2UVYA 3JS2A 4RJ3A 2QOKA 4QRCA 5CLPA 5IUHA 5AR4A 4C59A 3ORXA 2IG7A 3C4FA 3QTXA 1VR2A 2BZJA 3FE3A 2J0LA 2IZUA 2OW3A 4XHKB 3PY0A 5AP6A 3W0NA 4FTOA 4ZJVA 2QOCA 3FSKA 4IANA 4B0GA 4CRSA 4NU1A 2HELA 4E5WA 2CNVA 3A7JA 3ATSA 4YNEA 3R28A 4WG5A 3NUSA 2GMXA 2B4SB 3CKWA 4IJ9A 3NAYA 4ZTRA 5IDNA 3BZ3A 1YOMA 2VZ6A 3TEIA 3GNIB 4OR5A 1OPJA 3R0TA 3RK5A 4ACMA 4PMPA 3LIJA 2VX3A 3ZFXA 3U51A 3RINA 3P5KA 5LWNA 4L46A 2HWOA 3OS3A 5DR6A 5JGAA 4QP4A 3KCFA 4HYSA 3KN6A 2XIKA 4G5PA 5C01A 1FPUA 2PULA 4O84A 3AGLA 3HMIA 5IH6A 4IAFA 4RZVA 3LFNA 4PF4A 4QMWA 4TW9A 1HCLA 4ASDA 4U42A 3LXLA 4I3ZA 4YHTA 4APPA 2PVYA 2CCHA 3W16A 3HA6A 4CZTA 5L3AA 4AXEA 4Y72A 2OFUA 1V0BA 3NSZA 5HTIA 2ZV7A 3R8ZA 3QXOA 4R78A 4G34A 3QCYA 3R7EA 3NX8A 4BL1A 3PFYA 5JZNA 2C3JA 3OD6X 3RNIA 3DAJA 1W7HA 3QLFA 3QWKA 1WAKA 4YTHA 3ZFYA 5M4UA 3OY3A 4FJVA 5IEXA 2QO2A 5FD2A 1G8JA 5J95A 3RPRA 4BWKA 4LGGA 3CBLA 4IAIA 2PYWA 4FX3A 1VZOA 1YRPA 2HZNA 3DKFA 4RX7A 4EOPA 2WTVA 4O96A 4USEA 4C61A 3OT3A 2PPQA 3NEWA 4K77A 4JS8A 3LHJA 4IX5A 1PXIA 1XH6A 3B2TA 4XV1A 5EOLA 4UMTA 2WB8A 4R7HA 5BMMA 1IA8A 5E8TA 3BYUA 1W82A 2NRUA 4F4PA 5KKRB 2VTIA 4FTJA 2OZOA 4C34A 3S3IA 1JSTA 2X7FA 5AIRA 4NK9A 1LEZA 2CLXA 5C9CA 4FI1A 3BCEA 2GNJA 3HDNA 4QPMA 3BYOA 3HGKA 3FBVA 3ROCA 5CEKA 2ZV8A 3HP2A 1WVWA 3MBLA 4QDVA 2PY3A 2XNMA 2X0QA 4DH5A 4AT5A 2J90A 3PPZA 4LV7A 3W33A 4OTDA 4USFA 3Q3BA 4JIKA 3NCZA 2HW7A 3VBWA 5H3QA 2C3KA 5H9BA 1Q97A 3ZONA 4FSUA 3OCTA 3PXKA 4L6QA 4TNBA 3HRCA 5AP5A 3WZJA 4LRJA 3FQSA 4AGDA 4AW0A 3ZLYA 2ITOA 3KMUA 2BTSA 3K5VA 4U41A 4ASEA 5HG7A 4C57A 3UIUA 3PTGA 4A9UA 4BKJA 4C02A 3NVKI 3ORKA 3FZTA 5ANJA 5FP6A 4IWDA 4BN1A 5BX0A 4JRNA 3VS7A 4M13A 3HLLA 4RWKA 2JKKA 3WF6A 4TYIA 4Z16A 1CTPE 1OUYA 2IZRA 1J7UA 1GOLA 4O7NA 4TRLA 3NYVA 4KS7A 4RRVA 5AR7A 4EH9A 3FMDA 3JVSA 4ZZNA 2VWUA 3D14A 3R9HA 5I5ZA 2JGZA 5AP0A 3VBXA 3CTHA 5DOSA 5L4QA 5DPVA 4ZEGA 5HIDA 3A61A 2R3HA 2XB7A 4WO5A 3RPYA 3TWJA 1IA9A 2G1TA 5J5SA 5L2IA 2R3LA 2R3IA 4AZFA 2AQXA 3MI9A 3THBA 2RG6A 3QC9A 4BI1A 3AMYA 5M4FA 4L9IA 4GG7A 5EKOA 3PA3A 5HI2A 2RFEA 4DYMA 1MUOA 5CU0A 1IASA 4UZHA 5HESA 2JIVA 5D12A 3D7ZA 1RE8A 3PUPA 2QU6A 4FKVA 4X3FC 5JRSA 3GOPA 5T3QA 4LOPA 4ARKA 2CKPA 4HGLA 2V22A 5FGKA 5CF4A 1PMNA 3SA0A 3GCSA 3ANQA 4V01A 2XKDA 1W98A 3HZTA 1WBVA 3E92A 5CI6A 1H1PA 2IW9A 3VS6A 2FA2A 5JFXA 3MESA 2WMAA 5H2UA 4G3FA 2O5KA 5J8IA 1RQQA 4FGBA 4U44A 4MNEB 2PU8A 3AGMA 5CANA 5DEWA 4W4XA 4UMQA 4ANOA 4D55A 4QMPA 1PXJA 4RLLA 3HX4A 3PWDA 2YITA 4J96A 5IQHA 4FTCA 2R3GA 5FEEA 4O7SA 3WF7A 2XK3A 3BHVA 3H10A 3RP9A 2B7AA 4D4YA 1JLUE 3HP5A 4PDOA 4JBPA 4AA4A 5CVFA 5IQFA 2OK1A 1MP8A 2PE2A 3KC3A 4MD8E 4UWBA 3FI3A 4U80A 2BCJA 5JFWA 2PZRA 2UZOA 4MX9A 5DRDA 2WQMA 2E9OA 4ZSJA 4ACHA 3G90X 5IEYA 5HBEA 4I41A 2RFSA 2ZMDA 4J1RA 4RWLA 5HKMA 4D0WA 3W0QA 4AACA 3DU8A 3IW8A 3L8VA 4FKTA 4DTBA 3R02A 3IPHA 3ML1A 4KIQA 2XUUA 4JT3A 3G0FA 2R0UA 4PRJA 1JQHA 2DYLA 4JBVA 1FQ1B 4Y73A 4RZWA 3GQLA 4DLJA 2C6MA 4YU2A 2PMIA 4O0UA 1EH4A 5JKGA 4EZ7A 4FZAB 3P9JA 4DN5A 1YVJA 5IQIA 4DE4A 2CN8A 3ALNA 5E92A 1Y8GA 3V3VA 4DHZA 2VO7A 2VTTA 5HVKA 2XKEA 1XHAA 5HD4A 2UW3A 2WGJA 4X2GA 5E8XA 4K2RA 3G9LX 3KK8A 4FSTA 1X8BA 2UZLA 4FSWA 3W8LA 3U87A 4IWQA 4B8LA 5CVHA 3HECA 5CQUA 4AF3A 2YZLA 3PA5A 3RNYA 5AUYA 3EFWA 3VBQA 1LUFA 3LFAA 1ZZ2A 1LR4A 3LVPA 4O7YA 5E8YA 4CCBA 1STCE 1WMKA 4RIXA 2OLCA 5E1EA 2GTMA 4D4VA 1U54A 3LKMA 5K9IA 4EH3A 3FHIA 3FPQA 3RALA 2QVSE 4I4EA 4OT6A 3GC9A 2QONA 2PVFA 4XG9A 5D7AA 1UU3A 3MTFA 4I5CA 2C6DA 2WIHA 3ELJA 4ACCA 4M66A 2OJ9A 5KMLA 4EH7A 2WTJA 3C0GA 3SHEA 4YJPA 5EYDA 4H58A 5LVPA 3C4ZA 4MF0A 5IKWA 3ORTA 3VJNA 2WNTA 5EG3A 2GS6A 2PWLA 1CKIA 1OIUA 2WTKC 2XK9A 4V04A 4X21A 4C4EA 4D2RA 2XA4A 3UMXA 3G33A 3ROYA 3FZRA 5IQEA 2IEWA 3CC6A 3PXFA 3TZMA 4Y83A 1H1QA 2ONLA 4X2FA 2PK9A 4B8MA 5FWKK 4RVMA 2O8YA 3E93A 2G2HA 3CE3A 4D2SA 3BLQA 4DDGA 3H9OA 4WNPA 5CAPA 4APCA 2W4KA 4QPAA 3OFMA 3EKKA 2XYUA 4QYGA 3KEXA 1JOWB 5CEQA 3BU6A 3GXLA 4YTIA 3S2PA 4KS8A 2ZB1A 4FV1A 3UIBA 3ZTXA 1A48A 3NYXA 2ZM1A 3LCSA 3I0QA 3B8RA 3V04A 1PF8A 5J79A 4I92A 4J53A 4XG7A 4DG0E 4BY9E 2GFSA 4BKYA 3VAPA 3C4XA 3HVCA 5A54A 4KWPA 4FK3A 5BUEA 4EOIA 1ZWSA 5GZ9A 3O5AA 3PVUA 3MS9A 3Q5IA 1XR1A 2W4OA 2YABA 4S30A 1MRYA 4O38A 4D0XA 1OGYA 3PDTA 4MKCA 4BGHA 2WHBA 1R78A 5TOZA 4C4GA 1FMKA 1UWHA 2B0QA 5AX3A 3EN4A 4OW8A 5HNBA 4BDEA 3WZDA 4BCMA 4CG9A 1MRVA 5JT2A 4NIFA 4U8ZA 4TTHB 3UQFA 5FP5A 1BL7A 1OIRA 1Q4LA 2GQGA 3NYNA 2I7QA 3UQCA 2C0IA 2GFCA 2WTCA 2W1ZA 3QZHA 4W8EA 2XH5A 4EHVA 4L42A 1UNHA 4HVDA 5A4LA 4A07A 2HXQA 4J7BA 4AN9A 5L2WA 4PY1A 1NVSA 2W9ZB 4BIBA 4RIWB 3DBFA 4NW6A 2IVSA 3OW3A 2YA9A 2Y0AA 3LXNA 3O50A 3O7LB 4DAWA 3P0MA 5IG1A 4DFUA 1WZYA 3V5WA 4HGTA 1UU8A 3UODA 2WMWA 5EDQA 5FXQA 3VUHA 1E1VA 3ENHA 2CKEA 5AUUA 4GFMA 2H9VA 2PUUA 5IQGA 1ZY4A 4A9YA 1UWJA 4LL0A 2OU7A 2UW5A 3UOHA 4IVBA 5EK7A 2ITUA 4FKLA 4EH2A 3OXZA 4XUFA 5ANEA 3T9TA 2Z02A 2PZIA 3C51A 5E9EA 4IACA 4JBQA 4HVSA 4O4BB 2AEGA 4IVDA 1H25A 1OIYA 3DJ5A 4EBWA 3PIYA 1M2RA 3LQ5A 4CYJA 3KU2A 3OT8A 5I9WA 5G6VA 3MIYA 2R3NA 1GIJA 4K11A 2G2FA 4O21A 4E4NA 1PMUA 3BKBA 5JMSA 4FV6A 5L8JA 3R8LA 5HNGA 1UA2A 3WBLA 3MPAA 4G3CA 1H00A 3HV3A 2BTRA 5HE2A 5EYKA 3UPZA 1Y91A 3A62A 5FEDA 2G9XA 4UXQA 3ZS5A 1R0EA 3DKGA 5F95A 2FYSA 2LAVA 3EYGA 4FUYA 2WU7A 3TNHA 4D5HA 3UOKA 4HPUE 5IA5A 3ZH8A 4X6QC 4JR7A 5KMOA 3DTCA 3NS9A 4NL0A 5CAOA 1OL2A 5I9ZA 4FV9A 1Z57A 4EH8A 2F57A 4I5PA 3GFEA 4O91A 4D2TA 4FR4A 4KINA 3CKXA 5EQEA 3GC7A 3FZPA 1KE7A 4DHFA 3TZ8A 1F3MC 4QMOA 2FGIA 3BYSA 4NFMA 2I0EA 4NM5A 4D5KA 2O63A 3HUBA 2C0OA 2CLQA 3EZRA 4QMVA 1OL5A 4YC3A 5AWMA 3TIYA 2VTQA 3DY7A 3JY0A 1WVXA 3RGFA 2VTAA 3QTQA 5IH4A 2X6DA 5FTGA 3R04A 5JZJA 1ZYCA 3U6JA 1JBPE 5CF8A 3MFUA 1H26A 2OJFE 1XJDA 4NCTC 3JY9A 4RC3A 5DT4A 3BHHA 2GNLA 2XM8A 1H0VA 2AYPA 2YM5A 3R2BA 3W2SA 4NSTA 3FYKX 4CV9A 1XBCA 4TYEA 2A0CX 5AV2A 4DH3A 4LG4A 3UG2A 4RIXB 4CG8A 1H0WA 2BFXA 3A8WA 3OP5A 5CU4A 2E9PA 3NW5A 1U54B 4W4WA 3BQRA 1HOWA 1Q8UA 3A4OX 2QKRA 4E7WA 2XNEA 3PSDA 4U5JA 5HU9A 3O7LD 4BCIA 5LMKA 2JDRA 3U9NA 3FLWA 1GIIA 3DK6A 1WBTA 3CD8A 4ZIMA 4BBEA 1L3RE 3UOLA 3VW8A 4C0TA 3DOGA 5AAFA 3WIKA 2KULA 4O27B 4K6ZA 3LPBA 4JG7A 1GZKA 3ZZEA 5EKNA 3RJCA 3DLSA 3N9XA 4EQCA 3MWUA 3PG1A 3IS5A 4G2FA 3SV0A 4FTMA 3RM6A 3ZDUA 3W0RA 2CN5A 2ITTA 5B2LA 4PP7A 3Q52A 3DBDA 2ERZE 2YM4A 5A46A 2XRWA 4MXAA 2Y9QA 5DVRA 3ZEWA 3CJGA 4X6RA 4ZMFA 2GS7A 2XMYA 4O81A 2ZDTA 2FSTX 3R2YA 2VTJA 2W5BA 3KRWA 4FNWA 4QEBA 2VWIA 3MY5A 4GK2A 3RAKA 1J1BA 3LFEA 3PY3A 4P4CA 1YOLA 3EWHA 1M7QA 3FI4A 4I22A 4BDCA 3AT3A 5EM8A 5L6OA 4L7FA 5DRBA 5K5XA 3AMBA 5IQBA 1GZOA 2ETRA 4G9CA 2B9HA 4QYHA 2C0TA 3BE2A 4WSQA 4J71A 3KULB 2Z7RA 2EXCX 4CFNA 3LMIA 4D4RA 1JSVA 3U54A 3KRJA 3KXNA 3H30A 3LQ3A 4ERKA 1W0XC 2UW0A 2ZM3A 5BVNA 3DJ6A 4DTAA 2VGOA 5DR2A 5HIEA 4JVGA 2CPKE 3CTJA 5DG5A 2WAJA 3I1AA 5DHJA 3TYKA 5M4IA 4BWPA 4EQUA 1F5QA 2BKKA 3FMEA 5M53A 3QQKA 3BI6A 4IAYA 4H39A 4NIFB 4BDJA 1J1CA 4DGMA 4YR8A 1YKRA 1UVRA 3P86A 3FY2A 3VNTA 3W2QA 4Y5QA 2JD5A 4ZAUA 1G3NA 3BGZA 2IO6A 4FL2A 5EDPA 1YDRE 3ZRLA 2XARA 3PRFA 4FEQA 2J2IB 3UG1A 4N6YA 4IB1A 4UV0A 1UV5A 4E4XA 3HRFA 4MBIA 3R7OA 5BYLA 4QQJA 3V5TA 4QYFA 3TMOA 2YHVA 3VF8A 4N0SA 2XRUA 2P3GX 2XJ2A 3AC2A 3MTLA 3OOMA 4KNBA 4RVKA 4WA9A 4L7SA 3FDNA 3F9NA 3HKOA 2PZYA 4D1SA 3QTZA 2ZM4A 3KVWA 4GG5A 4A4LA 2WOTA 3E8CA 4GUBA 1BI8A 5K4JA 5L8KA 5AMNA 3UZTA 5DBXA 1HCKA 4F7JA 3K54A 3ID6C 3TCPA 4IFGA 5HQ0A 4AAYA 4QP9A 2FB8A 3DFCB 3NW6A 2XIYA 4GVAA 3QYZA 5DT0A 1O6YA 3ODYX 4IWPA 1SVGA 1ZYLA 2W4JA 5D11A 3D5WA 5AP4A 4U3ZA 4M97A 4AZSA 3ZMMA 3NUAA 4EBVA 4FZDB 2A2AA 3KFAA 3R8MA 3UVQA 4MEDA 2BDJA 3POZA 2CGWA 3LFFA 4RPVA 2HZ0A 2R3MA 2YM7A 2B9IA 4CLIA 3NVMB 1OUKA 3F5PA 1P5EA 1K9AA 2WMRA 3P23A 3UO4A 2BZIB 3HV5A 4RJ4A 5E8WA 4M67A 5J5TA 4JNWA 2GU8A 5AP2A 2VU3A 4QP7A 4EJNA 5KO1A 1P14A 4DH8A 3G6GA 4GK3A 4BIEA 5FXRA 3Q04A 4WNMA 3G51A 4XOYA 3ZO2A 5CAQA 3FLQA 4L45A 3CTQA 2C69A 2UW4A 2RGPA 3QTWA 3CP9A 5D9HA 2W1GA 5AV3A 3CR0A 1FGIA 1B38A 1ZARA 2UZDA 4Z7GA 2UVZA 4JQ7A 4JG8A 3QD4A 1DM2A 4G16A 3SD0A 2FSLX 2ZYBA 4AU8A 4FIIA 3R1QA 3F3WA 1KSWA 5DH3A 1ZOEA 3QBNA 1O6LA 2XF0A 4JAIA 2VTLA 2WOUA 4IW0A 4RA4A 3FKOA 3VUMA 5LXMA 5M57A 1CMKE 4H36A 3SLSA 3UPXA 4FT5A 3QD0A 4FSRA 2XBAA 4O7RA 3KB7A 4UMUA 2X39A 2YIRA 3QL8A 4E26A 3PWYA 3L9LA 2HYYA 5M07A 4XG6A 5KMIA 4RLKA 5LMBA 2HY0A 4BVUA 5HLWA 4O4CA 5LJJA 5E4HA 2XK4A 2HW6A 4H1MA 2Y8OA 1BL6A 5AM7A 2XNOA 4JR3A 3DK7A 1OBGA 3FEGA 3QC4A 2JLDA 2WMQA 4EKKA 5EW3A 4IH8A 5HTCA 2J5EA 4IB5A 4QTDA 3WYYA 1APME 1ATPE 1YOJA 4FG7A 3EL7A 3QCQA 4I93A 1H4LA 3N51A 4O1PA 2EU9A 5ANIA 4IBMA 3A60A 3C0HA 3AMAA 4GU6A 3KK9A 4KSPA 2YACA 4DG3E 5CEMA 1ZOHA 4FSQA 3MVMA 5JQ5A 3L8XA 3ZBXA 2QI8A 3D5VA 1FINA 3TN8A 4L43A 5BYZA 2QOFA 4IB0A 3R9DA 2IZTA 2QNJA 3TI1A 3S00A 5ACBC 2XEYA 4IVCA 1YHSA 4ZS0A 4EK8A 5HLNA 5J1WA 4AXDA 2ZJWA 2I0VA 2FUMA 2BRHA 5EH0A 5BVOA 2JFLA 4JOAA 2ITZA 5HO8A 2PUPA 3QUDA 5HBJA 5A4TA 2CHLA 1S9JA 3UNKA 1NT2A 3DNEA 4FSMA 3CGFA 4MD7E 3NUYA 1VJYA 4D9UA 3GU6A 4E8AA 3BWJA 4L53A 2RFNA 3K2LA 5TR6A 2JDTA 5KMMA 1CDKA 4F6WA 3Q9WA 3A99A 3FKLA 5EI6A 1KV2A 4CRLA 4EI4A 5HG9A 5ANGA 3ZSIA 3KMWA 4EOQA 3VRZA 2XP2A 2QG5A 4AW2A 3KF4A 2E9VA 4HPTE 4PMMA