4A9UA

Crystal structure of human chk2 in complex with benzimidazole carboxamide inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
304
structure length
287
Chain Sequence
MSVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKDPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Benzimidazole Inhibitors of the Protein Kinase Chk2: Clarification of the Binding Mode by Flexible Side Chain Docking and Protein-Ligand Crystallography
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 287
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a9uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a9uA01
3LM5A 5FLFA 2CKEA 2G9XA 3CE3A 4BDFA 1XQZA 3V01A 5KMMA 3KMMA 1PMVA 3U9NA 3I5NA 4GT5A 2YERA 3PSBA 4QTBA 1H08A 1KE7A 2IZUA 5AMNA 3EYGA 3VS7A 3IS5A 4BDAA 2G15A 3JUHA 4KINA 4WUNA 5EM7A 4WOVA 5BUIA 5HZNA 2PE0A 1QPCA 4XOYA 3ORXA 2QG7A 2VWBA 3FI3A 4XV1A 3O50A 5H8GA 4B9DA 1VJYA 4FL3A 3II5A 3I6UA 2WPAA 2E9VA 2BROA 2J0KA 4FTNA 5IU2A 1QPJA 2GHGA 4FR4A 4AACA 4BBMA 5AR8A 2XCKA 4R5SA 2C47A 3KGAA 5TO8A 2IJMA 4PDPA 4XG4A 1FOTA 3EQBA 3WYXA 2IN6A 3LFDA 4L7SA 1H1WA 2EU9A 3KN5A 3O8TA 4FT9A 4GEOA 4M14A 4OTWA 5AP2A 2F2UA 4DEHA 4YTFA 5BVNA 5IQGA 4QP4A 3QU0A 4FEUA 4D0WA 4YJPA 1LPUA 4NK9A 3IK3A 5J1VA 3BWJA 2A4LA 3TNPC 1J7LA 4PDYA 3LXKA 4X3FC 2WFYA 5CZIA 4BTKA 2YCSA 4DFBA 1DAWA 3DQWA 4LL5A 1ZOHA 4E4XA 4A06A 4GVJA 4G5JA 4MQ1A 2J6MA 4IH8A 3TUBA 5IQEA 1Q61A 4AN2A 2WQNA 4KWPA 5I3OA 3R8MA 3U51A 3NW6A 2RFEA 3L9LA 3V8SA 2PL0A 2AC5A 4JX7A 4NWMA 4AGCA 4C38A 1FINA 2HENA 5DFPA 2VWUA 5E8ZA 3V5JA 2IZSA 3GNIB 4QNAA 4O84A 5L2TA 5AUVA 3NUAA 1XWSA 4L3LA 3CC6A 3W55A 1B38A 5AR7A 3COKA 4D2SA 3QQKA 5EOLA 3FQSA 2CMWA 5AA9A 2X6EA 4BVUA 4MNEA 1WMKA 3I6WA 4L7FA 4C4IA 5KX8A 3AC1A 4BCNA 5L2SA 2HXQA 3F5GA 1WVXA 5CEIA 3QA8A 4K6ZA 4PQNA 5D7AA 1Y6AA 1Y8YA 3F5PA 4FODA 2VGPA 3VULA 4AE6A 3AGLA 3E3PA 1XH5A 3SOAA 2OJJA 2OXDA 2WB8A 4FZ7A 4ZTRA 1CMKE 1ZYCA 3DFAA 3MWUA 2G01A 4X2GA 5D7VA 4W4VA 4YMJA 3OP5A 4XEYA 4FV9A 1JKSA 3VHEA 3NAXA 5E8TA 4WSYA 3LCTA 2XM8A 5CAVA 3D14A 2OJGA 4TZRA 4AOTA 3TV7A 4O7NA 4EOIA 4W9XA 5BVKA 2YJSA 3JXWA 1IEPA 4GJ3A 1R0PA 3KULB 1PW2A 5CASA 3F7WA 4M15A 3V6RA 3A7GA 3RAIA 5HE2A 4AT5A 3KCKA 1SZMA 2VTJA 5E8XA 3TNWA 4QMUA 2E2BA 1MP8A 4NJDA 3NS9A 4O1OA 5EW9A 3ALNA 3WIKA 5KMJA 3UQCA 4K33A 4X3FB 4CQEA 4BCOA 4EHEA 4D28A 2FSMX 2W06A 3BE9A 4I5MA 1VR2A 3ACKA 3UODA 4KS8A 1GZKA 2JDRA 3UMXA 4ENXA 1FPUA 2ITOA 3LXNA 4G31A 3D5WA 1ATPE 5ETFA 4H3BA 5HCZA 5K9IA 5DRDA 2X9EA 2XIXA 3HRBA 2XIKA 4RJ8A 1ZWSA 3FKLA 3G0FA 3RWQA 4BIBA 5FXRA 3U55A 1LUFA 2E9OA 3FI4A 3GGFA 3PZHA 2OG8A 2X2MA 5LCKA 3MJ1A 4F9BA 4CRLA 5HIEA 2C0IA 2E9UA 4KB8A 4PL4A 1OUYA 5C4KA 2VO7A 4CKIA 2DUVA 2EVAA 1ZOEA 2YIWA 3WF7A 4RVKA 4EC8A 3F7ZA 4O83A 4OTQA 1R39A 2V55A 2WQMA 1YOJA 3A7JA 3HA8A 4G3FA 3KVWA 4E1ZA 4EYMA 3OW3A 2RG5A 1REJA 4FV6A 2BDFA 3PIZA 4C58A 4KSQA 4CD0A 5HLNA 3QYWA 4QP8A 3K54A 4MEDA 3BPRA 4EOOA 5BNJA 3NNWA 1Q24A 4PPAA 4OBQA 1Z5MA 2PE1A 3PFQA 2UZDA 3ZC6A 1Z57A 2UZLA 2ITNA 1OI9A 4GU9A 2A27A 1M7NA 4I4FA 1E1VA 3PXQA 3R0TA 3G6GA 5LVPA 4NL0A 4IAAA 3U6HA 5E1SA 3R71A 4KUJA 1NT2A 2OIQA 1Y57A 2WKMA 4JX3A 3GVUA 3IECA 3BE2A 4JXFA 4YJOA 3QF9A 2PZ5A 4GSBA 5AUXA 2P2HA 3MBLA 2UW4A 3QUDA 3NNXA 4QYEA 5T68A 3TNIA 5IISA 1H24A 3WIGA 4RJ3A 3SKCA 3Q52A 2VN9A 3U8WA 5FTOA 4M13A 3DBCA 3H4JA 5HX8A 4ACGA 3FXWA 2B54A 3UVQA 2EXEA 1IG1A 4S2ZA 5HLPA 3RK9A 3SC1A 4U42A 4C36A 4ZY5A 4N6ZA 5DOSA 2R5TA 5F9EA 5LQFA 4J98A 2ERZE 2UW9A 2J4ZA 5E90A 4QP1A 4HYUA 4MXOA 2NPQA 4HZSA 4QMZA 5HIDA 2PSQA 3GU4A 4GH2A 4QQJA 3A8XA 2EXMA 3L8VA 4GMYA 4IC8A 4MBJA 4QOXA 3ODYX 4XLVA 4FSTA 4CT1A 2RSVA 1VEBA 2RFSA 3QL8A 4YBKA 4AE9A 3ROCA 2PTKA 5AM6A 5AV1A 4CQGA 3NNUA 3KEXA 3FHRA 5ITAA 4TYEA 5L6OA 5EQEA 4G3GA 2O63A 4WRGA 3TCPA 3FMHA 4CCUA 3GENA 4WSQA 5E8YA 4EBVA 3D7TB 4ERKA 3LFQA 5L8LA 3MESA 3COHA 2OH0E 3MYGA 5FWKK 3BLQA 3PG3A 5CU2A 2B9IA 3FLWA 4C59A 4UWYA 1KE5A 4L3JA 1UU8A 4DT9A 4ID7A 4AW5A 4CKRA 3NLBA 4L46A 3EFJA 3TTJA 3OROA 4NH1A 5A4QA 3QTSA 2CLQA 4WA9A 5J9LA 3B8RA 1DM2A 4XP2A 2E9PA 2ITZA 5CI7A 4NFNA 3G0EA 3WBLA 5IUGA 4ZSGA 3PE1A 3S4QA 4DEBA 2RFNA 1E9HA 4AZFA 4UX9A 5AFVA 4RIYA 4K1BA 3M42A 5CEOA 4DCEA 2WD1A 4Z16A 2G2HA 3OF0A 4FX3A 4O0UA 3LJ1A 1KE8A 2ITQA 2C1BA 2QOCA 3G9LX 2QONA 3OY3A 2PZPA 2JITA 3HAVA 3C0IA 1UV5A 2ETMA 1OBGA 2C3KA 1H4LA 4FTUA 5KE0A 1ZOGA 4ZJVA 3F2AA 4YJRA 5GIOE 4XYFA 4RQVA 4OTHA 3K2LA 4RZVA 5I0BA 5L6PA 2X8DA 3PXYA 4YJUA 3UG1A 3H9RA 3DLZA 3G2FA 1T45A 2JKOA 1JLUE 3ERKA 4JDJA 4UEUA 1Q41A 5A9UA 4I0RA 4KIQA 3PA5A 3FDNA 1XR1A 5CF4A 1XH8A 3V5PA 1UWJA 4ALUA 1PMNA 4JBOA 1OIRA 5J7BA 3PJ8A 4EK8A 3L8XA 5B2MA 4NW5A 3SW4A 1YWNA 2UZEA 4TRLA 3ORTA 3A2CA 2UW8A 2ZOQA 3AD5A 3RPYA 5M56A 5CS6A 1Q3WA 3RAHA 2OLCA 2GPHA 3KRXA 4UB7A 5AP5A 4LI5A 4ZTQA 4UZDA 5HEZA 3MSSA 1U46A 4H1MA 4OTIA 1HCLA 4U43A 5BVEA 2IW9A 5DVRA 4WNOA 4Q9SA 4BCKA 3PG1A 2VTTA 2IVVA 3DAEA 3P78A 1FQ1B 4ITHA 1SVGA 4EKLA 2O64A 3DXQA 4FSZA 3V5TA 2PZIA 3UO5A 3ZUUA 4EBWA 4GL9A 4J97A 4M8TA 4NTSA 3Q2MA 4RLKA 2OH4A 1H25A 2ZV2A 3JPVA 2WQBA 2ZV9A 4I4EA 4V0GA 4W8DA 5J9YA 2UV2A 3FL4A 3DLSA 4R5YA 4YZNA 3RAWA 1J7IA 2C3LA 5AAGA 3UNKA 1AQ1A 4I6QA 3R7OA 3VS0A 3VF8A 5DEWA 1GZOA 3WYYA 2PUIA 5GHVA 4CRSA 4ASZA 5BYLA 2FH9A 4BFMA 3R8PA 3PXZA 4QMXA 5ETAA 4ZEGA 1WBNA 2V62A 2JKKA 4YJSA 2WIHA 5AADA 2ITUA 3WF5A 3NX8A 4K9YA 4M68A 1PXIA 3VAPA 4FVPA 3M2WA 5CSWA 1JKKA 3DZOA 5FD2A 4ZXTA 3VS1A 3VVHA 4ANNA 5E9EA 2VNYA 3F88A 4YJTA 4IE9A 2DWBA 3R7IA 2PU8A 4IB5A 3SGCA 3V8TA 4FICA 4A4XA 2RF9A 2XP2A 4R6VA 2H8HA 3OD6X 2QODA 1REKA 3I5ZA 3ANRA 3V51A 4ANLA 4CSVA 1A48A 5HIBA 4O0TA 3DTCA 5FBNC 1U54A 3E62A 3PJCA 5F1ZA 1GIJA 2EXCX 2OZAB 5A3XA 4TL0A 3LIJA 2YM3A 5HU3A 1F0QA 1FVRA 5I9ZA 5KHXA 4MKCA 2GNLA 4F64A 3UJGA 3H9FA 2FO0A 1GIHA 4R78A 3JR1A 4UMTA 2BRNA 4MXXA 5FEDA 3MB7A 4IAYA 4BHZA 4MX9A 3OZ6A 5CANA 3EQFA 4FSMA 4B99A 4TT7A 2CNVA 1WBPA 4LV8A 3CLYA 4AFEA 2XIRA 4UXLA 4L9IA 5KMIA 4G1WA 2WMXA 2XJ2A 1DS5A 2YCFA 5AR2A 4B8MA 4EKKA 4ZY6A 5EI2A 1PXMA 4F70A 3HMMA 5JFVA 2R7BA 3B2WA 4F9CA 4DFLA 4LG4A 2GQGA 2WTDA 4FSNA 2Q83A 4MXCA 2OFUA 4PDOA 1PKGA 4PTGA 5HO8A 5CXZA 2P55A 4I1ZA 3UG2A 2XZSA 3A4OX 3C5IA 4FIGA 5LVOA 2C6MA 4JDIA 4X7QA 3GFWA 4IM0A 3HECA 1H01A 4PX6A 4YJNA 2JBOA 2H34A 4U7ZA 4ZAUA 1R78A 3FLSA 4AT4A 1MRVA 3HYHA 1G8AA 4DEIA 4MD8E 3MH2A 4TYHA 4H39A 3PXRA 3ATTA 5CF8A 3P23A 5JFWA 2Y4PA 3FC1X 3NUSA 3FZOA 3BBWA 4W4YA 5J87A 2R3GA 3O0GA 4B7TA 5IUHA 5KUPA 2J0IA 2R2PA 4KBCA 1H07A 2FA2A 5AIKA 5FXSA 3F5UA 3OXZA 3VUKA 2BZKB 3CXWA 4FT3A 4ALWA 2WU7A 3LM0A 2CPKE 5CYIA 3W16A 1M2QA 4B6LA 5KMLA 3QZFA 4FG8A 4FKQA 3VC4A 3Q9ZA 4U45A 4DTBA 4RSSA 4KD1A 1WCCA 1XBBA 3IOKA 4FT0A 3IG7A 4IVCA 4LRMA 4M0YA 3DCVA 4MYGA 4FKUA 4YSMA 4C33A 5DMZA 4O7VA 4EQCA 2QKRA 3GB2A 3MS9A 4LOQA 4QP6A 5IA4A 3OUKA 4LMNA 4Y5HA 1ZRZA 3VS6A 4ANQA 3E5AA 3VUGA 2P4IA 1G5SA 3WZJA 4WHZA 3QTWA 3O8PA 4CMTA 1OITA 3MVHA 2ESMA 3SOCA 4CV9A 3GCQA 1W82A 2ZAZA 3QRIA 5HKMA 4BCFA 4Z3VA 3N4TA 5J1WA 3NWWA 2UW5A 4BKJA 4DAWA 2CGXA 3W2PA 1A06A 3R1NA 2CKOA 2ZDUA 2R64A 5CI6A 4ZTMA 4BY9E 4Q9ZA 4RQKA 2WTJA 3FPQA 5L3AA 1PKDA 3C5UA 5AV3A 4EHGA 3BBTB 1WZYA 3KXZA 4QP9A 3TNHA 5GIPE 3PTGA 4YUQA 1Z9XA 3Q32A 2BIYA 3T8OA 2VRXA 2FSLX 5GINE 2BHHA 1OB3A 4XHKB 4FKVA 5T3QA 4UMQA 2WXVA 4AZTA 4KIPA 5HO7A 4OBPA 3UIBA 3GU8A 3ZO4A 1PMUA 3SG8A 3E8DA 3UBDA 5F20A 4CFFA 4IJ9A 4GU6A 3O8UA 4OTGA 4QMPA 4CFVA 2C3JA 4MHAA 5CAPA 2WMAA 3DDPA 2QR7A 3OY1A 2PE2A 2R3OA 3DA6A 4IBMA 4Y73A 3T3VA 4DFZE 4CG9A 3U9CA 4E26A 3TUDA 2X8EA 3VQHA 4NM3A 2HZNA 5BX0A 2BRGA 3GOKA 4UZHA 4EH7A 2FSTX 2LGCA 3AQVA 4AUAA 2YM6A 3IQ7A 4BCIA 3FMJA 2XNGA 3C4FA 4PL5A 1GAGA 5CLPA 4JQEA 3HDNA 4GIHA 4BBFA 1J3HA 4GJ2A 1P2AA 4DITA 5FRIA 5C9CA 4UN0C 4AP7A 4C2VA 3QQLA 2ITYA 1PMEA 3H30A 3ODZX 1W84A 3NUUA 3EKKA 3C0GA 4J7BA 4ZTLA 5AV2A 1V0PA 3R8LA 2Y9QA 4F1OA 2V7OA 5AUZA 3NUPA 1H1PA 4I5CA 3QRTA 5FBOA 2I1MA 4C3PA 2C0TA 3DK6A 4RPVA 2OXXA 3ALOA 4PMSA 2QOHA 4IFCA 4XV2A 2CGUA 1YDSE 4QYGA 3MPTA 3SHEA 3FY2A 3ENHA 3DBFA 4C37A 4NIFB 3UQFA 4N6YA 3MGYA 2UZVA 4K77A 4QMSA 3NR9A 4U3ZA 3BEAA 3AC8A 4QPSA 4XG7A 3I79A 4X6RA 5IQBA 2B52A 2VAGA 3BU5A 4EH5A 3CJGA 3KXNA 2UZWE 3ORLA 3LAUA 3ZSGA 1MRYA 3P1AA 3S2PA 1ZYDA 5TF9A 4I94A 4TWCA 1ZY5A 4QTDA 4QMQA 4IWOA 5KZIA 3JY9A 3SRVB 3W8QA 3ZXZA 5LMKC 4EK6A 2I7QA 3EKNA 3NUNA 2HW6A 3FLYA 1IAJA 3R2BA 3QYZA 4FV1A 3O23A 4XG6A 4XRLA 4UMUA 2XNOA 3HV7A 4GIIA 3FKNA 4WBBB 5J5SA 4FG9A 5T6KA 3ZFMA 4IC7A 3ACJA 4IAFA 4IQ6A 4ASDA 4YZMA 2UUEA 3FMMA 1NW1A 3KXGA 1UU7A 4J99A 4RT7A 2X2LA 5HHWA 4D2VA 2WEIA 3DBQA 3REPA 4DLJA 4TWOA 3RK5A 4X2JA 1XH6A 4IVAA 4KSPA 3BYMA 3VUIA 4UV0A 3RNYA 3L1SA 4NYEA 4EOQA 3A7IA 4UMRA 4M69A 5B0XA 4KNBA 4KKEA 2C6KA 4M3QA 5HNIX 4D2PA 1FVVA 5EFQA 4BC6A 4C3RA 2DS1A 3IOPA 3QQHA 4FTLA 4TY1A 4EQUA 4EH6A 4IZ5A 4RZWA 4R7HA 2R3JA 1JNKA 3HKOA 5JGBA 4RBLA 1OL7A 3ZM4A 3MH3A 1JSTA 2W0JA 2YCQA 4YHFA 3UVPA 5CAQA 5JKGA 4S31A 3D15A 3CPBA 4PV0A 3FI2A 1M14A 4ZP5A 2FYSA 3MH1A 2VU3A 4WG4A 4ALVA 4EI4A 3A62A 2GHLA 2PMOX 3RHKA 3F69A 4EQMA 1GOLA 1W83A 3PA4A 3MA6A 3ZUTA 3OXIA 5H2UA 2BUJA 2QO2A 3I4BA 4HGLA 2VTSA 3C50A 4KRCA 5CT7A 5CSXA 3VRYA 4G6NA 3W2QA 5A4TA 2XNNA 4E4LA 3NZ0A 5C26A 4F0GA 1XBCA 3D0EA 2X4FA 4YO6A 3PXFA 4BZOA 5BUJA 4TTHB 2WAJA 1URCA 2CLXA 3IGGA 1WBSA 1U4DA 3C13A 3ZC5A 1JPAA 3LPBA 3ORIA 4FKOA 4MTAA 4QMYA 5D9HA 5JH6A 4KA3A 4IW0A 3BX5A 2GNGA 3DNEA 5DHJA 5B2LA 1O6YA 4TN6A 4UWCA 3MB6A 4JLCA 4HVIA 4GW8A 4EUUA 4N4SA 4F99A 3NIEA 4PP7A 3DFCB 3EOCA 2IG7A 4I5HA 3RM6A 3B2TA 3RP9A 1PF8A 3KF7A 2QKWB 2J7TA 3C4CA 5IQAA 3RBWA 2UZBA 1JKLA 4DHFA 3FMLA 2VWZA 4E5BA 5I9VA 4MQ2A 1OPLA 1Q99A 1K9AA 5DWRA 3PVGA 3KC3A 3N51A 2PWLA 3LMIA 1YWRA 1UWHA 2HCKA 4FV3A 4ASXA 5FEEA 1KE6A 4JNWA 4ANMA 4O0RA 1DI9A 3DGKA 3H10A 3NGAA 2VTHA 2XEZA 4X6QC 4AOIA 4JDHA 5H9BA 2OU7A 3AGMA 3BRBA 3QQGA 3VW8A 5EK7A 4E73A 5D11A 3AG9A 3PY1A 4Y8DA 4ZSEA 2QU6A 3ZU7A 2WMUA 3DZQA 4GYIA 3R02A 4RA5A 4D9TA 2P2IA 4QQTA 5AUUA 4FKTA 2BTSA 5KMOA 3U6IA 2UW3A 3P86A 4FV7A 3SDJA 5D12A 3WZKA 2IWIA 3VN9A 5J7HA 3EFWA 3RK7A 3Q53A 3E93A 1ZMUA 4DGGA 2B53A 4FT5A 3Q6WA 3DNDA 4QMVA 3OOMA 5HCXA 3GP0A 2Q0BA 3CS9A 1S9JA 4EH2A 4EOJA 3W2CA 4DGNA 1SYKA 4EHZA 3F61A 3V6SA 1P14A 5A6NA 2JAMA 2UZOA 1M52A 4FKPA 4FYNA 5AWMA 4E4NA 5C8NA 5J5TA 2PYWA 5EKOA 4FTQA 3C1XA 4NT4A 4FI1A 4BWPA 2QG5A 3HX4A 2XF0A 1BX6A 4N0SA 4PWNA 2QOIA 2XNPA 2YIYA 1CKJA 2J5EA 3KK9A 5CTPA 3FLQA 2B7AA 4FA2A 3DB6A 2I40A 3P7AA 4UWBA 3CJFA 3BGPA 2XM9A 2Z7LA 2GS2A 3GQIA 5FP5A 4FT7A 1MRUA 2O2UA 4RWIA 4FK6A 2DYLA 2QI8A 5FTQA 4QMNA 3H9OA 5J95A 4EH8A 2JDVA 4L45A 5ICPA 1OL5A 2GSFA 3AD6A 4CFNA 2C69A 3P7CA 3OT8A 3GU5A 3QQJA 4MNEB 3ZO2A 4O7TA 4BHNA 5K0KA 3R7EA 2EWAA 2VNWA 4V05A 2HK5A 1VYWA 4FKIA 3R7UA 4FSUA 1UU9A 3ZTXA 3K3JA 5L6WL 2XJ1A 4IEBA 2R3MA 2I6LA 4LGDA 4MXAA 3HV5A 5I9YA 1W7HA 2OW3A 4FOBA 2GQSA 3LLTA 3BELA 3QRUA 4XG8A 5L2WA 3NPCA 4FIHA 1WBTA 2R0UA 3JYAA 2GTNA 4ZSLA 4P5QA 4Z9LA 3R00A 2PZYA 2Z7SA 4TYGA 4E5AX 3TV6A 3C9WA 4A9TA 4F4PA 5ANEA 2GNJA 3LFSA 4YPDA 4Y5QA 3MVJA 2W1ZA 3QCQA 4FF8A 3W2RA 5M44A 2JD5A 3QX4A 5TR6A 3TZ9A 3VS2A 1L8TA 4RA4A 5JZJA 3P79A 3GFEA 3NW5A 3UGCA 3NYOA 2GFCA 3G5DA 1R0EA 3KREA 3QUPA 4ZJJA 5DBXA 2BFYA 3R8UA 2XVDA 2R9SA 4GK4A 3NIZA 4DH7A 2NRUA 4OBOA 2XB7A 2C1AA 3ITZA 4IX6A 5JRSA 2IW8A 3PA3A 3HAMA 2IO6A 2A19B 4EOSA 1S9IA 4EL9A 2OI4X 4QPAA 2PVMA 4BGQA 4DFNA 1F5QA 1BMKA 2PMLX 3MTLA 3QTUA 4IM2A 1HCKA 3IONA 5HE0A 3LE6A 4FSRA 4IWQA 4J1RA 4AGUA 2E9NA 3QA0A 4P5ZA 5M09A 3ORNA 3CD8A 3BU6A 3R73A 5HBJA 2C68A 1H27A 2JGZA 3PSCA 4FKJA 4FE2A 3OWLA 2ZM3A 2J9MA 1LP4A 1TVOA 3GQLA 4LRJA 3QD2B 3TJCA 3QHWA 3OCBA 4I3ZA 4CV8A 2KULA 4M7IA 3RMFA 3EYHA 1PXOA 4K2RA 5DLSA 2WOUA 3K5VA 2QR8A 2QLUA 4G34A 4LUDA 3FMKA 4UBAA 5E7RA 4N70A 4WUAA 2ONLC 3CQWA 4DA5A 4DEDA 1H1RA 2QU5A 2UZTA 3I60A 3KXXA 4TWPA 4G3CA 5CSPA 3DPKA 3F3VA 4NTTA 4EJNA 4BGGA 2UZNA 5F4NA 3KVXA 4HPTE 5AP1A 3VBWA 4PPBA 4XG9A 4YGAA 3C51A 3KCFA 4LFIA 5HG5A 1WBWA 1V1KA 5HG9A 2YLFA 2IZRA 3A61A 3FC2A 3K5UA 4Q5HA 5E8UA 5BVWA 4BTJA 1PRYA 3WF9A 3EN9A 1SNUA 1IA8A 1M7QA 2OZOA 2YAAA 3OEFX 3QD4A 4GVAA 1RJBA 2BAKA 3O2MA 3Q4CA 4R3RA 3G33A 3MTFA 4ITJA 4BN1A 4UXQA 3QKMA 4FVQA 3TIZA 3KRRA 3ETAA 1ZYLA 5M51A 1OBDA 3BLRA 3E88A 4PNKA 2VX0A 3VBVA 5FDXA 4UALA 4A9RA 1AD5A 2HY0A 5H3QA 5AUWA 2W1HA 5EW8A 2YFXA 4G3DA 3FKOA 4F7LA 4PP9A 2VX1A 3QLGA 4KKGA 4O7LA 2GMXA 3F6XA 5K4IA 3CD3A 4USFA 4A7CA 3G15A 3RTPA 2F49A 2H96A 5D10A 2YITA 3ULZA 4O2PA 3LJ2A 4AZSA 3OXTA 4BL1A 5CAOA 4OAUC 1OIQA 4F9WA 3S00A 1W8CA 4HVSA 4RC3A 4RX7A 4L67A 4QP3A 5IA2A 2R3RA 3HNGA 2CKQA 2X39A 2BKZA 3TG1A 3RWPA 4DYMA 3F3ZA 5LVNA 4IDTA 2CCHA 3T9IA 5L8KA 2JIUA 1OKVA 1M2RA 4AA5A 2VTAA 4LGGA 3AMYA 4JBVA 3QD3A 2ITTA 2BFXA 3LKMA 4ANSA 4D4SA 2XYNA 2Y6OA 1KV1A 4DBXA 3PPZA 3MI9A 2C5XA 4M84A 2F7ZE 3OCGA 1UKHA 4CLIA 2XJ0A 1Q4LA 4HCUA 3LOKA 4I6BA 1BKXA 2W96B 4L01A 1UU3A 1Y8GA 3A99A 3Q4UA 3CY2A 5AEPA 4JR7A 3SXRA 2W17A 3KFAA 4HYHA 2W5AA 3AXWA 4G9CA 3ULIA 3HP2A 1JWHA 2VTNA 3FSKA 1H1SA 4EONA 4S30A 2FUMA 4D4VA 4NZWB 5M06A 2QHMA 2UW6A 4FZAB 4RWJA 3EQDA 4FV4A 4P90A 5HTCA 4QYYA 4YSJA 3JS2A 3R04A 3ZYAA 5CEKA 5BVDA 4RJ7A 3I7BA 5JZNA 4YO4A 5C4LA 4ZS4A 4BYIA 2WMSA 4AT3A 5AM7A 2WMVA 4YBJA 2VTLA 2WQOA 3KMWA 1OKYA 5BPYA 3GCUA 2OF2A 5CSVA 3OFMA 4CMUA 5KBRA 5FM2A 3R01A 4NEUA 3I0QA 4NCTA 3GOPA 3R7GA 4II5A 1KOBA 1GJOA 3OMVA 4LM5A 4QRCA 4A9YA 4BIEA 3Q5IA 4EC9A 3TKIA 2I0HA 3R8VA 3ZSIA 2QOBA 4J52A 5AP3A 3VUMA 4YC6A 4ZTHA 5E92A 3ZDIA 4HZRA 2I0YA 2F57A 2J5FA 5HVKA 4I0TA 4TWNA 4FV0A 5KO1A 3FZRA 3VF9A 2UZUE 1X8BA 3F3WA 3KXHA 4F0FA 2PY3A 1TQIA 5HESA 3T3UA 2WNTA 3KU2A 4WBOA 4D55A 3UIUA 2VWIA 4HVGA 4MXYA 3OBGA 4YC8A 3EB0A 5ACKA 3EQRA 3Q4TA 4RMZA 2PUNA 3TI1A 5A14A 3LQ3A 3GU6A 1NY3A 3M1SA 1OL1A 4BI2A 1H26A 3CY3A 3PP1A 5DT0A 4BCHA 4FUXA 3CBLA 1U59A 5CAUA 4MAOA 2XUUA 4DGOA 4DTAA 3LQ8A 3EN5A 2BALA 3BYUA 3QD0A 2OKRA 4V0GB 3ZDUA 4F1MA 4JAIA 5FUTA 2BZHB 3VIDA 1R3CA 5DA3A 3ZMMA 4AGWA 2HW7A 4CCBA 4E8AA 2YDKA 3Q9YA 3MJ2A 3PSDA 1Q8TA 5L2IA 1KWPA 3FSFA 3PJ3A 3OCSA 2RL5A 1O9UA 4FV2A 2BAJA 4RIXA 5HTIA 2R7IA 4D5KA 4AS0A 4BCQA 3V5WA 4BCGA 1O6KA 3VBQA 2CNQA 3QBNA 4MBLA 5KMKA 2IVUA 3OOGA 4W4WA 4XH6A 1CSNA 2Y8OA 1Q8YA 4HJOA 3VRZA 1XH4A 3KRWA 3NCGA 5FDPA 4ZTSA 3N4VA 3FEGA 3TNQB 5BMSA 3ID6C 4PUZA 2GNIA 3ZRMA 2PVRA 2EUFB 4H3PA 4YZDA 3O71A 5IQDA 3UNZA 1IR3A 3O51A 4Q2AA 1XKKA 2XA4A 1OL6A 4FSQA 5I9XA 4YZ9A 5K3YA 4U5JA 3GU7A 2QOQA 4OUCA 2ZM1A 3EMGA 3QX2A 5JSMA 2XS0A 4JIAA 3CR0A 1IRKA 3ZLSA 3DY7A 2BAQA 3OS3A 3RCDA 4AN9A 1U54B 4ZSAA 2OIDA 4FNWA 2AUHA 3AT4A 1Q8WA 5EDPA 2XIZA 3LCOA 5LVMA 4A4OA 4GCJA 2GS7A 4PY1A 2OJIA 2WGJA 2ZYBA 4L8MA 1OVEA 3L8PA 2JDOA 5EI6A 2XKFA 1NVRA 3GC7A 3WE4A 5HTBA 5LXMA 5CVHA 4BDBA 4CFUA 2ETRA 2QOKA 4ACMA 1OMWA 3E8EA 3FMEA 1F3MC 1YXTA 4LYNA 4OTDA 3MY0A 4QTAA 4YZCA 3UO4A 3QC9A 4JBQA 3MH0A 5B2KA 5HNBA 2NNWB 4CZUA 4J71A 4XMOA 3R7YA 1BL7A 3ORPA 3FWQA 3ZM9A 3VO3A 4CFMA 1B6CB 3QCXA 5DNRA 4L43A 4C4EA 1ZLTA 2ZVAA 3LFFA 4EZ5A 4ZLZA 3MA3A 4PPCA 2BPMA 3QWKA 5D1JA 3HA6A 5CEQA 3RVGA 5M53A 3NUXA 3TT0A 4DBNA 4BDHA 4F7NA 5A4EA 3L9NA 1W98A 3W33A 3BV2A 5HE1A 3HV3A 4GKIA 2WQEA 4D2RA 2IVTA 4TYHB 4I20A 3NSZA 4FG7A 3KK8A 2VWVA 3W2OA 2C6IA 3BGQA 3E8CA 3CEKA 4RVTA 4ACDA 4QT1A 3RAKA 1JAMA 3HMPA 4C34A 5EYCA 3VJNA 1XH9A 4FTCA 5CEPA 4H1JA 1IASA 2IVSA 5IF1A 3LHJA 4K0YA 1CKIA 5BUEA 4B0GA 3ZOSA 1UNGA 2Y6MA 3ZXTA 5A46A 4E6QA 5KCVA 4RVMA 2XNMA 3PIYA 3W8LA 1PJKA 4IZAA 4D1ZA 1DAYA 2C4GA 2PK9A 2ZB1A 5HD4A 3JVSA 5AP6A 5DI1A 3OG7A 4YNEA 4AN3A 4F09A 4NM0A 2R3NA 2BZJA 3PVUA 4YJQA 2RFDA 5FQDC 3VHKA 4QD6A 4R7BA 4CXAA 1M17A 4GS6A 3PWDA 3VQUA 2VD5A 5DGZA 3W1FA 5M4IA 3A7FA 5BVOA 2YLEA 3UC4A 3CP9A 3WOWA 3KRLA 2WIPA 4QQ5A 2BRHA 1PXJA 5AJQA 3RALA 4F65A 5KHWA 2XRUA 5EDRA 4DC2A 3HEGA 3G51A 4G9RA 3N4UA 3FZPA 4FKLA 2FB8A 3QZIA 3HP5A 4GUEA 4YJVA 1APME 4YTHA 5E1EA 4EOKA 5K5XA 5TE0A 1Q5KA 3F2NA 5I3RA 1BI7A 1CKPA 1OKWA 2OFVA 2UVXA 2REIA 4AZEA 3EZRA 1GNGA 4GK2A 4E3CA 1SM2A 4HPUE 1PXNA 3C4WA 2O8YA 3N9XA 1JQHA 3Q9XA 4IB0A 5AA8A 4Z7GA 4MCVA 2XCHA 1BLXA 3M11A 3TM0A 1VZOA 1J1BA 3C4ZA 4RGJA 5CEMA 3R63A 3LFAA 3BLHA 3PZEA 4BCJA 2HZIA 4EZ7A 1ND4A 2AC3A 3R83A 4HYIA 3UTOA 1XH7A 5CZHA 3SLSA 4E6DA 5JN2A 4DEAA 1TQMA 2ETKA 1RW8A 2W4OA 3QRKA 3OTVA 2W99B 4OTRA 4DCAA 3FZ1A 1YXXA 2PVKA 2YIXA 4G16A 5EW3A 5BMMA 3OCTA 5F94A 5JFXA 3UOKA 3MFTA 2WTKC 4YHTA 5HBEA 4AF3A 1P4FA 3Q3BA 4QQCA 2OK1A 2WTIA 4G6OA 5CX9A 4AWIA 4ENYA 1MQ4A 2PZRA 3QALE 3D94A 5EH0A 2IZTA 2ACXA 4O91A 3RKBA 5L4QA 4JRVA 4OLIA 4FKGA 4YURA 4NUSA 4EH9A 1XBAA 4YLLA 3CPCA 2ZMCA 4QP7A 3EIDA 5AP7A 4YLKA 4BF2A 3KQ7A 5EHLA 3QTXA 5TT7A 2QO9A 4XCUA 3QQFA 5L2QA 2YWPA 5GNKA 3O96A 4G6LA 2F4JA 1OL2A 2V0DA 2XNBA 2C6EA 2R3KA 3IKAA 3JVRA 5CNNA 4DG0E 2W1IA 3AC4A 3D4QA 4I6HA 5DT4A 2YZAA 2YM7A 4ZS0A 2PMNX 4GRBA 2ZV8A 3IPHA 4L6QA 2JC6A 2XKDA 1XHAA 5JEBA 5CENA 3UE4A 4ACCA 1JSUA 5IG1A 5DG5A 3NEWA 3B8QA 1OECA 2VTQA 3NDMA 3TIYA 3ZLYA 2BHEA 4KBAA 4NM5A 3FE3A 2GFSA 2GDOA 5HI2A 4J53A 3UZPA 4BKZA 1P4OA 4X2FA 4L44A 3R30A 3UQGA 5HLWA 2FSOX 4FV8A 4Y95A 3SA0A 3GT8A 1YXVA 3A7HA 2W1CA 3PY3A 4HCTA 3UNJA 1YI4A 2JKQA 3D7ZA 4NIFA 3HRCA 1ZZLA 3PRIA 4APPA 5AUYA 5BYYA 3QHRA 4C57A 4KIOA 3E8NA 3EN6A 4F9AA 2YAKA 2YEXA 4C3FA 1PXLA 1YRPA 2PHKA 1RE8A 3DQXA 3G9NA 4FYOA 3ZO3A 4DH5A 2B0QA 4O86A 4F6UA 4WNKA 4HW7A 4J8NA 3L9PA 4L68A 3R6XA 4XJ0A 4RIWA 1ZYSA 3FXXA 3TXOA 3ROYA 3DJ5A 4C02A 3NYXA 4O7ZA 2OJFE 3RNIA 3VJOA 3VBYA 3PVWA 3R9DA 3FPMA 2J50A 4QMLA 3AT3A 2F9GA 4DFXE 2QC6A 3R7VA 1GZ8A 4FC0A 4F6SA 4M69B 4GV1A 4FNYA 5ETCA 3CTQA 2WZJA 2WTKB 2YM4A 4D4RA 4EYJA 1PHKA 3LW0A 5JFSA 1UNHA 1YHSA 3KN6A 2H9VA 3RGFA 3P9JA 3BQCA 1DI8A 4ZJIA 5LWMA 4I22A 1FBNA 1GY3A 1FGIA 1Y91A 2Z7RA 3LCDA 3EQPA 4KIKA 3BCEA 3PJ1A 4PL3A 4U40A 5IEYA 1PY5A 3FYJX 3TL8A 4AQCA 4UYNA 5D41A 4AW1A 3RHXA 4O0VA 4J95A 5F95A 2X7OA 3RPOA 3QTZA 3CSVA 3Q96A 3HUBA 4JDKA 3S0OA 4I6FA 1ZMWA 3F5XA 3NCZA 3FLNC 2HAKA 2QD9A 3DBEA 4I5PA 3TKHA 3AC5A 1TQPA 3QRJA 4O0WA 4RRVA 3MDYA 2ZM4A 4EJ7A 4MD9E 5K5NA 2ZMDA 4XV3A 5HG7A 4U97A 3FUPA 2QCSA 5HORA 2BIKB 2YHVA 3R28A 2X0GA 4OT6A 1YW2A 4L53A 2J51A 5HGIA 2CN8A 5LVLA 2VTIA 2ERKA 1FVTA 2X2KA 4JL9A 3BU3A 3QGWA 4MXZA 3RPRA 3EL7A 4NW6A 5TOZA 4YTIA 4GKHA 1HOWA 3CGFA 3CCNA 4L42A 4V04A 4O2ZA 4I23A 2W5HA 5IDNA 4C8BA 4M0ZA 2IW6A 2WMBA 3OW4A 4TYIA 5IA1A 3FHIA 1YOMA 5M4FA 2JFMA 5CNOA 3MFRA 4CYJA 5C1QB 3SAYA 3QKKA 1KE9A 5FP6A 4FL1A 1RDQE 3DKGA 4O96A 5FTGA 4IANA 3CQUA 1V0BA 4ZSJA 4FVRA 4QYHA 4WG5A 3EL8A 3Q4ZA 2YABA 4JBPA 4TPTA 2XK4A 5LWNA 4LRKA 3KL8A 2WU6A 2PMIA 2YDJA 3GC0A 3COIA 1LEZA 2QOLA 3TTIA 1Q97A 4IACA 4MNFA 2W1DA 1UVRA 3F9NA 3QUEA 4U41A 4EHVA 3PWYA 2QVSE 4C61A 2A0CX 4U80A 3GXLA 1U5RA 3IGOA 2YIRA 3VS3A 4IADA 4F63A 1J1CA 4C0TA 5JGAA 4GT4A 4JOAA 3ZUVA 3OWKA 3HLLA 4TNDA 5IDPA 3ZO1A 3SG9A 3TUCA 4CTBA 2YN8A 2HWPA 5AX3A 2R3PA 2C0OA 4J96A 4IB3A 4RJ5A 3DAKA 3R8ZA 5LCJA 1BYGA 2CCIA 3ZFXA 4LOOA 3KKVA 5JK3A 4WKQA 4ZZOA 4GG7A 4RX8A 1YOLA 2CGVA 4FTIA 5AP4A 2X7FA 3AC2A 3QXPA 4MVFA 4ZZMA 3R1SA 4GT3A 1ZXEA 4MD7E 3L8SA 2C6OA 3K3IA 1K2PA 5HNGA 1GIIA 4MH7A 4BI1A 3E7OA 3FQHA 4R3PA 4LUEA 4HVDA 2WO6A 2WEVA 2SRCA 5EQPA 5M07A 4PMPA 4BCMA 4F0IA 1CDKA 1ZMVA 4XBUA 4CTCA 1KUTA 4XP0A 4AG8A 4D1XA 4OAVB 3LFBA 3UIMA 1R1WA 4M12A 2VZ6A 4FMQA 3E64A 4E6CA 3MPMA 2OSCA 3ELJA 4ONAA 1OKZA 3WF6A 4BI0A 4H36A 5HU9A 4ZMFA 1H00A 1YI3A 1SVHA 5HCYA 4JRNA 4IX5A 3UDBA 3LZBA 4EEVA 3GUBA 4HGSA 2WMQA 4JQ7A 4USDA 1LEWA 3LMGA 2J90A 3U4UA 4D1SA 1ZYJA 4AZVA 2YIQA 2G2FA 4FTKA 5E91A 2HWOA 5FXQA 2W9FB 3R9HA 1BUHA 5DH3A 2B9FA 4F1TA 1UNLA 3OEZA 1QCFA 5GZ9A 2BILB 2ITXA 1WBOA 3PUPA 3ZS5A 1BL6A 2NO3A 4L00A 2BDJA 5CQUA 4TW9A 5EI8A 3E7VA 4A9UA 4X0MA 3IO7A 1WBVA 3BKBA 3CIKA 3DAJA 4GFGA 4HNFA 4RC4A 2LAVA 5IUIA 3QCSA 3WE8A 3HVCA 4DH3A 3A4PA 2R3IA 4HVHA 3Q9WA 3LFCA 1E1XA 3PVBA 3BGZA 5IH6A 5E8WA 4QP2A 4LQMA 5HE3A 3ZFYA 4RX5A 3HV6A 4GG5A 3F82A 1GZNA 4B8LA 4O27B 4ZTNA 2UW7A 3Q04A 3A60A 4A9SA 4EUTA 2BZIB 2GHMA 3ORZA 5LARA 4QPMA 3PP0A 4FKWA 4H05A 3DJ6A 3PY0A 3MFSA 2I0EA 3WI6A 2I0VA 4O7SA 2GQRA 4AW2A 4U6RA 2B9HA 2NRYA 4MF0A 4QMMA 4U79A 2X8IA 4ZY4A 3G6HA 3Q5ZA 4D0XA 2CSNA 4FTJA 2VUWA 4IX3A 4W8EA 4IXPA 4K8AA 4C35A 1STCE 4KABA 4CZTA 3DK3A 1A9UA 1JKTA 3HMIA 3NW7A 4U0IA 4YHJA 3BWFA 3VS5A 4BTMA 5IA0A 3Q2JA 2EB2A 2WMTA 2C5NA 2QLQA 4ZIMA 1Q8UA 3BYVA 2UW0A 4UMPA 4YTCA 3GC9A 4QYFA 1FMKA 2ITPA 1ZARA 3OBJA 3ZBXA 4IFGA 4BTFA 2ZDTA 3AOXA 5E4HA 4M97A 3ZBFA 2J0LA 3TWJA 4NU1A 3KULA 5LMBA 4R77A 5EYDA 2BR1A 3VS4A 4O0SA 1YI6A 2JDTA 5H8BA 1JBPE 3LMHA 4Y72A 4BGHA 2XBAA 4FKRA 3ET7A 2YA9A 5G6VA 3C4EA 3FJQE 2X81A 2W05A 2YJRA 3VUDA 3D5UA 4X3FA 5EHOA 3U87A 4EK4A 2CKPA 3LCKA 3V8WA 2C5OA 3I81A 4WG3A 3HDMA 3UO6A 3MIYA 2BRMA 4FZ6A 1ZY4A 4WNPA 4FNXA 2QQ7A 5CVGA 1YWVA 3HL7A 3NUYA 4A4LA 3EFKA 5CU0A 3SXFA 3MN3A 5IMXA 4TNBA 4RJ4A 2Z02A 4AX8A 3ZSHA 2X4ZA 5CXHA 3DKOA 1YDTE 3CKWA 4AXAA 2YM8A 5IKWA 5KKRC 2Z7QA 5CY3A 4ACHA 4G5PA 4XNEA 4BZNA 3LXLA 2W1EA 2VTMA 2CJMA 5DR6A 4F08A 4RJ6A 2WTWA 3GC8A 4YZBA 1XO2B 5HOAA 4CEGA 2X6DA 2PVJA 4HCVA 2PVHA 1EH4A 2R0IA 3EHAA 1KSWA 4PMMA 4L52A 3W18A 3O7LB 4MF1A 4NCTC 2V7AA 3UC3A 3V5QA 4O6LA 5M4UA 4C4FA 3S3IA 4IIRA 1VYZA 5DE2A 4DG2E 5AAEA 2VGOA 3BHTA 3EN4A 3QTQA 5DR2A 3LJ0A 3ZONA 3TV4A 4ARKA 1G8SA 4EH3A 4G17A 3MW1A 2UVZA 4FSYA 4O21A 4V01A 5CU3A 5DIAA 4BBEA 4EOPA 3QLFA 4UY9A 3UOHA 3PRFA 4Y85A 4XS2A 2W4JA 5AR5A 3DOGA 4FZFB 4JT3A 3KRJA 3DXPA 3PE2A 1K3AA 5DN3A 3IDPA 4APCA 4S33A 5DPVA 1YHWA 2W5BA 2JBPA 2G1TA 3RZBA 2WTCA 5TKDA 4DEGA 3BQRA 3SD0A 3V3VA 2ZJWA 4C4JA 1Q3DA 4R7IA 3BHUA 4LV5A 4QTCA 2CHLA 4W9WA 2XK9A 1QPDA 3IW5A 4X2KA 1CM8A 2Y7JA 4ITIA 3BEGA 3P4KA 4HGEA 4KKHA 5HVJA 4FGBA 4FEWA 2GTMA 3DXNA 2R4BA 3LVPA 5H8EA 3UYTA 3DJ7A 3LCSA 4XP3A 2XKEA 3FZSA 5L8JA 3LXPA 1NXKA 1SNXA 2O65A 3RJCA 4ZOGA 3F66A 3OUNB 3OVVA 1YVJA 3QZHA 3VUHA 4H58A 3LFEA 3V04A 4AAAA 5A4CA 4BWKA 2NP8A 2JIIA 2VWXA 3DU8A 3NAYA 5GZ8A 2KTYA 4PTCA 1L3RE 4FTRA 3VWAA 3EQIA 3FZTA 4X21A 4DFYA 2WOTA 4JI9A 3ZHPC 4O38A 5CU4A 3EH9A 3D7TA 2CGWA 4IZ7A 5A54A 4JIKA 5DRBA 4YPSA 4RIYB 4PNIA 2F7XE 2P33A 4QMOA 2HOGA 2XIYA 2R3FA 3OT3A 5C03A 4AW0A 3DV3A 4O0YA 4BDEA 5CWZA 5KKRB 4FUYA 2J2IB 2XMYA 5AP0A 3D5XA 4GYGA 2WTVA 2O3PA 4G3EA 4OT5A 2VX3A 3F2RA 5ETIA 3DTWA 3E63A 2ONLA 3W10A 2R3HA 1U5QA 2BVAA 4RVLA 2ITVA 2Y4IC 3KF4A 4GFMA 4OW8A 3P7BA 3QZGA 3IW8A 5IPJA 2C6TA 3C7QA 3DS6A 3LFNA 2VO6A 3W32A 3QTIA 2PVLA 3AMBA 4D2TA 4EORA 5JGDA 3P0MA 3KY2A 2YACA 1H0WA 3C4XA 2XK8A 4XUFA 4ERWA 4RFMA 2RIOA 4PF4A 3HUCA 4JVGA 2CDZA 1JSVA 4RWKA 2FVDA 2VTPA 3VNTA 4EK5A 5E8SA 3EFLA 5CF6A 5JQ8A 4F6WA 2G2IA 4CKJA 4P7EA 4R1VA 5CU6A 2A1AB 2VV9A 4IDVA 4X3JA 3DT1A 2C5YA 3HRFA 4R3CA 4LOPA 5IMEA 4DN5A 4CFWA 3BI6A 4JQ8A 4Q5EA 4LMUA 2VWWA 3GI3A 4FOCA 5BVFA 4DGLC 4I24A 2OWBA 4TYJA 4BRXA 1Y6BA 2EB3A 2PPQA 3CGOA 2B1PA 2B55A 3QTRA 4U8ZA 1FGKA 5HD7A 3U6JA 3NVMB 3DK7A 3HMNA 3L9MA 4U9AA 5GJGA 4NFMA 2Y0AA 4IAKA 4PDSA 3GEQA 2PVNA 3ZEPA 1NVQA 2BRBA 5AAFA 1OIYA 5AX9A 3WILA 2VTOA 5I9WA 4K11A 5K4JA 4BDCA 4IB1A 4DF3A 4XX9A 3SV0A 4ZLYA 2AYPA 3RPVA 3I1AA 4MBIA 1J7UA 4BIDA 4RIXB 3ZZEA 2RG6A 3QAME 5HVYA 4YR8A 3OWJA 5EHYA 1ERKA 1H8FA 3AMAA 2P0CA 1PYXA 3D2IA 4CMOA 4F7SA 3BIZA 3DDQA 4D58A 5AUTA 4O7RA 3IW6A 1JOWB 4F9YA 4Z55A 4W4XA 2C5VA 5AIRA 3DBDA 2W1FA 3H0YA 2B9JA 4IWPA 4CVAA 3ZRKA 3UZRA 3QKLA 4XV9A 4DINA 3FBVA 1YDRE 2QOOA 4HYSA 4KRDA 2PVYA 1NVSA 4E5WA 5M08A 2Y4IB 4DFUA 5IQIA 3OHTA 3F3UA 2O0UA 3R1YA 5CQWA 3TACA 4BICA 4BZDA 5J79A 3PLSA 3R9NA 4O22A 4IWDA 4IZYA 5EM5A 2Q0NA 5EYMA 2QOFA 4FIFA 4FZDB 4N57A 3GCVA 1IA9A 4IJPA 4RWLA 2PUPA 4DG3E 4E20A 4QTEA 5EQYA 2YISA 5B7VA 4O7WA 4FBXA 2F2CB 5EKNA 3ZCLA 1G3NA 2Z2WA 3MPAA 4H3QA 4WIHA 4YLJA 3BHHA 5KBQA 3ATSA 4FV5A 4IVDA 4E4MA 3UYSA 3R21A 1WVWA 4DGMA 3UPXA 4EK3A 4FEXA 4FTTA 5IQFA 4X2NA 1TKIA 3NYVA 3CKXA 2OZAA 4I21A 5I4NA 3SQQA 3D9VA 3NNVA 4QMWA 4PMTA 3ENMA 4CZYB 4FL2A 2VO3A 3RM7A 3TDWA 3KB7A 4RIOA 4FTAA 3QCYA 3ZH8A 4DH1A 2XK6A 5KNJA 3V5LA 1JVPP 1O6LA 4AA0A 2Z60A 4JAJA 4F7JA 3UZTA 2J0MB 1QPEA 3C0HA 2VWYA 3KA0A 5CSHA 5I5ZA 3UPZA 4QMTA 2GCDA 3WF8A 4ANOA 5IZFA 4RFYA 1J91A 4NKSA 2JFLA 4HGTA 4PTEA 4BDGA 2HYYA 4FKSA 3FI8A 3P5KA 5KMNA 4PRJA 5DT3A 5GJDA 1M2PA 4C2WA 5JQ5A 2PULA 3ZZWA 3R1QA 4UYAA 5EM6A 3SW7A 5C8MA 3P08A 4IAIA 2YDIA 2F7EE 2W9ZB 4U44A 4FSWA 2WMRA 4ZZNA 5IH4A 3PDTA 5LMAA 4G2FA 4RFZA 4R1YA 5ANIA 5M55A 2YCRA 4B4LA 1MUOA 4C4GA 4Z7HA 1KOAA 2VO0A 3FV8A 5BQ0A 2YZLA 2CN5A 2JLDA 4J8MA 3WZDA 3CTJA 2OICA 4FEQA 4BDIA 2YM5A 3OWPA 4RLLA 3TDVA 3POOA 2XH5A 3MIAA 2X1NA 2JEDA 2OBJA 3FMNA 3Q60A 5HQ0A 5FGKA 4DEEA 3ZRLA 3TN8A 3UOJA 4L3PA 5EM8A 3PYYA 3GCSA 4C7TA 2FGIA 3MVMA 3E87A 4GUBA 5HX6A 5J8IA 3OTUA 4EOMA 4IX4A 1V0OA 3HZTA 3EN7A 2UVYA 5ANKA 4ASEA 5IA5A 5FEQA 5IQCA 1YXUA 5AV4A 3AC3A 3MVLA 5IA3A 3RPSA 1I44A 1YKRA 4LGHA 2HELA 2OJ9A 3DB8A 5FG8A 5J9ZA 5ANJA 3SXSA 5DEYA 4BDJA 3ANQA 3DKFA 3QQUA 5EYKA 3E92A 5GJFA 4USEA 2A2AA 1WVYA 3FYKX 3IW7A 3MV5A 4IM3A 4M66A 4E93A 3PPJA 4K18A 5EG3A 4CLJA 1YXSA 4KS7A 3O17A 1I09A 3I0OA 4AZWA 4S34A 3RCJA 2ITWA 4FIIA 1RQQA 4EWQA 3S1HA 2W7XA 2W4KA 3PIXA 4OTFA 5A4LA 3G90X 2HZ0A 5ACBC 4FTOA 4JR3A 4BKYA 3FL5A 4MK0A 3PLAE 1OGUA 1H28A 2JAVA 3BYOA 3HV4A 3CTHA 3DKCA 1LR4A 3ORMA 4RC2A 3JY0A 4NM7A 4I41A 3RINA 4CNHA 3TZ7A 1T46A 1AGWA 5HICA 2XK7A 4AOJA 4FEVA 5JMSA 4FK3A 4O0XA 1UA2A 4AFJA 2XEYA 2GNFA 2XRWA 5M57A 4RG0A 2JKMA 1IAHA 3PPKA 4JG8A 3QWJA 4MWHA 4CT2A 3TKUA 4ANBA 2OO8X 5FM3A 4FTMA 2BTRA 4IHPA 2HZ4A 2ZB0A 3BV3A 4DE4A 2PVFA 4GK3A 2GS6A 2QURA 3UMWA 1OPKA 4NJ3A 1QMZA 4FGRA 1NA7A 2VTRA 3TJDA 4O1PA 3F3TA 4Y83A 4TKSA 3NYNA 2HIWA 4KBKA 3QC4A 4XG2A 5KZ0A 2BDWA 3FLZA 4WT6A 2DQ7X 1PXKA 1OM1A 4WNMA 4DT8A 4MWIA 4ORKA 3VW6A 3BHYA 4IVBA 4FNZA 3AT2A 2PUUA 1CTPE 3FMDA 3EJ1A 3OC1A 4WRSA 4XOZA 5EOBA 2IPXA 3IDCA 3R9OA 3UIXA 3SVVA 3UOLA 2R3QA 4XBRA 2W1GA 2WMWA 4LL0A 4YNOA 4A07A 3O7LD 3UP2A 3KMUA 4FIEA 5HBHA 3ZLXA 4C62A 3A8WA 4DH8A 4TXCA 5CVFA 4BDKA 4R8QA 3FQEA 2RGPA 4IMYA 3I7CA 3H0ZA 1Q62A 4NSTA 4O7YA 3BYSA 3TZ8A 3QXOA 3AD4A 2YWVA 1YHVA 4P2KA 2ZV7A 1MQBA 1XJDA 4QNYA 3NMUF 5GZAA 3UVRA 2OXYA 5C8KA 2HXLA 1ZZ2A 3Q6UA 2GNHA 4AU8A 3VBTA 5C27A 4RIWB 3EQHA 3QGYA 1OIUA 1YQJA 1W0XC 2GU8A 4S32A 3BZ3A 5CF5A 5M4CA 3SRVA 3VUTA 4BDDA 4EZ3A 5AR3A 1P5EA 1H1QA 1WAKA 4JJRA 3UP7A 3D2KA 3T9TA 2X9FA 2BMCA 2RKUA 2C30A 2V5QA 3D5VA 4P4CA 4HNIA 3U4WA 4CGAA 2V22A 3D83A 4OGRA 4BB4A 5LJJA 3PJ2A 3GCPA 5E8VA 5HO6A 4D2WA 2QO7A 4JS8A 2C6DA 5DR9A 3FY0A 1QL6A 3FAAA 5CT0A 5JT2A 4I0SA 2C3IB 2OIBA 3R2YA 1H0VA 3KXMA 4KIKB 4NKAA 2CNUA 4EWHA 4ZLOA 4EH4A 3COMA 4EOLA 4E7WA 1UKIA 3MY1A 4AA4A 5IEVA 3POZA 4KAOA 3NVKI 5AR4A 3HMOA 5BYZA 4CYIA 3LQ5A 4IAZA 2J0JA 2OGVA 3PXKA 4O6EA 3R9RA 4XLIA 1Q8ZA 3R22A 5EDQA 1BI8A 4FIJA 4D9UA 5IQHA 4HOKA 3TEIA 5ANOA 2Z8CA 3EZVA 2JIVA 4OTPA 4QO9A 2R3LA 3RI1A 2XBJA 1SMHA 4I93A 4JG7A 3WZUA 4BWXA 1PYEA 2O5KA 1OUKA 2BCJA 3FXZA 3BHVA 4AGDA 3WZEA 3EWHA 4M67A 2B4SB 2XK3A 5K0XA 5LOHA 1B39A 2C6LA 3VBXA 4U3YA 2P3GX 4YU2A 4CFXA 4D5HA 4E6AA 3WARA 5CALA 3EQGA 4RX9A 4YP8A 1KV2A 2WHBA 4OR5A 2JDSA 3IDBA 4ZMEA 2XNEA 3U54A 5AV0A 3GBZA 3SX9A 3TZMA 5A6OA 3ZLWA 3RZFA 4WD5A 3THBA 4JG6A 4BR3A 2QNJA 2WELA 4ZK5A 4CG8A 3LLAA 1ZAOA 3MFUA 1WFCA 1PXPA 5ANDA 5IH5A 5DYJA 3EQCA 2HY81 1SVEA 4YC3A 4D4YA 4XRJA 4Y46A 4DLIA 4DTKA 5IEXA 1OZ1A 1FMOE 3W2SA 5LMKA 2QHNA 4BCPA 5JRQA 2BKKA 5ANGA 3S95A 4C4HA 3ORKA 2X7GA 3MY5A 4O82A 3E3BX 3NRMA 4BYJA 1OPJA 3H3CA 3IW4A 4O81A 2XYUA 4I92A 3CQEA 5I9UA 1URWA 4WO5A 3QFVA 2XKCA 5G1XA 5HG8A 5C01A 4XG3A 2OF4A 3HGKA 4U81A 3ZEWA 2H6DA 4GFOA
chains in the Genus database with same CATH superfamily
3LM5A 5FLFA 2CKEA 2G9XA 3CE3A 4BDFA 1XQZA 3V01A 5KMMA 3KMMA 1PMVA 3U9NA 3I5NA 4GT5A 2YERA 3PSBA 4QTBA 1H08A 1KE7A 2IZUA 5AMNA 3EYGA 3VS7A 3IS5A 4BDAA 2G15A 3JUHA 4KINA 4WUNA 5EM7A 4WOVA 5BUIA 5HZNA 2PE0A 1QPCA 2X0OA 3ORXA 4XOYA 2QG7A 2VWBA 3FI3A 4XV1A 3O50A 5H8GA 4B9DA 1VJYA 4FL3A 3II5A 3I6UA 2WPAA 2E9VA 2BROA 2J0KA 4FTNA 5IU2A 1QPJA 2GHGA 4FR4A 4AACA 4BBMA 5AR8A 2XCKA 4R5SA 3PFYA 2C47A 3KGAA 5TO8A 2IJMA 4PDPA 4XG4A 1FOTA 3EQBA 3WYXA 2IN6A 3LFDA 4L7SA 1H1WA 2EU9A 3KN5A 3O8TA 4FT9A 4GEOA 4M14A 4OTWA 5AP2A 2F2UA 4DEHA 4YTFA 5BVNA 5IQGA 4QP4A 3QU0A 4FEUA 4D0WA 4YJPA 1LPUA 4NK9A 3IK3A 5J1VA 3BWJA 2A4LA 3TNPC 1J7LA 4PDYA 3LXKA 4X3FC 2WFYA 5CZIA 4BTKA 2YCSA 4DFBA 1DAWA 3DQWA 4LL5A 1ZOHA 4E4XA 4A06A 4GVJA 4G5JA 4MQ1A 2J6MA 4IH8A 3TUBA 3NFFB 5IQEA 1Q61A 4AN2A 2WQNA 4KWPA 5I3OA 3R8MA 3U51A 3NW6A 2RFEA 3L9LA 3V8SA 2PL0A 2AC5A 4JX7A 4NWMA 4AGCA 4C38A 1FINA 2HENA 5DFPA 2VWUA 5E8ZA 3V5JA 2IZSA 3GNIB 4QNAA 4O84A 5L2TA 5AUVA 3NUAA 1XWSA 4L3LA 3CC6A 3W55A 1B38A 5AR7A 3COKA 4D2SA 3QQKA 5EOLA 3FQSA 2CMWA 5AA9A 2X6EA 4BVUA 3BL9A 4MNEA 1WMKA 3I6WA 4L7FA 4C4IA 5KX8A 3AC1A 4BCNA 5L2SA 2HXQA 3F5GA 1WVXA 5CEIA 4DHIB 3QA8A 4K6ZA 4PQNA 5D7AA 1Y6AA 1Y8YA 3F5PA 4FODA 3TMOA 2VGPA 3VULA 4AE6A 3AGLA 3E3PA 1XH5A 3SOAA 2OJJA 2OXDA 2WB8A 4FZ7A 4ZTRA 1CMKE 1ZYCA 3DFAA 3MWUA 2G01A 4X2GA 5D7VA 4W4VA 4YMJA 3OP5A 4XEYA 4FV9A 1JKSA 3VHEA 3NAXA 5E8TA 4WSYA 3LCTA 2XM8A 5CAVA 3D14A 2OJGA 4TZRA 4AOTA 3TV7A 4AXEA 4O7NA 4EOIA 4W9XA 5BVKA 2YJSA 3JXWA 1IEPA 4GJ3A 1R0PA 3KULB 1PW2A 5CASA 3F7WA 4M15A 3V6RA 3A7GA 3RAIA 5HE2A 4AT5A 3KCKA 1SZMA 2VTJA 5E8XA 3TNWA 4QMUA 2E2BA 1MP8A 4NJDA 3NS9A 4O1OA 5EW9A 3ALNA 3WIKA 5KMJA 3UQCA 4K33A 4X3FB 4CQEA 4BCOA 4EHEA 4D28A 2FSMX 2W06A 3BE9A 4I5MA 1VR2A 3ACKA 3UODA 4KS8A 1GZKA 2JDRA 3UMXA 4ENXA 1FPUA 2ITOA 3LXNA 4G31A 3D5WA 1ATPE 5ETFA 4H3BA 5HCZA 5K9IA 5DRDA 2X9EA 2XIXA 3HRBA 2XIKA 4RJ8A 1ZWSA 3FKLA 3G0FA 3RWQA 4BIBA 5FXRA 3U55A 1LUFA 2E9OA 3FI4A 3GGFA 3PZHA 2OG8A 2X2MA 5LCKA 3MJ1A 4F9BA 4CRLA 5HIEA 2C0IA 2E9UA 4KB8A 4PL4A 1OUYA 5C4KA 2VO7A 4CKIA 2DUVA 2EVAA 1ZOEA 2YIWA 3WF7A 4RVKA 4EC8A 3F7ZA 4O83A 4OTQA 1R39A 2V55A 2WQMA 1YOJA 3A7JA 3HA8A 4G3FA 3KVWA 4E1ZA 4EYMA 3OW3A 2RG5A 1REJA 4FV6A 2BDFA 3PIZA 4C58A 4KSQA 4CD0A 5HLNA 3QYWA 4QP8A 3K54A 4MEDA 3BPRA 4EOOA 5BNJA 3NNWA 1Q24A 4PPAA 4OBQA 1Z5MA 2PE1A 3PFQA 2UZDA 3ZC6A 1Z57A 2UZLA 2ITNA 1OI9A 4GU9A 2A27A 1M7NA 4I4FA 1E1VA 3PXQA 3R0TA 3G6GA 5LVPA 4NL0A 4IAAA 3U6HA 5E1SA 3R71A 4KUJA 1NT2A 2OIQA 1Y57A 2WKMA 4JX3A 3GVUA 3IECA 3BE2A 4JXFA 4YJOA 3QF9A 2PZ5A 4GSBA 5AUXA 2P2HA 3MBLA 2UW4A 3QUDA 3NNXA 4QYEA 5T68A 3TNIA 5IISA 1H24A 3WIGA 4RJ3A 3SKCA 3Q52A 2VN9A 3U8WA 5FTOA 4M13A 3DBCA 3H4JA 5HX8A 4ACGA 3FXWA 2B54A 3UVQA 2EXEA 1IG1A 4S2ZA 5HLPA 3RK9A 3SC1A 4U42A 4C36A 4ZY5A 4N6ZA 5DOSA 2R5TA 5F9EA 5LQFA 4J98A 2ERZE 2UW9A 2J4ZA 5E90A 4QP1A 4HYUA 4MXOA 2NPQA 4HZSA 4QMZA 5HIDA 2PSQA 3GU4A 4GH2A 4QQJA 3A8XA 2EXMA 3L8VA 4GMYA 4IC8A 4MBJA 4QOXA 3ODYX 4XLVA 4FSTA 4CT1A 2RSVA 1VEBA 2RFSA 3QL8A 4YBKA 4AE9A 3ROCA 2PTKA 5AM6A 5AV1A 4CQGA 3NNUA 3KEXA 3FHRA 3PUFC 5ITAA 4TYEA 5L6OA 5EQEA 4G3GA 2O63A 4WRGA 3TCPA 3FMHA 4CCUA 3GENA 4WSQA 5E8YA 4EBVA 3D7TB 4ERKA 3LFQA 5L8LA 3MESA 3COHA 2OH0E 3MYGA 5FWKK 3BLQA 3PG3A 5CU2A 2B9IA 3FLWA 4C59A 4UWYA 1KE5A 4L3JA 1UU8A 4DT9A 4ID7A 4AW5A 4CKRA 3NLBA 4L46A 3EFJA 3TTJA 3OROA 4NH1A 5A4QA 3QTSA 2CLQA 4WA9A 5J9LA 3B8RA 1DM2A 4XP2A 2E9PA 2ITZA 5CI7A 4NFNA 3G0EA 3WBLA 5IUGA 4ZSGA 3PE1A 3S4QA 4DEBA 2RFNA 1E9HA 4AZFA 4UX9A 5AFVA 4RIYA 4K1BA 3M42A 5CEOA 4DCEA 2WD1A 4Z16A 2G2HA 3OF0A 4FX3A 4O0UA 4LV7A 3LJ1A 1KE8A 2ITQA 2C1BA 2QOCA 3G9LX 2QONA 3OY3A 2PZPA 2JITA 3HAVA 3C0IA 1UV5A 2ETMA 1OBGA 2C3KA 1H4LA 4FTUA 5KE0A 1ZOGA 4ZJVA 3F2AA 4YJRA 5GIOE 4XYFA 4RQVA 4OTHA 3K2LA 4RZVA 5I0BA 5L6PA 2X8DA 3PXYA 4YJUA 3UG1A 3H9RA 3DLZA 3G2FA 1T45A 2JKOA 1JLUE 3ERKA 3P5JC 4JDJA 4UEUA 1Q41A 5A9UA 4I0RA 4KIQA 3PA5A 3FDNA 1XR1A 5CF4A 1XH8A 3V5PA 1UWJA 4ALUA 1PMNA 4JBOA 1OIRA 5J7BA 3PJ8A 4EK8A 3L8XA 5B2MA 4NW5A 3SW4A 1YWNA 2UZEA 4TRLA 3ORTA 3A2CA 2UW8A 2ZOQA 3AD5A 3RPYA 5M56A 5CS6A 1Q3WA 3RAHA 2OLCA 2GPHA 3KRXA 4UB7A 5AP5A 4LI5A 4ZTQA 4UZDA 5HEZA 3MSSA 1U46A 4H1MA 4OTIA 1HCLA 4U43A 5BVEA 2IW9A 5DVRA 4WNOA 4Q9SA 4BCKA 3PG1A 1W2DA 2VTTA 2IVVA 3DAEA 3P78A 1FQ1B 4ITHA 1SVGA 4EKLA 2O64A 3DXQA 4FSZA 3V5TA 2PZIA 3UO5A 3ZUUA 3NFGB 4EBWA 4GL9A 4J97A 4M8TA 4NTSA 3Q2MA 4RLKA 2XANA 2OH4A 1H25A 2ZV2A 3JPVA 2WQBA 2ZV9A 4I4EA 4V0GA 4W8DA 5J9YA 2XARA 2UV2A 3FL4A 3DLSA 4R5YA 4YZNA 3RAWA 1J7IA 2C3LA 5AAGA 3UNKA 1AQ1A 4I6QA 3R7OA 3VS0A 3VF8A 5DEWA 1GZOA 3WYYA 2PUIA 5GHVA 4CRSA 4ASZA 5BYLA 2FH9A 4BFMA 3R8PA 3PXZA 4QMXA 5ETAA 4ZEGA 1WBNA 2V62A 2JKKA 4YJSA 2WIHA 5AADA 2ITUA 3WF5A 3NX8A 4K9YA 4M68A 1PXIA 3VAPA 4FVPA 3M2WA 5CSWA 1JKKA 3DZOA 5FD2A 4ZXTA 3VS1A 3VVHA 4ANNA 5E9EA 2XAMA 2VNYA 3F88A 4BJJA 4YJTA 4IE9A 2DWBA 3R7IA 2PU8A 4IB5A 3SGCA 3V8TA 4FICA 4A4XA 2RF9A 2XP2A 4R6VA 2H8HA 3OD6X 2QODA 1REKA 3I5ZA 3ANRA 3V51A 4ANLA 4CSVA 3O5AA 1A48A 5HIBA 4O0TA 3DTCA 5FBNC 1U54A 3E62A 3PJCA 5F1ZA 1GIJA 2EXCX 2OZAB 5A3XA 4TL0A 3LIJA 2YM3A 5HU3A 1F0QA 1FVRA 5I9ZA 5KHXA 4MKCA 2GNLA 4F64A 3UJGA 3H9FA 2FO0A 1GIHA 4R78A 3JR1A 4UMTA 2BRNA 4MXXA 5FEDA 3MB7A 4IAYA 4BHZA 4MX9A 3OZ6A 5CANA 3EQFA 4FSMA 4B99A 4TT7A 2CNVA 1WBPA 4LV8A 3CLYA 4AFEA 2XIRA 4UXLA 2AQXA 4L9IA 5KMIA 4G1WA 2WMXA 2XJ2A 1DS5A 2YCFA 5AR2A 4B8MA 4EKKA 4ZY6A 5EI2A 1PXMA 4F70A 3HMMA 5JFVA 1TFFA 2R7BA 3B2WA 4F9CA 4DFLA 4LG4A 2GQGA 2WTDA 4FSNA 2Q83A 4MXCA 2OFUA 4PDOA 1PKGA 4PTGA 5HO8A 5CXZA 2P55A 4I1ZA 3UG2A 2XZSA 3A4OX 3C5IA 4FIGA 5LVOA 2C6MA 4JDIA 4X7QA 3GFWA 4IM0A 3HECA 1H01A 2AEGA 4PX6A 4YJNA 2JBOA 2H34A 4U7ZA 4ZAUA 1R78A 3FLSA 4AT4A 1MRVA 3HYHA 1G8AA 4DEIA 4MD8E 3MH2A 4TYHA 4H39A 3PXRA 3ATTA 5CF8A 3P23A 5JFWA 2Y4PA 3FC1X 3NUSA 3FZOA 3BBWA 4W4YA 5J87A 2R3GA 3O0GA 4B7TA 5IUHA 5KUPA 2J0IA 2R2PA 4KBCA 1H07A 2FA2A 5AIKA 5FXSA 3F5UA 3OXZA 3VUKA 2BZKB 3CXWA 4FT3A 4ALWA 2WU7A 3LM0A 2CPKE 5CYIA 3W16A 1M2QA 4B6LA 5KMLA 3QZFA 4FG8A 4FKQA 3VC4A 3Q9ZA 4U45A 4DTBA 4RSSA 4KD1A 1WCCA 1XBBA 3IOKA 4FT0A 3IG7A 4IVCA 4LRMA 4M0YA 3DCVA 4MYGA 4FKUA 4YSMA 4C33A 5DMZA 4O7VA 4EQCA 2QKRA 3GB2A 3MS9A 4LOQA 4QP6A 5IA4A 3OUKA 4LMNA 4Y5HA 1ZRZA 3VS6A 4ANQA 3E5AA 3VUGA 2P4IA 4O4FA 1G5SA 3WZJA 4WHZA 3QTWA 3O8PA 4CMTA 1OITA 3MVHA 2ESMA 3SOCA 4CV9A 3GCQA 1W82A 2ZAZA 3QRIA 5HKMA 4BCFA 4Z3VA 3N4TA 5J1WA 3NWWA 2UW5A 4BKJA 4DAWA 2CGXA 3W2PA 1A06A 3R1NA 2CKOA 2ZDUA 2R64A 5CI6A 4ZTMA 4BY9E 4Q9ZA 4RQKA 2WTJA 3FPQA 5L3AA 1PKDA 3C5UA 5AV3A 4EHGA 3BBTB 1WZYA 3KXZA 4QP9A 3TNHA 5GIPE 3PTGA 4YUQA 1Z9XA 3Q32A 2BIYA 3T8OA 4O4EA 2VRXA 2FSLX 5GINE 2BHHA 1OB3A 4XHKB 4FKVA 5T3QA 4UMQA 2WXVA 4AZTA 4KIPA 5HO7A 4OBPA 3UIBA 3GU8A 3ZO4A 1PMUA 3SG8A 3E8DA 3UBDA 5F20A 2X0PA 4CFFA 4IJ9A 4GU6A 3O8UA 4OTGA 4QMPA 3UDZA 4CFVA 2C3JA 4MHAA 5CAPA 2WMAA 3DDPA 2QR7A 3OY1A 2PE2A 2R3OA 3DA6A 4IBMA 4Y73A 3T3VA 4DFZE 4CG9A 3U9CA 4E26A 3TUDA 2X8EA 3VQHA 4NM3A 2HZNA 5BX0A 2BRGA 3GOKA 4UZHA 4EH7A 4QDVA 2FSTX 2LGCA 3AQVA 4AUAA 2YM6A 3IQ7A 4BCIA 3FMJA 2XNGA 3C4FA 4PL5A 1GAGA 5CLPA 4JQEA 3HDNA 4GIHA 4BBFA 1J3HA 4GJ2A 1P2AA 4DITA 5FRIA 5C9CA 4UN0C 4AP7A 4C2VA 3QQLA 2ITYA 1PMEA 3H30A 3ODZX 1W84A 3NUUA 3EKKA 3C0GA 4J7BA 4ZTLA 5AV2A 1ST4A 1V0PA 3R8LA 2Y9QA 4F1OA 2V7OA 5AUZA 3NUPA 1H1PA 4I5CA 3QRTA 5FBOA 2I1MA 4C3PA 2C0TA 3DK6A 4RPVA 2OXXA 3ALOA 4PMSA 2QOHA 4IFCA 4XV2A 2CGUA 1YDSE 4QYGA 3MPTA 3SHEA 3FY2A 3ENHA 3DBFA 4C37A 4NIFB 3UQFA 4N6YA 3MGYA 2UZVA 4K77A 4QMSA 3NR9A 4U3ZA 3BEAA 3AC8A 4QPSA 4XG7A 3I79A 4X6RA 5IQBA 2B52A 2VAGA 3BU5A 4EH5A 3CJGA 3KXNA 2UZWE 3ORLA 3LAUA 3ZSGA 1MRYA 3P1AA 3S2PA 1XMMA 1ZYDA 5TF9A 4I94A 4TWCA 1ZY5A 4QTDA 4QMQA 4IWOA 5KZIA 3JY9A 3SRVB 3W8QA 3ZXZA 5LMKC 4EK6A 2I7QA 3EKNA 3NUNA 2HW6A 4F78A 3FLYA 1IAJA 3R2BA 3QYZA 4FV1A 3O23A 4XG6A 4XRLA 4UMUA 2XNOA 3HV7A 4GIIA 3FKNA 4WBBB 5J5SA 4FG9A 5T6KA 3ZFMA 4IC7A 3ACJA 4IAFA 4IQ6A 4ASDA 4YZMA 2UUEA 3FMMA 1NW1A 3KXGA 1UU7A 4J99A 4RT7A 1VLRA 2X2LA 5HHWA 4D2VA 2WEIA 3DBQA 3REPA 4DLJA 4TWOA 3RK5A 4X2JA 4FJVA 1XH6A 4IVAA 4KSPA 3BYMA 3VUIA 4UV0A 3RNYA 3L1SA 4NYEA 4EOQA 3A7IA 4UMRA 4M69A 5B0XA 4KNBA 4KKEA 2C6KA 4M3QA 5HNIX 4D2PA 1FVVA 5EFQA 4BC6A 4C3RA 2DS1A 3IOPA 3QQHA 4FTLA 4TY1A 4EQUA 4EH6A 4IZ5A 4RZWA 4R7HA 2R3JA 1JNKA 3HKOA 5JGBA 4RBLA 1OL7A 3ZM4A 3MH3A 1JSTA 2W0JA 2YCQA 4YHFA 3UVPA 5CAQA 5JKGA 4S31A 3D15A 3CPBA 4PV0A 3FI2A 1M14A 4ZP5A 2FYSA 3MH1A 2VU3A 4WG4A 4ALVA 4EI4A 4I6LA 3A62A 2GHLA 2PMOX 3RHKA 3F69A 4EQMA 1GOLA 1W83A 3PA4A 3MA6A 3ZUTA 3OXIA 5H2UA 2BUJA 2QO2A 3I4BA 4HGLA 2VTSA 3C50A 4KRCA 5CT7A 5CSXA 3VRYA 4G6NA 3W2QA 5A4TA 2XNNA 4E4LA 3NZ0A 5C26A 4F0GA 1XBCA 3D0EA 2X4FA 4YO6A 3PXFA 4BZOA 5BUJA 4TTHB 2WAJA 1URCA 2CLXA 3IGGA 1WBSA 1U4DA 3C13A 3ZC5A 1JPAA 3LPBA 3ORIA 4FKOA 4MTAA 4QMYA 5D9HA 5JH6A 4KA3A 4IW0A 3BX5A 2GNGA 3DNEA 5DHJA 5B2LA 1O6YA 4TN6A 4UWCA 3MB6A 4JLCA 4HVIA 4GW8A 4EUUA 4N4SA 4F99A 3NIEA 4PP7A 3DFCB 3EOCA 2IG7A 4I5HA 3RM6A 3B2TA 3RP9A 1PF8A 3KF7A 2QKWB 2J7TA 3C4CA 5IQAA 3RBWA 2UZBA 1JKLA 4DHFA 3FMLA 2VWZA 4E5BA 5I9VA 4MQ2A 1OPLA 1Q99A 1K9AA 5DWRA 3PVGA 3KC3A 3N51A 2PWLA 3LMIA 1YWRA 1UWHA 2HCKA 4FV3A 4ASXA 5FEEA 1KE6A 4JNWA 4ANMA 4O0RA 1DI9A 3DGKA 3H10A 3NGAA 2VTHA 2XEZA 4X6QC 4AOIA 4JDHA 5H9BA 2OU7A 3AGMA 3BRBA 3QQGA 3VW8A 5EK7A 4E73A 5D11A 3AG9A 3PY1A 4Y8DA 4ZSEA 2QU6A 3ZU7A 1ST0A 2WMUA 3DZQA 4GYIA 3R02A 4RA5A 4D9TA 2P2IA 4QQTA 5AUUA 4FKTA 2BTSA 5KMOA 3U6IA 2UW3A 3P86A 4FV7A 3SDJA 5D12A 3WZKA 2IWIA 3VN9A 5J7HA 3EFWA 3RK7A 3Q53A 3E93A 1ZMUA 4DGGA 2B53A 4FT5A 3Q6WA 3DNDA 4QMVA 3OOMA 5HCXA 3GP0A 2Q0BA 3CS9A 1S9JA 4EH2A 4EOJA 3W2CA 4DGNA 1SYKA 4EHZA 3F61A 3V6SA 1P14A 5A6NA 2JAMA 2UZOA 1M52A 4FKPA 4FYNA 5AWMA 4E4NA 5C8NA 5J5TA 2PYWA 5EKOA 4FTQA 3C1XA 4NT4A 4FI1A 4BWPA 2QG5A 3HX4A 2XF0A 1BX6A 4N0SA 4PWNA 2QOIA 2XNPA 2YIYA 1CKJA 2J5EA 3KK9A 5CTPA 3FLQA 2B7AA 4FA2A 3DB6A 2I40A 3P7AA 4UWBA 3CJFA 3BGPA 2XM9A 2Z7LA 2GS2A 3GQIA 5FP5A 4FT7A 1MRUA 2O2UA 4RWIA 4FK6A 2DYLA 2QI8A 5FTQA 4QMNA 3H9OA 5J95A 4EH8A 2JDVA 4L45A 5ICPA 1OL5A 2GSFA 3AD6A 4CFNA 2C69A 3P7CA 3OT8A 3GU5A 3QQJA 4FRFA 4MNEB 3ZO2A 4O7TA 4BHNA 5K0KA 3R7EA 2EWAA 2VNWA 4V05A 2HK5A 1VYWA 4FKIA 3R7UA 4FSUA 1UU9A 3ZTXA 3K3JA 5L6WL 2XJ1A 4IEBA 2R3MA 2I6LA 4LGDA 4MXAA 3HV5A 5I9YA 1W7HA 2OW3A 4FOBA 2GQSA 3VONA 3LLTA 3BELA 3QRUA 4XG8A 5L2WA 3NPCA 4FIHA 1WBTA 2R0UA 3JYAA 2GTNA 4ZSLA 4P5QA 4Z9LA 3R00A 2PZYA 2Z7SA 4TYGA 4E5AX 3TV6A 3C9WA 4A9TA 4F4PA 5ANEA 2GNJA 3LFSA 4YPDA 4Y5QA 3MVJA 2W1ZA 3QCQA 4FF8A 3W2RA 5M44A 2JD5A 3QX4A 5TR6A 3TZ9A 3VS2A 1L8TA 4RA4A 5JZJA 3P79A 3GFEA 3NW5A 3UGCA 3NYOA 2GFCA 3G5DA 1R0EA 3KREA 3QUPA 4ZJJA 5DBXA 2BFYA 3R8UA 2XVDA 2R9SA 4GK4A 3NIZA 4DH7A 2NRUA 4OBOA 2XB7A 2C1AA 3ITZA 4IX6A 5JRSA 2IW8A 3PA3A 3HAMA 2IO6A 2A19B 4EOSA 1S9IA 4EL9A 2OI4X 4QPAA 2PVMA 4BGQA 4DFNA 1F5QA 1BMKA 2PMLX 3MTLA 3QTUA 4IM2A 1HCKA 3IONA 5HE0A 3LE6A 4FSRA 4IWQA 4J1RA 4AGUA 2E9NA 3QA0A 4P5ZA 5M09A 3ORNA 3CD8A 3BU6A 3R73A 5HBJA 2C68A 1H27A 2JGZA 3PSCA 4FKJA 4FE2A 3OWLA 2ZM3A 2J9MA 1LP4A 1TVOA 3GQLA 4LRJA 3QD2B 3TJCA 3QHWA 3OCBA 4I3ZA 4CV8A 2KULA 4M7IA 3RMFA 3EYHA 1PXOA 4K2RA 5DLSA 2WOUA 3K5VA 2QR8A 2QLUA 4G34A 4LUDA 3FMKA 4UBAA 5E7RA 4N70A 4WUAA 2ONLC 3CQWA 4DA5A 4DEDA 1H1RA 2QU5A 2UZTA 3I60A 3KXXA 4TWPA 4G3CA 5CSPA 3DPKA 3F3VA 4NTTA 4EJNA 4BGGA 2UZNA 5F4NA 3KVXA 4HPTE 5AP1A 3VBWA 4PPBA 4XG9A 4YGAA 3C51A 3KCFA 4LFIA 5HG5A 1WBWA 1V1KA 5HG9A 2YLFA 2IZRA 3A61A 3FC2A 3K5UA 4Q5HA 5E8UA 5BVWA 4BTJA 1PRYA 3WF9A 3EN9A 1SNUA 1IA8A 1M7QA 2OZOA 2YAAA 3OEFX 3QD4A 4GVAA 1RJBA 2BAKA 3O2MA 3Q4CA 4R3RA 3G33A 3MTFA 4ITJA 4BN1A 4UXQA 3QKMA 4FVQA 3TIZA 3KRRA 3ETAA 1ZYLA 5M51A 1OBDA 3BLRA 3E88A 4PNKA 2VX0A 3VBVA 5FDXA 4UALA 4A9RA 1AD5A 2HY0A 5H3QA 5AUWA 1TZDA 2W1HA 5EW8A 2YFXA 4G3DA 3FKOA 4F7LA 4PP9A 2VX1A 3QLGA 4KKGA 4O7LA 2GMXA 3F6XA 5K4IA 3CD3A 4USFA 4A7CA 3G15A 3RTPA 2F49A 2H96A 5D10A 2YITA 3ULZA 4O2PA 3LJ2A 4AZSA 3OXTA 4BL1A 5CAOA 4OAUC 1OIQA 4F9WA 3S00A 1W8CA 4HVSA 4RC3A 4RX7A 4L67A 4QP3A 5IA2A 2R3RA 3HNGA 2CKQA 2X39A 2BKZA 3TG1A 3RWPA 4DYMA 3F3ZA 5LVNA 4IDTA 2CCHA 3T9IA 5L8KA 2JIUA 1OKVA 1M2RA 4AA5A 2VTAA 4LGGA 3AMYA 4JBVA 3QD3A 2ITTA 2BFXA 3LKMA 4ANSA 4D4SA 2XYNA 2Y6OA 1KV1A 4DBXA 3PPZA 3MI9A 2C5XA 4M84A 2F7ZE 3OCGA 1UKHA 4CLIA 2XJ0A 1Q4LA 4HCUA 3LOKA 4I6BA 1BKXA 2W96B 4L01A 1UU3A 1Y8GA 3A99A 3Q4UA 3CY2A 5AEPA 4JR7A 3SXRA 2W17A 3KFAA 4HYHA 2W5AA 3AXWA 4G9CA 3ULIA 3HP2A 1JWHA 2VTNA 3FSKA 1H1SA 4EONA 4S30A 2FUMA 4D4VA 4NZWB 5M06A 2QHMA 2UW6A 4FZAB 4RWJA 3EQDA 4FV4A 4P90A 5HTCA 4QYYA 4YSJA 3JS2A 4QEBA 3R04A 3ZYAA 5CEKA 5BVDA 4RJ7A 3I7BA 5JZNA 4YO4A 5C4LA 4ZS4A 4BYIA 2WMSA 4AT3A 5AM7A 2WMVA 4YBJA 2VTLA 2WQOA 3KMWA 1OKYA 5BPYA 3GCUA 2OF2A 5CSVA 3OFMA 2A98A 4CMUA 5KBRA 5FM2A 3R01A 4NEUA 3I0QA 4NCTA 3GOPA 3R7GA 4II5A 1KOBA 1GJOA 3OMVA 4LM5A 4QRCA 4A9YA 4BIEA 3Q5IA 4EC9A 3TKIA 2I0HA 3R8VA 3ZSIA 2QOBA 4J52A 5AP3A 3VUMA 4YC6A 4ZTHA 5E92A 3ZDIA 4HZRA 2I0YA 2F57A 2J5FA 5HVKA 4I0TA 4TWNA 4FV0A 5KO1A 3FZRA 3VF9A 2UZUE 1X8BA 3F3WA 3KXHA 4F0FA 2PY3A 1TQIA 5HESA 3T3UA 2WNTA 3KU2A 4WBOA 4D55A 3UIUA 2VWIA 4HVGA 4MXYA 3OBGA 4YC8A 3EB0A 3W0NA 5ACKA 2XALA 3EQRA 3Q4TA 4RMZA 2PUNA 3TI1A 5A14A 3LQ3A 3GU6A 1NY3A 3M1SA 1OL1A 4BI2A 1H26A 3CY3A 3PP1A 5DT0A 4BCHA 4FUXA 3CBLA 1U59A 5CAUA 4MAOA 2XUUA 4DGOA 4DTAA 3LQ8A 3EN5A 2BALA 3BYUA 3QD0A 2OKRA 4V0GB 3ZDUA 4F1MA 4JAIA 5FUTA 2BZHB 3VIDA 1R3CA 5DA3A 3ZMMA 4AGWA 2HW7A 4CCBA 4E8AA 2YDKA 3Q9YA 3MJ2A 3PSDA 1Q8TA 5L2IA 1KWPA 3FSFA 3PJ3A 3OCSA 2RL5A 3W0SA 1O9UA 4FV2A 2BAJA 4RIXA 5HTIA 2R7IA 4D5KA 4AS0A 4BCQA 3V5WA 4BCGA 1O6KA 3VBQA 2CNQA 3QBNA 4MBLA 5KMKA 2IVUA 3OOGA 4W4WA 4XH6A 1CSNA 2Y8OA 1Q8YA 4HJOA 3VRZA 1XH4A 3KRWA 3NCGA 5FDPA 4ZTSA 3N4VA 3FEGA 3TNQB 5BMSA 3ID6C 4PUZA 2GNIA 3ZRMA 2PVRA 2EUFB 4H3PA 4YZDA 3O71A 5IQDA 3UNZA