4A9UA

Crystal structure of human chk2 in complex with benzimidazole carboxamide inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
304
structure length
287
Chain Sequence
MSVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKDPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Benzimidazole Inhibitors of the Protein Kinase Chk2: Clarification of the Binding Mode by Flexible Side Chain Docking and Protein-Ligand Crystallography
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
total genus 90
structure length 287
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a9uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a9uA01
4FIJA 1H07A 1P5EA 2XCKA 4MCVA 1WVYA 4MEDA 2O2UA 5JRQA 2F2UA 4YTHA 2WMBA 3I81A 2I1MA 4UMUA 5AP3A 4BCJA 3H9RA 4FZ7A 2B9IA 4YSJA 4WBBB 4JVGA 3K5VA 2ZM3A 5JSMA 4GV1A 4CRLA 4ZJVA 3HUCA 3EH9A 1PW2A 1V1KA 2H9VA 5FTGA 3NYOA 5CNOA 4CXAA 3F7ZA 3FZSA 3VUDA 3MI9A 4A9YA 2PWLA 5CYIA 4YR8A 3JPVA 4KABA 4KS8A 4NW5A 4FZAB 4IZYA 3WF7A 4IB1A 4C4JA 4RRVA 4EBVA 3CGOA 4Z9LA 4FIGA 1H1SA 2G2FA 2KULA 2QOOA 2YZAA 5BVFA 3E8DA 4EOPA 3R1YA 4D4RA 3V01A 4QTEA 2CNVA 2B9FA 4IM3A 3RALA 4AF3A 4G3FA 4TYHB 1H01A 1PKGA 2ITWA 4M0YA 2ITNA 3GU6A 4PMPA 4BKJA 4FKVA 4D28A 3POZA 4QP2A 4FYNA 5DYJA 4J53A 4Q9ZA 5JT2A 3RNIA 4QOXA 3PA5A 4GEOA 2C69A 2YAKA 1H8FA 4XLVA 5AEPA 3V51A 2HY0A 2YHVA 1JVPP 3MJ1A 4K18A 1UU8A 4QP3A 3T8OA 2BPMA 3VS1A 3NUSA 4E3CA 2XIKA 3ENHA 3UNJA 3U55A 3IW5A 2A4LA 4BKYA 4TN6A 4JDIA 4BWKA 4TYEA 3EN9A 5FM2A 3ANQA 4RSSA 3NW7A 3RAIA 3VBYA 3V3VA 4DYMA 5JGDA 3DK6A 1REJA 5LVMA 3MFTA 3FY0A 4LL0A 2JLDA 3HAVA 3O8TA 4FSYA 2R4BA 3SD0A 5AA9A 3TN8A 2H8HA 3CCNA 4FV3A 5M08A 3CIKA 2JFLA 3PZHA 1OUKA 5E8WA 1GZKA 3NWWA 3GP0A 1M52A 3TV6A 3E3PA 2P3GX 5DR6A 3QXPA 1A06A 5EG3A 2HZIA 4BY9E 1G5SA 1XQZA 3FQHA 2RG5A 3QTUA 4NJDA 3OCTA 4K6ZA 4RG0A 3QCYA 3KN5A 4OTPA 4CT1A 4L9IA 5I5ZA 4BC6A 2B1PA 3KL8A 3UO6A 5IQDA 4KIQA 4XUFA 4V01A 1OZ1A 2Q0BA 3MJ2A 1Q3DA 1DAYA 4TWPA 4WIHA 4F1MA 5EQYA 2J0JA 3ORNA 5L6OA 3C4XA 3OMVA 3GUBA 2QQ7A 4GCJA 5L8LA 4ANNA 3D94A 3E8NA 2GNIA 4C3FA 2F49A 3CP9A 3D83A 4AN2A 2VZ6A 3MN3A 4FTAA 5TE0A 3DK7A 4QMNA 3ZMMA 2R3LA 4XG4A 4GFMA 4WOVA 4DF3A 3OS3A 2C0IA 4YTFA 4JG8A 2I7QA 1LUFA 5IUHA 1ZZLA 4DTAA 3HP5A 4HGTA 3UVQA 3A4OX 2V22A 4ZP5A 2PVMA 4B4LA 3HRCA 2Z02A 1E9HA 4RFZA 4FVPA 4C4IA 5AA8A 4AAAA 3BYVA 4L53A 3RM7A 5IEYA 2QOCA 3T9TA 4CZYB 5IH4A 4DT9A 2GNFA 3IW4A 5LQFA 5IA2A 5IQGA 4RX8A 5F20A 1GZNA 3DXPA 4JT3A 4RJ6A 4AN9A 2BZKB 5IEXA 4UALA 3NCZA 4ZXTA 3VJNA 1UWHA 4QP4A 3WF5A 2ZDTA 1O9UA 3CTJA 3V5WA 2QKRA 4J96A 4D58A 3G0FA 4G6LA 5CAPA 4FTJA 1K3AA 3DDPA 3CKXA 3BHHA 4AE6A 3R8MA 2FB8A 2WZJA 2UW9A 2B53A 3MVLA 5AUYA 5DIAA 2F57A 2I0VA 3QC9A 2BRBA 5ETIA 5EDPA 1UU3A 2QO2A 5B2MA 3EB0A 4YO4A 2QURA 5ACBC 4IIRA 5A6NA 5GZ9A 3K3JA 4YPSA 3ZO1A 4FA2A 2UZLA 4F9BA 4DA5A 3FEGA 1Q5KA 1KOBA 3B2TA 3ETAA 2WHBA 4LOPA 4PPAA 3CJGA 4PY1A 2CGUA 5HD7A 5CQWA 5E7RA 3W10A 4DFZE 5IU2A 2XEZA 2V0DA 1ZYLA 2W5BA 1PHKA 1OECA 1PYEA 4IZAA 4DEGA 4YUQA 4TT7A 5E8TA 3HAMA 5CI7A 1YWNA 4DGOA 2YIXA 1H1PA 3CTHA 3F6XA 3UC3A 4GVAA 5EYKA 4EWHA 3EN5A 4HJOA 3WILA 4EEVA 3WOWA 4RJ5A 3CR0A 3HV7A 4YU2A 3R9DA 3BQRA 2G2IA 3LFDA 2IZUA 4LRKA 3NS9A 4YJQA 4DG0E 5KKRC 4AXAA 4PMTA 5H2UA 1YQJA 3EN4A 5TO8A 1B6CB 4UWBA 2YJRA 3DV3A 4O27B 5AP6A 5K5XA 4AA5A 2HYYA 2JIVA 4EI4A 1OKZA 1JSUA 3COKA 3ULIA 2GNLA 3MB6A 4I94A 5A54A 3QTWA 4UYNA 4BCFA 2WGJA 2CCIA 5DFPA 2J90A 3MB7A 5IZFA 4YZBA 4CQEA 2YDKA 3AC8A 2PYWA 4PF4A 3QA8A 2WTIA 3HL7A 3GBZA 3TJCA 3ZEWA 2J5FA 4X3FA 4IX5A 4C0TA 2X8EA 3L8PA 4EHVA 1GIJA 4CQGA 5A6OA 2OG8A 3ZRLA 1VJYA 4XCUA 4D1SA 1PXIA 2OJ9A 3BLRA 3QU0A 3O23A 4RVLA 4D9TA 4FV6A 5F95A 4AGWA 2W96B 3R8ZA 1TQPA 4R5YA 2O0UA 3PPZA 3S0OA 4YZ9A 5DT4A 3NSZA 3TUCA 2XS0A 1XBBA 4XG6A 3OUKA 4D1XA 2OI4X 3PSDA 3F3VA 4L6QA 4QTAA 5JEBA 1UVRA 4LRJA 3G9LX 4ZY5A 5IA4A 3HVCA 2XK7A 1IAJA 2B55A 4L8MA 3HGKA 4FUYA 3G33A 4BCNA 4ASZA 2IVUA 4L7SA 4I5MA 2ZV8A 4C61A 4M66A 4BWPA 3O7LD 3SVVA 2VD5A 4GUEA 2WTCA 3EZVA 2ERKA 2QO9A 4IWQA 4OTQA 2BCJA 4DFYA 5HZNA 1H1WA 5AAFA 3ROCA 5HTCA 4FK6A 4F1TA 4CLIA 4YSMA 2WMXA 3HMMA 4BCQA 1GJOA 4FNZA 2R3RA 1PMVA 2RL5A 2PUUA 3CC6A 3OHTA 4XEYA 1F5QA 4M3QA 3WZDA 4FSTA 5BQ0A 4U3ZA 3RTPA 5GIPE 5JZJA 5AUVA 2YZLA 4AZFA 4GU6A 2AUHA 3MW1A 4DCAA 2J50A 3IW8A 1Q3WA 2F4JA 3HEGA 2ZB1A 4RIXB 3WF8A 2CKOA 4JAIA 4R6VA 3WZJA 3NDMA 2QLUA 2OLCA 3RK9A 3PE2A 4D5HA 2YCFA 2EB3A 4E5AX 4MBJA 2YM5A 5CAVA 4YBKA 3LCDA 4EORA 1O6KA 3FI4A 3OXZA 5JGBA 4DEAA 4O0YA 2VX0A 3D2IA 3Q4ZA 3O96A 5JRSA 2X1NA 1UU7A 2XKCA 1E1VA 4Z3VA 4UY9A 4XG3A 3UVPA 2ERZE 2UVXA 4M8TA 4UMQA 2ITTA 4G1WA 4TYIA 3QUPA 5IQEA 3EIDA 4C36A 2WMUA 4WHZA 1Q99A 2OICA 2JITA 3D7ZA 3KVXA 3WYYA 3F3UA 5CSPA 2GQRA 2C30A 2QNJA 3NPCA 5AM7A 2XKFA 4ZTHA 4AE9A 4D0WA 2OJGA 2PVHA 3TNWA 4ZMEA 2QOIA 3ZO3A 1VZOA 3AD5A 5DN3A 3VW8A 2JDTA 3LHJA 4W4VA 2W9ZB 4PNKA 3N9XA 5CS6A 2R3IA 4DFXE 4QMOA 4XH6A 1BX6A 3VF8A 4F4PA 3PSCA 3P4KA 2SRCA 3C5IA 2HIWA 3DQXA 3REPA 2P4IA 4NM3A 4BVUA 2YISA 4D4YA 1XO2B 3CTQA 5TR6A 1WBOA 2QOLA 2Y0AA 5I9XA 2OO8X 4QMUA 2PPQA 4RWJA 3AQVA 3GC8A 3UTOA 3DU8A 1QPJA 4DEIA 4HVHA 2YA9A 2VN9A 4G3CA 5C26A 3PA4A 4OR5A 4USFA 4O2ZA 1J3HA 2XNPA 4CKRA 1AQ1A 2G01A 1BKXA 4QMVA 4FR4A 1X8BA 4NM7A 4FC0A 3QWKA 3DJ5A 4JXFA 3W16A 3RZBA 4PTCA 4S2ZA 4RBLA 4G31A 4ZTSA 2GFCA 4FV1A 1OBGA 3ACKA 5T68A 4F0FA 3ZZWA 2XNOA 3R02A 4XRLA 5CX9A 4WBOA 4OUCA 4QRCA 4DT8A 2P2HA 4IWDA 4KKHA 4LG4A 3BGPA 4XHKB 3DXNA 3L1SA 3OFMA 3IO7A 2PMIA 3QD4A 5JZNA 4C33A 5HO6A 4ASDA 2ITVA 1OL2A 2C47A 4BDKA 4JQ8A 3CD8A 2F9GA 2WU7A 5IH6A 4CCBA 2IWIA 2WAJA 3BBWA 3GCUA 4CT2A 2J5EA 1KUTA 4X0MA 3CPCA 1FINA 3HYHA 3I1AA 1JBPE 3PFQA 2ZV2A 4RZVA 5ANDA 4H3BA 4YJTA 5HEZA 3RMFA 5IISA 4PNIA 2GCDA 3DZOA 4MHAA 2OGVA 4H1JA 2I0YA 3KXMA 2C3JA 2CGXA 3MVJA 4UEUA 5ACKA 4DGLC 4FKTA 2CNUA 3R7IA 3VRYA 4NYEA 4FTIA 4ALVA 4NL0A 3NUXA 2QR7A 3BHYA 3PY3A 4MF0A 4N6YA 4O21A 2XP2A 2FUMA 3FMJA 3HV4A 3QCQA 4JQEA 2OH4A 4CKIA 5GZ8A 3UIUA 1GZ8A 2HWPA 3VBXA 2X2KA 4QYHA 3FMLA 4X2NA 3S4QA 2C6DA 4RJ7A 4RVTA 2VO6A 4GFOA 1JQHA 2WB8A 3TDVA 3AMBA 3P9JA 4N57A 4DINA 2C4GA 2W0JA 3WI6A 5LOHA 2HXLA 3FKLA 3V5LA 3SC1A 5KCVA 4GYGA 2J51A 4PMMA 1JOWB 5CF8A 4W9WA 2LGCA 5HI2A 3EQDA 3ELJA 1ZWSA 2VTPA 5AR2A 5EM8A 2QOQA 4WSYA 3C0HA 2QHMA 2O3PA 2XK3A 4X2KA 4EOIA 2QCSA 4RLKA 4YJOA 3FXZA 4O7VA 2P0CA 2QOBA 3NW6A 5HNBA 3UYTA 1BL6A 1GY3A 4JBOA 4Y5QA 4USEA 4AW2A 2B54A 2ZOQA 1BL7A 5FXSA 1TVOA 3R1NA 4BFMA 3W2CA 4JJRA 4I3ZA 5CVFA 3WF6A 4CFWA 4IVCA 4FTMA 1H24A 3IDBA 4U41A 4MNEB 4C57A 2GU8A 4RJ4A 4TWNA 5HQ0A 4PDPA 2OJIA 3KRWA 3OZ6A 1WBNA 2ETMA 4UMPA 3TUBA 2NRYA 1FQ1B 4Q5EA 2CDZA 4HZSA 3RWPA 5AV0A 3W2RA 2FSLX 1H0WA 5FTOA 4CYIA 4ACGA 2JFMA 4MX9A 4O6EA 5AR8A 2OXXA 4JRNA 3TNPC 3COHA 2YAAA 4DLIA 4RC3A 4KWPA 3ZS5A 4HCTA 4EWQA 4BTJA 5JQ8A 4FEUA 3UG1A 1SVHA 4J71A 2B9HA 4H1MA 2C6OA 2C1AA 3PIXA 3BBTB 2XNGA 5DT0A 3QA0A 5BVKA 3L8XA 4KBCA 3C1XA 4O0WA 1SNXA 4U6RA 5AV4A 5KMLA 4ZY6A 1NW1A 4O7ZA 2XBJA 4FOCA 4QPMA 2EWAA 3DAJA 3DZQA 3QKKA 3ZU7A 1J7LA 1M2RA 5TF9A 1LEZA 4A9UA 2ACXA 3QRJA 3HMOA 1PXOA 4MQ1A 4I23A 4XNEA 4FBXA 4KRCA 3QL8A 4NZWB 4UV0A 3OG7A 5ANGA 4C3RA 3ZLSA 4DLJA 4ZZOA 1R39A 4USDA 4JQ7A 4JIAA 4KS7A 3QWJA 2VTNA 4ZTQA 3OC1A 3ZXTA 2QU5A 5I9YA 4BDHA 2OZAA 3P5KA 3TKHA 2YWPA 3W2OA 4JDJA 2PVKA 2R3OA 5LVNA 2XNNA 2YM3A 3QRUA 2ONLA 3R6XA 3RCDA 2E9VA 3C51A 5CZIA 3O7LB 3UZTA 5JQ5A 5C1QB 4WA9A 3EQFA 5EOBA 5JMSA 4KUJA 4AUAA 3P1AA 4A4OA 3ORXA 4WRGA 5C01A 4UWYA 4X2JA 3UZRA 3FJQE 3CY3A 3O8PA 2VNWA 5EW9A 4AOTA 3FL4A 2JGZA 3FLWA 4KKGA 4A4LA 2RFDA 4IVAA 5DOSA 2XJ0A 3PRFA 5AP5A 4B9DA 2WQBA 1RDQE 4R3CA 3RCJA 3KVWA 3LXPA 4XP3A 3NUAA 2C5NA 4FIEA 1OUYA 2QKWB 4FT0A 3TXOA 3BHVA 5AP7A 4XS2A 3RM6A 4I0RA 2P2IA 2PE2A 4IBMA 5ANKA 4I93A 2V7AA 3MVMA 1AD5A 1OKYA 2I0EA 3I7CA 4KKEA 4RQKA 3H0YA 4QQ5A 4OLIA 3OROA 1Q8ZA 4W8EA 5D11A 4NH1A 3FHIA 2R7IA 5B2KA 4PMSA 4C3PA 5HG9A 5BVDA 5IA5A 3IQ7A 4MBLA 4A9TA 2J4ZA 5TOZA 3GFWA 3PLAE 5BVNA 3EWHA 4IW0A 2UW7A 3OW3A 2CLQA 3AGMA 2XJ1A 3LCTA 3R1QA 2R64A 3LQ5A 3KEXA 1YWVA 1U59A 2NNWB 3OVVA 2Y8OA 4M97A 3WARA 5F9EA 3EFJA 2XNEA 2IW8A 1Q8UA 4IVDA 2V5QA 4QMQA 4J52A 3TNQB 2PE1A 3CBLA 3VULA 3U6IA 2IPXA 2ITQA 3ORKA 1URWA 4FZFB 5AR4A 2RFSA 5H9BA 3MH2A 3JR1A 4GL9A 4QNYA 3MTFA 3P08A 2UVYA 4M68A 3R8UA 3TNIA 4DH8A 3BZ3A 4G3GA 1JNKA 3FMHA 4HPTE 5LCKA 3VBWA 3BU6A 4ZTRA 3VVHA 4S31A 4FEVA 5HBHA 4RPVA 2R2PA 2YIQA 3MY5A 4QTCA 3ZDUA 4AZWA 5AR5A 4AZEA 4E26A 2C6LA 4JDHA 3FLSA 3ZH8A 1XJDA 1ZYJA 2BUJA 4W4YA 5KBRA 4LL5A 2WELA 3UNKA 4G16A 4K2RA 2YABA 4OBPA 3TL8A 3K3IA 3UG2A 4CG8A 4ZMFA 2GPHA 4HGSA 4U7ZA 4O1PA 4FSWA 4D2RA 5FUTA 2OFVA 4I5PA 3PJ2A 2IO6A 4X3FB 5FG8A 5HX6A 1W0XC 4ITHA 4KIOA 3W2QA 1S9JA 4RFMA 2GFSA 3PPKA 3EOCA 4RFYA 5HO8A 4ZZNA 5K5NA 5J7BA 5C8NA 1CMKE 4D55A 5B2LA 1UV5A 4O7WA 3K5UA 4G9CA 1XR1A 3KCFA 4RWIA 2P33A 3FPQA 3SDJA 3ANRA 4M13A 1FPUA 3ET7A 2A27A 3A8XA 2I40A 4FV0A 4MD7E 5CLPA 3VO3A 2EXCX 4FTTA 4EOQA 4AT3A 1WVXA 4ASEA 3LFCA 5K0XA 3EQCA 4PP7A 3FYKX 3PJCA 2JKQA 2PK9A 2R3PA 4U79A 2ITOA 4TTHB 3VS5A 1U54B 3NNVA 3ZSHA 3QQJA 1Q8TA 3SLSA 4CTCA 2UZBA 4CVAA 3MFRA 3GNIB 1LEWA 5AM6A 3SXSA 4Y8DA 3NUYA 5IMXA 2CCHA 3R22A 2OKRA 4IXPA 5JFVA 4D2PA 4IQ6A 1CKPA 3QTIA 1U4DA 4TYGA 5K9IA 2HW6A 2R3QA 2W06A 3G15A 4CTBA 4PDSA 3RINA 2IZSA 1Q8WA 3TG1A 1T46A 4EOMA 4MTAA 3U87A 4X6QC 3UDBA 2WIPA 4FKOA 2PSQA 3R7EA 2YM4A 4Y46A 4NWMA 3FMKA 4EHGA 3HKOA 3OXIA 4YC8A 3LXKA 2W17A 3RPOA 5E8YA 4NM0A 3QYWA 4A9RA 1QPCA 2X8IA 3MYGA 3QD2B 3PP1A 1OMWA 4RA5A 1Q97A 3SG9A 4FF8A 4UYAA 3C5UA 4IH8A 4QMYA 3LFNA 5DGZA 5EI6A 4ACDA 5AIKA 2O65A 2RSVA 1FMKA 3E87A 4BBMA 1BMKA 5M51A 3FAAA 2X8DA 4GK3A 3QZGA 4TNBA 5E8XA 5M53A 4FSZA 2XK4A 4EK8A 4C4GA 2QR8A 4FKSA 4FYOA 4FTUA 1FVRA 5DBXA 4BICA 3GI3A 3H9OA 4N6ZA 5TKDA 2UZUE 3Q9WA 2A1AB 4FTNA 2ETRA 4LGDA 4ANMA 1IR3A 4RMZA 4LV8A 3GCQA 2VWVA 3PWDA 4CCUA 4IWPA 2ZYBA 2WU6A 2VO3A 3F2NA 5FEEA 4NKAA 3D5WA 3CD3A 4MQ2A 4RJ3A 4MXAA 3QXOA 2YEXA 5HKMA 3UIBA 4Z55A 2YIYA 1M2PA 4EH5A 5EHOA 3V5TA 4BB4A 2FA2A 4P2KA 4QYGA 5DE2A 4ZSAA 1W8CA 3ORLA 3ATTA 2QU6A 5JFWA 5BUEA 4OTHA 3C0IA 4FI1A 4YHFA 5KBQA 4TWCA 2A2AA 4BHNA 1DI8A 5FWKK 1Q4LA 2VWYA 3KQ7A 5A4QA 4TPTA 2VO7A 1UKHA 4F99A 4IX6A 4BZNA 4C4EA 4R7HA 3FZOA 2BHEA 5HE1A 3DB6A 3W2SA 3UOHA 4L01A 3SQQA 1XH5A 4GK2A 4IMYA 1OI9A 4U97A 2AYPA 4ZTLA 3ZM9A 2CPKE 3W18A 5AP4A 3QUDA 3OUNB 2PZIA 4TYJA 2X39A 3UNZA 2R7BA 3KREA 4B8LA 2RKUA 4L00A 1V0OA 3KKVA 2HWOA 4FV2A 4ANLA 3AGLA 2IZTA 5L2QA 3KA0A 2VWUA 2C5XA 1W7HA 3F3WA 3GGFA 3JY9A 3SAYA 2JDRA 1YI3A 2Q83A 1ZAOA 2ITYA 3OOGA 4R1YA 2YIRA 4ALUA 5AX3A 3AT2A 3G0EA 3VAPA 3DKCA 4DG3E 2Y6OA 3R7YA 3KGAA 5IPJA 1ZOGA 5GJGA 2JAMA 3WYXA 5IQAA 4UMTA 2AC5A 4BDAA 3TTJA 5J8IA 3G51A 4R8QA 3RPSA 1WBSA 3VS7A 3CSVA 4O7LA 5C4KA 2ZM1A 1JKKA 4NUSA 3E64A 4IADA 5KZ0A 3D7TA 5CSHA 3TJDA 2UZVA 4EZ7A 3QQKA 1UNGA 4OBOA 2CSNA 3NEWA 3BHUA 4F6WA 1H25A 1AGWA 2W1ZA 5J95A 5EHLA 2E9PA 2GDOA 5IF1A 1YHSA 3MTLA 4NEUA 5KNJA 3UMWA 3QTQA 4EYMA 3QQGA 2R3JA 4KBAA 2J7TA 3CKWA 3QTRA 1P4FA 3ZUUA 3KXNA 3VUMA 3C4ZA 3PXZA 1L8TA 3R83A 3NNUA 3R21A 4ARKA 3NVMB 3KULA 3Q96A 4M7IA 4EOSA 1U46A 3BELA 5EYMA 3CQEA 2VNYA 4CZUA 2JDSA 3CE3A 3G90X 3COIA 3CLYA 3DFCB 2OK1A 4NFMA 3QHRA 1YDSE 4WUNA 4XV1A 3DY7A 3SXFA 3UBDA 4BF2A 1Z5MA 1MQBA 2GQGA 3FMNA 5D1JA 2W5HA 3BIZA 4CV8A 3IOPA 3V5PA 2WQMA 4LGHA 4AS0A 5KMOA 1BLXA 2JIUA 3P79A 4IWOA 3BYOA 1H4LA 3FXXA 3ZUVA 3NNWA 4XG8A 4J1RA 3NAYA 2O63A 3E92A 3BE2A 4FVRA 4MXYA 2OJFE 4BBEA 3ID6C 2W4OA 2V62A 4FKUA 3P86A 3PA3A 2PL0A 3VS3A 5LWNA 4I92A 2V7OA 4FSRA 4JBVA 4EOLA 3OXTA 3TEIA 2XVDA 4F09A 5HG8A 4B8MA 4OTDA 5HBJA 4E20A 3HV3A 3GENA 3GOPA 4HYSA 4JOAA 2IVTA 3QZFA 3MVHA 4JIKA 5ANOA 4BWXA 2QODA 4DGNA 3ORPA 3DPKA 5IDNA 4D2WA 3O71A 4ZLOA 4HGEA 3DNEA 3R30A 2B9JA 4L3JA 2F7EE 2VWIA 2Z60A 4A06A 4DC2A 4X6RA 1ATPE 1U54A 2UZOA 3GCVA 3R71A 3H3CA 4HCVA 3R9HA 4F0IA 4HW7A 3PE1A 4JX7A 2RGPA 3SW7A 3ULZA 3RKBA 3D2KA 5CEPA 1R1WA 2HOGA 2YERA 5BNJA 4GMYA 1M7QA 2A19B 4NTTA 4RLLA 2YWVA 2DQ7X 4K8AA 4YO6A 4AWIA 1UWJA 3VN9A 4E73A 2YM6A 2HENA 4U81A 1RE8A 4GYIA 4EJ7A 3L9NA 2OZAB 1MQ4A 3QF9A 2V55A 4QT1A 5AV1A 4TY1A 4AZTA 2ZVAA 4XV2A 2WTJA 2OBJA 4D0XA 4FZ6A 2C6TA 3Q2JA 4YBJA 4YC3A 2BZHB 4F9AA 2VU3A 4MF1A 2RF9A 3NAXA 3UC4A 4X2FA 5ANIA 1W83A 5FDPA 2BDJA 2X0GA 4WSQA 5J9YA 2CHLA 3ORTA 4IHPA 4TNDA 3RAWA 1WAKA 4ITIA 3LCSA 5I4NA 3QLGA 3R01A 4YJRA 1FGIA 4K11A 3FV8A 3QGWA 2ITUA 3P23A 1OPKA 4BZOA 5FLFA 2JEDA 4DAWA 2IJMA 4EC8A 4O7SA 3MA6A 3NNXA 1NT2A 1W82A 3LKMA 2UZWE 4CFUA 3NX8A 3U6HA 4EQCA 4BIBA 2XRUA 5HNGA 3BLQA 5ETAA 4C59A 5LMBA 3LQ3A 5EKNA 3VBTA 4AZVA 1YXUA 2PU8A 2ITPA 5DPVA 5M07A 3T3VA 3BX5A 4V05A 3CY2A 3PWYA 1URCA 1MP8A 4GKHA 3M1SA 4P7EA 1NA7A 3OBGA 4MD8E 1Y91A 3I4BA 3RVGA 3NYXA 4YZDA 4HNFA 2NP8A 2ZMDA 3EQIA 4WO5A 3TV7A 3SW4A 4DH7A 2C6MA 5FBNC 4BCPA 3OT3A 5E8UA 2G1TA 4C2WA 3NUPA 3EQGA 4U3YA 2C0TA 1XH7A 2YCQA 4A07A 4U45A 2PTKA 4F08A 3HDMA 4YLJA 5HCZA 4E6DA 5CEKA 3EQHA 5E91A 2XIYA 2PVNA 1OIRA 2EVAA 5DR9A 2HW7A 1GZOA 1U5QA 2JKKA 3HRFA 3NYVA 5BMMA 5CU3A 4AT4A 4AGUA 2Y4IC 5E1SA 2XK8A 2C3LA 3BEAA 4PPBA 4DITA 2FSTX 4IAIA 4WUAA 1R78A 1YI4A 3L9LA 2BKZA 3P0MA 2CKPA 5DRDA 3FLQA 5M57A 3W33A 4IAYA 4FTOA 5HG5A 3SOCA 2HELA 1YHWA 4AGDA 3UO5A 4EHEA 2HAKA 3SA0A 2Y9QA 2YLFA 3Q4TA 3R9OA 4P5QA 3E62A 3UZPA 1OL7A 1GNGA 3PXFA 4XP0A 3MPAA 3PSBA 4E7WA 3S00A 4XOZA 3BCEA 1VYZA 1J1BA 1YWRA 4BCOA 1WBPA 4BDJA 1OGUA 3LFSA 2XBAA 4ZY4A 3L8VA 5DT3A 3RK5A 4FIIA 2UVZA 2ITZA 2PMLX 4H58A 5K0KA 3LPBA 3FKOA 1B38A 5HVKA 3A8WA 4IANA 2PVJA 2VUWA 4V04A 5CZHA 5DG5A 5F94A 1B39A 4H05A 4EJNA 4APPA 4DH1A 3NVKI 5F1ZA 3JY0A 4AP7A 5HOAA 4D4SA 3KXXA 2X81A 4F65A 1T45A 3DDQA 4CGAA 4K33A 2YM7A 5AIRA 2VTIA 2WNTA 1JPAA 3GU5A 4QMXA 4ZK5A 3C4EA 2EU9A 2Z7RA 1YI6A 3VHEA 4RVMA 4CFMA 5IG1A 3QD0A 4QMMA 3TWJA 1OBDA 1JWHA 3MH0A 4M15A 5KHXA 4WG4A 5FD2A 3BHTA 2G9XA 3GEQA 1PXNA 3BWJA 4UWCA 3PVUA 1K9AA 5FRIA 5J9ZA 4PTEA 5A14A 4ZS4A 3OEFX 3F3ZA 1MRVA 3SHEA 2IZRA 4LUEA 3IECA 5CENA 1BI8A 2G15A 4EKKA 4FNXA 1ZZ2A 1CTPE 4U43A 3A61A 2XCHA 4NFNA 3LIJA 3DGKA 4MVFA 1Y8GA 4I20A 3F7WA 5M44A 3TZ8A 3DBDA 4YNEA 4G34A 2OF2A 1YDRE 4KINA 5CF6A 3QTXA 3CS9A 4PDYA 1FOTA 4YC6A 2W4JA 4FSQA 2C6IA 3GU4A 4PL5A 3QAME 4MKCA 4EK5A 1FVVA 3THBA 4C35A 2GS6A 4XBRA 5EQPA 4KBKA 3WZKA 1PKDA 4IAKA 5M55A 5KMNA 3NLBA 5KHWA 2QG5A 3VBVA 2J6MA 4H3QA 5AV2A 2WFYA 2VGPA 3PJ3A 4CNHA 1SNUA 4F7SA 3MH1A 5IQCA 2BTRA 4IZ5A 4WNKA 3I0QA 4GJ2A 5CASA 5BUJA 4HYIA 4OTIA 3GB2A 5LVLA 4Z7GA 5CWZA 3P78A 3I5NA 4G3DA 4WT6A 1DI9A 1YXTA 2BROA 4CFVA 3UO4A 4YURA 1KE7A 3DT1A 2NO3A 4AU8A 2XF0A 3DLZA 3BQCA 5HGIA 5CEMA 3R28A 2H6DA 3ZUTA 4DTKA 1UA2A 4J98A 3FMEA 2Y7JA 4BDDA 3OF0A 3V8WA 5H8EA 5BVEA 4JL9A 4IEBA 1PXMA 4YJUA 5ANJA 5EK7A 3ZBXA 4C34A 4HYUA 2R5TA 4V0GA 2NRUA 3VIDA 2WOTA 2ITXA 2QVSE 3PZEA 2BR1A 2JAVA 4FG9A 3KC3A 4UBAA 3FBVA 1M7NA 4L44A 1I44A 4O91A 4D2TA 3GC0A 4CMTA 2GTMA 3E8EA 3FSKA 3M2WA 4H39A 2VO0A 2JDOA 4O22A 4AW0A 5C8KA 2PZPA 1CKIA 4ZLZA 1ZYDA 3RI1A 5JGAA 4MNFA 2CN5A 4CYJA 4BCMA 4FX3A 1HCLA 4O0TA 2PVRA 1H0VA 2BRHA 2O64A 2WOUA 3LQ8A 2WMQA 3Q60A 1GAGA 5GZAA 4XMOA 4CFFA 3MBLA 4J97A 4ZTNA 3TUDA 4E4LA 3EKKA 3W32A 3OWKA 1ZYSA 3QGYA 4K0YA 4ZSJA 1NVQA 3V6RA 2PY3A 4RQVA 3KMUA 1YHVA 4I24A 5DA3A 4BTMA 4GG5A 2UW8A 5HX8A 3DLSA 1JKSA 4XV9A 4BDFA 3C0GA 4D5KA 1V0BA 3R04A 4KA3A 2WQEA 2YDJA 4GT4A 4PL4A 5KUPA 4GIIA 3LFQA 3W1FA 1BUHA 4BCHA 4CZTA 3U6JA 5HE0A 4YTCA 3R7OA 2J0LA 4M0ZA 3FPMA 3PXQA 1YOLA 2WQOA 3R00A 4KD1A 4L46A 4O2PA 5D12A 5LARA 3O17A 4R3PA 4BYJA 5L3AA 5IQIA 1HCKA 4MK0A 4FSMA 1YXXA 1P2AA 4O7NA 3OD6X 3GQIA 3LFEA 4QQJA 2A0CX 4O0UA 3UP7A 2WPAA 2OU7A 4QQCA 3ZLWA 4ENXA 4O81A 1H00A 1OL6A 2WMTA 3PG1A 4BGHA 4RGJA 3DS6A 5L2TA 2EB2A 1DAWA 5HICA 4GUBA 4XLIA 4WG3A 3AT4A 3QX4A 4K9YA 2ZDUA 5EW8A 1H1QA 2C3KA 2PZYA 3E3BX 4NT4A 4E6CA 2VTAA 2UUEA 4OW8A 5IA3A 4OBQA 4XRJA 4H3PA 4JS8A 1XWSA 5CEOA 5M4FA 3SRVA 3SOAA 4I21A 2VWBA 2DUVA 5DH3A 2DS1A 5GINE 4HVGA 2BRGA 3R63A 3SXRA 2VTHA 4PDOA 5HBEA 4CFXA 4C7TA 1APME 4ZSGA 4AT5A 4ZZMA 2WMAA 3DAKA 5D7VA 4HVIA 3FC2A 3GU8A 4FEWA 3D7TB 4P5ZA 4QTBA 3VUGA 4BYIA 5BX0A 2HCKA 3GCPA 2O5KA 5H8BA 1PYXA 3HV5A 3D14A 4GIHA 5DRBA 4U0IA 3ORZA 4O96A 3EQBA 3HX4A 3KCKA 5FQDC 2OH0E 3U9NA 4DFNA 5I9ZA 3O51A 3E7OA 1ZARA 3AC4A 3ORMA 2X4ZA 4L7FA 4QPAA 3MY0A 4DEEA 3QLFA 3CQUA 3R2YA 4PL3A 4U80A 3I7BA 4TZRA 4BI0A 1JSVA 3A7FA 5CF4A 3TV4A 5IQBA 4G5PA 1Z57A 4I6FA 2W1IA 3ROYA 2E9OA 4D1ZA 2WD1A 3KN6A 1Q8YA 2YCRA 3O0GA 3AD4A 4BDEA 5JFSA 4MWHA 3HRBA 4DFBA 1M2QA 3HMIA 3MIAA 2W1EA 3M11A 3VUKA 4O0XA 1KOAA 5HE2A 3LLAA 2WMVA 2XNMA 4RIYB 3W2PA 4JBPA 5GIOE 3RPYA 1G3NA 3R7VA 4GFGA 3HZTA 4YJNA 3CGFA 4Z7HA 3KRRA 4QMLA 1IA9A 2XKEA 2UW0A 4RX9A 2BZIB 3UOJA 3EL8A 2J0IA 3UODA 4C8BA 4ACCA 5A9UA 2FGIA 2REIA 5C8MA 3IONA 3EHAA 4O0SA 4NTSA 5GHVA 2PE0A 3FY2A 3PXKA 4XG7A 4EHZA 2C1BA 3KRJA 5EM7A 3ZONA 5L8JA 4EONA 3V8TA 3F3TA 4GSBA 3OWJA 2C6KA 4Y85A 5AWMA 2IVVA 4PP9A 5FP6A 2ESMA 2BKKA 4ZJIA 3F2RA 4IDVA 3DQWA 3NW5A 2GQSA 3R2BA 3HLLA 4KSPA 4KNBA 4PX6A 4FSUA 5DI1A 3R9NA 3LMGA 3NMUF 2HXQA 5H3QA 3TZMA 2W1CA 4FKJA 4LMUA 1PXLA 4N0SA 5EOLA 3DKFA 3PY0A 3NIEA 2QOFA 3E93A 3TCPA 2ZB0A 5E4HA 5GJFA 4GU9A 4S30A 4FL3A 5CF5A 1J7UA 1PJKA 1SMHA 3RWQA 1K2PA 4JG7A 4BDGA 2B52A 2FO0A 3KXGA 4GT5A 1WBWA 4E4MA 2OXDA 4FOBA 4RIYA 5FBOA 4YP8A 4JR3A 3V6SA 5A4EA 2W9FB 2ZM4A 3EN6A 4PUZA 2EXMA 4EOKA 5M09A 4RIOA 4GW8A 2GNGA 3W55A 3I0OA 4CRSA 3C50A 3FC1X 3KMWA 2XYNA 3FSFA 2WMWA 2PHKA 3R0TA 3OCSA 3DBQA 3R7GA 3TNHA 3ZZEA 3KB7A 2FSMX 3KU2A 3IG7A 1PXKA 2BAQA 4BIDA 1LR4A 5HO7A 3UGCA 4O83A 4QYYA 4R7IA 4MAOA 5A4TA 2X7FA 1GIIA 2OFUA 1G8SA 5J7HA 1YVJA 3NYNA 3Q4UA 1WBVA 2WKMA 5CAUA 3R9RA 4EL9A 4EK3A 2OSCA 3QUEA 1IA8A 3MPMA 1OKVA 3C7QA 1VR2A 5T3QA 3Q32A 1ZRZA 5AUUA 5CU0A 4C62A 2QHNA 5EHYA 4AA0A 4UB7A 5B7VA 5CY3A 3MWUA 4QP6A 3KMMA 4G2FA 2GHLA 2B4SB 4RA4A 4YZCA 2VTQA 4QP9A 5HU3A 4F7NA 1JSTA 4LFIA 3MESA 3MV5A 4YLLA 1YXSA 4LOOA 4EOOA 2R0IA 3G6GA 1NVRA 2XRWA 4O0VA 4RWKA 3D0EA 4UZDA 4D2SA 4DHFA 2BFYA 1XHAA 3OCBA 1XH8A 1RW8A 5AAGA 3AC5A 3Q6WA 1QCFA 4I5CA 4I1ZA 2OW3A 4G3EA 3QZHA 5CT0A 3OTVA 4UXQA 4I4FA 4NW6A 2RFNA 4X7QA 1PRYA 5J79A 3VW6A 2RG6A 4HZRA 3OY3A 4ID7A 2JIIA 5GNKA 2WMRA 5K4IA 4ZIMA 4X21A 3SX9A 3FL5A 3IDPA 1Y6AA 3QKLA 5A46A 4F6SA 4HPUE 5L6PA 5CNNA 1DS5A 4C4HA 1LP4A 2F7XE 5EDQA 4I5HA 4FICA 4F6UA 3IW7A 4Q2AA 2PUPA 3V5JA 2BILB 1UNLA 3V5QA 2YCSA 4OTWA 1SYKA 2DYLA 3VS0A 4CG9A 4KRDA 4L43A 2G2HA 3WIGA 2RFEA 1OKWA 3Q6UA 4UZHA 2BRNA 3DCVA 3QTSA 4EK4A 5GJDA 5A4LA 5TT7A 3KK9A 1P14A 4G9RA 1ZY4A 4U9AA 3TZ7A 4IC8A 3K2LA 4JDKA 1O6YA 3W8QA 4AX8A 2PZ5A 3FZ1A 5JFXA 3VUIA 3PRIA 5M06A 5KX8A 2XJ2A 3II5A 3E88A 4L3PA 3N4TA 4BN1A 4NU1A 2WTWA 2R3KA 4DH5A 1OVEA 3AXWA 4EUTA 3FKNA 3PY1A 4HNIA 4IFCA 4FTLA 3TIYA 5LVPA 3KF4A 5HLWA 1DM2A 4GT3A 3ZSGA 5I9WA 4O7TA 3BU5A 3ZOSA 5FXRA 4L45A 4ZJJA 2UZNA 3UOLA 5D10A 3WF9A 1L3RE 1RJBA 5L4QA 3P7BA 2Y4IB 4IJ9A 3F5PA 1WBTA 3A7GA 4I0TA 4YGAA 2C0OA 3R8PA 4ERKA 3ZYAA 5KMKA 1IRKA 3D9VA 5JH6A 4Y95A 3AT3A 2WIHA 2X7GA 2Z7QA 5CANA 3UMXA 3DAEA 1TQMA 5EQEA 2XIZA 5M4CA 3LMIA 2QD9A 4FKIA 4ORKA 3EN7A 3Q04A 5EW3A 2X6EA 3FUPA 1ZMVA 2W1GA 4FT7A 3ZC5A 3A2CA 5ETFA 3LOKA 4BIEA 4ENYA 3ODYX 2WMSA 4A7CA 1PMUA 4DH3A 5JN2A 4U5JA 4FG8A 3I60A 5AR3A 5CVHA 3EQPA 3HECA 2CGWA 4MBIA 2E9NA 4EBWA 1I09A 3RHXA 1Z9XA 4X3FC 1FGKA 3KY2A 5C4LA 5I0BA 3MSSA 3LCKA 4JR7A 1OPJA 3BGQA 3S3IA 3CPBA 3BV2A 3OEZA 3WBLA 2VTMA 2W05A 4FK3A 3WE8A 3JS2A 3FQEA 3NGAA 3EFWA 4MNEA 3UVRA 2IVSA 4QMPA 4F70A 4MWIA 4FE2A 3ZCLA 1FMOE 4IZ7A 4O82A 2PULA 3FI2A 4U40A 3G5DA 3C4FA 3I5ZA 2OIDA 4QMZA 2GNJA 3FZPA 1W84A 4BDCA 4F0GA 4KAOA 5EKOA 5DR2A 2XK9A 3IDCA 1MRUA 3L8SA 2VWZA 2EUFB 3SV0A 2PVLA 3RHKA 3VUHA 2HZNA 5EDRA 4C2VA 4FNWA 3GFEA 5C03A 3O2MA 3C4CA 3KXHA 4YLKA 2Z8CA 3CQWA 4IAAA 5DEYA 4IACA 3KRLA 5KZIA 5BVWA 3CXWA 5HIEA 5E90A 5IQFA 1UU9A 3NIZA 4FV4A 3DFAA 3FHRA 5CSXA 4DN5A 3B2WA 4EUUA 5BMSA 5H8GA 5LJJA 1IASA 1A9UA 4XG2A 5CAOA 3QQFA 4EH9A 5HCYA 4QP1A 2PVFA 2PVYA 4E93A 4RVKA 3LFFA 5FDXA 3U8WA 4QP8A 4RC4A 1WZYA 4FKQA 3T9IA 3KK8A 4AW1A 2R3FA 4ACMA 2KTYA 4EYJA 2UZEA 4PWNA 4W8DA 3OBJA 3JYAA 1XBCA 2VAGA 4AN3A 4AW5A 2OF4A 4WNOA 4E4XA 2OWBA 2VX1A 2W5AA 1SM2A 4GVJA 5LMAA 3TACA 3V8SA 5LCJA 5ITAA 2Y4PA 3VQHA 4I4EA 3R73A 3QHWA 4QNAA 4C02A 4OAVB 3LXNA 3Q9XA 5FM3A 3M42A 3F82A 1J7IA 4ITJA 4LGGA 1KE6A 4BHZA 4EH6A 2JD5A 4QYFA 3AC3A 4Q5HA 4WNPA 5AP2A 2X4FA 1TQIA 2XH5A 3DB8A 4IM2A 2WTVA 3NCGA 1OL5A 4C38A 4UMRA 4FUXA 1FVTA 4NIFB 2BVAA 3GXLA 4YJSA 2HZ0A 3ZTXA 3GOKA 3LJ0A 5B0XA 4II5A 4BCGA 3FE3A 3IOKA 4JG6A 2IW9A 3AC2A 3IK3A 3VS6A 4BRXA 3C13A 1J1CA 4Y73A 3NUNA 2C68A 2Q0NA 4P90A 2CMWA 3SRVB 3SKCA 4RJ8A 5EFQA 1R3CA 3PJ1A 5IDPA 2YN8A 5HESA 4EKLA 4QQTA 4NK9A 3HP2A 2J2IB 4BDIA 5ICPA 4CEGA 3G9NA 2PMOX 1IAHA 2R9SA 4NJ3A 3TIZA 4UN0C 2GNHA 4JNWA 3HV6A 2QG7A 3RAHA 3FYJX 4GRBA 4JX3A 3DNDA 1CKJA 4F9YA 3QX2A 1Q41A 5HTIA 3F5UA 5FXQA 3R8LA 3DJ6A 3GC7A 3OY1A 4FKGA 5CXHA 3VUTA 5AUWA 5L6WL 3ZLXA 4CFNA 2WEIA 4S33A 3FLNC 5EI2A 4HVSA 1Y57A 3DOGA 1ZMWA 4XBUA 3UJGA 4CLJA 3KULB 3F66A 4FT9A 5FGKA 5BYYA 1OIYA 1ZMUA 4HYHA 3PDTA 5D41A 4IM0A 1V0PA 4IB3A 3MH3A 3ZM4A 4JI9A 4MXXA 4F9WA 5CI6A 4NCTC 2IW6A 3I79A 1W98A 4LMNA 4OT6A 5M4UA 3S2PA 4NIFA 4ANOA 5HIDA 3ITZA 4BGGA 4DBNA 4YMJA 4AG8A 1OIUA 3PXRA 2YJSA 4NM5A 4DEHA 5ANEA 1XKKA 2EXEA 3SG8A 3NUUA 4FTQA 3QALE 4KSQA 2X9EA 5J5SA 3TKIA 4EH4A 5EYCA 3DBCA 4J95A 2JKMA 3OOMA 4FT5A 1CDKA 3GCSA 5A4CA 3A7HA 2UW4A 3FMMA 2J0MB 4JAJA 3H30A 3UIXA 3VF9A 1RQQA 4Z16A 3LXLA 5A3XA 5I3RA 3BPRA 4U44A 3H10A 5BYZA 5DLSA 3PLSA 4KIPA 4QTDA 4KIKB 4AOJA 1H27A 2VX3A 4G5JA 3T3UA 1IG1A 2BDFA 5KKRB 2WTKB 3OWPA 3R1SA 4E5BA 3I6UA 4C4FA 3MA3A 2GMXA 3F69A 1WFCA 2WTKC 1E1XA 2YITA 2VTRA 2XYUA 3LJ2A 5L2IA 4JRVA 2JBOA 2HZ4A 4E5WA 1Q24A 1A48A 3Q3BA 4TXCA 3ATSA 3QBNA 3VC4A 4A4XA 4DE4A 3BYSA 1M14A 3EL7A 4M69A 1OIQA 4FNYA 5HVYA 4F7JA 4MXOA 2ZAZA 4Y72A 3MFUA 5JK3A 3FLYA 5DEWA 3TDWA 2BAJA 5D7AA 3FZTA 3IW6A 3FI3A 3HA8A 4YHTA 3A99A 4E6AA 3KRXA 3BRBA 2LAVA 2VWXA 4NCTA 4RX7A 1SVGA 4ZSEA 3L9PA 3BLHA 2PMNX 2R0UA 5AFVA 1LPUA 3FI8A 2VTLA 1JLUE 2YDIA 1S9IA 4L52A 4MYGA 4MXCA 4D2VA 4DGGA 4W4WA 5HIBA 1PXPA 4EH7A 4Q9SA 3HNGA 5L8KA 1WCCA 3IGOA 3B8QA 2VTTA 3KF7A 4XV3A 1Q62A 3LMHA 3EFKA 4FT3A 1J91A 3BEGA 1SVEA 3KXZA 3RNYA 1Y6BA 4AQCA 4D4VA 4GG7A 4BTKA 4DFUA 3A60A 1YXVA 3C9WA 4FTKA 5AP0A 2X6DA 3UQGA 4FGRA 5CAQA 3VWAA 3VQUA 2PZRA 2QLQA 3ZEPA 3N4UA 3D5UA 3LJ1A 4IVBA 3RGFA 2WO6A 2GSFA 4R77A 3MY1A 3L9MA 3RPVA 3QQLA 1PXJA 2VRXA 2BRMA 3PP0A 1CM8A 5HD4A 5IQHA 2CGVA 4S34A 2QOKA 4UXLA 4TRLA 2X2MA 2E2BA 3GT8A 1KV2A 1HOWA 1KWPA 1XH6A 4PPCA 5AUTA 4JBQA 2ZV7A 5FP5A 3LCOA 3VJOA 3LFBA 4ZOGA 3W8LA 4X3JA 3JVSA 2NPQA 4YJVA 3ZSIA 4BBFA 3LM5A 4IJPA 4CMUA 4E8AA 4EK6A 4E1ZA 4TL0A 3D4QA 3HA6A 3OW4A 4M12A 2YACA 3AG9A 3LM0A 3RJCA 4G6NA 4L67A 5HE3A 4FEQA 3EYGA 1ZY5A 1NVSA 3CJFA 5D9HA 2H96A 4XX9A 2BZJA 3EQRA 3Q5ZA 4TKSA 5CU6A 3ACJA 2PUIA 3HMPA 1GOLA 2GHMA 4NKSA 5J5TA 2Z7SA 5BPYA 3E7VA 3EYHA 4YJPA 1F3MC 2W1HA 3ZO2A 3OWLA 3ZFYA 5IA0A 2X2LA 3Q52A 2Z2WA 4N4SA 4GS6A 3UOKA 4W4XA 3ZFXA 4X2GA 3N51A 2ONLC 3Q53A 5DHJA 2WXVA 4FG7A 4DGMA 1BI7A 2UZDA 4TYHA 3UQCA 5CTPA 5I9UA 5HTBA 4ZEGA 1NXKA 5IUIA 3AD6A 3G6HA 3QCSA 2UW6A 2I0HA 3E8CA 4RT7A 4BCIA 5CXZA 3WZUA 3H0ZA 5EM5A 2W99B 3DJ7A 5DNRA 5KE0A 3NRMA 3RPRA 4LOQA 3F5XA 4FVQA 4I6QA 2CLXA 2JBPA 3UPXA 2XNBA 1M17A 1R0EA 2W1FA 5CSVA 5CU4A 4BI2A 4PTGA 4QD6A 4O6LA 4F7LA 5AJQA 4E4NA 3S1HA 4GH2A 5CALA 5T6KA 2C5OA 4I6HA 3FLZA 3TZ9A 4RWLA 3NR9A 4XYFA 3FZRA 4BKZA 4DEDA 4FKLA 3PG3A 2CKQA 3R7UA 1ZYCA 1Q61A 5KMIA 5LVOA 3BWFA 2YM8A 3EJ1A 3IGGA 5IH5A 4FIHA 4GKIA 5EYDA 4TWOA 5BVOA 5JKGA 2B0QA 1MUOA 3QFVA 4PQNA 4OGRA 1CSNA 5E92A 4D9UA 5J9LA 4XG9A 1OITA 1STCE 1SZMA 2IN6A 3F5GA 2OXYA 4I22A 3QTZA 5CVGA 3BGZA 3BU3A 4EOJA 2OIQA 1NY3A 3OTUA 4J8MA 2FSOX 5E8SA 4HGLA 4GJ3A 5IMEA 4I0SA 5C27A 4N70A 3S95A 5HLPA 5KMMA 1OM1A 4W9XA 3DXQA 1IEPA 3I6WA 4GK4A 4RIWA 4AFEA 2UW5A 1ND4A 1WVWA 3PUPA 5M56A 3FQSA 4AZSA 1ZLTA 2BIYA 3C4WA 5LXMA 3UIMA 4IFGA 3BYMA 5G6VA 3QD3A 4FTCA 1PMEA 3E63A 4PRJA 1H26A 4XJ0A 4C37A 2VTJA 4DFLA 4H36A 4BGQA 4LQMA 4ANBA 1Y8YA 1UNHA 2GHGA 3GU7A 2WEVA 4TW9A 5E1EA 5CEQA 3H4JA 3PIYA 4I41A 3HMNA 5DMZA 2QOHA 4ANSA 4M14A 2OZOA 3QRTA 1XH9A 4FL1A 4Y5HA 4IAFA 2UW3A 3U4WA 1TKIA 3IS5A 4FV8A 2WQNA 2P55A 5DWRA 4M84A 2BALA 5FEDA 2JC6A 3ZC6A 4YZMA 4EQUA 5EH0A 3VS2A 5IA1A 2BMCA 2ETKA 5HLNA 2BDWA 3RZFA 3DA6A 2H34A 2X7OA 1BYGA 2CKEA 2YFXA 3COMA 3GVUA 3Q4CA 1WMKA 4G6OA 3A4PA 3EKNA 5AR7A 4IB0A 5FTQA 3BV3A 1YRPA 5HORA 4FV5A 4FTRA 3VRZA 4R3RA 4XOYA 3U9CA 4BTFA 3ORIA 4P4CA 3WIKA 2UZTA 5K3YA 4LRMA 1GIHA 4YNOA 3O8UA 4WNMA 1FBNA 2HK5A 2XIXA 4BDBA 3WE4A 2ZMCA 2HY81 3G2FA 3ZLYA 4AACA 4CD0A 1H08A 4HCUA 4J8NA 4IX3A 4MD9E 5BUIA 4DTBA 3HUBA 3F61A 5CU2A 4L3LA 2BIKB 3QKMA 3PTGA 3A62A 4K1BA 5AUZA 4YTIA 2XKDA 3AC1A 3P7AA 1H28A 2AC3A 3ZBFA 5J1VA 4EH8A 3QRIA 4U8ZA 5J87A 4O86A 3UQFA 1EH4A 3IPHA 4DG2E 2FYSA 4CV9A 4DBXA 4F64A 4OAUC 2GTNA 4C58A 4O7YA 3PIZA 3POOA 3RBWA 4M69B 1JKLA 5IKWA 4CKJA 3A7JA 3F88A 3MS9A 2OJJA 2VTSA 3MDYA 2R3GA 3MPTA 4BZDA 3BE9A 3KFAA 5AMNA 4O84A 3F2AA 2FH9A 4RIXA 2YLEA 2QONA 2XZSA 5BYLA 4QMSA 3UYSA 3MIYA 4KB8A 5IUGA 2XUUA 2CNQA 4BCKA 1VEBA 3OT8A 3QCXA 4DEBA 4EZ3A 3ZRMA 3DBEA 4MH7A 4R1VA 1KSWA 5HU9A 4K77A 4YZNA 4EC9A 5HG7A 3WZEA 3ALNA 3FDNA 3QRKA 5AUXA 3DK3A 3LFAA 3TKUA 4B7TA 4O7RA 3EFLA 3DKGA 4ALWA 3QZIA 3FMDA 3E5AA 4PV0A 5AADA 4EH3A 3PVBA 1YDTE 2VWWA 3DBFA 4MXZA 1XBAA 1KE9A 4J7BA 3DTWA 4S32A 4BL1A 5HNIX 4FKRA 2W4KA 4ZAUA 4ANQA 5EM6A 5AV3A 4QO9A 3LZBA 3LLTA 4FKPA 2QI8A 5HCXA 3VBQA 4EZ5A 4LV5A 4FIFA 3ENMA 4FV7A 4IX4A 2CJMA 5G1XA 4HVDA 2XIRA 3PVGA 3JUHA 1QMZA 3Q9ZA 5EI8A 2QO7A 3GQLA 5I3OA 4ZLYA 5KMJA 4FV9A 5FEQA 2E9UA 3UP2A 3B8RA 5LMKA 2XA4A 5M4IA 4FEXA 3U51A 4IB5A 3IKAA 5AAEA 1OB3A 1JAMA 2XMYA 1JKTA 4O0RA 1OL1A 5AX9A 4IE9A 5CEIA 4AA4A 3N4VA 1PY5A 1R0PA 3U54A 3D15A 5LMKC 5HVJA 3BKBA 4R5SA 4A9SA 3RP9A 1YW2A 2C5YA 4WRSA 5L2WA 4WD5A 3QYZA 5E9EA 1QPDA 3HDNA 3MFSA 4M67A 3VHKA 4O1OA 3JXWA 1YOMA 2BHHA 3AMAA 3VS4A 4WG5A 3SGCA 2R3NA 3RK7A 3UE4A 4QMTA 2UV2A 4BR3A 2J0KA 4R78A 3Q5IA 1OPLA 2DWBA 4RZWA 1KV1A 3A7IA 3ZO4A 2GS7A 4OTRA 4LUDA 3ALOA 4RC2A 4FGBA 5CQUA 5I9VA 4AFJA 5ETCA 4L68A 1F0QA 4QMWA 5E8ZA 4ZTMA 4UX9A 4FL2A 4KIKA 4U42A 2VTOA 4WKQA 4HOKA 4ONAA 3K54A 4XP2A 4B0GA 3D5VA 4B6LA 2C5VA 3JVRA 3ODZX 2F2CB 4RIWB 1ZOHA 2R3MA 4LI5A 4APCA 2XM9A 2R3HA 1XH4A 2XEYA 2BTSA 3ZDIA 2IG7A 1P4OA 3CEKA 4CSVA 1PMNA 3DKOA 4ZSLA 4OT5A 2J9MA 4ASXA 3MGYA 4CMOA 5CT7A 3TT0A 2C3IB 3EMGA 4E6QA 3QQHA 3OCGA 1KE8A 2GS2A 3TTIA 5E8VA 3FXWA 3ZHPC 1O6LA 4OTGA 3GC9A 3BYUA 2XB7A 4NSTA 4ACHA 4EH2A 4FODA 4ERWA 2ZJWA 4QPSA 3BI6A 3PYYA 3ZRKA 4R7BA 1PF8A 5K4JA 3R8VA 3UPZA 3ZXZA 4F9CA 2F7ZE 2C6EA 2VV9A 3QC4A 4V0GB 5CSWA 3ZFMA 4IC7A 3EZRA 3PJ8A 2CN8A 3ERKA 3H9FA 4I6BA 4IAZA 3PPJA 1ZOEA 1YOJA 5C9CA 1REKA 3LW0A 2FVDA 3AOXA 4LYNA 1UKIA 3AMYA 4FKWA 5J1WA 4AOIA 2W7XA 2OIBA 3DTCA 4L42A 5LWMA 4RX5A 1YKRA 4QP7A 4FZDB 3PXYA 4YPDA 4BI1A 4J99A 4B99A 2BAKA 4AGCA 4G17A 4OTFA 2XK6A 4EQMA 1VYWA 3LE6A 4IDTA 1H1RA 2W1DA 3LAUA 5DVRA 1G8AA 3FWQA 3D5XA 5L2SA 1KE5A 2Y6MA 4O38A 2QC6A 2YIWA 2VGOA 4JLCA 5F4NA 3Q9YA 3QQUA 2O8YA 3OP5A 2RIOA 3PVWA 5IEVA 2JKOA 4LM5A 2Z7LA 2I6LA 3P7CA 3RAKA 4YHJA 5HHWA 1ERKA 3LVPA 2JDVA 2BFXA 2WTDA 4FMQA 2B7AA 4F1OA 1QL6A 4FSNA 5AP1A 3F9NA 3V04A 4DCEA 2ZV9A 4F63A 3TI1A 5KO1A 1U5RA 2PUNA 2XM8A 4QYEA 1QPEA 1MRYA 3O50A 4ZS0A 4Y83A 3VNTA 2X9FA 3TM0A 1ZXEA 3U4UA 3Q2MA 3NZ0A
chains in the Genus database with same CATH superfamily
4FIJA 1H07A 1P5EA 2XCKA 4MCVA 1WVYA 4MEDA 2O2UA 5JRQA 2F2UA 4YTHA 2WMBA 3I81A 2I1MA 4UMUA 3W0RA 5AP3A 4BCJA 3H9RA 4FZ7A 2B9IA 4YSJA 4WBBB 4JVGA 3K5VA 2ZM3A 5JSMA 4GV1A 4CRLA 4ZJVA 3HUCA 3EH9A 1PW2A 1V1KA 2H9VA 5FTGA 3NYOA 5CNOA 4CXAA 3F7ZA 3FZSA 3VUDA 3MI9A 4A9YA 2PWLA 5CYIA 4YR8A 3JPVA 4KABA 4KS8A 4NW5A 4FZAB 4IZYA 3WF7A 4IB1A 4C4JA 4RRVA 4EBVA 4F78A 1XMLA 3CGOA 4Z9LA 4FIGA 1H1SA 2G2FA 2KULA 2QOOA 2YZAA 5BVFA 3E8DA 4EOPA 3R1YA 4D4RA 3V01A 4QTEA 2CNVA 2B9FA 4IM3A 3RALA 4AF3A 4G3FA 4TYHB 1H01A 1PKGA 2ITWA 4M0YA 2ITNA 3GU6A 4PMPA 4BKJA 4FKVA 4D28A 3POZA 4QP2A 4FYNA 5DYJA 4J53A 4Q9ZA 5JT2A 3RNIA 4QOXA 3PA5A 4GEOA 2C69A 2YAKA 1H8FA 4XLVA 5AEPA 3V51A 2HY0A 2YHVA 1JVPP 3MJ1A 4K18A 1UU8A 4QP3A 3T8OA 2BPMA 3VS1A 3NUSA 4E3CA 2XIKA 3ENHA 3UNJA 3U55A 3IW5A 2A4LA 4BKYA 4TN6A 4JDIA 4BWKA 4TYEA 3EN9A 5FM2A 3ANQA 4RSSA 3NW7A 3RAIA 3VBYA 3V3VA 4DYMA 5JGDA 3DK6A 1REJA 5LVMA 3MFTA 3FY0A 4LL0A 2JLDA 3HAVA 3O8TA 4FSYA 2R4BA 3SD0A 5AA9A 3TN8A 2H8HA 3CCNA 4FV3A 5M08A 3CIKA 2JFLA 3PZHA 1OUKA 5E8WA 1GZKA 3NWWA 3GP0A 1M52A 3TV6A 3E3PA 2P3GX 5DR6A 3QXPA 1A06A 5EG3A 2HZIA 4BY9E 1G5SA 1XQZA 3FQHA 2RG5A 3QTUA 4NJDA 3OCTA 4K6ZA 4RG0A 3QCYA 3KN5A 4OTPA 4CT1A 4L9IA 5I5ZA 4BC6A 2B1PA 3KL8A 3UO6A 5IQDA 4KIQA 4XUFA 4V01A 1OZ1A 2Q0BA 3MJ2A 1Q3DA 1DAYA 1W2CA 4TWPA 4WIHA 4F1MA 5EQYA 2J0JA 3ORNA 5L6OA 3C4XA 3OMVA 3GUBA 2QQ7A 4GCJA 5L8LA 4ANNA 3D94A 3E8NA 2GNIA 4C3FA 2F49A 3CP9A 3D83A 4AN2A 2VZ6A 3MN3A 4FTAA 5TE0A 3DK7A 4QMNA 3ZMMA 2R3LA 4XG4A 4GFMA 4WOVA 4DF3A 3OS3A 2C0IA 4YTFA 4JG8A 2I7QA 1LUFA 5IUHA 1ZZLA 4DTAA 3HP5A 4HGTA 3UVQA 3A4OX 2V22A 4ZP5A 2PVMA 4B4LA 4DHZA 3HRCA 2Z02A 1E9HA 4RFZA 4FVPA 4C4IA 5AA8A 4AAAA 3BYVA 4L53A 3RM7A 5IEYA 2QOCA 3T9TA 4CZYB 5IH4A 4DT9A 2GNFA 3IW4A 5LQFA 5IA2A 5IQGA 4RX8A 5F20A 1GZNA 3DXPA 4JT3A 4RJ6A 4AN9A 2BZKB 5IEXA 4UALA 3NCZA 4ZXTA 3VJNA 1UWHA 4QP4A 3WF5A 2ZDTA 1O9UA 3CTJA 3V5WA 2QKRA 4J96A 4D58A 3G0FA 4G6LA 5CAPA 4FTJA 1K3AA 3DDPA 3CKXA 3BHHA 4AE6A 3R8MA 2FB8A 2WZJA 2UW9A 2B53A 3MVLA 5AUYA 5DIAA 2F57A 2I0VA 3QC9A 2BRBA 5ETIA 5EDPA 1UU3A 2QO2A 5B2MA 3EB0A 4YO4A 4AXCA 2QURA 5ACBC 4IIRA 5A6NA 5GZ9A 3K3JA 4YPSA 3ZO1A 4FA2A 2UZLA 4F9BA 4DA5A 3FEGA 1Q5KA 1KOBA 3B2TA 3ETAA 2WHBA 4LOPA 4PPAA 3CJGA 4PY1A 2CGUA 5HD7A 5CQWA 5E7RA 3W10A 4DFZE 5IU2A 2XEZA 2V0DA 1ZYLA 2W5BA 1PHKA 1OECA 1PYEA 4IZAA 4DEGA 4YUQA 4TT7A 5E8TA 3BL7A 3HAMA 5CI7A 1YWNA 4DGOA 2YIXA 1H1PA 3CTHA 3F6XA 3UC3A 4GVAA 5EYKA 4EWHA 3EN5A 4HJOA 3WILA 4EEVA 3WOWA 4RJ5A 3CR0A 3HV7A 4YU2A 3R9DA 3BQRA 2G2IA 3LFDA 2IZUA 4LRKA 3NS9A 4YJQA 4DG0E 5KKRC 4AXAA 4PMTA 5H2UA 1YQJA 3EN4A 5TO8A 1B6CB 2XAOA 4UWBA 2YJRA 3DV3A 4O27B 5AP6A 5K5XA 4AA5A 2HYYA 2JIVA 4EI4A 1OKZA 1JSUA 3COKA 3ULIA 2GNLA 3MB6A 4I94A 1TZDA 5A54A 3PFYA 3QTWA 4UYNA 4BCFA 2WGJA 2CCIA 5DFPA 2J90A 3MB7A 4QDEA 5IZFA 4YZBA 4CQEA 2YDKA 3AC8A 2PYWA 4AQKA 4PF4A 3QA8A 2WTIA 3HL7A 3GBZA 3TJCA 3ZEWA 2J5FA 4X3FA 4IX5A 4C0TA 2X8EA 3L8PA 4EHVA 1GIJA 4CQGA 5A6OA 2OG8A 3ZRLA 1VJYA 4XCUA 4D1SA 1PXIA 2OJ9A 3BLRA 3QU0A 3O23A 4RVLA 4D9TA 4FV6A 5F95A 4AGWA 2W96B 3R8ZA 1TQPA 4R5YA 2O0UA 3PPZA 3S0OA 4YZ9A 5DT4A 3NSZA 3TUCA 2XS0A 1XBBA 4XG6A 3OUKA 4D1XA 2OI4X 3PSDA 3F3VA 4L6QA 4QTAA 5JEBA 1UVRA 4LRJA 3G9LX 4ZY5A 5IA4A 3HVCA 2XK7A 1IAJA 2B55A 4L8MA 3HGKA 4FUYA 3G33A 4BCNA 4ASZA 2IVUA 4L7SA 4I5MA 2ZV8A 4C61A 4M66A 4BWPA 3O7LD 4DDGA 3SVVA 2VD5A 4GUEA 2WTCA 3EZVA 2ERKA 2QO9A 4IWQA 4OTQA 2BCJA 4DFYA 5HZNA 1H1WA 4MUQA 5AAFA 3ROCA 5HTCA 4FK6A 4F1TA 4CLIA 4YSMA 2WMXA 3HMMA 4BCQA 1GJOA 4FNZA 2R3RA 1PMVA 2RL5A 2PUUA 3CC6A 3OHTA 4XEYA 1F5QA 4M3QA 3WZDA 4FSTA 5BQ0A 4U3ZA 3RTPA 5GIPE 5JZJA 5AUVA 2YZLA 4AZFA 4GU6A 2AUHA 3MW1A 3AKJA 4DCAA 2J50A 3IW8A 1Q3WA 2F4JA 3HEGA 2ZB1A 4RIXB 3WF8A 2CKOA 4JAIA 4R6VA 3WZJA 3NDMA 2QLUA 2OLCA 3RK9A 3PE2A 4D5HA 2YCFA 2EB3A 4E5AX 4MBJA 2YM5A 5CAVA 4YBKA 3LCDA 4EORA 1O6KA 3FI4A 3OXZA 5JGBA 4DEAA 4O0YA 2VX0A 3D2IA 3Q4ZA 3O96A 5JRSA 2X1NA 1UU7A 2XKCA 1E1VA 4Z3VA 4UY9A 4XG3A 3UVPA 2ERZE 2UVXA 4M8TA 4UMQA 2ITTA 4G1WA 4TYIA 3UDZA 3QUPA 5IQEA 3EIDA 4C36A 2WMUA 4WHZA 1Q99A 2OICA 2JITA 3D7ZA 3KVXA 3WYYA 3F3UA 5CSPA 2GQRA 2C30A 2QNJA 3NPCA 5AM7A 2XKFA 4ZTHA 4AE9A 4D0WA 2OJGA 2PVHA 3TNWA 4ZMEA 2QOIA 3ZO3A 1VZOA 3AD5A 5DN3A 3VW8A 2JDTA 3LHJA 4W4VA 2W9ZB 4PNKA 3N9XA 5CS6A 2R3IA 4DFXE 4QMOA 4XH6A 1BX6A 3VF8A 4F4PA 3PSCA 3P4KA 2SRCA 3C5IA 2HIWA 3DQXA 3REPA 2P4IA 4NM3A 4BVUA 2YISA 4D4YA 1XO2B 3CTQA 5TR6A 1WBOA 2QOLA 2Y0AA 5I9XA 2OO8X 4QMUA 2PPQA 4RWJA 3AQVA 3GC8A 3UTOA 3DU8A 1QPJA 4DEIA 4HVHA 2YA9A 2VN9A 4G3CA 5C26A 3PA4A 4OR5A 4USFA 4O2ZA 1J3HA 2XNPA 4CKRA 1AQ1A 2G01A 1BKXA 4QMVA 4FR4A 1X8BA 4NM7A 4FC0A 3QWKA 3DJ5A 4JXFA 3W16A 3RZBA 4PTCA 4S2ZA 4RBLA 4G31A 4ZTSA 2GFCA 4FV1A 1OBGA 3ACKA 5T68A 4F0FA 3ZZWA 2XNOA 3R02A 4XRLA 5CX9A 4WBOA 4OUCA 4QRCA 4DT8A 2P2HA 4IWDA 4KKHA 4LG4A 3BGPA 4XHKB 3DXNA 3L1SA 3OFMA 3IO7A 2PMIA 3QD4A 5JZNA 4C33A 5HO6A 4ASDA 2ITVA 1OL2A 2C47A 4BDKA 4JQ8A 3W0MA 3CD8A 2F9GA 2WU7A 5IH6A 4CCBA 2IWIA 2WAJA 3BBWA 3GCUA 2IEWA 4CT2A 2J5EA 1KUTA 4X0MA 3CPCA 1FINA 3HYHA 3I1AA 1JBPE 3PFQA 2ZV2A 4RZVA 5ANDA 4H3BA 4YJTA 5HEZA 3RMFA 5IISA 4PNIA 2GCDA 3DZOA 4MHAA 2OGVA 4H1JA 2I0YA 3KXMA 2C3JA 2CGXA 3MVJA 4UEUA 5ACKA 3UDTA 4DGLC 4FKTA 2CNUA 3R7IA 3VRYA 4NYEA 4FTIA 4ALVA 4NL0A 3NUXA 2QR7A 3BHYA 3PY3A 4MF0A 4N6YA 4O21A 2XP2A 2FUMA 3FMJA 3HV4A 3QCQA 4JQEA 2OH4A 4CKIA 5GZ8A 3UIUA 1GZ8A 2HWPA 3VBXA 2X2KA 4QYHA 3FMLA 4X2NA 3S4QA 2C6DA 4RJ7A 4RVTA 2VO6A 4GFOA 1JQHA 2WB8A 3TDVA 3AMBA 3P9JA 4N57A 4DINA 2C4GA 2W0JA 3WI6A 5LOHA 2HXLA 3FKLA 3V5LA 3SC1A 5KCVA 4GYGA 2J51A 4PMMA 1JOWB 5CF8A 4W9WA 2LGCA 5HI2A 3EQDA 3ELJA 1ZWSA 2VTPA 5AR2A 5EM8A 2QOQA 4WSYA 3C0HA 2QHMA 2O3PA 2XK3A 4X2KA 4EOIA 2QCSA 4RLKA 4YJOA 3FXZA 4O7VA 2P0CA 2QOBA 3NW6A 5HNBA 3UYTA 1BL6A 1GY3A 4JBOA 4Y5QA 4USEA 4AW2A 2B54A 2ZOQA 1BL7A 5FXSA 1TVOA 3R1NA 4BFMA 3W2CA 4JJRA 4I3ZA 5CVFA 3WF6A 4CFWA 4IVCA 4FTMA 1H24A 3IDBA 4U41A 4MNEB 4C57A 2GU8A 4RJ4A 4TWNA 5HQ0A 4PDPA 2OJIA 3KRWA 3OZ6A 1WBNA 2ETMA 4UMPA 3TUBA 2NRYA 1FQ1B 4Q5EA 2CDZA 4HZSA 3RWPA 5AV0A 3W2RA 2FSLX 1H0WA 5FTOA 4CYIA 4ACGA 2JFMA 4MX9A 4O6EA 5AR8A 2OXXA 4JRNA 3TNPC 3COHA 2YAAA 4DLIA 4RC3A 4KWPA 3ZS5A 4HCTA 4EWQA 4BTJA 5JQ8A 4FEUA 3UG1A 1SVHA 4J71A 2B9HA 4H1MA 2C6OA 2C1AA 3PIXA 3BBTB 2XNGA 5DT0A 3QA0A 5BVKA 3L8XA 4KBCA 3C1XA 4O0WA 1SNXA 4U6RA 5AV4A 5KMLA 4ZY6A 1NW1A 4O7ZA 2X0OA 2XBJA 4FOCA 2EWAA 3DAJA 3DZQA 3QKKA 4QPMA 3ZU7A 1M2RA 5TF9A 1LEZA 4A9UA 2ACXA 3QRJA 3HMOA 1PXOA 4MQ1A 4I23A 4XNEA 4FBXA 4KRCA 3QL8A 4NZWB 4UV0A 3OG7A 5ANGA 4C3RA 3ZLSA 4DLJA 4ZZOA 1R39A 4USDA 4JQ7A 4JIAA 4KS7A 3QWJA 2VTNA 4ZTQA 3OC1A 3ZXTA 2QU5A 5I9YA 4BDHA 2OZAA 3P5KA 3TKHA 2YWPA 3W2OA 4JDJA 2PVKA 2R3OA 5LVNA 2XNNA 2YM3A 3QRUA 2ONLA 3R6XA 3RCDA 2E9VA 3C51A 5CZIA 3O7LB 3UZTA 5JQ5A 5C1QB 4WA9A 3EQFA 5EOBA 5JMSA 4KUJA 4AUAA 3P1AA 4A4OA 3ORXA 4WRGA 5C01A 4UWYA 4X2JA 3UZRA 3FJQE 3CY3A 3O8PA 2VNWA 5EW9A 4AOTA 3FL4A 2JGZA 3FLWA 4KKGA 4A4LA 2RFDA 4IVAA 5DOSA 2XJ0A 3PRFA 5AP5A 4B9DA 2WQBA 1RDQE 4R3CA 3RCJA 3KVWA 3LXPA 4XP3A 3NUAA 2C5NA 4FIEA 1OUYA 2QKWB 4FT0A 3TXOA 3BHVA 5AP7A 4XS2A 3RM6A 4I0RA 2P2IA 2PE2A 4IBMA 5ANKA 4I93A 2V7AA 3MVMA 1AD5A 1OKYA 2I0EA 3I7CA 4KKEA 4RQKA 3H0YA 4QQ5A 4OLIA 3KIOC 3OROA 1Q8ZA 4W8EA 5D11A 4NH1A 3FHIA 2R7IA 5B2KA 4PMSA 4C3PA 5HG9A 5BVDA 5IA5A 3IQ7A 4MBLA 4A9TA 2J4ZA 5TOZA 3GFWA 3PLAE 5BVNA 3EWHA 4IW0A 2UW7A 3OW3A 2CLQA 3AGMA 2XJ1A 3LCTA 3R1QA 3BLAA 2R64A 3LQ5A 3KEXA 1YWVA 1U59A 2NNWB 3OVVA 2Y8OA 4M97A 3WARA 5F9EA 3EFJA 2XNEA 2IW8A 1Q8UA 4IVDA 2V5QA 4QMQA 4J52A 3TNQB 2PE1A 3CBLA 3VULA 3U6IA 2IPXA 2ITQA 3ORKA 1URWA 4FZFB 5AR4A 2RFSA 3PUFC 5H9BA 3MH2A 3JR1A 4GL9A 4QNYA 3MTFA 3P08A 2UVYA 4M68A 3R8UA 3TNIA 4DH8A 3BZ3A 4G3GA 1JNKA 3FMHA 4HPTE 5LCKA 3VBWA 3BU6A 4ZTRA 3VVHA 4S31A 4FEVA 5HBHA 4RPVA 2R2PA 2YIQA 3MY5A 4QTCA 3ZDUA 4AZWA 5AR5A 4AZEA 4E26A 2C6LA 4JDHA 3FLSA 3ZH8A 1XJDA 1ZYJA 2BUJA 4W4YA 5KBRA 4LL5A 1VLRA 2WELA 3UNKA 4G16A 4K2RA 2YABA 4OBPA 3TL8A 3K3IA 3UG2A 4CG8A 4ZMFA 2GPHA 4HGSA 4U7ZA 4O1PA 4FSWA 4D2RA 5FUTA 2OFVA 4I5PA 3PJ2A 2IO6A 4X3FB 5FG8A 5HX6A 1W0XC 4ITHA 4KIOA 3W2QA 1S9JA 4RFMA 2GFSA 3PPKA 3EOCA 4RFYA 5HO8A 4ZZNA 5K5NA 5J7BA 5C8NA 1CMKE 4D55A 5B2LA 1UV5A 4O7WA 3K5UA 4G9CA 1XR1A 3KCFA 4RWIA 2P33A 3FPQA 3SDJA 3ANRA 4M13A 1FPUA 3ET7A 2A27A 3A8XA 2I40A 4FV0A 4MD7E 5CLPA 3VO3A 2EXCX 4FTTA 4EOQA 4AT3A 1WVXA 4ASEA 3LFCA 5K0XA 3EQCA 4PP7A 3FYKX 3PJCA 2JKQA 2PK9A 2R3PA 4U79A 2ITOA 4TTHB 3VS5A 1U54B 3NNVA 3ZSHA 3QQJA 1Q8TA 3SLSA 4CTCA 2UZBA 4CVAA 3MFRA 3GNIB 1LEWA 5AM6A 3SXSA 4Y8DA 3NUYA 5IMXA 2CCHA 3R22A 2OKRA 4IXPA 5JFVA 4D2PA 4IQ6A 1CKPA 3QTIA 1U4DA 4TYGA 5K9IA 2HW6A 2R3QA 2W06A 3G15A 4CTBA 4PDSA 3RINA 2IZSA 1Q8WA 3TG1A 1T46A 4EOMA 4MTAA 3U87A 4X6QC 3UDBA 2WIPA 4FKOA 2PSQA 3R7EA 2YM4A 4Y46A 4NWMA 3FMKA 4EHGA 3HKOA 3OXIA 4YC8A 3LXKA 2W17A 3RPOA 5E8YA 4NM0A 3QYWA 4A9RA 1QPCA 2X8IA 4LDTA 3MYGA 3QD2B 3PP1A 1OMWA 4RA5A 1Q97A 3SG9A 4FF8A 4UYAA 3C5UA 4IH8A 4QMYA 3LFNA 5DGZA 5EI6A 4ACDA 5AIKA 2O65A 2RSVA 1FMKA 3E87A 4BBMA 1BMKA 5M51A 3FAAA 2X8DA 4GK3A 3QZGA 4TNBA 5E8XA 5M53A 4FSZA 2XK4A 4EK8A 4C4GA 2QR8A 4FKSA 4FYOA 4FTUA 1FVRA 5DBXA 4BICA 3GI3A 3H9OA 4N6ZA 5TKDA 2UZUE 3Q9WA 2A1AB 4FTNA 2ETRA 4LGDA 4ANMA 1IR3A 4RMZA 4LV8A 3GCQA 2VWVA 3PWDA 4CCUA 4IWPA 2ZYBA 2WU6A 2VO3A 3F2NA 5FEEA 4NKAA 3D5WA 3CD3A 4MQ2A 4RJ3A 4MXAA 3QXOA 2YEXA 5HKMA 3UIBA 4Z55A 2YIYA 1M2PA 4EH5A 5EHOA 3V5TA 4BB4A 2FA2A 4P2KA 4QYGA 5DE2A 4ZSAA 1W8CA 3ORLA 3ATTA 2QU6A 5JFWA 5BUEA 4OTHA 3C0IA 4FI1A 4YHFA 5KBQA 4TWCA 2A2AA 4BHNA 1DI8A 5FWKK 1Q4LA 2VWYA 3KQ7A 5A4QA 4TPTA 2VO7A 1J7LA 1UKHA 4F99A 4IX6A 4BZNA 4C4EA 4R7HA 3FZOA 2BHEA 5HE1A 3DB6A 3W2SA 3UOHA 4L01A 3SQQA 1XH5A 4GK2A 4IMYA 1OI9A 4U97A 2AYPA 4ZTLA 3ZM9A 2CPKE 3W18A 5AP4A 3QUDA 3OUNB 2PZIA 4TYJA 2X39A 3UNZA 2R7BA 3KREA 4B8LA 2RKUA 4L00A 1V0OA 3KKVA 2HWOA 4FV2A 4ANLA 3AGLA 2IZTA 5L2QA 3KA0A 2VWUA 2C5XA 1W7HA 3F3WA 3GGFA 3JY9A 3SAYA 2JDRA 1YI3A 2Q83A 1ZAOA 2ITYA 3OOGA 4R1YA 2YIRA 4ALUA 5AX3A 3AT2A 3G0EA 3VAPA 3DKCA 4DG3E 2Y6OA 3R7YA 3KGAA 5IPJA 1ZOGA 5GJGA 2JAMA 3WYXA 5IQAA 4UMTA 2AC5A 4BDAA 3TTJA 5J8IA 3G51A 4R8QA 3RPSA 1WBSA 3VS7A 3CSVA 4O7LA 5C4KA 2ZM1A 1JKKA 4NUSA 3E64A 4IADA 5KZ0A 3D7TA 5CSHA 3TJDA 2UZVA 4EZ7A 3QQKA 1UNGA 4OBOA 2CSNA 3NEWA 3BHUA 4F6WA 1H25A 1AGWA 2W1ZA 5J95A 5EHLA 2E9PA 2GDOA 4AXEA 5IF1A 1YHSA 3MTLA 4NEUA 5KNJA 3UMWA 3QTQA 4EYMA 3QQGA 2R3JA 4KBAA 2J7TA 3CKWA 3QTRA 2XANA 1P4FA 3ZUUA 3KXNA 3VUMA 3C4ZA 3PXZA 1L8TA 3R83A 3NNUA 3R21A 4ARKA 3NVMB 3KULA 3Q96A 4M7IA 4EOSA 1U46A 3BELA 5EYMA 3CQEA 2VNYA 4CZUA 2JDSA 3CE3A 3G90X 3COIA 4FRFA 3CLYA 3DFCB 2OK1A 4NFMA 3QHRA 1YDSE 4WUNA 4XV1A 3DY7A 3SXFA 3UBDA 4BF2A 1Z5MA 1MQBA 2GQGA 3FMNA 5D1JA 2W5HA 3BIZA 4CV8A 3IOPA 3V5PA 2WQMA 4LGHA 4AS0A 5KMOA 1BLXA 2JIUA 3P79A 4IWOA 3BYOA 1H4LA 3FXXA 3ZUVA 3NNWA 4XG8A 4J1RA 3NAYA 2O63A 3E92A 3BE2A 4FVRA 4MXYA 2OJFE 4BBEA 3ID6C 2W4OA 2V62A 4FKUA 3P86A 3PA3A 2PL0A 3VS3A 5LWNA 4I92A 2V7OA 4FSRA 4JBVA 4EOLA 3OXTA 3TEIA 2XVDA 4F09A 5HG8A 4B8MA 4OTDA 5HBJA 4E20A 3HV3A 3GENA 3GOPA 4HYSA 4JOAA 2IVTA 3QZFA 3MVHA 4JIKA 5ANOA 4BWXA 2QODA 4DGNA 3ORPA 3DPKA 5IDNA 4D2WA 3O71A 4ZLOA 4HGEA 3DNEA 3R30A 2B9JA 4L3JA 2F7EE 2VWIA 2Z60A 4A06A 4DC2A 4X6RA 1ATPE 1U54A 2UZOA 3GCVA 3TMOA 3R71A 3H3CA 4HCVA 3R9HA 4F0IA 4HW7A 3PE1A 4JX7A 2RGPA 3SW7A 3ULZA 3RKBA 3D2KA 5CEPA 1R1WA 2HOGA 2YERA 5BNJA 4GMYA 1M7QA 2A19B 4NTTA 4RLLA 2YWVA 2DQ7X 4K8AA 4YO6A 4AWIA 1UWJA 3VN9A 4E73A 2YM6A 2HENA 4U81A 1RE8A 4GYIA 2AEGA 4EJ7A 3L9NA 2OZAB 1MQ4A 3QF9A 2V55A 4QT1A 5AV1A 4TY1A 4AZTA 2ZVAA 4XV2A 2WTJA 2OBJA 4D0XA 4FZ6A 2C6TA 3Q2JA 4YBJA 4YC3A 2BZHB 4F9AA 2VU3A 4MF1A 2RF9A 3NAXA 3UC4A 4X2FA 5ANIA 1W83A 5FDPA 2BDJA 2X0GA 4WSQA 5J9YA 2CHLA 3ORTA 4IHPA 4TNDA 3RAWA 1WAKA 4ITIA 3LCSA 5I4NA 3QLGA 3R01A 4YJRA 1FGIA 4K11A 3FV8A 3QGWA 2ITUA 3P23A 1OPKA 4BZOA 5FLFA 2JEDA 4DAWA 2IJMA 4EC8A 4O7SA 3MA6A 3NNXA 1NT2A 1W82A 3LKMA 2UZWE 4CFUA 3NX8A 3U6HA 4EQCA 2AQXA 4BIBA 2XRUA 5HNGA 3BLQA 5ETAA 4C59A 5LMBA 3LQ3A 5EKNA 3VBTA 4AZVA 1YXUA 2PU8A 2ITPA 5DPVA 2NYAA 5M07A 3T3VA 3BX5A 4V05A 3CY2A 3PWYA 1URCA 1MP8A 4GKHA 3M1SA 4P7EA 4AXDA 1NA7A 3OBGA 4MD8E 1Y91A 3I4BA 3RVGA 3NYXA 4YZDA 4HNFA 2NP8A 2ZMDA 3EQIA 4WO5A 3TV7A 3SW4A 4DH7A 2C6MA 5FBNC 4BCPA 4DHJA 3OT3A 5E8UA 2G1TA 4C2WA 3NUPA 3EQGA 4U3YA 2C0TA 1XH7A 2YCQA 4A07A 4U45A 2PTKA 4F08A 3HDMA 4YLJA 5HCZA 4E6DA 5CEKA 3EQHA 5E91A 2XIYA 2PVNA 1OIRA 2EVAA 5DR9A 2HW7A 1GZOA 1U5QA 2JKKA 3HRFA 3NYVA 5BMMA 5CU3A 4AT4A 4AGUA 2Y4IC 5E1SA 2XK8A 2C3LA 3BEAA 4PPBA 4DITA 2FSTX 4AXFA 4IAIA 4WUAA 1R78A 1YI4A 3L9LA 2BKZA 3P0MA 2CKPA 5DRDA 3FLQA 5M57A 3W33A 4IAYA 4FTOA 5HG5A 3SOCA 2HELA 1YHWA 4AGDA 3UO5A 4EHEA 2HAKA 3SA0A 2Y9QA 2YLFA 3Q4TA 3R9OA 4P5QA 3E62A 3UZPA 1OL7A 1GNGA 3PXFA 4XP0A 3MPAA 3PSBA 4E7WA 3S00A 4XOZA 3BCEA 1VYZA 1J1BA 1YWRA 4BCOA 1WBPA 4BDJA 1OGUA 3LFSA 2XBAA 4ZY4A 3L8VA 5DT3A 3RK5A 4FIIA 2UVZA 2ITZA 2PMLX 4H58A 5K0KA 3LPBA 3FKOA 1B38A 5HVKA 3A8WA 4IANA 2PVJA 2VUWA 4V04A 5CZHA 5DG5A 5F94A 1B39A 4H05A 4EJNA 4APPA 4DH1A 3NVKI 5F1ZA 3JY0A 4AP7A 5HOAA 4D4SA 3KXXA 2X81A 4F65A 1T45A 3DDQA 4CGAA 4K33A 2YM7A 5AIRA 2VTIA 2WNTA 1JPAA 3GU5A 4QMXA 4ZK5A 3C4EA 2EU9A 2Z7RA 1YI6A 3VHEA 4RVMA 4CFMA 5IG1A 3QD0A 4QMMA 3TWJA 1OBDA 1JWHA 3MH0A 4M15A 5KHXA 4WG4A 5FD2A 3BHTA 2G9XA 3GEQA 1PXNA 3BWJA 4UWCA 3PVUA 1K9AA 5FRIA 5J9ZA 4PTEA 5A14A 4ZS4A 3OEFX 3F3ZA 1MRVA 3SHEA 2IZRA 4LUEA 3IECA 5CENA 1BI8A 2G15A 4EKKA 4FNXA 1ZZ2A 1CTPE 4U43A 3A61A 2XCHA 4NFNA 3LIJA 3DGKA 4MVFA 1Y8GA 4I20A 3F7WA 2X0PA 5M44A 3TZ8A 3DBDA 4YNEA 4G34A 2OF2A 1YDRE 4KINA 5CF6A 3QTXA 3CS9A 4PDYA 1FOTA 4YC6A 2W4JA 4FSQA 2C6IA 3GU4A 4PL5A 3QAME 4MKCA 4EK5A 1FVVA 3THBA 4C35A 2GS6A 3W0NA 4XBRA 5EQPA 4KBKA 3WZKA 1PKDA 4IAKA 5M55A 5KMNA 3NLBA 5KHWA 2QG5A 3VBVA 2J6MA 4H3QA 5AV2A 2WFYA