3RINA

P38 kinase crystal structure in complex with small molecule inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Indolin-2-one p38(alpha) inhibitors I: design, profiling and crystallographic binding mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rinA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rinA01
3PP1A 4UMTA 1AD5A 4K18A 3RAWA 1VYWA 5DNRA 4BDCA 3R71A 3E93A 3RPYA 4C4IA 4QP1A 2CKQA 3BYOA 2PHKA 3PIYA 1BX6A 4J7BA 4UEUA 4OAVB 5CU3A 1FGKA 4FVRA 4D55A 3RM6A 1KE8A 3UO4A 1ZYCA 4DG0E 4H58A 3NYOA 2HELA 5HIEA 3ID6C 2PYWA 3LAUA 4W9WA 3V5PA 3K3IA 2YAAA 4UWYA 5LXMA 2LAVA 3LMGA 1H00A 2FGIA 2OJFE 1VZOA 3BYUA 3KREA 4MF1A 2WB8A 4N6YA 4ZY6A 2F7EE 3MVMA 2UZBA 5HD7A 3CTHA 4BCJA 2JKOA 4E73A 1X8BA 3QZIA 4JG8A 3TZMA 2QOQA 2ZM3A 3JXWA 4FI1A 4MBJA 4P7EA 4XV2A 3FUPA 3CD3A 1E1VA 3NUNA 2F7XE 5AP7A 2QVSE 4TYHA 5EW9A 3W33A 4BIDA 2PUPA 5FWKK 3UIUA 2X2MA 3QUEA 2W99B 3OEZA 3MA3A 3ZSIA 4ZZOA 3TM0A 3GXLA 2R3HA 2HWPA 2R3GA 3E8DA 3QD4A 4FMQA 4USDA 3ORXA 4YZ9A 1AQ1A 4L3PA 2O65A 2Y0AA 3L8VA 5AX3A 3OZ6A 3VBVA 4XRJA 2CGUA 3C4XA 4MAOA 4ZSEA 5HGIA 4GIHA 3RPOA 1XO2B 4G6NA 2ZOQA 3WZKA 4F0IA 2VWYA 4DF3A 2Q83A 2V22A 3LXNA 4JBVA 4PTCA 3U8WA 4I93A 4G6LA 4E26A 4XOZA 4W4YA 2A27A 3UVPA 2UZTA 2V7OA 2W5AA 5GJFA 4O0SA 3V01A 3CKXA 4EZ3A 1YXXA 3AD6A 4D9UA 4GT5A 4MNEB 5CYIA 2VWVA 5BPYA 5KMMA 3IQ7A 2P33A 3QX2A 4NFMA 4L8MA 4BDFA 2W1GA 4DE4A 3KXMA 3IW5A 2PUIA 4Y95A 1H01A 4S34A 2CN5A 2C3LA 4AE9A 2C6TA 1W82A 3GCSA 3VUMA 3NR9A 3KRRA 3QQFA 4FT5A 4NM7A 4O7LA 5HX6A 3LCDA 3LJ0A 4H1MA 4XNEA 4KBCA 4F1TA 4BBEA 1KV1A 4RIOA 3SXFA 2XBJA 4MXOA 4FC0A 3CY2A 4JS8A 4W4XA 4XX9A 3F66A 2J2IB 2WIHA 3AC5A 5FM3A 2XKFA 4FGBA 4CFVA 4TPTA 4RX8A 4FIFA 4UB7A 3NRMA 4GK3A 1B38A 1U5RA 4FSYA 4GCJA 4IADA 3R30A 1REKA 5AP5A 5AR3A 5K4IA 5FTGA 2QU6A 3EYHA 4F9AA 1Q5KA 1H28A 3LCTA 4WT6A 3MFSA 3B8RA 4U9AA 5D1JA 3VNTA 3G5DA 5HKMA 5LMBA 2W1EA 2W1DA 3UQCA 3NMUF 2OGVA 5CNNA 3RAKA 1GAGA 4L67A 2R0IA 4WA9A 4FV6A 4MXYA 2C5VA 5JGDA 4YU2A 1Y6BA 5FEDA 3PG3A 4BN1A 2O5KA 5ACKA 1JKKA 3FPMA 3WZUA 3FKLA 3UC3A 4QYEA 2G1TA 3ORPA 2XP2A 4R7HA 4F9BA 4BR3A 4W4WA 2AC3A 2OJJA 3KCKA 4M66A 3MSSA 3C7QA 4ID7A 1REJA 1F0QA 3HV7A 4TNDA 4FIJA 4E5AX 4TNBA 1Z9XA 1ZZ2A 1V1KA 4XG6A 3CPCA 4BGQA 1KOAA 2B9HA 2BFXA 2YA9A 5CASA 5CEMA 4AGUA 3R7GA 4RIWB 2R5TA 4HCTA 2X1NA 4C33A 1JAMA 3A60A 4BTFA 3G0EA 3P0MA 2VNWA 4PUZA 5DEYA 4F0GA 5HLPA 1PXLA 4UMPA 1Y8GA 4EZ5A 5L8LA 3S1HA 2V55A 4TY1A 5AR4A 3SG8A 4XYFA 3SVVA 1H1SA 4TRLA 4X2JA 4C2VA 5IQCA 1ATPE 1MRYA 2I40A 4RFYA 2VUWA 3HECA 2JDOA 3AMYA 5CT0A 4ZK5A 3S4QA 4I3ZA 2IG7A 3ORTA 2CKEA 4A4LA 4XJ0A 3Q9XA 4EEVA 5D11A 4RZWA 2BZKB 3MW1A 5BVOA 2AUHA 4NJDA 3R1YA 5EK7A 5AAFA 4LG4A 1B6CB 5G1XA 3PA4A 2PK9A 2YZAA 4BKZA 3IKAA 4R8QA 3KF4A 3BLQA 3KULA 5HHWA 3O2MA 5EH0A 2OF4A 3MVHA 1QCFA 3H9FA 3FKOA 4KINA 4FTOA 4D0XA 4RJ7A 3D14A 4IQ6A 4D0WA 4ZY5A 4G17A 1ERKA 2JIIA 4BF2A 4E4MA 4F63A 4QQTA 3NUSA 3PJ8A 3E63A 3AC1A 4PMSA 3BE9A 3NVMB 1YXTA 4FT9A 1WVYA 3QZGA 4TYHB 2CSNA 2QURA 5FTOA 4QPSA 4AA0A 2Z60A 2PE2A 3O7LB 4TT7A 3GU6A 2R3KA 2G01A 4LOQA 3IW6A 4DFLA 3F7WA 4KIQA 3V8SA 4RJ4A 4G5PA 3EQDA 1KE7A 4ACHA 3F5XA 2CLQA 2WNTA 3P86A 3DBDA 5J9YA 5IQEA 3SLSA 4GU9A 3M42A 1OPLA 5HTCA 2CLXA 4JXFA 3PXKA 3T9TA 4M13A 4CKIA 5FD2A 5B0XA 4EOQA 3A61A 4ZXTA 3OY3A 3RWPA 1Q41A 2BILB 2CCHA 3A7GA 2X8DA 4Q5EA 3HAMA 5JFWA 3UZTA 3PRIA 3ZLWA 3G6HA 2QOBA 5CF6A 4FV2A 4UALA 4OBQA 4C4JA 3QWJA 4I6BA 3R9DA 4BVUA 4CFUA 4F9CA 2CNUA 1ZYLA 3F5GA 3DBQA 4MXCA 1Q62A 5E9EA 2EU9A 2OSCA 1PKGA 2KTYA 4U79A 2X2KA 5DI1A 1OGUA 3C4WA 1YWRA 2JAVA 1XH4A 2OICA 3PPZA 4QPMA 5CY3A 4C7TA 3AC3A 3RAIA 1JSTA 2X4FA 4XV1A 5IH5A 3FLSA 2WEVA 2CMWA 2JDTA 2VO0A 4BI1A 5E1SA 3VHEA 4R1VA 4GEOA 5EOLA 4BKYA 2ACXA 2BDWA 2BR1A 2OK1A 4XLIA 1P4OA 2YITA 4O7VA 4P4CA 2HY0A 2WEIA 3W2SA 2B55A 3BPRA 3O8TA 4LQMA 2GNIA 2XM9A 3C0HA 5C1QB 3ZM9A 3OWKA 4O0VA 3C4EA 1YVJA 3JS2A 2JKQA 3U87A 5KBQA 3BU6A 1WVXA 1YOLA 3VS3A 4BCPA 4NCTC 4YJVA 5BYYA 5LVOA 4NM0A 5DA3A 1GNGA 3Q5IA 5EI2A 5HESA 1URWA 3TXOA 4EH7A 4RVMA 4XV3A 4NYEA 4WG5A 4I4EA 2VO3A 3EB0A 3SKCA 4DBXA 4XRLA 4CEGA 5JFSA 1JWHA 2O64A 2PMNX 2YM3A 5EM6A 3D94A 2YN8A 3FC1X 3IW4A 2C68A 2EXEA 3A7FA 1ZOHA 3EQBA 3NPCA 3H3CA 3PLSA 2AYPA 5AIRA 3WYYA 1NA7A 3R7IA 4KRDA 4UWBA 1WFCA 3FSKA 4FKWA 4JDHA 5KMOA 3C51A 5E8WA 5J87A 2JFLA 2YCRA 3W1FA 4EH2A 1BMKA 4D5HA 4PP7A 3QALE 3DDPA 4YZDA 5FGKA 4ZY4A 3UJGA 5EHLA 3ZUUA 2J51A 5TR6A 4IVAA 3ZRMA 2NO3A 2QR8A 4UMRA 1MQBA 1Q8ZA 3E7VA 2UW3A 3KFAA 4IWOA 4BKJA 4RX5A 5LWNA 4EK6A 4FG7A 1P5EA 4BWXA 4CSVA 5LARA 2WMAA 3D7TA 4G16A 1R1WA 3RPSA 4DLIA 3TUCA 3NYXA 2UV2A 4UV0A 2X7OA 4NU1A 3SD0A 3G33A 5DYJA 2X4ZA 1ZYJA 3KMMA 5BMMA 1YDTE 4NT4A 4Q9ZA 3PLAE 3KRXA 3COHA 4FKOA 1SVEA 2YIWA 2DWBA 1SZMA 2P2IA 3CGFA 4FICA 4FK3A 1ZRZA 4DH1A 1E9HA 2G15A 2VRXA 3W2RA 2HYYA 4CMUA 5E8ZA 3ACJA 5EYKA 2C30A 2C6EA 2J7TA 3AC8A 4XP2A 4ANNA 2UUEA 3UOKA 3V6SA 4FUXA 3BWFA 4WNKA 4IBMA 5IUHA 2QOHA 3OCSA 2PL0A 3OWJA 1UVRA 3FWQA 3FZTA 3II5A 3IONA 5D9HA 3CKWA 4J99A 3MTLA 5HOAA 5I3RA 2PVLA 4A7CA 2UVZA 1IRKA 1GIIA 3DK7A 5GHVA 4N70A 3Q9WA 4DEIA 5JT2A 3I7BA 3EKNA 3EN6A 4BDIA 3COMA 3KULB 3EL8A 5J7BA 4ONAA 3DTCA 5J1VA 4PNIA 2A19B 3NCGA 4LL5A 3E8EA 2C1AA 3P78A 3FYJX 4IX5A 3QYWA 4I22A 2IWIA 3R63A 3PJ3A 5TF9A 3L9LA 1JPAA 5HU3A 2CPKE 3BHYA 3UNZA 4C37A 4MXZA 5IA2A 1M14A 5CU2A 1UWJA 3Q4TA 4DEEA 1PMNA 2G2IA 4H3QA 4J98A 4KA3A 3POZA 1FGIA 4I0SA 1LEWA 2W96B 3TZ9A 2X0GA 3JPVA 2XKEA 2PPQA 1IA8A 5I9ZA 4G3GA 5GIOE 5K0XA 3VS7A 4AUAA 4BCIA 5AR7A 3PY1A 1S9IA 4FUYA 2GNFA 4DGMA 4C3FA 1H1PA 2OZAA 2WZJA 5DT4A 3H9RA 5FRIA 3N4VA 3PUPA 5FBOA 3K5VA 1PF8A 1PKDA 4FEUA 4BL1A 4MD7E 5FEQA 4ZLOA 5CEOA 4CTBA 2GS6A 3P23A 1XH9A 4A9TA 5BUIA 4MWIA 3QRKA 3EL7A 3IS5A 5JGBA 3C50A 5CEQA 1F3MC 3RNIA 4CD0A 3BE2A 4OTQA 4FTKA 3NNWA 4EOLA 2G2HA 1UA2A 4DEHA 3VHKA 4HZSA 1BUHA 4JBOA 4IX4A 3MPAA 4I92A 4FV7A 2B53A 4AW1A 3OMVA 2Y8OA 4FV3A 4GYIA 5C03A 5AV2A 4O7NA 3PZHA 5ANEA 4K11A 4FL2A 2BTSA 3F3UA 4RC2A 3ELJA 4E1ZA 2OW3A 4DTAA 1WBOA 3DBFA 3A7HA 3DOGA 2A0CX 4FT0A 1QPCA 3ENMA 3L9PA 2IZSA 3OCGA 5ETAA 1G8AA 4CFFA 3CR0A 5EI6A 1PXKA 3GC0A 5IISA 1A9UA 3MESA 3BX5A 5CEPA 5L8KA 2R3FA 5TOZA 2ITQA 2QQ7A 2XJ0A 5L2QA 4DCEA 2OJ9A 3NNUA 5DT0A 1GIHA 3QTUA 2W4KA 4XOYA 3TNHA 5KMIA 4RG0A 2VWWA 5CVHA 4YPDA 3Q9YA 4XEYA 1P2AA 3TNWA 3A4PA 3K2LA 4AF3A 5A4LA 1ZY4A 1WBTA 3COIA 4ITIA 4USFA 4F65A 4F7LA 3FAAA 3PRFA 3QXPA 4OTFA 3TKHA 4FV8A 5EYDA 4G2FA 4TWOA 4WSYA 2IVSA 3VF8A 2O2UA 5HCZA 3VBYA 4FV1A 5JQ8A 3PWYA 1XJDA 3NUPA 4X3FC 2WQOA 5M4UA 4K8AA 3AG9A 5D7AA 2C3JA 2GTMA 2GSFA 3R6XA 5AP0A 3BU5A 1OL2A 3DLZA 4FBXA 4QNAA 5G6VA 1O9UA 1Y8YA 1WAKA 4EOOA 4F08A 3V04A 3BBTB 4YPSA 4MK0A 3E87A 4EKKA 2ITPA 2PVHA 1H8FA 4AG8A 5HU9A 4O7SA 3OOMA 5HNIX 5IPJA 3QTSA 5E90A 1YQJA 5FP6A 4J97A 4M68A 4YHJA 4Y46A 5DOSA 3RINA 1DI9A 4O0XA 4E6DA 3SOAA 1YHWA 4AXAA 3PXFA 5CNOA 1U54B 1UKIA 2UZDA 2YJRA 5CLPA 4Z7GA 4TXCA 4NH1A 3LLAA 4YHFA 5AP1A 3UOJA 4DFBA 4YSMA 3ATTA 1JVPP 3NW6A 4OTWA 2YDKA 4F1OA 3SQQA 1PYXA 4IJ9A 5DH3A 4DFZE 4AT3A 4E4XA 4B8LA 4YMJA 3ENHA 1PMVA 4CFWA 4RIYB 4D2VA 3D15A 3KVWA 3QQKA 3O71A 4RPVA 3ZSHA 4YJNA 2ESMA 4J53A 5KX8A 1SYKA 5A4TA 3DXPA 3R01A 5CQUA 2ZVAA 3GFEA 2R9SA 1KSWA 3ZBFA 3HYHA 4PDPA 1WVWA 5ETIA 4YNEA 1JKSA 2WMSA 4X3JA 4PP9A 4BDAA 4EH4A 2GDOA 2ZV8A 3KB7A 2OXDA 1VJYA 4IB5A 1M7QA 4FODA 5EKNA 4NWMA 1YDRE 1GOLA 5ANOA 4O7TA 5HX8A 4D4SA 1P4FA 2OJGA 2B54A 3BELA 3NUUA 2YEXA 3KA0A 3Q9ZA 4ZIMA 4YZNA 3PXZA 3O8UA 4O0UA 4RQKA 4O0TA 5IA0A 2JDRA 1UNHA 4AW5A 2ETKA 3VBXA 4IACA 2BALA 2XM8A 3ORIA 4R78A 1FPUA 2XB7A 3JY9A 4HVIA 4L45A 4FEXA 5EW8A 5HE2A 1Q24A 3CS9A 5LMKA 3QLGA 3TKIA 4ZEGA 2UW9A 3PXYA 3R1QA 4XS2A 5DE2A 4EHGA 3DBCA 4BFMA 1OBGA 3D5WA 2ZV9A 4TWPA 5CWZA 3FMJA 4FVQA 2WPAA 4B7TA 3EQRA 4DA5A 4TWNA 3WZEA 4DTBA 2W4OA 2YM5A 4OUCA 3E62A 3GOPA 3F61A 2IVVA 1GIJA 2BAQA 4ZS0A 2QD9A 2ERKA 2IJMA 4K0YA 4IWPA 3ZXTA 4IX6A 3UGCA 4HZRA 3GU8A 3R28A 4WRGA 3SW7A 5EDQA 3FL4A 4QMWA 5EKOA 3S00A 5H8GA 4L43A 3U6IA 1YHSA 2X9FA 1PXJA 4L3JA 4FE2A 4LUDA 3RK5A 3TTIA 3LJ1A 3VUHA 2RFEA 2UZLA 2O8YA 2BROA 2XF0A 2C0IA 4F6SA 4EH5A 1BI8A 4LL0A 4RA5A 2R3RA 4L3LA 2WHBA 4X2GA 4FV9A 4N57A 5HBHA 3OROA 2UW4A 4Y83A 3EWHA 2Q0NA 3VAPA 4C59A 4YSJA 2F2CB 2NRUA 3PE1A 3HV4A 2WTDA 4EK5A 3R02A 4EL9A 2FSOX 1BL7A 2PUUA 4IM3A 5E8VA 4XHKB 1XBAA 2EXCX 4C34A 4CYJA 5KE0A 1OMWA 4NM3A 4J8MA 4NKSA 3BBWA 3QC4A 4XG8A 1UU7A 4CKRA 3O8PA 4ZJVA 4C3PA 2BAJA 5JZJA 3LFCA 5C01A 2Y6MA 3SGCA 5B7VA 3I1AA 4FKPA 4KABA 4KNBA 5DHJA 5BVEA 4D2TA 2I0HA 5HICA 3AQVA 3KXGA 3ERKA 3BWJA 3FXZA 3PP0A 2ITTA 4DTKA 4AWIA 3R8VA 1ZXEA 4G1WA 2EB2A 2W4JA 5DWRA 5F1ZA 2RIOA 4QTBA 5AUYA 3KF7A 3RPRA 4FTUA 4O1PA 1UNGA 3C4ZA 4F7JA 4QPAA 2PVJA 1Q3DA 4G6OA 5CF8A 1FOTA 3VN9A 4JL9A 5DR9A 5I9YA 2GCDA 1OKWA 2W1HA 2Y4PA 3KCFA 3OBGA 4HNIA 4QMTA 3OG7A 4R1YA 2FA2A 1SM2A 3OCTA 4C62A 3FLWA 4QP2A 1XH8A 4MNFA 2RL5A 5EM5A 3KXZA 3NX8A 2WAJA 4C35A 4IDVA 2YDJA 5LVLA 2W7XA 3GEQA 4FEVA 3TIYA 4U80A 1UNLA 2HAKA 2IPXA 3QA0A 4U81A 4APPA 4RT7A 4IFCA 4E7WA 2C6MA 1PW2A 4WHZA 4DEBA 4S33A 2EWAA 4GVAA 2HZ0A 4RSSA 4FIHA 2OH0E 3WBLA 4V0GA 2EUFB 2WQMA 3GU4A 3F82A 2I6LA 3FY0A 4HPTE 4NM5A 3ZO4A 3MFRA 3HAVA 4GW8A 1F5QA 2H96A 4TW9A 1NT2A 3U9NA 3V5LA 2WTCA 3AC4A 3E92A 5HIDA 4UMQA 4KUJA 2NRYA 3ORMA 4C4GA 4EH8A 2R3LA 3PWDA 4C2WA 4HVDA 3HRBA 4J52A 2YACA 3R8PA 3DAKA 4TYJA 5CX9A 4NTSA 5AUZA 4U3ZA 4WD5A 2J5FA 3Q6UA 4L46A 4X7QA 4YJQA 2C3IB 1RDQE 5J9LA 3RKBA 3DAEA 1YI3A 2WQBA 3DB6A 3GC8A 4FTIA 1TQIA 3P4KA 2R3IA 2I1MA 3PSBA 4FSZA 4ENXA 5IQFA 3F88A 5CAVA 5IEVA 2RF9A 4QYHA 4EWHA 5EQEA 5IQBA 4O96A 4RX7A 1L3RE 3EN7A 4YTIA 5CXZA 1DI8A 2BMCA 5HG7A 3QD2B 2F7ZE 2XNPA 3ZLXA 3IOKA 4FZ6A 3F5UA 4C02A 3U6JA 3FI4A 3TI1A 3EIDA 2CN8A 3ZSGA 1OL5A 2CDZA 2LGCA 3TV4A 3W18A 3BYVA 2QCSA 4YZMA 3IOPA 5EQYA 3ZFXA 4EC8A 2YLEA 1ZYDA 4FEQA 3HUCA 3TUDA 2QO2A 3O50A 1CM8A 3DJ5A 3QCQA 3V5QA 5KO1A 2VX0A 5C8MA 2JC6A 4GKIA 2ZB0A 1Q8UA 1TVOA 3FKNA 4Y5QA 2OJIA 2W1FA 5HG8A 5BUJA 4EHZA 3QZFA 4FTMA 4IAFA 1Q4LA 4BDGA 4KS7A 4QT1A 2NP8A 3I4BA 4YJSA 2BPMA 3ET7A 1O6KA 3LIJA 2PMOX 4BTKA 1BLXA 4O22A 3VS0A 4TTHB 4AU8A 4RLLA 3IG7A 2YCFA 2GU8A 5TT7A 3WOWA 4R77A 2QOKA 3PVBA 3RK7A 2CGVA 3P5KA 2GHGA 3RMFA 3TN8A 5CAQA 3ROYA 1UU3A 2V5QA 4MBLA 5CANA 2YFXA 3DKGA 4U5JA 4WRSA 3A7IA 3F2AA 1OL7A 3EZVA 3GQIA 3HP5A 3LJ2A 5EQPA 3HZTA 2XUUA 4AP7A 1PJKA 3F7ZA 2YJSA 4XBUA 5JRQA 3DNEA 2GQRA 3EQFA 4CG8A 5I0BA 2GQGA 3ZO1A 3TL8A 3K3JA 3MVJA 1OKZA 2XS0A 4L52A 2VTQA 3EFWA 2H6DA 3ODYX 2WTKB 4KIOA 1V0BA 3FHIA 4U7ZA 3RZFA 4BCFA 3ODZX 4IC7A 4ASEA 3GFWA 2GS2A 3HV5A 4L44A 4AZEA 5IUGA 1ZLTA 4O7YA 4ALVA 4E3CA 4PF4A 4UXQA 1W84A 1J7LA 2VD5A 1M52A 5E8SA 5KUPA 4JAIA 5CEIA 4YJRA 3FQHA 3GU7A 3MYGA 2RFNA 5FXRA 3V5WA 2W05A 1OKVA 3DU8A 2E9VA 2CNVA 5EOBA 3DA6A 3BV3A 3SXSA 2HZ4A 3UG1A 3FLYA 3GCUA 5HLNA 2NNWB 4IEBA 4FYOA 4D1ZA 4IC8A 3EFJA 4F09A 2YHVA 4FKQA 4FTJA 4BHNA 2ZM1A 5I9XA 2GNHA 5HCYA 4BGHA 1MRVA 3OUKA 4L42A 4X3FA 2YIYA 1YRPA 2BTRA 2IO6A 1GY3A 3HDMA 2WQNA 3QL8A 3HMOA 4FKVA 4ASDA 4N4SA 4AFEA 2WELA 4FL3A 4CFNA 4M67A 3FXXA 3Q3BA 2XIZA 4G9RA 3VRZA 4UN0C 5AJQA 3JVRA 4C3RA 3FMEA 4M0ZA 4BDHA 4I24A 1Y57A 1U46A 1JOWB 3HX4A 1MP8A 4FTRA 3PY0A 1YI4A 3UMXA 3ZYAA 5HE1A 4P5QA 4EH3A 5AADA 3DXQA 2QO7A 3TG1A 2R7IA 3EHAA 2WTWA 2OXXA 3RPVA 3VJOA 5HD4A 5TKDA 4BYIA 4AOJA 4O86A 4Q5HA 5H8EA 3NNVA 3HMPA 3IDPA 4K77A 3W10A 3LMHA 5M4CA 4FTAA 4AZVA 4O1OA 5CSPA 2ZJWA 4QRCA 5A46A 1DS5A 2C6IA 3E8CA 1R39A 4C0TA 2PVNA 3R21A 1NW1A 4QYYA 2H9VA 5D12A 4K33A 4U0IA 4TWCA 1OB3A 4G3DA 4FTQA 1DAWA 5AEPA 3ATSA 5JFXA 3FI3A 5BMSA 3LFDA 3CBLA 3R00A 4AW2A 4CGAA 4ZSGA 1PMEA 2VTPA 3PJCA 3QU0A 4TKSA 3AGMA 4UWCA 4KSPA 2CJMA 4EOMA 5ACBC 4JT3A 2WTJA 2X6DA 3ULZA 1IG1A 2QLQA 2C0TA 4YZBA 3R8MA 4B0GA 2XEYA 5GJGA 3AXWA 4FG9A 1SMHA 3KMWA 5CF5A 1PHKA 2J0KA 3KY2A 2B9IA 1JSUA 1URCA 3PYYA 3EQGA 3I0QA 2PY3A 1XHAA 4QMOA 5TO8A 2J0LA 3VW8A 4K1BA 4HVGA 4BDEA 3DKOA 2BAKA 3LXLA 1W8CA 4QMXA 3ZFMA 4A9YA 5M08A 3QD0A 3E5AA 4YC3A 5CZHA 4CV9A 4DFYA 3HKOA 4L7SA 5HO7A 2GQSA 4RLKA 3DKFA 3VVHA 1K2PA 3E64A 2X81A 5AUWA 3R9OA 5C8KA 1I09A 5IMEA 2C6OA 3U4UA 1STCE 1Y91A 4XV9A 5HVYA 3D9VA 4KKEA 4MQ2A 1CKPA 1OPKA 5L6WL 4FZFB 3NYNA 3HV3A 4LOPA 3CLYA 3V5TA 3VF9A 3JY0A 2PZRA 1R78A 3QRTA 2VTJA 3R0TA 4L53A 1U5QA 4U44A 5EHYA 3BU3A 3RNYA 3KMUA 2ZV2A 4CT2A 5KBRA 1XH7A 5AMNA 2YZLA 5HG5A 3BLRA 3KGAA 2WXVA 1H25A 3VQHA 4KAOA 3PPKA 3EN9A 4PDOA 4AGWA 3IDCA 2ONLC 3N51A 2F9GA 4EOSA 4ZTHA 1Q8WA 4ERKA 2XK3A 3AMAA 4I6QA 1QL6A 3VS6A 2WMTA 4QP6A 3CQWA 4E6CA 3QQLA 3RP9A 4YNOA 3PA3A 4GUBA 2PSQA 4FKUA 4E6AA 3KN5A 4QQCA 5CU4A 4HGSA 5K9IA 4ZJIA 1FMKA 3MWUA 4YTFA 2R4BA 3FMMA 3W8QA 4YURA 5LJJA 1J7IA 2H8HA 2BDFA 2FH9A 4HNFA 2W1ZA 3PY3A 3U51A 3VIDA 3MH3A 4QTDA 2ITVA 5DEWA 2C4GA 2P0CA 5A4EA 2VN9A 3NAYA 4A07A 5FXQA 5HBEA 4XMOA 2VO7A 1JQHA 4IZ7A 3UOHA 3KKVA 2B0QA 3IW7A 1OM1A 4X6QC 3R7OA 1ZMWA 3ROCA 2QU5A 3EQCA 2YAKA 3F3VA 1IASA 3ITZA 3ZRLA 5LWMA 3QKLA 4NK9A 5FG8A 2WTIA 5HO6A 1JKLA 1QPEA 2W9ZB 3R2YA 4I0TA 4HYIA 4IM0A 4DH5A 4J95A 2PULA 3NAXA 3D0EA 2VX3A 4L00A 3NIZA 4K6ZA 2BZIB 4FKRA 4UMUA 3L9NA 1OIYA 5GZAA 5C4KA 4YC8A 5E8YA 5M06A 4RVTA 4AACA 3MS9A 3BLHA 1Q3WA 3IGGA 2QHMA 3NEWA 3GGFA 4NW6A 4ASXA 2JIVA 3CIKA 4IANA 4RWKA 1JBPE 4ZZNA 4FZAB 1JSVA 2WTKC 4U43A 3SC1A 5LVPA 1FVTA 4DG3E 5I9UA 3C5IA 3NDMA 4YJUA 4QMLA 1WCCA 1OVEA 3OOGA 3FLZA 2XVDA 4R7IA 5L3AA 3D7ZA 5JSMA 3QX4A 3R7YA 4ENYA 4FGRA 5FUTA 4M12A 5GIPE 4RVKA 2BFYA 2ZDTA 1W83A 4AZSA 3FEGA 1QMZA 5EM7A 1GJOA 4KRCA 3OFMA 4M8TA 4HYUA 5CZIA 4AT4A 5CAPA 4EQCA 2BRMA 2P55A 1H0WA 4PPAA 4RVLA 2X7GA 1K3AA 4EH6A 4DFUA 1UU8A 1UV5A 2VTIA 3SDJA 2XJ2A 3QRIA 3CJGA 1Z5MA 3OY1A 4D9TA 4JJRA 3GI3A 1Q8TA 2RGPA 4AZWA 2O0UA 2HCKA 2XZSA 3I81A 4GFMA 4X2KA 4USEA 3IDBA 4YGAA 1XKKA 4E93A 3MI9A 4XG9A 3K5UA 3LFFA 3CEKA 3I5ZA 3MJ1A 4X2FA 4YP8A 4FZDB 5HNBA 5T68A 3MBLA 2R2PA 4EWQA 4FA2A 4HW7A 4ZMEA 2AC5A 4CQEA 4U3YA 1OITA 4EI4A 3SW4A 3NSZA 3KXNA 2BDJA 4LV8A 5GZ8A 5JK3A 4ZTSA 4DH7A 4FOBA 3UQFA 4FIIA 2PZYA 4U97A 3ZLYA 2ZMDA 3HP2A 4MVFA 4NL0A 3LE6A 4GT4A 3FZOA 4R7BA 2YCSA 2XJ1A 4JOAA 3LM0A 1OUKA 3L8PA 3FL5A 4WSQA 4GH2A 3TNPC 4GVJA 3QTRA 4RC3A 5F95A 1HCKA 1W0XC 3FV8A 3MB7A 5E8XA 4AQCA 4I1ZA 4XH6A 4AZFA 4GT3A 2GFCA 5AP3A 4HCVA 2W17A 3F69A 3OW4A 4J8NA 3QZHA 4AGCA 3VO3A 2OIQA 2ZM4A 3OXTA 4DGOA 5ANIA 3BHVA 4XG2A 3ANQA 3GT8A 4KBAA 5AA9A 3M11A 4GK2A 5L8JA 4RIXA 2BRBA 2E9OA 3WE4A 3S0OA 4I94A 4FIEA 3PDTA 2OI4X 3KU2A 4D2PA 4M15A 2GNGA 3SRVA 1HOWA 1KE5A 3QTQA 3Q2JA 3REPA 3SOCA 4CYIA 4M69A 4DAWA 2RFDA 4AE6A 2QI8A 3NS9A 4G3FA 5F20A 4AN9A 2F57A 1SNUA 2J90A 3CC6A 3P7CA 3PTGA 3L8SA 4F6UA 5AAEA 3IPHA 5CSHA 5JKGA 3C5UA 3FZPA 5AV4A 5DVRA 4D2RA 1R3CA 2IW6A 3B8QA 3GOKA 3QUPA 2XCKA 2R0UA 4DYMA 4O27B 4JQEA 5DGZA 3PG1A 1PXNA 3QYZA 4G9CA 1XBBA 3OT3A 2HW6A 3BQRA 4H3BA 3TCPA 4WG4A 3OF0A 5I5ZA 2JKMA 4IJPA 5AUVA 1OPJA 3ORZA 5LVMA 5IQGA 3S95A 1W98A 1T46A 3LXPA 4EK3A 3RK9A 1PXPA 3L9MA 2F2UA 4FSRA 2F4JA 3ZO2A 3QCXA 4II5A 4S32A 3ANRA 2XKCA 3A2CA 3DKCA 3EQIA 3DJ6A 5E8TA 3I7CA 5CTPA 3SXRA 3SA0A 3VS2A 3HRCA 1FVVA 1OKYA 4J96A 5AV1A 4CZYB 4ZTRA 2W1CA 2QOLA 3DQWA 3MTFA 3QCYA 4S2ZA 4ERWA 3LQ8A 5TE0A 3UIMA 2UZOA 5CENA 4C58A 4E8AA 1VEBA 4U8ZA 2UZUE 4C38A 2XNBA 4UZDA 1IEPA 4TYGA 4OW8A 3ZLSA 3BHHA 3O0GA 4OGRA 2XIYA 4C4EA 3PPJA 3U4WA 1G3NA 3BI6A 3MFUA 5AV0A 2VAGA 4C4HA 4EJ7A 2IZRA 4O0YA 3ZONA 4O91A 5JFVA 5K5NA 2J6MA 2HK5A 3WZDA 3WF5A 3I79A 2B9JA 3I0OA 1J1BA 5DFPA 3KK9A 4FOCA 2OIBA 4DHFA 3FE3A 2C6KA 4PNKA 4HJOA 4U40A 4BTJA 4WKQA 2J9MA 4BBMA 4ANQA 3EYGA 4LOOA 4MH7A 4DG2E 3FYKX 4KKHA 3FQSA 5IA3A 3CGOA 1OUYA 3E3BX 4BCKA 4L01A 4N0SA 3LCSA 4NZWB 3DK6A 1NXKA 2RG5A 2Z7LA 3Q2MA 2DUVA 4OR5A 1MUOA 1SVHA 2R3NA 1FINA 4RGJA 5H2UA 4G5JA 5FLFA 2EB3A 3D7TB 4M0YA 4W8DA 3EH9A 4FSQA 2VTRA 4JR3A 5GZ9A 3VS5A 5L6OA 2IVUA 3KXXA 5HVJA 4MCVA 4DGGA 4CZUA 4S30A 4F9YA 5BYLA 3QBNA 5D7VA 4LRMA 5AP2A 2RFSA 3L8XA 3RWQA 3C9WA 3D83A 3TTJA 4P90A 5JGAA 2ETMA 2YWPA 4QO9A 3BZ3A 4DC2A 3KK8A 1RE8A 3NZ0A 4PPBA 2GHMA 3W2QA 2I0YA 3UYSA 3PSCA 5BVNA 1YW2A 4BCHA 5EHOA 4O83A 3GUBA 1GZOA 2XIKA 3OBJA 2FSTX 3C0GA 2R64A 2C3KA 1VR2A 3KN6A 5M4FA 2FB8A 2WMBA 2XCHA 4ITJA 2UW5A 4Z16A 2CKPA 3QRJA 4ASZA 4W8EA 2PTKA 3CY3A 4EKLA 4OTPA 3E88A 4H1JA 5BVDA 4I5HA 5CSVA 4WUNA 2PE0A 1CSNA 2E9NA 2QO9A 2VWZA 3Q04A 5EYCA 3TWJA 3BGPA 2XA4A 2PMIA 2QNJA 3T3VA 3VW6A 4BI0A 2HW7A 1J3HA 3GNIB 3R9HA 4D1SA 3ORKA 2ITXA 4CNHA 4PV0A 5BX0A 2XRUA 1Q97A 4YC6A 3VWAA 4JRNA 4DINA 1FVRA 1KWPA 2OKRA 5AUTA 5JN2A 2VTMA 5ANJA 4JI9A 4IZAA 4OT5A 3HMNA 1A06A 5EFQA 3GP0A 5CVFA 4ZZMA 5M55A 3WZJA 2YCQA 3JVSA 4RIXB 4XUFA 3U9CA 5A9UA 4JX3A 2BHHA 1TKIA 4O6LA 3RGFA 2DYLA 4KKGA 4RWLA 3FLNC 5B2KA 5GNKA 3ZDIA 4AX8A 4O82A 3AGLA 4ALWA 4MBIA 4WO5A 3V51A 2ZDUA 5FBNC 4AOIA 4EUUA 2Z7QA 2W9FB 4FR4A 4RBLA 5FDXA 4M14A 3DFAA 3HRFA 1XWSA 2JIUA 2OZAB 4WG3A 5LCKA 5CSWA 4PMPA 3RCJA 3WYXA 3ZDUA 2FUMA 2V62A 2XK8A 4HYSA 1TQPA 3HL7A 4RJ5A 1ND4A 2ZAZA 4FTNA 5HNGA 4BTMA 4EYJA 2B7AA 5K4JA 2PUNA 1APME 2ITOA 5JRSA 4L68A 3UO5A 4NFNA 4PMTA 3G90X 5CF4A 1J7UA 3W32A 3UPZA 1OBDA 5BYZA 4BWKA 2BHEA 2WU7A 3A62A 3VS1A 2XIRA 4R3PA 4YBJA 2XK9A 5HLWA 1TQMA 2XK7A 2W06A 4GL9A 5DBXA 3R83A 3NUXA 5DR6A 2DS1A 2UVYA 4HGLA 4TL0A 5A54A 4KIKA 1H24A 2FVDA 4WUAA 3LMIA 4FNXA 3FC2A 1WBWA 4IDTA 2PMLX 5E8UA 4I21A 1O6YA 2X2LA 3FMHA 1SNXA 3HLLA 5AM6A 3AC2A 3W8LA 4MKCA 4ZS4A 5BQ0A 1YOJA 2QR7A 4BRXA 4NCTA 2BVAA 1I44A 1YXVA 2SRCA 4FL1A 4NSTA 4R3CA 4Y5HA 3QUDA 4JG6A 4EQMA 2REIA 3Q96A 3HNGA 5AV3A 4QOXA 3ZEWA 3RZBA 2Z02A 4AA5A 4WNMA 3R7VA 2WQEA 3OT8A 2G9XA 4FF8A 4L9IA 4BDBA 4FKTA 1ZAOA 3Q4CA 4O6EA 4YZCA 2WD1A 4BDJA 3TUBA 2R3PA 3RVGA 1KE9A 5JEBA 4BIEA 4C8BA 2W5HA 5L2TA 3HVCA 4QMUA 4P5ZA 4GU6A 2QKWB 3AT2A 3IGOA 4GIIA 4XP3A 2VWUA 3CTQA 4FKGA 3HEGA 4CT1A 2IW8A 4XBRA 4FIGA 3VUKA 5ANDA 4APCA 3ZS5A 3EN4A 4RJ3A 4JQ7A 4GRBA 5FDPA 4IAIA 1WMKA 4LMUA 5FXSA 5KMKA 4D4YA 3ZOSA 2WO6A 4G34A 4JQ8A 5A6OA 4F6WA 3U54A 3TEIA 5M09A 1G5SA 1V0OA 3GU5A 4KD1A 3LFEA 2YLFA 3R73A 1BYGA 4O2ZA 3V3VA 3BGQA 5L2WA 4ZSAA 2YM4A 4W9XA 4ANMA 4CLJA 4YJOA 5FTQA 1GZKA 4JDIA 3LFAA 2BKZA 1H1WA 2R3JA 3PVGA 3Q53A 3UZPA 4BIBA 5E7RA 4ACGA 1DM2A 4I6HA 4CFMA 5D41A 5J9ZA 3MN3A 4N6ZA 4O0WA 2JLDA 4ALUA 2PZIA 4GSBA 3LFQA 5HEZA 3BV2A 3CQUA 3UOLA 3PJ2A 4QMSA 3MY0A 3ZMMA 3UVRA 4KWPA 3DTWA 4KS8A 4RIWA 4M97A 1H27A 3AOXA 3DY7A 5LQFA 3F3TA 3PXRA 2WKMA 3OHTA 4D4VA 4IIRA 2IN6A 4DGLC 2OXYA 1FQ1B 4CMTA 2OIDA 4Q9SA 5HORA 4HGEA 2JEDA 4Z9LA 3ALNA 4FSUA 2ITWA 5AP4A 2OFVA 3NGAA 3PXQA 2QOIA 2ZV7A 3NCZA 3QAME 3MH1A 4JG7A 2C5OA 3RHKA 1WBNA 3V5JA 2Z7SA 1LUFA 4BI2A 3RAHA 4AN3A 3QTZA 3NNXA 1YWVA 3N9XA 2VWXA 3A7JA 4FYNA 2XH5A 2YM7A 3TV6A 4E20A 5HTIA 4KIPA 5BVKA 4BZNA 2C6LA 4JAJA 4O7RA 4GG5A 4R6VA 3ZC5A 2Z2WA 2YWVA 3DBEA 2EXMA 4HYHA 3C0IA 4AW0A 2W1IA 1CKJA 3FPQA 3FZRA 4DH8A 4PDYA 3U55A 4DGNA 5KNJA 4IHPA 3CE3A 4RA4A 4XG4A 4EHVA 3U6HA 2J4ZA 2BIKB 2ITZA 3UO6A 4B6LA 5A6NA 2WMUA 3PA5A 5EDPA 2JITA 3IO7A 3ORNA 3OXZA 2C5XA 3NYVA 3QGYA 2WMWA 4NIFA 2UZVA 4QP4A 4TYEA 3ZHPC 3QRUA 4FX3A 4CRLA 3Q5ZA 3G2FA 2B1PA 2Q0BA 5BVWA 4LM5A 5HO8A 4A9SA 4CVAA 3WI6A 2E9UA 4ZTQA 1RW8A 5E92A 3UMWA 5C4LA 2OZOA 4I4FA 2YISA 2BRGA 3GC7A 4HGTA 4QTAA 1KUTA 3DCVA 4UXLA 4F64A 1PXIA 2VWBA 3BIZA 3Q32A 4YBKA 3WIGA 5L2SA 3BYSA 4KIKB 2VWIA 2GTNA 5HTBA 3LZBA 2C6DA 4CFXA 4YUQA 2VTLA 4FSMA 1PYEA 3H0ZA 2A1AB 3QWKA 4YLKA 3D5XA 2IZTA 4FKIA 3CD8A 3CCNA 1KV2A 3EFLA 2PWLA 1XH6A 3MY1A 4PTEA 5CI7A 4OBOA 2PVFA 4EUTA 2BKKA 2XK6A 5M44A 2HY81 3V8TA 4MXXA 4K9YA 4QYGA 5K0KA 4PTGA 5IA5A 4CKJA 5JQ5A 3D5VA 5D10A 5J95A 4CV8A 5AX9A 3WE8A 5IZFA 1U59A 3EJ1A 3QF9A 4BB4A 3A99A 3W2PA 3UP2A 1Z57A 1ZARA 5M56A 2VNYA 2CGXA 3UQGA 2PVYA 2JDSA 3ZU7A 1NVRA 2HWOA 3H4JA 5HE0A 3TDWA 3SHEA 3MPMA 3FMDA 3R04A 1H1RA 3CTJA 3H9OA 5F4NA 3THBA 3FMKA 3CPBA 4M84A 5DT3A 1ZZLA 3FY2A 4GYGA 1WBSA 3F6XA 5ANKA 3QKMA 4FKJA 3NUYA 5ITAA 4F70A 5IF1A 4YTCA 2OG8A 4EHEA 2H34A 3P9JA 4QMYA 3UE4A 2HXLA 2W0JA 4HPUE 2WTVA 2J50A 3LVPA 3OC1A 4RC4A 3VUTA 3JYAA 3VBTA 5ICPA 5JMSA 4MTAA 5CS6A 5IA4A 2FSMX 3QTWA 4H3PA 4BZDA 3NWWA 2QC6A 3F3ZA 5DG5A 4RZVA 1YDSE 2FYSA 4FVPA 3Q4ZA 1QPJA 4IXPA 3W55A 3G51A 4DT8A 5IA1A 2XNMA 4QTEA 5J5SA 2WFYA 4TN6A 1RQQA 4ITHA 2X6EA 4Y73A 4BCGA 4HVSA 3Q4UA 5DRBA 4ZSLA 3UYTA 1KE6A 3T8OA 2C5NA 3FXWA 4V0GB 3UNKA 4NTTA 4AGDA 2R7BA 4NW5A 4BHZA 1YXUA 2R3OA 3LFSA 5J1WA 3C13A 3PJ1A 1NY3A 1P14A 1M2RA 2XNEA 5CEKA 3C1XA 3VBQA 2PU8A 4J71A 3DNDA 2YABA 3P7AA 4HOKA 4V05A 3T9IA 4JVGA 5L2IA 2XMYA 3UDBA 4CLIA 2O3PA 4UZHA 2VTOA 5EM8A 5M4IA 4EBWA 4X6RA 2PZ5A 4I5CA 2QOFA 5A4CA 3S3IA 3P1AA 4F99A 4DLJA 1G8SA 3VJNA 3OTVA 3AT3A 5GJDA 5C9CA 4IVDA 3F2RA 5KZ0A 3DGKA 4JDJA 1CMKE 4YHTA 3R22A 2UZNA 3G6GA 2JGZA 4ACMA 3LOKA 3BGZA 3HMIA 1ZWSA 4G3CA 4L6QA 4O21A 4PMMA 3RBWA 2XNGA 5M57A 4CZTA 4U45A 4E5BA 2XYUA 2VTHA 1YXSA 1NVQA 3VC4A 5B2LA 5IQHA 4FV0A 3UBDA 5EDRA 3LLTA 4RWJA 5AUXA 3SX9A 5KMLA 4F0FA 1Q61A 3ZBXA 4OTDA 3D5UA 5C26A 4Y85A 4GMYA 2QLUA 2X7FA 2XEZA 4FSNA 4I0RA 1CKIA 3UIXA 5M51A 1ZY5A 4MYGA 4EOJA 3GCVA 5J8IA 4MHAA 1ZOGA 3ZCLA 3D4QA 4XG7A 2BUJA 3QHRA 4FKLA 4RRVA 4JRVA 2UZWE 5HBJA 4NIFB 3C4CA 4Q2AA 4IVCA 1OECA 3RALA 3NVKI 3CXWA 5DLSA 5L6PA 4KBKA 4GJ3A 3ACKA 1IAHA 3Q60A 2ITUA 2VGOA 3KXHA 5BVFA 4QP9A 4QQ5A 4LRJA 3WF7A 1O6LA 2CCIA 3N4TA 5AP6A 3FMLA 3S2PA 2ERZE 5CQWA 5LVNA 3EZRA 3VRYA 5H9BA 4U41A 4EONA 4GFGA 3VS4A 4EQUA 4LFIA 4Y72A 3EQHA 4I6FA 3MGYA 3DLSA 5LMKC 3B2WA 4UYNA 4C36A 3OUNB 1H07A 3BHUA 3ZZEA 4BCOA 5M53A 3OXIA 1OI9A 2OFUA 4F7SA 4H05A 1PXOA 3IK3A 3I5NA 2BZJA 5DIAA 3SG9A 3F2NA 4FSTA 4F1MA 5KKRB 3ZO3A 3VQUA 5BNJA 4BYJA 4I23A 3RHXA 4IAYA 3PVUA 4NKAA 4JBPA 2YIXA 3HA6A 5AAGA 5DR2A 2I0EA 5HQ0A 3O23A 4FKSA 4GUEA 4LGHA 3DB8A 3UNJA 4PPCA 3WIKA 5K5XA 4I5MA 3FZSA 5J5TA 2XBAA 4AZTA 5IU2A 3CQEA 5IKWA 2VTTA 3ZH8A 1YHVA 4JIAA 4EOIA 3LHJA 4YO4A 3JR1A 4NEUA 3CJFA 4QTCA 3MH2A 4YTHA 4IX3A 2XNOA 4CG9A 3EKKA 2OO8X 1ZMUA 4A06A 3QA8A 3FBVA 4IB1A 3ZUVA 5DPVA 3ZZWA 4DEAA 3DT1A 1LP4A 4EJNA 3K54A 3LQ5A 4IAAA 4UBAA 5I3OA 5AR8A 3TZ7A 4X3FB 3AMBA 2B4SB 2Y6OA 4ORKA 4AN2A 1XH5A 3O7LD 5CAOA 5FM2A 3TJDA 3QC9A 4YR8A 4BCQA 3KC3A 2CNQA 2V7AA 4GFOA 2HIWA 4J1RA 2VX1A 1LEZA 2XKDA 2XNNA 3E3PA 3EMGA 2J5EA 4KB8A 3KL8A 4D2WA 4EZ7A 4OAUC 4UYAA 1M2QA 1ZOEA 2E2BA 5LCJA 3BCEA 3H30A 2V0DA 5A3XA 5T3QA 3ZTXA 3RI1A 5M07A 3R7UA 3KEXA 2PVRA 3CP9A 4XCUA 3KRLA 2PZPA 3DZQA 2GNLA 3MJ2A 3R8ZA 4QMNA 2A4LA 5EI8A 2P4IA 3ZM4A 1JLUE 3FJQE 3UTOA 4FV5A 5KHWA 4IWQA 5IEXA 3DZOA 3PIZA 5LOHA 1WZYA 3AT4A 4QP8A 4BZOA 2JBOA 2YM8A 3G9LX 2YIRA 3OTUA 4FV4A 3HDNA 1H26A 4O7ZA 2YERA 5T6KA 2J0JA 5H8BA 2OF2A 3BRBA 5AWMA 2IW9A 2C1BA 4AAAA 3A8XA 5ANGA 1B39A 1U4DA 3MH0A 3E7OA 2X8EA 2QG5A 4CTCA 3P08A 4MD8E 4WOVA 3DQXA 2I0VA 4JIKA 4E5WA 4ZAUA 3QLFA 3NUAA 5I9WA 2VZ6A 1H0VA 5JH6A 2C0OA 1U54A 2HENA 1IR3A 2R3MA 4QMQA 1PY5A 2XIXA 4TYIA 2XK4A 4QP7A 4E4LA 3ZRKA 5K3YA 5ETCA 1NVSA 4R5SA 4M7IA 2X8IA 4Z7HA 2KULA 2E9PA 2C69A 5KMJA 3FQEA 2UZEA 3OEFX 2JD5A 4FSWA 4PQNA 4FG8A 1EH4A 1KOBA 2GPHA 3OP5A 1M7NA 3NIEA 4RIYA 5C27A 3KVXA 2HZNA 4D5KA 4X0MA 4BGGA 4YO6A 4G3EA 3F3WA 5KZIA 1E1XA 4RFZA 5IQAA 4FEWA 2G2FA 3O17A 3KRWA 4FZ7A 4U42A 4QP3A 3TV7A 4GV1A 4AT5A 3EFKA 4RFMA 4DFXE 2J0IA 4X2NA 1OIUA 3MY5A 4MXAA 3W2OA 1H08A 4ZTNA 4CXAA 5I4NA 2WOTA 4E6QA 4A9UA 4QMVA 1W7HA 4UY9A 1XR1A 2BRNA 3OD6X 2YIQA 3RTPA 5J79A 4IE9A 4S31A 2OLCA 3TDVA 3VUIA 1BKXA 3GENA 4RMZA 4KSQA 2RSVA 1YI6A 4FTCA 1Q99A 2RG6A 4OT6A 4IMYA 1VYZA 5F94A 3G0FA 5DN3A 3OW3A 2HZIA 2QONA 4B4LA 4WNPA 2YM6A 2QOOA 2WOUA 3FMNA 4OTGA 1GZNA 3OWPA 3GCPA 4QMZA 4BCMA 2C5YA 5HVKA 1YWNA 3F5PA 3R9RA 3I60A 4ARKA 3ZUTA 3UVQA 4I20A 3HMMA 4PDSA 4B9DA 3ETAA 3DAJA 3Q6WA 4NJ3A 2ZMCA 5AM7A 3MPTA 3MVLA 4AA4A 1PMUA 3QD3A 3H10A 3I6UA 5CT7A 1CTPE 4IB0A 3R7EA 3QKKA 1OIRA 4IFGA 2Y7JA 4D58A 4G31A 4DITA 4PRJA 4RJ6A 4FTTA 5F9EA 4EC9A 5EYMA 2CKOA 4AOTA 4D2SA 5HZNA 2QODA 3LFBA 5IMXA 5GINE 3MV5A 1GZ8A 4CQGA 2UW8A 5IG1A 5HG9A 1QPDA 3TT0A 1A48A 1V0PA 5CAUA 4O84A 4OTRA 3O51A 3OVVA 4IH8A 3ALOA 4Z55A 5J7HA 1AGWA 4ACDA 4M3QA 4ZLYA 3LXKA 3GQLA 4EK4A 4X21A 4OTIA 3R8LA 2WMVA 5IUIA 5CVGA 1IAJA 4AS0A 4IVBA 3R8UA 5AA8A 2GMXA 1OZ1A 5HCXA 4PL3A 5FEEA 2GS7A 2JKKA 4WNOA 1RJBA 4GS6A 4YJTA 3ULIA 4ANLA 5KKRC 3M2WA 3B2TA 3V6RA 4DBNA 3SAYA 3UP7A 3UG2A 4ZTMA 4Y8DA 3FI8A 5C8NA 4H39A 3TJCA 3P79A 4RX9A 4O81A 4YLLA 4EH9A 1XBCA 2UW7A 3PZEA 4ANBA 2X39A 3DDQA 4IW0A 2CGWA 4LYNA 4MX9A 2IZUA 5HIBA 3ZC6A 1LPUA 2VTNA 4C4FA 4R5YA 5IEYA 3MIYA 5L4QA 4XLVA 1DAYA 2Y4IB 4O0RA 2GHLA 3DPKA 2QG7A 4QYFA 4DT9A 2Z8CA 3COKA 3M1SA 2ZB1A 5KMNA 3OS3A 5A4QA 2BIYA 4YLJA 3ZEPA 1OIQA 1BI7A 3D2IA 5HI2A 2UW6A 3TIZA 4FNWA 4BY9E 5E4HA 2Y9QA 4I5PA 1CDKA 2GNJA 4IWDA 5CSXA 3NW5A 3GBZA 4EOKA 3FDNA 4XP0A 3T3UA 1J91A 2B52A 5AUUA 3MDYA 1S9JA 3MFTA 2BZHB 3DK3A 4A4XA 1WBVA 2P3GX 3G9NA 3QGWA 4D1XA 2A2AA 3MIAA 4QMMA 4DCAA 1FMOE 3CSVA 1R0PA 3MA6A 4HCUA 5CALA 4E4NA 2J0MB 2ZYBA 3VUDA 4QNYA 2I7QA 3FLQA 2FO0A 4MD9E 4BCNA 3LCKA 3FI2A 5IDPA 3BEGA 5AFVA 3DV3A 4BC6A 4ZOGA 3PSDA 3HGKA 3P7BA 3W16A 4D4RA 2ETRA 5CU0A 3NLBA 4CRSA 5KHXA 3N4UA 2WMXA 4F9WA 3QQGA 2B9FA 5KCVA 4CMOA 4MEDA 3GC9A 4F7NA 5IH4A 3KQ7A 2OWBA 4JX7A 2QKRA 2GFSA 3EN5A 3FSFA 3UC4A 3UIBA 3L1SA 3R1NA 3VULA 4PX6A 5CI6A 4RJ8A 1OL6A 3SV0A 3UZRA 1HCLA 1T45A 1ZMVA 4FT3A 3R2BA 4L7FA 4V04A 4H36A 2R3QA 5FP5A 2JBPA 1MRUA 3QQHA 2VTAA 1H4LA 3EQPA 3A8WA 3F9NA 2F49A 3FHRA 4IZYA 2XRWA 5FQDC 4UX9A 2C47A 4JNWA 4WBOA 4JR7A 3SRVB 3TNIA 4EORA 4ZMFA 2VO6A 3R1SA 1PRYA 2ONLA 4C61A 4MF0A 4MWHA 2BRHA 4WIHA 4M69B 4MQ1A 2HXQA 3Q52A 4LGDA 5IDNA 3QXOA 4FNZA 2XYNA 4ZSJA 3A4OX 3WF9A 4V01A 5BUEA 2ITYA 2Z7RA 3WARA 4OLIA 4BDKA 2YDIA 3RJCA 4IB3A 3QCSA 1Y6AA 3LCOA 3PFQA 4DN5A 3DFCB 5IQIA 2PVMA 1M17A 5LMAA 4ACCA 3G15A 4K2RA 3C4FA 4Z3VA 4PL4A 3GB2A 1Q8YA 3TKUA 4JBQA 2O63A 4C57A 4I41A 2X9EA 4GJ2A 4LI5A 3D2KA 3WILA 2DQ7X 3HA8A 3BHTA 5ETFA 1H1QA 4FNYA 1JKTA 2QOCA 4WBBB 4B99A 1IA9A 4U6RA 5H3QA 3LQ3A 2W5BA 5DRDA 4EOPA 4BBFA 3QFVA 2UW0A 1YKRA 1J1CA 3HUBA 4ZP5A 3DJ7A 2P2HA 3W2CA 4DFNA 3WF6A 3LW0A 3PE2A 1BL6A 5E91A 3ORLA 4MNEA 4JDKA 1PXMA 4IM2A 5AR2A 4ANOA 4BICA 3QTXA 3RCDA 2BCJA 1MQ4A 2PVKA 4O2PA 4A9RA 3RM7A 4CCUA 4QMPA 3TACA 4W4VA 2WU6A 1FBNA 4R3RA 5IQDA 4O7WA 1SVGA 3GCQA 4QQJA 2JFMA 1LR4A 2OH4A 1M2PA 3LM5A 5EG3A 4LGGA 2VV9A 3H0YA 4CCBA 4RWIA 1UWHA 4B8MA 2WIPA 1ZYSA 4OBPA 1OL1A 4XG3A 1R0EA 3UPXA 4P2KA 3VBWA 5DMZA 4GG7A 2JAMA 3UODA 4OTHA 4JLCA 2PE1A 4NUSA 2NPQA 4FT7A 3LFNA 4DEGA 4ZTLA 2ITNA 2UVXA 5A14A 4IAZA 5AR5A 4DEDA 3POOA 4A4OA 4O38A 4D28A 1YOMA 1WBPA 3PIXA 3QQUA 4PY1A 5EW3A 5JZNA 3TZ8A 4EBVA 3QQJA 2IVTA 2CHLA 2VTSA 4QD6A 1UU9A 4TZRA 2OBJA 3BYMA 3GVUA 4ZJJA 3MB6A 2WGJA 3R9NA 4EYMA 5AIKA 3PVWA 3O96A 3AD4A 3KRJA 3LPBA 4GKHA 4AFJA 3TNQB 3LKMA 1XQZA 4YJPA 4PL5A 1JNKA 5HE3A 3HV6A 3VUGA 3DS6A 3WF8A 2JDVA 4ANSA 2VGPA 4IAKA 2OU7A 2RKUA 5IH6A 3JUHA 3IW8A 4FK6A 2HOGA 3OCBA 4FTLA 2QHNA 4EK8A 4ZLZA 3AD5A 4IZ5A 3EOCA 5B2MA 5I9VA 4HVHA 3OWLA 4BDDA 4LMNA 1UKHA 4PWNA 1L8TA 2WMRA 2Y4IC 4LV5A 3ZFYA 3ZXZA 4RQVA 5CU6A 2FSLX 5CXHA 3IECA 4F4PA 4LUEA 3BQCA 3FZ1A 2WMQA 3QTIA 3BKBA 3V8WA 3E8NA 3QHWA 4LRKA 2EVAA 4GK4A 4BWPA 4DH3A 1K9AA 3DXNA 3I6WA 3NW7A 5E1EA 2VU3A 3BEAA
chains in the Genus database with same CATH superfamily
3PP1A 4UMTA 1AD5A 4K18A 3RAWA 1VYWA 5DNRA 4BDCA 3R71A 3E93A 3RPYA 4C4IA 4QP1A 2CKQA 3BYOA 2PHKA 3PIYA 1BX6A 4J7BA 4UEUA 4OAVB 5CU3A 1FGKA 4FVRA 4D55A 3RM6A 1KE8A 3UO4A 1ZYCA 4DG0E 4H58A 3NYOA 2HELA 5HIEA 3ID6C 2PYWA 3LAUA 4W9WA 3V5PA 3K3IA 2YAAA 4UWYA 5LXMA 2LAVA 3LMGA 1H00A 2FGIA 2OJFE 1VZOA 3BYUA 3KREA 4MF1A 2WB8A 4N6YA 4ZY6A 4I6LA 2F7EE 3MVMA 2UZBA 5HD7A 3CTHA 4BCJA 2JKOA 4E73A 1X8BA 3QZIA 4JG8A 3TZMA 2QOQA 2ZM3A 3JXWA 4FI1A 4MBJA 4P7EA 4XV2A 3FUPA 3CD3A 1E1VA 3NUNA 2F7XE 5AP7A 2QVSE 4TYHA 5EW9A 3W33A 4BIDA 2PUPA 5FWKK 3UIUA 2X2MA 3QUEA 2W99B 3OEZA 3MA3A 3ZSIA 4ZZOA 3TM0A 3GXLA 2R3HA 2HWPA 2R3GA 3E8DA 3QD4A 4FMQA 4USDA 3ORXA 4YZ9A 1AQ1A 4L3PA 2O65A 2Y0AA 3L8VA 5AX3A 3OZ6A 3VBVA 4XRJA 2CGUA 3C4XA 4MAOA 4ZSEA 5HGIA 4GIHA 3RPOA 1XO2B 4G6NA 2ZOQA 3WZKA 4F0IA 2VWYA 4DF3A 2Q83A 2V22A 3LXNA 4JBVA 4PTCA 3U8WA 4I93A 4G6LA 4E26A 4XOZA 4W4YA 2A27A 3UVPA 2UZTA 2V7OA 2W5AA 5GJFA 4O0SA 3V01A 3CKXA 4EZ3A 1YXXA 3AD6A 4D9UA 4GT5A 4MNEB 5CYIA 2VWVA 5BPYA 5KMMA 3IQ7A 2P33A 3QX2A 4NFMA 4L8MA 4BDFA 2W1GA 4DE4A 3KXMA 3IW5A 2PUIA 4Y95A 1H01A 4S34A 2CN5A 2C3LA 4AE9A 2C6TA 1W82A 3GCSA 3VUMA 3NR9A 3KRRA 3QQFA 4FT5A 4NM7A 2XANA 3BL9A 4O7LA 5HX6A 3LCDA 3LJ0A 4H1MA 4XNEA 4KBCA 4F1TA 4BBEA 1KV1A 4RIOA 3SXFA 2XBJA 4MXOA 4FC0A 3CY2A 4JS8A 4W4XA 4XX9A 3F66A 2J2IB 2WIHA 3AC5A 5FM3A 2XKFA 4FGBA 4CFVA 4TPTA 4RX8A 4FIFA 4UB7A 3NRMA 4GK3A 1B38A 1U5RA 4FSYA 4GCJA 4IADA 3R30A 1REKA 5AP5A 5AR3A 5K4IA 5FTGA 2QU6A 3EYHA 4F9AA 1Q5KA 1H28A 3LCTA 4WT6A 3MFSA 3B8RA 4U9AA 5D1JA 3VNTA 3G5DA 5HKMA 5LMBA 2W1EA 2W1DA 3UQCA 3NMUF 2OGVA 5CNNA 3RAKA 1GAGA 4L67A 2R0IA 4WA9A 4FV6A 4MXYA 2C5VA 5JGDA 4YU2A 1Y6BA 5FEDA 3PG3A 4BN1A 2O5KA 2IEWA 5ACKA 1JKKA 3FPMA 3WZUA 3FKLA 3UC3A 4QYEA 2G1TA 3ORPA 2XP2A 4R7HA 4F9BA 4BR3A 4W4WA 2AC3A 2OJJA 3KCKA 4M66A 3MSSA 3C7QA 4ID7A 1REJA 1F0QA 3HV7A 4TNDA 4FIJA 4E5AX 4TNBA 1Z9XA 1ZZ2A 1V1KA 4XG6A 3CPCA 4BGQA 1KOAA 2B9HA 2BFXA 2YA9A 5CASA 5CEMA 4AGUA 3R7GA 4RIWB 2R5TA 4HCTA 2X1NA 4C33A 1JAMA 3A60A 4BTFA 3G0EA 3P0MA 2VNWA 4PUZA 5DEYA 4O4EA 4F0GA 5HLPA 1PXLA 4UMPA 1Y8GA 4EZ5A 5L8LA 3S1HA 2V55A 4TY1A 5AR4A 3SG8A 4XYFA 3SVVA 1H1SA 4TRLA 4X2JA 4C2VA 5IQCA 1ATPE 1MRYA 3UDTA 2I40A 4RFYA 2VUWA 3HECA 2JDOA 3AMYA 5CT0A 4ZK5A 3S4QA 4I3ZA 2IG7A 3ORTA 2CKEA 4A4LA 4XJ0A 3Q9XA 4EEVA 5D11A 4RZWA 2BZKB 3MW1A 2X0OA 5BVOA 2AUHA 4NJDA 3R1YA 5EK7A 5AAFA 4LG4A 1B6CB 5G1XA 3PA4A 2PK9A 2YZAA 4BKZA 3IKAA 4R8QA 3KF4A 3BLQA 3KULA 5HHWA 3O2MA 5EH0A 2OF4A 3MVHA 1QCFA 3H9FA 3FKOA 4KINA 4FTOA 4D0XA 4RJ7A 3D14A 4IQ6A 4D0WA 4ZY5A 4G17A 1ERKA 2JIIA 4BF2A 4E4MA 4F63A 4QQTA 3NUSA 3PJ8A 3E63A 3AC1A 4PMSA 3BE9A 3NVMB 1YXTA 4FT9A 1WVYA 3QZGA 4TYHB 2CSNA 2QURA 5FTOA 4QPSA 4AA0A 2Z60A 2PE2A 3O7LB 4TT7A 3GU6A 2R3KA 2G01A 4LOQA 3IW6A 4DFLA 3F7WA 4KIQA 3V8SA 4RJ4A 4G5PA 3EQDA 1KE7A 4ACHA 3F5XA 2CLQA 2WNTA 2X0PA 3DBDA 3P86A 5J9YA 5IQEA 3SLSA 4GU9A 3M42A 1OPLA 5HTCA 2CLXA 4JXFA 3PXKA 3T9TA 4M13A 4CKIA 5FD2A 5B0XA 4EOQA 3A61A 4ZXTA 3OY3A 3RWPA 1Q41A 2BILB 2CCHA 3A7GA 2X8DA 4Q5EA 3HAMA 5JFWA 3UZTA 3PRIA 3ZLWA 3G6HA 2QOBA 5CF6A 4FV2A 4UALA 4OBQA 4C4JA 3QWJA 4I6BA 3R9DA 4BVUA 4CFUA 4F9CA 2CNUA 4O4DA 1ZYLA 3F5GA 3DBQA 4MXCA 1Q62A 5E9EA 2EU9A 2OSCA 1PKGA 2KTYA 4U79A 2X2KA 5DI1A 1OGUA 3C4WA 1YWRA 2JAVA 1XH4A 2OICA 3PPZA 4QPMA 5CY3A 4C7TA 3AC3A 3RAIA 1JSTA 2X4FA 4XV1A 5IH5A 3FLSA 2WEVA 2CMWA 2JDTA 2VO0A 4BI1A 5E1SA 3VHEA 4R1VA 4GEOA 5EOLA 4BKYA 2ACXA 2BDWA 2BR1A 2OK1A 4XLIA 1P4OA 2YITA 4O7VA 4P4CA 2HY0A 2WEIA 3W2SA 2B55A 3BPRA 3O8TA 4LQMA 2X0QA 2GNIA 2XM9A 3C0HA 5C1QB 3ZM9A 3OWKA 4O0VA 3C4EA 1YVJA 3JS2A 2JKQA 3U87A 5KBQA 3BU6A 1WVXA 1YOLA 3VS3A 4BCPA 4NCTC 4YJVA 5BYYA 5LVOA 4NM0A 5DA3A 1GNGA 3Q5IA 5EI2A 5HESA 1URWA 3TXOA 4EH7A 4RVMA 4XV3A 4NYEA 4WG5A 4I4EA 2VO3A 3EB0A 3SKCA 4DBXA 4XRLA 4CEGA 5JFSA 1JWHA 2O64A 2PMNX 2YM3A 5EM6A 3D94A 2YN8A 3FC1X 3IW4A 2C68A 2EXEA 3A7FA 1ZOHA 3EQBA 3NPCA 3H3CA 3PLSA 2AYPA 5AIRA 3WYYA 1NA7A 3R7IA 4KRDA 4UWBA 1WFCA 3FSKA 4FKWA 4JDHA 5KMOA 3C51A 5E8WA 5J87A 2JFLA 2YCRA 3W1FA 4EH2A 1BMKA 4D5HA 4PP7A 3QALE 3DDPA 4YZDA 5FGKA 4ZY4A 3UJGA 5EHLA 3ZUUA 2J51A 5TR6A 4IVAA 3ZRMA 2NO3A 3W0NA 2QR8A 4UMRA 1MQBA 1Q8ZA 3E7VA 2UW3A 3KFAA 4IWOA 4BKJA 4RX5A 5LWNA 4EK6A 4FG7A 1P5EA 4BWXA 4CSVA 5LARA 2WMAA 3D7TA 4G16A 1R1WA 3RPSA 4DLIA 3TUCA 3NYXA 2UV2A 4UV0A 2X7OA 4NU1A 3SD0A 3G33A 5DYJA 2X4ZA 1ZYJA 3KMMA 5BMMA 1YDTE 4NT4A 4Q9ZA 3PLAE 3KRXA 3COHA 4FKOA 1SVEA 2YIWA 2DWBA 1SZMA 2P2IA 3CGFA 4FICA 4FK3A 1ZRZA 4DH1A 1E9HA 2G15A 2VRXA 3W2RA 2HYYA 4CMUA 5E8ZA 3ACJA 1W2DA 5EYKA 4QEBA 2C30A 2C6EA 2J7TA 3AC8A 4XP2A 4ANNA 2UUEA 3UOKA 3V6SA 4FUXA 3BWFA 4WNKA 4IBMA 5IUHA 2QOHA 3OCSA 2PL0A 3OWJA 1UVRA 3FWQA 3FZTA 3II5A 3IONA 5D9HA 3CKWA 4J99A 3MTLA 5HOAA 5I3RA 2PVLA 4A7CA 2UVZA 1IRKA 1GIIA 3DK7A 5GHVA 4N70A 3Q9WA 4DEIA 5JT2A 3I7BA 3EKNA 3EN6A 4BDIA 3COMA 3KULB 3EL8A 5J7BA 4ONAA 3DTCA 5J1VA 4PNIA 2A19B 3NCGA 4LL5A 3E8EA 2C1AA 3P78A 3FYJX 4IX5A 3QYWA 4I22A 2IWIA 3R63A 3PJ3A 1W2CA 3L9LA 1JPAA 5TF9A 5HU3A 2CPKE 3BHYA 3UNZA 4C37A 4MXZA 5IA2A 1M14A 5CU2A 1UWJA 3Q4TA 4DEEA 1PMNA 2G2IA 4H3QA 4J98A 4KA3A 3POZA 1FGIA 4I0SA 1LEWA 2W96B 3TZ9A 2X0GA 3JPVA 2XKEA 2PPQA 1IA8A 5I9ZA 4G3GA 5GIOE 5K0XA 3VS7A 4AUAA 4BCIA 5AR7A 3PY1A 1S9IA 4FUYA 2GNFA 4DGMA 4C3FA 1H1PA 2OZAA 2WZJA 5DT4A 3H9RA 5FRIA 3N4VA 3PUPA 5FBOA 3K5VA 1PF8A 1PKDA 4FEUA 4BL1A 4MD7E 5FEQA 4ZLOA 5CEOA 4CTBA 2GS6A 3P23A 1XH9A 4A9TA 5BUIA 4MWIA 3QRKA 3EL7A 3IS5A 5JGBA 3C50A 5CEQA 1F3MC 3RNIA 4CD0A 3BE2A 4OTQA 3W0PA 4FTKA 3NNWA 4EOLA 2G2HA 1UA2A 3ML1A 4DEHA 3VHKA 4HZSA 1BUHA 4JBOA 4IX4A 3MPAA 4I92A 4FV7A 2B53A 4AW1A 3OMVA 2Y8OA 4FV3A 4GYIA 5C03A 5AV2A 4O7NA 3PZHA 5ANEA 4K11A 4FL2A 2BTSA 3F3UA 4RC2A 3ELJA 4E1ZA 2OW3A 4DTAA 1WBOA 3DBFA 3A7HA 3DOGA 2A0CX 4FT0A 1QPCA 3ENMA 3L9PA 2IZSA 3OCGA 5ETAA 1G8AA 4CFFA 3CR0A 5EI6A 1PXKA 3GC0A 5IISA 1A9UA 3MESA 3BX5A 5CEPA 5L8KA 2R3FA 5TOZA 2ITQA 2QQ7A 2XJ0A 5L2QA 4DCEA 2OJ9A 3NNUA 5DT0A 1GIHA 3QTUA 2W4KA 4XOYA 3TNHA 5KMIA 4RG0A 2VWWA 5CVHA 4YPDA 3Q9YA 4XEYA 1P2AA 3TNWA 3A4PA 3K2LA 4AF3A 5A4LA 1ZY4A 1WBTA 3COIA 4ITIA 4USFA 4F65A 4F7LA 3FAAA 3PRFA 3QXPA 4OTFA 3TKHA 4FV8A 5EYDA 4G2FA 4TWOA 4WSYA 2IVSA 3VF8A 2O2UA 5HCZA 3VBYA 4FV1A 5JQ8A 3PWYA 1XJDA 3NUPA 4X3FC 2WQOA 5M4UA 4K8AA 3AG9A 5D7AA 2C3JA 2GTMA 2GSFA 3R6XA 5AP0A 3BU5A 1OL2A 3DLZA 4FBXA 4QNAA 5G6VA 1O9UA 1Y8YA 1WAKA 4EOOA 4F08A 3V04A 3BBTB 4YPSA 4MK0A 3E87A 4FRFA 4EKKA 2ITPA 2PVHA 1H8FA 4AG8A 5HU9A 4O7SA 3OOMA 5HNIX 5IPJA 3QTSA 5E90A 1YQJA 5FP6A 4J97A 4M68A 4YHJA 4Y46A 5DOSA 3RINA 4DHJA 1DI9A 4O0XA 4E6DA 3SOAA 1YHWA 4AXAA 3PXFA 5CNOA 1U54B 1UKIA 2UZDA 2YJRA 5CLPA 4Z7GA 4TXCA 4NH1A 3LLAA 4YHFA 5AP1A 3UOJA 4DFBA 4YSMA 3ATTA 1JVPP 3NW6A 4OTWA 2YDKA 4F1OA 3SQQA 1PYXA 4IJ9A 5DH3A 4DFZE 4AT3A 4E4XA 4B8LA 4YMJA 3ENHA 1PMVA 4CFWA 4RIYB 4D2VA 2NYAA 3D15A 3KVWA 3QQKA 3O71A 4RPVA 3ZSHA 4YJNA 3W0MA 2ESMA 4J53A 5KX8A 1SYKA 5A4TA 3DXPA 3TMOA 3R01A 5CQUA 2ZVAA 3GFEA 2R9SA 1KSWA 3ZBFA 3HYHA 4PDPA 1WVWA 5ETIA 4YNEA 1JKSA 2WMSA 4X3JA 4PP9A 4BDAA 4EH4A 2GDOA 2ZV8A 3KB7A 2OXDA 1VJYA 4IB5A 1M7QA 4FODA 5EKNA 4NWMA 1YDRE 1GOLA 5ANOA 4O7TA 5HX8A 4D4SA 1P4FA 2OJGA 2B54A 3BELA 3NUUA 2YEXA 3KA0A 1TZDA 3Q9ZA 4ZIMA 4YZNA 3PXZA 3O8UA 4O0UA 4RQKA 4O0TA 5IA0A 2JDRA 1UNHA 4AW5A 2ETKA 3VBXA 2AQXA 4IACA 2BALA 2XM8A 3ORIA 4R78A 1FPUA 2XB7A 3JY9A 4HVIA 4L45A 4FEXA 5EW8A 5HE2A 1Q24A 3CS9A 2XAMA 5LMKA 3QLGA 3TKIA 4ZEGA 2UW9A 3PXYA 3R1QA 4XS2A 5DE2A 4EHGA 3DBCA 4BFMA 1OBGA 3D5WA 2ZV9A 4TWPA 5CWZA 3FMJA 4FVQA 2WPAA 4B7TA 3EQRA 4DA5A 4TWNA 3WZEA 4DTBA 2W4OA 2YM5A 4OUCA 3E62A 3GOPA 3F61A 2IVVA 1GIJA 2BAQA 4ZS0A 2QD9A 2ERKA 2IJMA 4K0YA 4IWPA 3ZXTA 4IX6A 3UGCA 4HZRA 3GU8A 3P5JC 3R28A 4WRGA 3SW7A 4AXEA 5EDQA 3FL4A 4QMWA 5EKOA 3S00A 5H8GA 4L43A 3U6IA 1YHSA 2X9FA 1PXJA 4L3JA 4FE2A 4LUDA 3RK5A 3TTIA 3LJ1A 3VUHA 2RFEA 2UZLA 2O8YA 2BROA 2XF0A 2C0IA 4F6SA 4EH5A 1BI8A 4LL0A 4RA5A 2R3RA 4L3LA 2WHBA 4X2GA 4FV9A 4N57A 5HBHA 3OROA 2UW4A 4Y83A 3EWHA 2Q0NA 3VAPA 4C59A 4YSJA 2F2CB 2NRUA 3PE1A 3HV4A 2WTDA 4EK5A 3R02A 4EL9A 2FSOX 1BL7A 2PUUA 4IM3A 5E8VA 4XHKB 1XBAA 2EXCX 4C34A 4CYJA 5KE0A 1OMWA 4NM3A 4J8MA 4NKSA 3BBWA 3QC4A 4XG8A 1UU7A 4CKRA 3O8PA 4ZJVA 4C3PA 2BAJA 5JZJA 3LFCA 5C01A 2Y6MA 3SGCA 5B7VA 3I1AA 4O4CA 4FKPA 4KABA 4KNBA 5DHJA 5BVEA 4D2TA 2I0HA 5HICA 3AQVA 3KXGA 3ERKA 3BWJA 3FXZA 3PP0A 2ITTA 4DTKA 4AWIA 3R8VA 1ZXEA 4G1WA 2EB2A 2W4JA 5DWRA 5F1ZA 2RIOA 4QTBA 5AUYA 3KF7A 3RPRA 4FTUA 4O1PA 1UNGA 3C4ZA 4F7JA 4QPAA 2PVJA 1Q3DA 4G6OA 5CF8A 1FOTA 3VN9A 4JL9A 5DR9A 5I9YA 2GCDA 1OKWA 2W1HA 2Y4PA 3KCFA 3OBGA 4HNIA 4QMTA 3OG7A 4R1YA 2FA2A 1SM2A 3OCTA 4C62A 3FLWA 4QP2A 1XH8A 4MNFA 2RL5A 5EM5A 3KXZA 3NX8A 2WAJA 4C35A 4IDVA 2YDJA 5LVLA 2W7XA 4DHZA 3GEQA 4FEVA 3TIYA 4U80A 1UNLA 2HAKA 2IPXA 3QA0A 4U81A 4APPA 4RT7A 4IFCA 4E7WA 2C6MA 1PW2A 4WHZA 4DEBA 4S33A 2EWAA 4GVAA 2HZ0A 4RSSA 4FIHA 2OH0E 3WBLA 4V0GA 2EUFB 2WQMA 3GU4A 3F82A 2I6LA 3FY0A 4HPTE 4NM5A 3ZO4A 3MFRA 3HAVA 4GW8A 1F5QA 2H96A 4TW9A 1NT2A 3U9NA 3V5LA 2WTCA 3AC4A 3E92A 5HIDA 4UMQA 4KUJA 2NRYA 3ORMA 4C4GA 4EH8A 2R3LA 3PWDA 4C2WA 4HVDA 3HRBA 4J52A 2YACA 3R8PA 3DAKA 4TYJA 5CX9A 4NTSA 5AUZA 4U3ZA 4WD5A 2J5FA 3Q6UA 4L46A 4X7QA 4YJQA 2C3IB 1RDQE 5J9LA 3RKBA 3DAEA 1YI3A 2WQBA 3DB6A 3GC8A 4FTIA 1TQIA 3P4KA 2R3IA 2I1MA 3PSBA 4FSZA 4ENXA 5IQFA 3F88A 5CAVA 5IEVA 2RF9A 4QYHA 4EWHA 5EQEA 5IQBA 4O96A 4RX7A 1L3RE 3EN7A 4YTIA 5CXZA 1DI8A 2BMCA 5HG7A 3QD2B 2F7ZE 2XNPA 3ZLXA 3IOKA 4FZ6A 3F5UA 4C02A 3U6JA 3FI4A 3TI1A 3EIDA 2CN8A 3ZSGA 1OL5A 2CDZA 2LGCA 3TV4A 3W18A 3BYVA 2QCSA 4YZMA 3IOPA 5EQYA 3ZFXA 4EC8A 2YLEA 1ZYDA 4FEQA 3HUCA 3TUDA 2QO2A 3O50A 2XAOA 1CM8A 3DJ5A 3QCQA 3V5QA 5KO1A 2VX0A 5C8MA 2JC6A 4GKIA 2ZB0A 1Q8UA 1TVOA 3FKNA 4Y5QA 2OJIA 2W1FA 5HG8A 5BUJA 4EHZA 4LV7A 3QZFA 4FTMA 4IAFA 1Q4LA 4BDGA 4KS7A 4QT1A 2NP8A 3I4BA 4YJSA 2BPMA 3ET7A 1O6KA 3LIJA 2PMOX 4BTKA 1BLXA 4O22A 3VS0A 4TTHB 4AU8A 4RLLA 3VONA 3IG7A 2YCFA 2GU8A 5TT7A 3WOWA 4R77A 2QOKA 3PVBA 3RK7A 2CGVA 3P5KA 2GHGA 3RMFA 3TN8A 5CAQA 3ROYA 1UU3A 2V5QA 4MBLA 5CANA 2YFXA 3DKGA 4U5JA 4WRSA 3A7IA 3F2AA 1OL7A 3EZVA 3GQIA 3HP5A 3LJ2A 5EQPA 3HZTA 2XUUA 4AP7A 1PJKA 3F7ZA 2YJSA 4XBUA 5JRQA 3DNEA 2GQRA 3EQFA 4CG8A 5I0BA 2GQGA 3ZO1A 3TL8A 3K3JA 3MVJA 1OKZA 2XS0A 4L52A 2VTQA 3EFWA 2H6DA 3ODYX 2WTKB 4KIOA 1V0BA 3FHIA 4U7ZA 3RZFA 4BCFA 3ODZX 4IC7A 4ASEA 3GFWA 2GS2A 3HV5A 4L44A 4AZEA 5IUGA 1ZLTA 4O7YA 4ALVA 4E3CA 4PF4A 4UXQA 1W84A 1J7LA 2VD5A 1M52A 5E8SA 5KUPA 4JAIA 5CEIA 4YJRA 3FQHA 3GU7A 3MYGA 2RFNA 5FXRA 3V5WA 2W05A 1OKVA 3DU8A 2E9VA 2CNVA 5EOBA 3DA6A 3BV3A 3SXSA 2HZ4A 3UG1A 3FLYA 3GCUA 5HLNA 2NNWB 4IEBA 4FYOA 4D1ZA 4IC8A 3EFJA 4F09A 2YHVA 4FKQA 4FTJA 4BHNA 2ZM1A 5I9XA 2GNHA 5HCYA 4BGHA 1MRVA 3OUKA 4L42A 4X3FA 2YIYA 1YRPA 2BTRA 2IO6A 1GY3A 3HDMA 2WQNA 3QL8A 3HMOA 4FKVA 4ASDA 4N4SA 4AFEA 2WELA 4FL3A 4CFNA 4M67A 3FXXA 3Q3BA 2XIZA 4G9RA 3VRZA 4UN0C 5AJQA 3JVRA 4C3RA 3FMEA 4M0ZA 4BDHA 4I24A 1Y57A 1U46A 1JOWB 3HX4A 1MP8A 4FTRA 3PY0A 1YI4A 3UMXA 3ZYAA 5HE1A 4P5QA 4EH3A 5AADA 3DXQA 2QO7A 3TG1A 2R7IA 3EHAA 2WTWA 2OXXA 3RPVA 3VJOA 5HD4A 5TKDA 4BYIA 4AOJA 4O86A 4AAYA 4Q5HA 5H8EA 3NNVA 3HMPA 3IDPA 4K77A 3W10A 3PUFC 3LMHA 5M4CA 4FTAA 4AZVA 4O1OA 5CSPA 2ZJWA 4QRCA 5A46A 1DS5A 2C6IA 3E8CA 1R39A 4C0TA 2PVNA 3R21A 1NW1A 4QYYA 2H9VA 5D12A 4K33A 4U0IA 4TWCA 1OB3A 4G3DA 4FTQA 1DAWA 1VLRA 5AEPA 3ATSA 5JFXA 3FI3A 5BMSA 3LFDA 3CBLA 3R00A 4AW2A 4CGAA 4ZSGA 1PMEA 2VTPA 3PJCA 3QU0A 4TKSA 3AGMA 4UWCA 4KSPA 2CJMA 4EOMA 5ACBC 4JT3A 2WTJA 2X6DA 3ULZA 1IG1A 2QLQA 2C0TA 4YZBA 3R8MA 4B0GA 2XEYA 5GJGA 3AXWA 4FG9A 1SMHA 3KMWA 5CF5A 1PHKA 2J0KA 3KY2A 2B9IA 1JSUA 1URCA 3PYYA 3EQGA 3I0QA 2PY3A 1XHAA 4QMOA 5TO8A 2J0LA 3VW8A 4K1BA 4HVGA 4BDEA 3DKOA 2BAKA 3LXLA 1W8CA 4QMXA 3ZFMA 4A9YA 5M08A 3QD0A 3E5AA 4YC3A 5CZHA 4CV9A 4DFYA 3HKOA 4L7SA 5HO7A 2GQSA 4RLKA 3DKFA 3VVHA 1K2PA 3E64A 2X81A 5AUWA 3R9OA 5C8KA 1I09A 5IMEA 2C6OA 3U4UA 1STCE 1Y91A 4XV9A 5HVYA 4QDEA 3D9VA 3W0OA 4KKEA 4MQ2A 1CKPA 1OPKA 5L6WL 4FZFB 3NYNA 3HV3A 4LOPA 3CLYA 3V5TA 3VF9A 3JY0A 2PZRA 1R78A 3QRTA 2VTJA 3R0TA 4L53A 1U5QA 4U44A 5EHYA 3BU3A 3RNYA 3KMUA 2ZV2A 4CT2A 5KBRA 1XH7A 5AMNA 2YZLA 5HG5A 1ST4A 3BLRA 3KGAA 2WXVA 1H25A 3VQHA 4KAOA 3PPKA 3EN9A 4PDOA 4AGWA 3IDCA 3NFFB 2ONLC 3N51A 2F9GA 4EOSA 4ZTHA 1Q8WA 4ERKA 2XK3A 3AMAA 4I6QA 1QL6A 3VS6A 2WMTA 4QP6A 3CQWA 4E6CA 3QQLA 3RP9A 4YNOA 3PA3A 4GUBA 2PSQA 4FKUA 4E6AA 3KN5A 4QQCA 5CU4A 4HGSA 5K9IA 4ZJIA 1FMKA 3MWUA 4YTFA 2R4BA 3FMMA 3W8QA 4YURA 5LJJA 1J7IA 2H8HA 2BDFA 2FH9A 4HNFA 2W1ZA 3PY3A 3U51A 3VIDA 3MH3A 4QTDA 2ITVA 5DEWA 2C4GA 2P0CA 5A4EA 2VN9A 3NAYA 4A07A 4DDIA 5FXQA 5HBEA 4XMOA 2VO7A 1JQHA 4IZ7A 3UOHA 3KKVA 2B0QA 3IW7A 1OM1A 4X6QC 3R7OA 1ZMWA 3ROCA 2QU5A 3EQCA 2YAKA 3F3VA 1IASA 3ITZA 3ZRLA 5LWMA 3QKLA 4NK9A 5FG8A 2WTIA 5HO6A 1JKLA 1QPEA 2W9ZB 3R2YA 4I0TA 4HYIA 4IM0A 4DH5A 4J95A 2PULA 3NAXA 3D0EA 2VX3A 4L00A 3NIZA 4K6ZA 2BZIB 4FKRA 4UMUA 3L9NA 1OIYA 5GZAA 5C4KA 4YC8A 5E8YA 5M06A 4RVTA 4AACA 3MS9A 3BLHA 1Q3WA 3IGGA 2QHMA 3NEWA 3GGFA 4NW6A 4ASXA 2JIVA 3CIKA 4IANA 4RWKA 1JBPE 4ZZNA 4FZAB 1JSVA 2WTKC 4U43A 3SC1A 5LVPA 1FVTA 4DG3E 5I9UA 3C5IA 3NDMA 4YJUA 4QMLA 1WCCA 1OVEA 3OOGA 3FLZA 2XVDA 4R7IA 5L3AA 3D7ZA 5JSMA 3QX4A 3R7YA 4ENYA 4FGRA 5FUTA 4M12A 5GIPE 2IF8A 4RVKA 2BFYA 2ZDTA 1W83A 4AZSA 3FEGA 1QMZA 5EM7A 1GJOA 4KRCA 3OFMA 4M8TA 4HYUA 5CZIA 4AT4A 5CAPA 4EQCA 2BRMA 2P55A 1H0WA 4PPAA 4RVLA 2X7GA 1K3AA 4EH6A 4DFUA 1UU8A 1UV5A 2VTIA 3SDJA 2XJ2A 3QRIA 3CJGA 1Z5MA 3OY1A 4D9TA 4JJRA 3GI3A 1Q8TA 2RGPA 4AZWA 2O0UA 2HCKA 2XZSA 3I81A 4GFMA 4X2KA 4USEA 3IDBA 4YGAA 1XKKA 4E93A 3MI9A 4XG9A 3K5UA 3LFFA 3CEKA 3I5ZA 3MJ1A 4X2FA 4YP8A 4FZDB 5HNBA 5T68A 3MBLA 2R2PA 4EWQA 4FA2A 4HW7A 4ZMEA 2AC5A 4CQEA 4U3YA 1OITA 4EI4A 3SW4A 3NSZA 3KXNA 2BDJA 4LV8A 5GZ8A 5JK3A 4ZTSA 4DH7A 4FOBA 3UQFA