1R39A

The structure of p38alpha
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
345
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Lattice stabilization and enhanced diffraction in human p38 alpha crystals by protein engineering.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 345
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1r39A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1r39A01
3SW4A 3UDBA 2ZB1A 4C8BA 4FV1A 4ANOA 3GB2A 4G3FA 3Q9WA 5GIOE 2WMSA 2Z8CA 2GS6A 2ITZA 5C8MA 3EFLA 1OIUA 4RVKA 4EQCA 5JK3A 1PMVA 1UU3A 2JFMA 1YVJA 2FGIA 5HD7A 4B4LA 1OKZA 3D2KA 4IB0A 4UMQA 5AUVA 3R9HA 4M0YA 3LW0A 4PRJA 4K6ZA 4O91A 3R9NA 2HELA 5AR4A 3TI1A 1H28A 1Y57A 4BDKA 5CT7A 2YCRA 5HE2A 4E73A 5IQCA 3R01A 2IW9A 5I5ZA 2GQGA 3RPRA 4NJ3A 4DFNA 3MFTA 5HOAA 5LWMA 2F4JA 3Q96A 1VYZA 4M69B 3A4OX 2WTWA 3PXRA 1ZRZA 4ERKA 3NCZA 4GVAA 4ZSJA 2WTIA 5IZFA 3PJ2A 4IB3A 4ANQA 1ZWSA 2VTNA 4QQTA 2WMWA 5A14A 2UZNA 3KF7A 4LGGA 2BZKB 1J1BA 4E6CA 2ZDUA 1OUYA 2C5OA 4O0VA 1YI4A 3ORXA 3B2WA 3QCXA 3F88A 4OUCA 3EQHA 4RC3A 5KKRC 5AAEA 4BN1A 3Q52A 2F9GA 5HGIA 3F6XA 3C4XA 3NVMB 2QQ7A 4IEBA 4IAYA 1Y6BA 2XIKA 4HJOA 4LV5A 2NRYA 3BYVA 5AV2A 4RVTA 4BBEA 1U5QA 3OT3A 4QYGA 4RWKA 4BC6A 4J97A 2OZOA 3IDPA 4AP7A 2HY81 3TZ8A 3KULA 3GT8A 3NNWA 3O7LD 2YCSA 2F7XE 4IVDA 4PNIA 4CG9A 3FAAA 2UW5A 1ZAOA 1REKA 1JBPE 2R9SA 3PG3A 4U43A 5H2UA 3UVQA 4EKLA 1H00A 1MUOA 5ETIA 5B0XA 4R5YA 4YZBA 4EK8A 1V0PA 3IQ7A 4OBQA 3EIDA 4JL9A 3G6HA 4L45A 2Q0BA 3QGWA 5ANOA 4QP3A 3VBTA 4GG7A 4AOIA 3LCSA 5IH6A 3PXYA 3QA0A 5IEYA 4E6AA 3GQIA 4FTMA 1OKYA 3E88A 3ORZA 3DJ5A 4B99A 2V5QA 3W2QA 3K5UA 3RBWA 3BYSA 4FKVA 4J95A 5J7HA 3BYOA 2YIXA 2CKQA 1OPKA 5JKGA 1OIQA 4FSNA 5D7AA 2BZHB 4DT8A 3UOHA 4HYSA 4ACHA 3CY2A 2XIZA 3KRRA 3AD6A 3FY2A 4FI1A 2XCKA 3OD6X 5EQPA 4AZFA 4BCFA 4IM0A 2F7ZE 4ZJVA 5CANA 4F1TA 2RG5A 3Q3BA 4I5HA 4WG3A 3MFRA 2QOKA 3GOPA 5CEQA 2J6MA 1YWNA 3LHJA 4ZSAA 3R8ZA 2IW6A 4DA5A 3Q53A 4L7SA 4YNOA 2PZRA 1S9IA 3FLSA 4V0GA 5D11A 4QP6A 1X8BA 4X7QA 1XH4A 3ZYAA 4YJRA 4G5PA 5CNNA 3KXHA 2VO3A 4I3ZA 4NKAA 5F1ZA 4O7YA 2WTDA 2I7QA 4RIYA 2ACXA 3TN8A 3UODA 4PP7A 1WVWA 2WXVA 4TZRA 5KHWA 4F70A 4OBOA 4DFZE 4ZOGA 3VRZA 3MY0A 2FO0A 5HHWA 4FKLA 1GY3A 5CXZA 3ELJA 4NWMA 5A4LA 4CQGA 1U54A 2X9EA 2BVAA 3MPTA 3RNYA 3SA0A 4QP1A 2ERKA 3OROA 4XG2A 5FM3A 5HG7A 5L2QA 4AZSA 3PA5A 1FQ1B 3M42A 4DEAA 3DQXA 2WTCA 4HCVA 3HV7A 3ZHPC 2BCJA 4ZP5A 3VAPA 3VUKA 3BGZA 4M3QA 2FB8A 2VTLA 5KKRB 5GJGA 2E9NA 5IQEA 4MVFA 1Q62A 1ZOHA 1MRUA 4O6EA 4GFGA 4IIRA 2UZOA 4ENXA 1OECA 4EH5A 2GNFA 4ZTHA 2EVAA 4FYOA 5IA3A 3R28A 4C7TA 2EUFB 4MWIA 1MP8A 2BDFA 4EOIA 3OFMA 3PVWA 1Y91A 3PUPA 3QUEA 4E4LA 4I6BA 5IPJA 1R1WA 2E9PA 4C4FA 4QMUA 2GU8A 2OF4A 2YERA 3MBLA 1VJYA 4WHZA 2VU3A 4M68A 5TO8A 4UZHA 5AUWA 4BI0A 4MQ2A 2PVKA 4TYGA 5LVLA 2QR7A 3RAIA 3UVPA 3LFEA 5JMSA 4X3FA 5ETFA 5F9EA 3QALE 2OU7A 4J52A 5EI2A 3S3IA 4Z16A 2GHMA 5KZIA 2BZJA 3TKIA 4XOYA 1YXSA 3FZ1A 1YQJA 3VW8A 5K9IA 5M06A 4BDEA 4QMXA 4RIWA 3ZO2A 5A4QA 3LXPA 1U59A 2QHNA 3DDQA 3DLZA 1GIIA 5D10A 4FZ7A 3KFAA 4MH7A 3HP2A 3U6HA 4N0SA 2UZUE 2BILB 2JDRA 4PX6A 5L2TA 2WD1A 3MH2A 4FSQA 4DLJA 3PDTA 3LFDA 1SVGA 3FBVA 3OUNB 2YWVA 3IGGA 5B2KA 3RZBA 3W2OA 4L46A 3HECA 1STCE 4RA5A 3C4CA 4LOOA 5TOZA 3ORNA 4ZZMA 2PPQA 1YDRE 2YFXA 4WG5A 4Q9SA 4MQ1A 3BGPA 3MVJA 4PQNA 4XP3A 5AIKA 2OXXA 2PMLX 2XYUA 4FTLA 4QMMA 3W32A 4EWHA 4DFXE 3OCSA 4YP8A 5J9LA 1BL6A 1YXXA 2HXLA 4J7BA 3W2RA 1BI7A 5CF8A 4YC3A 4LGHA 4R78A 4O38A 2W1FA 3DGKA 4I0RA 2W99B 5EW8A 2WU6A 3HMMA 3F3ZA 1G8SA 4XLVA 5HEZA 1JSUA 3GCVA 5C8NA 4O0XA 3TJCA 4AZWA 5BVWA 1QCFA 4HPUE 4DEBA 4W9WA 3V01A 3SX9A 2YLFA 3OUKA 4PDYA 1YOJA 3FLNC 3QAME 3HP5A 1M7QA 3A7FA 1SVHA 3G90X 3B8QA 3DKFA 3LIJA 4GH2A 3BHHA 3PPJA 2BZIB 4GT4A 3SRVB 4CLIA 5KX8A 5LWNA 1Z57A 2WTVA 4IC8A 4ZS0A 4FZDB 1A9UA 4N4SA 3UQCA 5TKDA 4GL9A 5D12A 5E8SA 3UGCA 5BVNA 2BROA 5IQHA 4AACA 4ONAA 5IDNA 2JIIA 2PUNA 2OWBA 2QO2A 2VTPA 5AFVA 2YDJA 3TKHA 4EOKA 4DFBA 1H25A 4IAFA 4JDJA 5DEYA 4ACGA 4IB1A 3BZ3A 4G3DA 4IAZA 3WZJA 3ZM4A 2EXMA 3V8WA 3FKLA 4CFMA 2XK3A 4YZMA 3LVPA 5AADA 1PRYA 5EQYA 3O7LB 2HZ0A 4R3CA 3ZM9A 1ZZ2A 5FG8A 3WF9A 4CKIA 3E7VA 3E5AA 4GKIA 3DNDA 3O23A 5EYMA 3LXKA 4E20A 5IKWA 4E8AA 4O7TA 4KRCA 2B53A 4AU8A 4YTCA 4CMUA 3EN7A 2HK5A 4N6ZA 1HOWA 2HIWA 4EHZA 3PP1A 2R3KA 4YLLA 3GU5A 2QNJA 3U51A 3ZH8A 1PKGA 2X8IA 4U79A 5M09A 4ZTNA 4Y73A 4HYIA 5GHVA 3MYGA 4XH6A 2B52A 5TF9A 2Z7LA 4A4XA 3MS9A 4PTGA 3LFBA 5FRIA 1M14A 3UNKA 2ITVA 3O0GA 4KIQA 4UZDA 4B9DA 4BKJA 3IW8A 1YOLA 2W7XA 3UG2A 4Z55A 3ULZA 4I94A 2FSOX 2QKRA 3TNWA 5JFXA 3CJGA 5DRBA 1OI9A 3ORIA 2W5AA 3U6JA 2QD9A 4FIFA 3HV3A 2GQRA 3QQGA 4UALA 1PMEA 3VHEA 2IZTA 4TT7A 4UX9A 2XF0A 3FI8A 3EB0A 4XG3A 3VS4A 5HQ0A 3D5UA 3JY9A 4BTMA 4QP8A 2XK4A 4DEHA 1GAGA 3D7TA 5E1EA 1CM8A 3GVUA 4IDTA 5HCXA 1ZOEA 4B8MA 4G5JA 5J5SA 4KBAA 3UOKA 4EK5A 4IX6A 3MTFA 3BX5A 3IG7A 4FKPA 4GUBA 5JFVA 2CN5A 3CQEA 4DBNA 2OO8X 4RX5A 2XS0A 1NVSA 5H8BA 3KN5A 4O0WA 5HLNA 2W9ZB 5I3OA 3VS3A 5KMJA 3BWFA 3RHKA 2GMXA 4IDVA 3KVWA 4DGLC 3LMGA 4IWQA 2B9FA 2C4GA 5CZIA 4TPTA 3ZEPA 4NM3A 3FZOA 5HBEA 2WTJA 4E7WA 4F1OA 4IFCA 3OWJA 3DAKA 3QQFA 2OSCA 1XJDA 4F7LA 3O8UA 4JQEA 4D1ZA 5M4CA 3TEIA 3POZA 5HVKA 4CVAA 3RK5A 5HU9A 1IEPA 1OPJA 5AV3A 1J7LA 5IQGA 2CSNA 4X3JA 2IZSA 1CKIA 3QWJA 5CAQA 5FLFA 4OT5A 4WBOA 5GIPE 3PE1A 3GCPA 4QMZA 1Q61A 1PMNA 1SVEA 3QRTA 3QTXA 4BGGA 2BFYA 1QPJA 3LJ0A 3QYZA 4RWIA 3CQUA 2HZNA 4D2SA 3V6SA 2J9MA 4TYHA 4D2RA 3R8VA 4F65A 4OAVB 1YXVA 4DG3E 4ZLOA 5IA0A 3OCBA 5KMOA 1P2AA 3I79A 4RQKA 3EQFA 4A9SA 4DH8A 5CU6A 5CEKA 2F2CB 3PSBA 4YJNA 3ZRLA 4M0ZA 4H05A 2C3KA 2AUHA 3IPHA 4K2RA 1PY5A 4MF0A 3QTIA 3O17A 4NL0A 2I0HA 2QHMA 4RSSA 5EW9A 1RE8A 1CDKA 1HCLA 4G16A 3DK7A 4UXQA 3UMXA 5L2IA 5CZHA 2UZEA 5DEWA 4FKUA 3ZFXA 3QTRA 5HX8A 3G51A 2JIUA 3NCGA 3PA4A 5KUPA 2JGZA 1F0QA 3DDPA 1UU9A 2J4ZA 3JVSA 4W8EA 3ZO4A 3ZXTA 4RIOA 5D9HA 3PLSA 4FIJA 2RL5A 4BDJA 4BYJA 2JKKA 1T46A 3EWHA 4EH8A 3HNGA 5AX9A 3QRJA 3DAJA 3TNIA 3WF5A 4AGDA 3GU4A 5CWZA 4RJ3A 1P14A 4FOCA 4IFGA 1OIYA 1ZMUA 2NRUA 3KF4A 2YN8A 4TNDA 3ZRKA 3TIZA 1YWVA 4BICA 2VWYA 2G9XA 3NUYA 3PY3A 4BWPA 3W33A 1A06A 5IQDA 3BKBA 4YO6A 3WYXA 2C5NA 5IDPA 3SC1A 2ZDTA 1KE5A 1W7HA 5AP6A 3R7IA 2XP2A 4MHAA 2CLXA 2IPXA 2PE1A 4CT2A 4GIHA 1H1WA 5DR6A 2C5VA 2O3PA 1UKHA 5M53A 3ZUVA 2CNVA 2WB8A 3DFAA 2XKCA 4FKWA 4AOTA 1OIRA 1JQHA 3CTQA 2HENA 3CGFA 4FEXA 4EBVA 4DH5A 3S0OA 3ATTA 1YWRA 3F5GA 4GVJA 4USDA 4O0UA 5EDPA 4CRSA 5LMKA 3EH9A 5FBNC 4EJNA 4HPTE 4MNEB 4PDSA 5CEPA 1Q24A 3P7BA 5CSXA 3VUHA 4O7WA 5HVJA 3QRIA 1WVYA 5BVEA 2R2PA 4BF2A 5JFSA 4MX9A 1GZ8A 3JUHA 4QNAA 5I9YA 3G0EA 3V3VA 1GJOA 3JY0A 3UIBA 3BCEA 3ROCA 2GTMA 3EKKA 3F2RA 3PPZA 4O7NA 4R3PA 4XRLA 3HMNA 4ZSEA 4FKSA 2KTYA 2YAKA 2OJJA 1H1PA 3GC9A 4IW0A 5DRDA 5EYKA 3VS7A 3PJCA 2F7EE 4AWIA 1PXJA 4EI4A 1UWJA 2C5YA 4PDOA 4CT1A 4G2FA 5CF6A 3SG9A 3NW5A 4QOXA 4NFNA 2CGUA 4UB7A 2VGPA 3T9IA 4DGMA 3GEQA 3H4JA 4FKRA 3ZLSA 3HKOA 4JS8A 2WO6A 4FV8A 3QQLA 3RK7A 3ORTA 3WZUA 3F82A 1PHKA 2BMCA 4F63A 3OXTA 4LUDA 2PVHA 4MNFA 4YO4A 4QRCA 2RIOA 2XK7A 3VS5A 4F64A 2Z02A 3NAXA 4ITHA 2HXQA 2UW8A 4RPVA 4YR8A 2FYSA 3C4EA 3VUTA 3WZEA 5EG3A 3DJ6A 5HCYA 3VHKA 2PMOX 4O0SA 4GK2A 4KAOA 3FYKX 2EWAA 5CI6A 4D2PA 3WARA 3ZUTA 3ZLYA 3JYAA 5AP4A 4BDDA 2ZV8A 2GSFA 4MYGA 4HVIA 4U42A 3TV7A 3MPAA 5LMBA 4UXLA 4ACDA 3QGYA 1LPUA 5B2MA 4OTIA 4OTPA 1ZOGA 3S95A 1IRKA 2VTHA 3SXFA 2XA4A 3KXMA 5J7BA 4G3GA 4GU6A 1K3AA 2OICA 2WMTA 4RIXA 4BY9E 1RW8A 4AZVA 1Z5MA 3RVGA 5J5TA 3NSZA 3R00A 1APME 5CVHA 3FLYA 5AR3A 2B54A 2NP8A 3DY7A 4UYNA 3OY3A 4Q5HA 1YDTE 3M2WA 5F94A 2CHLA 3FKOA 4PP9A 1UNHA 1J91A 4MK0A 4NYEA 4ID7A 3A7IA 4TL0A 2QR8A 2VO7A 3QTWA 2ONLA 4DEGA 4IHPA 3ORPA 3EZVA 3C51A 1BKXA 3OBGA 4C4EA 4MBIA 4YHFA 3K3JA 3HEGA 5DA3A 3SKCA 1ND4A 4JOAA 4CFFA 4AFEA 4BHZA 3TZ7A 4DYMA 2XK9A 3D5WA 4O7ZA 4WG4A 3VBVA 3CPBA 3MDYA 3KRWA 4LRMA 2XMYA 3RPSA 2R3OA 2YIQA 3LFNA 4O27B 4I6FA 4ZSLA 5K0KA 4BGHA 5EQEA 5IEVA 5CEMA 1NVQA 2W1ZA 3QRKA 4S2ZA 1PXOA 2DQ7X 2QLUA 2VN9A 1XO2B 5KMLA 2GHLA 3UP2A 2IVSA 1H27A 2XVDA 3LOKA 1TVOA 2OJGA 5LARA 2PZYA 4WA9A 4XX9A 5FXQA 5FTGA 2KULA 4AW5A 4PDPA 2GFCA 3BGQA 5FEQA 2WU7A 3R7OA 4LV8A 2W06A 4OLIA 3KL8A 4JBQA 3I0QA 3R63A 3FHRA 4UN0C 2OZAB 5JRQA 3BWJA 3L8PA 1XH6A 4BDHA 3VJOA 4F6SA 3LXLA 2JDTA 5JGAA 3N4VA 4XMOA 4Q9ZA 2PUUA 5EK7A 3FQHA 5J95A 3U87A 3VVHA 3TTJA 2YAAA 4OGRA 4GCJA 3E3BX 5M4UA 4RJ5A 1JSTA 3P78A 2V7AA 3P1AA 1K2PA 3TZMA 3HDMA 4O1OA 4WNOA 4RFYA 5DYJA 1AD5A 5BYZA 1KV1A 3UBDA 4BKYA 1JVPP 3UIXA 2YIWA 2GNIA 3RPVA 5EM8A 4EH6A 3ORLA 5LMAA 3ZSIA 2J2IB 3DS6A 5AUUA 1XHAA 5DOSA 2C69A 5I9XA 3HDNA 5DN3A 4AW0A 5AIRA 4CXAA 2VWIA 1GZOA 5AUTA 4ASZA 2UW9A 5DT4A 3SLSA 1H1RA 5J9ZA 4C02A 4BR3A 5HKMA 4QP7A 5CEIA 3G0FA 2VTAA 5D41A 2R3GA 5AAFA 1E1VA 2OXYA 4EQMA 5CI7A 2QOCA 4H1JA 3RWPA 2XNPA 4EONA 5BUIA 1J1CA 3FLWA 1OL2A 1WAKA 4BTJA 3REPA 2X1NA 3QTZA 4L53A 3V5QA 4O81A 3GU7A 3TV6A 2BTRA 4FL2A 4U97A 5DG5A 1JKKA 2XNEA 3AT2A 4EH3A 5LVMA 4F0FA 4D4YA 2C0TA 2ETKA 3KA0A 3R04A 4OTQA 2CGVA 2PE2A 1URCA 3MJ2A 4QMLA 1PXLA 3ZRMA 3R1NA 3LJ2A 2WKMA 3DJ7A 4YPSA 2PVNA 4L3JA 4D55A 4E6QA 3FI3A 4I93A 4LL0A 2JAVA 4F09A 1R0EA 4LQMA 3VS6A 4BI1A 3QTUA 3PJ1A 4BCOA 5BVDA 3DXPA 1SNUA 4XEYA 5BPYA 3RTPA 4HVSA 4A9TA 2VUWA 3ZFYA 3S4QA 5HNIX 2GNHA 5CU4A 2QO7A 3QA8A 3T3UA 3C9WA 3CEKA 5EI6A 4RBLA 4TXCA 2I0VA 4YJSA 3TXOA 3EQBA 4F7JA 2SRCA 4X3FC 4KD1A 3KXGA 4F9CA 4FTNA 2W05A 3UZRA 5A4EA 4QMPA 3HAMA 2C5XA 4MD8E 4S34A 1WFCA 3BIZA 4AW2A 2F49A 5GJDA 3LXNA 3R1QA 2W5HA 1UA2A 2W4OA 4XG4A 3K2LA 4F9WA 4FTTA 5JSMA 2CDZA 3R73A 2XUUA 5DH3A 3TWJA 4ITIA 2ZM3A 3EQCA 2J0IA 2ZV7A 4AA5A 2XK6A 3L8XA 5E91A 5C4KA 2RSVA 2XB7A 5M08A 3IW4A 4RLLA 5DWRA 3I81A 4C3PA 4JJRA 4QTDA 5TT7A 3QLGA 2XRWA 4NM0A 1CSNA 5C4LA 4B7TA 1CMKE 2CKPA 4G1WA 1SMHA 2PUPA 3KQ7A 4RZVA 2UZDA 2YHVA 2O5KA 1JKTA 2ZM4A 5IEXA 2V0DA 2J51A 3PIYA 2PMIA 4FICA 5HO8A 5J1VA 1YOMA 4C36A 4PNKA 3C1XA 3F2AA 4BIDA 4D0XA 3CQWA 5BYLA 4ACCA 1E1XA 2ITWA 2VTJA 1H1QA 2IZUA 2UVYA 4R1VA 4YJQA 2ITTA 4O2ZA 4AF3A 1ATPE 4V0GB 5LCKA 3ANQA 4DBXA 4Q5EA 4J96A 1IA9A 2YDIA 5EDRA 4WT6A 4DEDA 4IAAA 3EQRA 1TQPA 3RAWA 3GENA 2DUVA 5A6NA 4BDGA 4QYFA 3CIKA 3NX8A 3R9OA 3FSFA 4YBKA 2I0EA 4RIYB 3RCDA 5BVFA 4CKRA 4YSMA 1CKPA 3KMWA 2XKEA 4XBUA 4DLIA 2R7BA 4TY1A 3QQKA 4JG7A 5IH4A 4FGRA 1NXKA 4BCNA 4PL3A 2J0JA 4IANA 3COMA 3CKXA 2BIYA 3KMMA 3LCOA 3ANRA 3ENMA 3L9LA 3QD2B 4IX3A 4KKHA 4BB4A 2XKDA 5FP5A 4DH1A 4BKZA 1UU7A 3NUNA 5DVRA 3M1SA 4KS7A 4JR3A 4ZSGA 4A9RA 4CSVA 1OUKA 2XIRA 4AXAA 2A27A 2YISA 2J5EA 4FC0A 4ZZOA 4DH7A 4D9UA 2X81A 4IJPA 3VW6A 4HVHA 3PXKA 3ZU7A 4JRVA 2WQEA 4NCTA 4KABA 4PL5A 5DIAA 3ZSHA 4JG6A 3MA6A 4YTIA 4TTHB 3WF7A 5AP1A 4QYYA 4C33A 2HW6A 3I6UA 3MN3A 3C5IA 1B6CB 3HA8A 3CJFA 2V62A 5JN2A 3CP9A 1KUTA 3UG1A 4ARKA 4C0TA 3EYHA 4FG7A 1T45A 2YM7A 4D58A 4CV9A 3EN6A 2RG6A 4O2PA 2R4BA 4FIGA 4ORKA 1OPLA 3UTOA 5HCZA 2QOBA 2V7OA 4RT7A 3F69A 3WF6A 2VD5A 1KSWA 3OVVA 2OFUA 3DTWA 5KE0A 4USFA 4AN2A 4X3FB 5KMMA 2LAVA 4BL1A 4C4HA 4BCIA 4KIOA 1FVTA 3PYYA 4Z7HA 4LMNA 4C34A 4N57A 1OGUA 4U6RA 4PPCA 3E93A 2OG8A 4XRJA 5EYDA 3CBLA 2QLQA 4GV1A 3R7GA 1UWHA 3CLYA 1YXUA 3KK8A 3ATSA 4RIWB 4AAAA 2VX1A 5I9VA 2WOTA 3NGAA 3QD3A 5E8VA 3WBLA 4CFVA 3U54A 3HX4A 1J7IA 2XJ1A 5EDQA 2VGOA 4AT4A 4DHFA 5EKNA 5KCVA 4OTHA 2XJ2A 3ALOA 5E8UA 4GYGA 4DCAA 4WUAA 2R3QA 2VWXA 3PWYA 4G3CA 4WSYA 4C3RA 4O96A 5BMSA 2OXDA 3FMDA 4G34A 5HICA 4X2NA 3ERKA 3Q9XA 3CKWA 4XV1A 3G15A 4ZY4A 4BGQA 1IR3A 3BEGA 1OKVA 4IM3A 3HMPA 5EW3A 5CALA 3FKNA 4DEIA 3T8OA 1WBSA 3F7ZA 4LG4A 3TKUA 2JKQA 4QMYA 4YBJA 2W1DA 3CXWA 3DXNA 4QQ5A 3OP5A 1VEBA 2EB2A 3IONA 4FTIA 3UZPA 4EOLA 3IK3A 3V8TA 1Q5KA 2P4IA 3Q4ZA 3HL7A 2X6EA 4MXOA 3PA3A 5CY3A 5F4NA 4EHEA 2PU8A 3GFEA 5HTCA 4JX3A 3FL4A 4NSTA 5FUTA 4F6WA 2XIXA 4FYNA 1H0VA 3VIDA 1UNLA 2CJMA 3P7CA 4I24A 5I4NA 4CG8A 1JLUE 4O21A 3FJQE 4APCA 4TNBA 4ALUA 4GKHA 5B7VA 3FYJX 4UV0A 2IJMA 3GC7A 3GFWA 5DHJA 2IVTA 4G9CA 1FOTA 3UJGA 3ZSGA 2QOOA 3DPKA 3L9MA 5DBXA 4NTSA 5AR8A 4EYJA 4IH8A 1OL5A 3HRCA 4K33A 5E8XA 3U6IA 1IASA 1XH5A 4F1MA 5AM6A 4YSJA 4CTBA 4U40A 5CEOA 4C2VA 2VRXA 2PL0A 1UV5A 4U45A 5ANEA 2XYNA 4EUTA 2WQNA 5AUZA 4QO9A 3R7YA 3V5PA 4YZCA 5EOLA 4ZLYA 3COKA 3MH1A 3Q2MA 2R7IA 3HLLA 4FEUA 2WIHA 3LJ1A 4HCUA 2C6MA 2XKFA 4LUEA 4EH2A 4JBVA 5FTOA 2YLEA 4ACMA 2XIYA 2X7OA 3R6XA 1ZXEA 1BI8A 5AX3A 4I4EA 2WOUA 5ANJA 3H30A 4FG9A 2XJ0A 2A2AA 4RZWA 4UEUA 3ORKA 4LL5A 5ACBC 1RQQA 5FDPA 4MCVA 3GBZA 3HUBA 4M67A 4Z7GA 3D7ZA 3BU6A 3DK6A 3VWAA 3ZZWA 3ODYX 3OEFX 3HMIA 5HZNA 3DLSA 1JAMA 4C38A 4D28A 3RJCA 4BVUA 2CCIA 3AC5A 1Y8YA 2J0KA 5AR7A 4PUZA 2Y4IC 4CFWA 3BPRA 2C6OA 4JRNA 3LLTA 2R3LA 4EL9A 2C1BA 4J1RA 3E62A 4XG6A 3IOPA 4XUFA 3EJ1A 4R7IA 4HGTA 3G9NA 3T3VA 4FUYA 1UU8A 3EN4A 4PL4A 3C13A 4YZNA 3AGMA 5J9YA 2W5BA 3RALA 5M51A 3KGAA 4AOJA 1H8FA 3WE4A 3D9VA 3C0GA 4ZJIA 5L3AA 4AG8A 1G8AA 4ZIMA 3W1FA 2BALA 5A4CA 5J8IA 2Y8OA 3HMOA 2W4KA 4AGUA 2JD5A 1GNGA 4J53A 4FSYA 3F3WA 2J0LA 3AG9A 3MY1A 3DKGA 3GCUA 4AUAA 4EH7A 5LMKC 3EQDA 3QQHA 5L6PA 2H96A 3ALNA 2GS7A 5JH6A 3DZQA 3MFUA 5TE0A 4CZYB 3R22A 4AN9A 2W1IA 4DTKA 4E6DA 3CSVA 3O96A 5I3RA 3AMYA 4WRSA 1MQ4A 3D7TB 4DFYA 4UMTA 4IZ7A 5CQWA 2B7AA 2E9OA 4IWOA 4IWPA 3CCNA 4EKKA 2XNMA 3GOKA 4NUSA 3RKBA 2YEXA 3QU0A 4GU9A 1BMKA 5LVOA 4OTFA 3C0HA 4FKIA 3VUIA 4DN5A 3CD3A 4KBKA 2UZVA 5M56A 1ERKA 4FIHA 2A1AB 5E8TA 4EQUA 3PP0A 4YJVA 3GXLA 2UZWE 3QL8A 4BWKA 3TUCA 5C01A 2ITOA 2PK9A 3G6GA 4RJ6A 3LQ3A 2VO6A 4WSQA 4XV2A 3FMNA 5C1QB 4EZ7A 4JAJA 4BBMA 4QTAA 1A48A 2PUIA 4HW7A 5CASA 3DBDA 2UW6A 4AT5A 4ANBA 3W18A 3NYXA 3BHYA 3VBWA 2HY0A 5JGDA 4F0IA 4FA2A 4D4SA 3MJ1A 4E4XA 3F9NA 3BE9A 2Y6MA 4QYHA 4QMSA 2YM8A 1MQBA 4CYJA 3POOA 1MRVA 3CY3A 4L42A 1VR2A 3FDNA 3LFAA 5HX6A 4DG2E 5ACKA 3MI9A 4OTDA 3ZDIA 1U4DA 4ZTLA 3DV3A 2P2HA 3UC3A 4R7BA 4KINA 4PV0A 2PZIA 4YJTA 5E4HA 4E93A 5GNKA 3SHEA 3FC2A 1DAWA 3OCTA 4FSMA 4H58A 4ASEA 4E3CA 3MGYA 2PVLA 4TYHB 5E8WA 4R77A 2G2IA 3FXWA 3WF8A 2ZOQA 3C0IA 4FTRA 3II5A 4GW8A 3HRFA 2C6LA 4JIKA 2YM5A 2H6DA 3UO6A 3GC0A 3VBYA 3HGKA 4AZEA 3ZDUA 4CV8A 2V22A 2WPAA 4IM2A 4FOBA 2VTRA 3BLQA 4MD7E 4IVBA 3SXRA 4NK9A 4ASDA 5FWKK 3WI6A 4BCKA 2ONLC 4KWPA 4DT9A 2X6DA 3PVGA 3NYOA 1H4LA 2BHHA 3K5VA 4XV3A 2WTKC 3P7AA 5DFPA 4BZOA 4FK3A 1K9AA 3COHA 5K5NA 4ZZNA 3U4WA 4O86A 3R9RA 2H9VA 3BV2A 3UIMA 1DAYA 5BQ0A 1S9JA 2EB3A 1PF8A 3A61A 4WBBB 4CKJA 1ZZLA 2E9UA 3NEWA 4P7EA 4GEOA 2F2UA 1OVEA 3L8SA 4F9AA 4AGCA 3VBXA 1KWPA 1XQZA 2EXEA 4K8AA 2YDKA 4OTWA 3NUXA 4IAKA 2YABA 3ZC6A 5HD4A 4FV5A 2CLQA 3EKNA 5HVYA 4OR5A 2Y4IB 4NFMA 4MKCA 4G31A 1KE9A 3H9OA 4E5BA 4YUQA 2VX3A 3LM0A 4C4GA 2OGVA 4Y8DA 3KRXA 5M4IA 3MW1A 4LRJA 2B1PA 3ZO1A 4FT3A 3FXZA 3D94A 3EFWA 3ZOSA 1BUHA 3A99A 2QOHA 3ETAA 3GC8A 4D4VA 4RQVA 1Q97A 2X2LA 5HNGA 5DI1A 3U9NA 4EOQA 1IAJA 3PLAE 1J3HA 4UMUA 4G6OA 2X39A 2R3RA 5LOHA 4RVLA 4FNZA 4S33A 3BQCA 5AP0A 1Q3DA 2XZSA 3F66A 3ZTXA 2AC3A 2VTOA 4QMOA 4QMNA 4FTJA 3DK3A 3EL7A 4I41A 2ETRA 3OMVA 4USEA 2IZRA 3QHWA 4KA3A 3UQFA 4M97A 3QZFA 2ZMCA 5C03A 4FE2A 3RPYA 4JX7A 3G33A 3FZRA 4W4YA 5CVFA 3VO3A 3LZBA 3W2PA 4IB5A 3FC1X 2YCFA 3OOGA 4TWPA 1SNXA 3LQ8A 1NA7A 1TKIA 3KRLA 4D0WA 5BVOA 5JZNA 5IQAA 2I40A 2O63A 3ZUUA 3S00A 4F9YA 3DKOA 3QZGA 2CNQA 4JBOA 3IGOA 1I09A 3I5NA 5CU3A 3TUDA 4D9TA 4EYMA 3QZHA 3O8PA 4HZRA 1Q4LA 5IU2A 4FSTA 3HVCA 1YXTA 5JQ5A 5JRSA 3K54A 4M7IA 3R83A 4YU2A 2PVYA 3EQIA 2RFEA 2HZIA 3AGLA 4C58A 2B9HA 2YIYA 3R7VA 5J87A 1G5SA 2PZ5A 3EN9A 4FKOA 2QOFA 4UYAA 3AD4A 4JDKA 2W4JA 1AGWA 4FVRA 3I0OA 2XM8A 3QHRA 4W4VA 4ENYA 2ETMA 2G2HA 3VS1A 2PHKA 4NKSA 4V05A 4QQJA 4DGGA 2UVXA 3PJ3A 3KREA 3MH3A 4IX5A 2Z2WA 5CAUA 1PKDA 2OH0E 3LAUA 1XWSA 3N51A 2OBJA 4JI9A 3ET7A 1H08A 1Q41A 4RIXB 3SV0A 3I4BA 5IMXA 4RJ8A 3LFQA 5M4FA 2X8EA 3LFCA 4K0YA 4L00A 1B38A 4PF4A 3DBQA 3FWQA 2UV2A 3QCSA 5IQIA 4X0MA 2Z7RA 4M12A 1NY3A 1KV2A 4FNXA 4QMTA 3UIUA 3BHTA 2X7FA 5HG8A 2YZLA 1DS5A 4EBWA 4II5A 5ETCA 2WTKB 4EH4A 2W1EA 4KRDA 5DT3A 2FSLX 4ITJA 3UC4A 3Q04A 4HVGA 2AC5A 4K18A 3A8WA 3VRYA 5FD2A 5CX9A 1KE8A 2WQMA 3LCDA 2BAKA 4FSWA 1R39A 4FTOA 4GG5A 4HGLA 4L8MA 4U8ZA 5IUIA 4Y5QA 5M57A 5CS6A 4LM5A 3BI6A 4EEVA 3K3IA 2GHGA 5IA4A 2R0IA 1UKIA 3OG7A 2B4SB 4FV6A 3NNXA 4JLCA 3BE2A 5FEEA 4KS8A 3T9TA 2ZM1A 5DMZA 4JQ7A 4R1YA 2C3JA 5HLPA 1WVXA 1VYWA 4FTUA 3NAYA 4AW1A 4O7SA 4AA4A 4KIKA 4BDAA 4YGAA 4YLKA 1NT2A 2QG5A 1TQMA 3E8CA 3KCKA 4AQCA 4IX4A 1LEWA 4BDBA 4YURA 2C68A 3KXZA 3RI1A 5A6OA 1Q8ZA 4D2WA 4L67A 3VBQA 3DA6A 4Y95A 3GU8A 5IH5A 2ZB0A 3FMJA 3NRMA 3P08A 4N70A 4QMQA 1PW2A 3TT0A 5KO1A 5I9ZA 5LVPA 3SVVA 2R3IA 3OZ6A 4FMQA 3F7WA 4H3QA 1U5RA 3O71A 4J71A 5HU3A 5J1WA 3TACA 4D5KA 1OBDA 3UYSA 2C3LA 3BHVA 1V0OA 3AXWA 2PVMA 1QMZA 3LFSA 4DC2A 2QOIA 2XNOA 3U55A 5BX0A 4WD5A 2P33A 3FMLA 2FSMX 5HO6A 2OIBA 5CSPA 4BCGA 1BYGA 4X6RA 3L9NA 4BYIA 4I23A 3COIA 4XP2A 2YJSA 3H9RA 3FUPA 3CE3A 5T68A 3SOAA 3MPMA 3NLBA 3E64A 5EHLA 3V04A 3VF8A 3CGOA 1O6LA 3QKKA 3RAKA 5L8LA 3OS3A 2P55A 2JITA 3UOJA 3MH0A 3NUPA 4YC6A 4AFJA 3PRFA 4ALWA 2WMAA 4XS2A 4ERWA 2E2BA 4ZMEA 4LI5A 4G6NA 2XM9A 5HE0A 5CU2A 3RINA 1UNGA 4UBAA 3C4ZA 2VZ6A 4X21A 4OTGA 4H39A 2J7TA 3JXWA 3AMAA 3MB6A 4KKGA 4ZTRA 2XBJA 4CCBA 4P2KA 2JDOA 1RDQE 1PXPA 3FE3A 3BU3A 5T3QA 2JDSA 2UW4A 4GK3A 1U46A 2C6DA 4JDIA 3NUUA 3A7GA 4L3PA 4R5SA 4RC4A 5EI8A 4CFUA 5JGBA 5CVGA 4KUJA 1PXIA 3NIEA 3PY1A 5GZ9A 3UQGA 2UZTA 4F7NA 3WIKA 3NYVA 3QUPA 4NCTC 4NIFA 2WMBA 3BLHA 3QUDA 2CMWA 2OIDA 5ICPA 1H1SA 2R3FA 2V55A 3ENHA 3JR1A 3OTUA 4RA4A 1JKSA 4LYNA 3RNIA 3WYYA 3AOXA 3AQVA 4Y72A 2OJFE 5ANIA 5EYCA 2BDWA 1CKJA 3ROYA 4JG8A 2JBOA 4I6QA 4P5QA 3ACJA 4FT0A 1KE7A 4K11A 5ANKA 3TUBA 2ITNA 5ETAA 3UO5A 2Y9QA 4FEWA 3CPCA 4BHNA 3VUMA 5C8KA 3V5TA 4RMZA 1E9HA 4TYIA 3V5WA 3ZLXA 3SG8A 2JIVA 3LCTA 4MXAA 1UVRA 3P23A 3UNJA 4YZDA 3TNQB 4UWCA 3N9XA 4H3PA 4HVDA 5A3XA 5KZ0A 3KRJA 5IA2A 3NR9A 2ZYBA 4C4IA 1H07A 3U9CA 3AC4A 4U0IA 3MVLA 2IG7A 4ZEGA 4AN3A 3EZRA 2HZ4A 3FLQA 3Q60A 5HIBA 3TM0A 4A7CA 4X2GA 4APPA 4EK3A 3E63A 2QC6A 1XBCA 3P0MA 4O84A 5G1XA 3QQUA 2OH4A 2O2UA 2PVJA 1F5QA 2XNGA 4FV4A 4JIAA 4ZTQA 4D1SA 3ID6C 4CCUA 5AA9A 2R3HA 4I22A 4CLJA 4O0RA 1OMWA 3HUCA 5I9WA 3QF9A 4CTCA 4O6LA 5M55A 4NM7A 3OXZA 2QO9A 4QT1A 1PXKA 3KULB 3PWDA 2WQOA 3PPKA 4FKJA 4OW8A 3W16A 3I7CA 2VWZA 5K3YA 4DGNA 4U81A 4IMYA 5A46A 4M13A 5EHYA 4I6HA 5F20A 4PPBA 5BMMA 5FEDA 4S32A 4P4CA 3OHTA 4IXPA 4CEGA 3BU5A 2R3JA 1OL6A 2OJIA 2IO6A 5AV0A 2FSTX 4ZLZA 3HV6A 1WBNA 3AC8A 2UW0A 2BAJA 4UMRA 4DGOA 4FNWA 5A4TA 1GZKA 2GPHA 3QD4A 4EZ5A 3E8EA 4QMWA 3VUDA 4EC8A 1BX6A 3PRIA 1FPUA 2PTKA 3WOWA 3ZXZA 2QOQA 3V8SA 4G3EA 2YM6A 3P79A 2HCKA 2BRBA 3Q32A 3WZDA 3OY1A 3V51A 1GOLA 4U9AA 5DLSA 3JPVA 4LOPA 5EKOA 5AUYA 2QKWB 2RGPA 4V04A 4YTFA 1L3RE 4EWQA 4C35A 1M2RA 4DTBA 5HTBA 5DE2A 4IC7A 5HTIA 5KMIA 3C4WA 4U44A 3GCQA 1WBOA 4BFMA 4G6LA 4C2WA 1WMKA 1JPAA 3OWLA 1ZARA 2Z7SA 4MD9E 4CMOA 4ANSA 4DFUA 5LXMA 2PYWA 4X2KA 2YIRA 5FQDC 2X4ZA 2GTNA 5JT2A 2UW7A 4CFNA 5FP6A 4QTBA 2QOLA 5CAPA 2JAMA 4JXFA 2ZJWA 4OTRA 3AT3A 2C6IA 3KKVA 3EOCA 3QCYA 4Q2AA 5AP2A 3UPXA 2O0UA 3ZEWA 3ZS5A 5HBJA 3OC1A 5E1SA 2GCDA 1OITA 3V6RA 3R2BA 2ZMDA 4QTEA 4I1ZA 2QONA 2X2KA 2PY3A 1CTPE 3L8VA 2ITQA 2WEVA 4MF1A 4M69A 3FPQA 3TL8A 2WZJA 3FI4A 3MIAA 3MESA 4HCTA 5JQ8A 3D14A 3PXFA 5HO7A 5BUEA 1JWHA 1XH9A 3OWPA 3RCJA 1LP4A 3FQSA 4GJ3A 4BDCA 4WNMA 2WMQA 4J8MA 3LMIA 3ORMA 2BKZA 3VS0A 5AAGA 3F5XA 4K77A 4L3LA 4FUXA 4DEEA 4OBPA 1U54B 4RG0A 3D15A 4FIIA 4BIEA 4QTCA 4HNFA 1Q8UA 2GS2A 1YHWA 1JNKA 4ZJJA 3KB7A 4AGWA 3SAYA 3R8LA 4IVAA 5EM6A 1WCCA 2ITUA 3NZ0A 1M52A 3PVBA 4QQCA 1KOAA 3QBNA 2OI4X 3D4QA 5KBRA 4HYHA 2Y0AA 2YCQA 1H26A 4QD6A 4FKQA 3KU2A 3EMGA 2YWPA 3G5DA 4RJ4A 3VQHA 2JDVA 3IOKA 4O22A 3QC9A 3LM5A 3OT8A 3CTJA 1M17A 2Y6OA 4FF8A 4FSUA 4IQ6A 3B2TA 5JFWA 3E3PA 2E9VA 4U7ZA 4LRKA 4M8TA 2BR1A 4MXXA 3C4FA 1W83A 4WIHA 3NNVA 5FXSA 5H9BA 3IO7A 2BTSA 1MRYA 3DQWA 5K4IA 4RC2A 3KY2A 5IA5A 3W2SA 3NDMA 1W8CA 2BFXA 3A4PA 3CTHA 5EH0A 3SW7A 3SQQA 1M2QA 3CC6A 4NTTA 3Q2JA 4B8LA 4YNEA 1LR4A 4DTAA 1KE6A 3O2MA 3DZOA 4QP9A 4L52A 2W9FB 4YHTA 3RM6A 3Q6WA 3W8QA 2ITYA 3QWKA 4YJPA 5H8EA 4F4PA 4QMVA 3UMWA 3LPBA 4XNEA 2W0JA 1JSVA 3PIZA 2BRMA 3ZBXA 1R78A 3C7QA 3PZHA 3ZONA 3TZ9A 4BZDA 4DITA 3BBWA 1URWA 3DCVA 4GUEA 4I20A 4EHVA 1L8TA 4EUUA 4FT7A 1ZY4A 2O8YA 4O0YA 2XEZA 3MVMA 2UZBA 4H36A 4X2FA 5HIEA 3E8DA 3ODZX 2C0OA 5HG5A 4YHJA 4EJ7A 4OT6A 2BRHA 1F3MC 1REJA 4L01A 4XG9A 1XKKA 3R1YA 1I44A 3VS2A 5GZAA 1FGIA 4FSRA 3MWUA 1SZMA 4TWNA 5DR9A 4E5AX 3IW5A 4AS0A 4YLJA 2WMRA 4BCHA 5AP5A 4V01A 3PSDA 2Y4PA 4RFMA 2VX0A 4ZS4A 4K9YA 1RJBA 2VTQA 4MXYA 3FL5A 4QP4A 4IZ5A 2BPMA 1ZYCA 2PMNX 5DPVA 5L8JA 3QFVA 4C37A 3EQGA 2CKEA 3VNTA 2DWBA 5L2WA 4I21A 4XBRA 3QXPA 4TWCA 4A9YA 2IVUA 3QTQA 3RHXA 4C61A 3LCKA 4KB8A 4EOPA 3NVKI 3R21A 4EOJA 3E92A 1ZYSA 3IW7A 3EYGA 4GFMA 2CN8A 3OXIA 4IJ9A 5IQBA 3DKCA 4O7VA 3NIZA 4L9IA 4F9BA 5AP7A 3D83A 4ALVA 4EOMA 1ZLTA 4OAUC 3UNZA 2X9FA 1ZYLA 3BYMA 4RWLA 4C62A 4MBLA 4CZUA 4YJUA 1QPCA 3FLZA 3RM7A 3S2PA 3WZKA 3DT1A 2VWVA 2F57A 4DINA 3QLFA 2NO3A 4PPAA 3KN6A 3PE2A 3GP0A 4ANNA 3WILA 4RGJA 1ZMWA 5FM2A 3R30A 4XP0A 5IUHA 3TDVA 5G6VA 3KXXA 2R3NA 3MSSA 5L6WL 4ZTMA 2W1GA 2CGXA 3C5UA 4ZY6A 3GGFA 4ZTSA 2NNWB 3CS9A 4Z9LA 2UUEA 3PJ8A 4FV2A 3EQPA 2REIA 5IUGA 1XR1A 5K4JA 4M84A 2GFSA 4F7SA 4TYEA 1DM2A 3UE4A 3FMHA 2IVVA 4FZAB 5E7RA 2ZV9A 3I1AA 5CENA 4FTAA 2PWLA 4PMSA 4TW9A 3SXSA 3VF9A 5B2LA 5IA1A 2ERZE 5BUJA 3IDCA 4NZWB 3UVRA 3OEZA 2Q83A 5LJJA 4CFXA 1AQ1A 4R6VA 1YI6A 3MB7A 2G2FA 4DH3A 5KNJA 3AC3A 2LGCA 3EL8A 5K5XA 4I5CA 5C9CA 1OM1A 4FSZA 3F3TA 4HOKA 2FVDA 2J90A 2JLDA 2P0CA 1FMOE 3A60A 3DAEA 3DBCA 3Q9YA 5FGKA 4O83A 5HBHA 5DT0A 1IG1A 2DS1A 3QX2A 1YI3A 3SD0A 4L44A 4NJDA 5C27A 5FXRA 5GZ8A 1Y6AA 2G1TA 1OZ1A 3OW3A 2RKUA 2X4FA 2QU5A 1QPEA 3R9DA 3NMUF 4LMUA 5HLWA 3THBA 4I4FA 3UYTA 4WKQA 4F99A 3GQLA 3VQUA 4YZ9A 5I0BA 4DG0E 2XNBA 2HYYA 5D7VA 5L2SA 1W82A 4AA0A 4E1ZA 4HGEA 3DU8A 1FINA 2HWPA 3MVHA 2ZAZA 5E90A 3LKMA 3LE6A 4BCQA 1PYEA 4Z3VA 3TNPC 5J79A 2ITXA 2QU6A 4C57A 1JKLA 4BCPA 3LLAA 2RF9A 5IG1A 4WOVA 2FH9A 5E8YA 2JC6A 2GDOA 4FVQA 5TR6A 4CRLA 3L9PA 3RAHA 2B9JA 1ZMVA 5AV4A 4A4OA 1OKWA 3OBJA 2BAQA 3OTVA 4JAIA 2CGWA 5AM7A 4D1XA 4A4LA 5AP3A 4U80A 4KNBA 3N4TA 2OKRA 3ZCLA 5BYYA 2R5TA 4DFLA 1DI8A 1PMUA 3IDBA 4TRLA 4RX8A 4ZK5A 1QL6A 4XG7A 4AT3A 2W96B 4ANLA 5CYIA 2BRGA 4BCJA 4KSPA 1EH4A 3E8NA 3LQ5A 1OBGA 3QKMA 3R0TA 3ZZEA 3DBEA 4U3ZA 5DR2A 3F5UA 3RZFA 2A4LA 4RX9A 2R0UA 4KSQA 3IW6A 3SRVA 3BRBA 1JOWB 4MWHA 5HI2A 3NPCA 2WIPA 2OW3A 5AA8A 5D1JA 5KMNA 4GS6A 1IAHA 4XHKB 4J99A 4MEDA 3A2CA 4B0GA 4EK6A 4WNPA 3KXNA 3OCGA 5LVNA 5M44A 1WBPA 3JVRA 4EOSA 4N6YA 2HAKA 4S30A 3A7HA 1H24A 3O50A 3I5ZA 4GSBA 3DNEA 5ITAA 3ACKA 2W1CA 3BV3A 5CT0A 3DFCB 3FPMA 2BIKB 4K1BA 5BVKA 4A9UA 2WFYA 5IMEA 2UZLA 4PMMA 1NW1A 1O6YA 2XNNA 3H0ZA 2OLCA 3L1SA 2C6TA 4FR4A 2QODA 3H9FA 3R7UA 4J98A 3MIYA 4P90A 5GJFA 4ZAUA 5EHOA 1W84A 3TDWA 2Q0NA 1P4OA 1QPDA 3SOCA 5L4QA 2YITA 3CR0A 3V5JA 5AEPA 4RWJA 4ASXA 4CZTA 2YZAA 3QYWA 3G9LX 4W4WA 4QP2A 3NWWA 2EXCX 1H01A 2GNGA 3IS5A 2ZVAA 2CPKE 1M7NA 1NVRA 1FVVA 2JKOA 3MY5A 2I0YA 4MTAA 1SYKA 2VWUA 1R3CA 2HWOA 3D2IA 3F2NA 3Q5IA 3W2CA 4O82A 4KBCA 3GNIB 3C50A 4U5JA 4YPDA 2WMUA 4R8QA 2C30A 1WBTA 3MA3A 4CYIA 4WNKA 4XCUA 2IW8A 1W98A 2J0MB 3PIXA 4FL1A 4JDHA 4QNYA 4FEQA 4QPSA 4I0TA 3KK9A 3R7EA 2VTMA 3F5PA 4PTCA 4FODA 5FDXA 4NM5A 2B55A 3QC4A 3QD0A 5H3QA 4IADA 5CAVA 3FZPA 4CMTA 4EC9A 1Q99A 2J50A 2Z7QA 3PSCA 3DBFA 2PVFA 5E92A 4JR7A 4NH1A 5CSVA 4FK6A 1P4FA 4E5WA 4IE9A 2VNWA 2JBPA 3CD8A 4FKGA 4BZNA 3Q4CA 3KMUA 2HOGA 2C6KA 2O64A 4PWNA 5FBOA 5L6OA 4IBMA 2X8DA 4NEUA 4GYIA 4D2TA 2X7GA 5C26A 1FGKA 5AUXA 4QPMA 4GFOA 3IKAA 4GK4A 3A62A 3AC2A 5EM7A 3EHAA 4TWOA 5AR5A 3PXQA 3KEXA 5AJQA 5HNBA 3OF0A 5HE3A 4FTCA 3TIYA 1FBNA 2YJRA 4IAIA 3A8XA 3BBTB 3NYNA 4UY9A 4E4NA 2J5FA 3ULIA 4F0GA 3MTLA 3BQRA 5I9UA 5K0XA 2H34A 4JQ8A 2QG7A 3DTCA 4ZMFA 1XBBA 3NUSA 1TQIA 1M2PA 3Q4UA 2PSQA 2RFDA 4R7HA 2GQSA 1LUFA 1XBAA 4BCMA 3DB6A 2FUMA 4A06A 3QKLA 5EOBA 1PJKA 3F3VA 5AV1A 2VAGA 1IA8A 3QRUA 4EH9A 3R1SA 5CTPA 2VV9A 4QYEA 4X2JA 4FZ6A 4MAOA 1GZNA 3FZTA 2VWBA 3NNUA 4I5MA 3TCPA 4Y83A 3FHIA 4E26A 3W8LA 4XYFA 4L7FA 4LOQA 3E7OA 3FMKA 3R8UA 1WBVA 4M14A 5M07A 4GMYA 3Q4TA 3ZO3A 3GCSA 3NS9A 3V5LA 3LMHA 3AT4A 3I7BA 3HV5A 2WHBA 3I6WA 4E4MA 2R3MA 4GT5A 3QZIA 3WIGA 2P3GX 4FGBA 1ZY5A 3VUGA 3FMMA 2BRNA 4D2VA 5CU0A 4Y46A 3NW6A 3PVUA 4FL3A 1Q3WA 5HESA 4PMTA 3FEGA 4DF3A 3UO4A 4FV7A 4CD0A 4XV9A 5KMKA 4NU1A 3U4UA 4DAWA 2XCHA 2R3PA 4AX8A 4P5ZA 4W8DA 2WELA 5ANGA 4JBPA 5IISA 4JVGA 1XH7A 3M11A 4H1MA 4KIPA 4EZ3A 2VTIA 3JS2A 3QXOA 3R2YA 4WRGA 2BHEA 5EM5A 3DB8A 2VNYA 3G2FA 5LQFA 1Q8TA 4KIKB 1VZOA 5GINE 3QCQA 2P2IA 3D0EA 3PTGA 4W9XA 1ZYJA 4D5HA 5E9EA 2R64A 4TYJA 3Q5ZA 1GIJA 2JEDA 3B8RA 3PFQA 4RJ7A 5AWMA 2WAJA 3VN9A 1PYXA 5HG9A 2OIQA 3TTIA 3AD5A 3QTSA 5CXHA 2QVSE 2Z60A 2Y7JA 5L8KA 3FV8A 1SM2A 3LFFA 2QI8A 1W0XC 4Y5HA 2OK1A 3GU6A 4HYUA 3MV5A 2QURA 4B6LA 3W10A 4TKSA 2C1AA 5HE1A 3ZMMA 2AYPA 4GJ2A 2W17A 3VC4A 2PULA 2QCSA 4FTKA 4M66A 4UMPA 4JNWA 4NW5A 2ZV2A 2FA2A 3H10A 4KKEA 5T6KA 3P4KA 4YJOA 4FKTA 4IWDA 4MNEA 1V0BA 5EFQA 1GIHA 3FMEA 4IZYA 4FX3A 4HGSA 3F61A 4XOZA 3R8MA 3ZFMA 3W55A 2IN6A 2EU9A 3R8PA 1WBWA 4C4JA 4PMPA 1YRPA 4FV9A 3FQEA 4BI2A 3KCFA 1PXMA 1J7UA 2BUJA 4PY1A 3AMBA 4G9RA 5H8GA 3NUAA 4FVPA 3N4UA 4ZY5A 2G01A 3ITZA 4MBJA 3HRBA 3GI3A 4FEVA 4O1PA 5CQUA 3NW7A 4R3RA 3AC1A 3QQJA 2XRUA 3FI2A 4FNYA 1B39A 5LCJA 3PXZA 4EK4A 2C6EA 4I0SA 3EN5A 4F6UA 3UZTA 1FMKA 3HA6A 1Q8WA 2YM3A 2RFNA 2RFSA 3KC3A 4J8NA 4L43A 2A19B 2GNLA 2YM4A 4FTQA 4FIEA 4BBFA 3BLRA 4GT3A 2BDJA 5DGZA 3UP7A 4I5PA 1DI9A 1O9UA 3QX4A 4CNHA 2BKKA 2OFVA 4W4XA 2WQBA 3TNHA 1OL1A 2CKOA 4HZSA 1G3NA 4FG8A 4NIFB 5A9UA 4AZTA 3PG1A 4LFIA 2ESMA 4BTFA 3RWQA 2PVRA 3FY0A 2IWIA 2VTTA 4BRXA 5KHXA 1OB3A 3ZLWA 4ANMA 3HYHA 3GUBA 3F3UA 3FSKA 5CLPA 2H8HA 4FV0A 4ZXTA 5IQFA 3R02A 3DOGA 4UWBA 4X6QC 3SDJA 4BDIA 3S1HA 4BDFA 4H3BA 5KBQA 4NW6A 3A7JA 4M15A 2UVZA 4S31A 2JFLA 4L6QA 4XJ0A 3TJDA 3EFJA 1BL7A 4L68A 1YW2A 1KOBA 4XLIA 4F08A 4TN6A 3H3CA 3HAVA 4FT5A 3D5XA 4XG8A 2I6LA 4PTEA 5F95A 3RK9A 4Y85A 1V1KA 4RX7A 2XBAA 4BTKA 3BEAA 4C59A 4DE4A 4QPAA 5IF1A 3ZBFA 1ZYDA 2CCHA 4CGAA 3BHUA 5CNOA 1FVRA 5BNJA 2VWWA 3FXXA 4O0TA 3RGFA 3WE8A 4C3FA 4NT4A 2XK8A 3UPZA 3RMFA 4A07A 4IACA 3P9JA 4FBXA 3MFSA 3HV4A 4GIIA 5AR2A 5JEBA 1HCKA 3R71A 2G15A 4BIBA 3OW4A 3EFKA 3P86A 4MXZA 5HIDA 2B0QA 4U41A 3DXQA 2ITPA 1Z9XA 3H0YA 3BYUA 2GNJA 3IECA 4D4RA 2NPQA 2JKMA 2PE0A 1LEZA 2WMVA 1WZYA 3E87A 4WUNA 5FTQA 1YHSA 4AE9A 3U8WA 5JZJA 4FV3A 2WNTA 3HZTA 4RLKA 3O51A 3PY0A 2X2MA 2X0GA 4GRBA 2YACA 2C47A 3OOMA 2UW3A 4CQEA 5DNRA 5CSHA 3UOLA 4UWYA 3O8TA 3TG1A 1P5EA 3FZSA 3ZC5A 2VTSA 2DYLA 4JT3A 5E8ZA 3VULA 4AE6A 4EHGA 2W1HA 3OWKA 3RP9A 4HNIA 4BWXA 5A54A 1Y8GA 4FZFB 4LGDA 4YC8A 5AMNA 4EOOA 5CAOA 2OJ9A 2WGJA 3P5KA 3Q9ZA 1YDSE 4MXCA 2A0CX 4EORA 4U3YA 4YMJA 4O7RA 3SGCA 2YA9A 2WEIA 3Q6UA 1YHVA 4I92A 3D5VA 2OZAA 1O6KA 2C0IA 4FT9A 2WMXA 4IZAA 5HORA 4O7LA 2CNUA 2OF2A 1PXNA 3BELA 4RFZA 4RRVA 2VO0A 3VJNA 1H0WA 1OL7A 5CF4A 2O65A 3KVXA 4G17A 2B9IA 2XH5A 4YTHA 2C3IB 1R0PA 5CSWA 2HW7A 1BLXA 1Q8YA 2XEYA 4DCEA 5CF5A 5ANDA 4RVMA 3PZEA 2I1MA 3RPOA 3I60A 4IVCA 1XH8A 4WO5A 2PZPA 1YKRA 3TV4A
chains in the Genus database with same CATH superfamily
3SW4A 3UDBA 2ZB1A 4C8BA 4FV1A 4ANOA 3GB2A 4G3FA 3Q9WA 5GIOE 2WMSA 2Z8CA 2GS6A 2ITZA 5C8MA 3EFLA 1OIUA 4RVKA 4EQCA 5JK3A 1PMVA 1UU3A 2JFMA 1YVJA 2FGIA 5HD7A 4B4LA 1OKZA 3D2KA 4IB0A 4UMQA 5AUVA 3R9HA 4M0YA 3LW0A 4PRJA 4K6ZA 4O91A 3R9NA 2HELA 5AR4A 3TI1A 1H28A 1Y57A 4O4DA 4BDKA 4QEBA 5CT7A 1TFFA 2YCRA 5HE2A 4E73A 5IQCA 3R01A 2IW9A 5I5ZA 2GQGA 3RPRA 4NJ3A 4DFNA 3MFTA 5HOAA 5LWMA 2F4JA 3Q96A 1VYZA 4M69B 3A4OX 2WTWA 3PXRA 1ZRZA 4ERKA 3NCZA 4GVAA 4ZSJA 2WTIA 5IZFA 3PJ2A 4IB3A 4ANQA 1ZWSA 2VTNA 4QQTA 2WMWA 5A14A 2UZNA 3KF7A 4LGGA 2BZKB 1J1BA 4E6CA 2ZDUA 1OUYA 2C5OA 4O0VA 1YI4A 3ORXA 3B2WA 3QCXA 3F88A 4OUCA 3EQHA 4RC3A 5KKRC 5AAEA 4BN1A 3Q52A 2F9GA 5HGIA 3F6XA 3C4XA 3NVMB 2QQ7A 4IEBA 4IAYA 1Y6BA 2XIKA 4HJOA 4LV5A 2NRYA 3BYVA 5AV2A 2XARA 4RVTA 4QDVA 4BBEA 1U5QA 3OT3A 4QYGA 4RWKA 4BC6A 4J97A 2OZOA 3IDPA 4AP7A 2HY81 3TZ8A 3KULA 3GT8A 3NNWA 3O7LD 2YCSA 2F7XE 1XMMA 4IVDA 4PNIA 4CG9A 3FAAA 2UW5A 1ZAOA 1REKA 1JBPE 2R9SA 3PG3A 4U43A 5H2UA 3UVQA 4EKLA 1H00A 1MUOA 5ETIA 5B0XA 4R5YA 4YZBA 4EK8A 1V0PA 3IQ7A 4OBQA 3EIDA 4JL9A 3G6HA 4L45A 2Q0BA 3QGWA 5ANOA 4QP3A 3VBTA 4GG7A 4AOIA 3LCSA 5IH6A 3PXYA 3QA0A 5IEYA 4E6AA 3GQIA 4FTMA 1OKYA 3UDTA 3E88A 3ORZA 3NFGB 3DJ5A 3AKKA 4B99A 2V5QA 3W2QA 3K5UA 3RBWA 3BYSA 4FKVA 4J95A 5J7HA 2IF8A 3BYOA 2YIXA 2CKQA 1OPKA 5JKGA 1OIQA 4FSNA 5D7AA 2BZHB 4DT8A 3UOHA 4HYSA 4ACHA 3CY2A 2XIZA 3KRRA 3AD6A 3FY2A 2X0OA 2XCKA 4FI1A 3OD6X 5EQPA 4AZFA 4BCFA 4IM0A 2F7ZE 4ZJVA 5CANA 4F1TA 2RG5A 3Q3BA 4I5HA 4WG3A 3MFRA 2QOKA 3GOPA 5CEQA 2J6MA 1YWNA 3LHJA 4ZSAA 3R8ZA 2IW6A 4DA5A 3Q53A 4L7SA 4YNOA 2PZRA 1S9IA 3FLSA 4V0GA 3PUFC 5D11A 4QP6A 1X8BA 4X7QA 1XH4A 3ZYAA 4YJRA 4G5PA 5CNNA 3KXHA 2VO3A 4I3ZA 4NKAA 5F1ZA 4O7YA 2WTDA 2I7QA 4RIYA 2ACXA 3TN8A 3UODA 4PP7A 1WVWA 2WXVA 4TZRA 5KHWA 4F70A 4OBOA 4DFZE 4ZOGA 3VRZA 3MY0A 2FO0A 5HHWA 4FKLA 1GY3A 5CXZA 3ELJA 4NWMA 5A4LA 4CQGA 1U54A 2X9EA 2BVAA 3MPTA 3RNYA 3SA0A 4QP1A 2ERKA 3OROA 4XG2A 5FM3A 5HG7A 5L2QA 4AZSA 3PA5A 1FQ1B 3M42A 4DEAA 4BJJA 3DQXA 2WTCA 4HCVA 3HV7A 3ZHPC 2BCJA 4ZP5A 3VAPA 3VUKA 3BGZA 4M3QA 2FB8A 2VTLA 5KKRB 5GJGA 2E9NA 5IQEA 4MVFA 1Q62A 1ZOHA 1MRUA 4O6EA 4GFGA 4IIRA 2UZOA 4ENXA 1OECA 4EH5A 2GNFA 4ZTHA 2EVAA 4FYOA 5IA3A 3R28A 4C7TA 2EUFB 4MWIA 1MP8A 2BDFA 4EOIA 3OFMA 3PVWA 1Y91A 3PUPA 3QUEA 4E4LA 4I6BA 5IPJA 1R1WA 2E9PA 4C4FA 4QMUA 2GU8A 2OF4A 2YERA 3MBLA 1VJYA 4WHZA 2VU3A 4M68A 5TO8A 4UZHA 5AUWA 4BI0A 4MQ2A 2PVKA 4TYGA 5LVLA 2QR7A 3RAIA 3UVPA 3LFEA 5JMSA 4X3FA 5ETFA 5F9EA 3QALE 2OU7A 4J52A 5EI2A 3S3IA 4Z16A 2GHMA 5KZIA 2BZJA 3TKIA 4XOYA 1YXSA 3FZ1A 1YQJA 3VW8A 5K9IA 5M06A 4BDEA 4QMXA 4RIWA 3ZO2A 5A4QA 3LXPA 1U59A 2QHNA 3DDQA 3DLZA 1GIIA 5D10A 4FZ7A 3KFAA 4MH7A 3HP2A 3U6HA 4N0SA 2UZUE 2BILB 2JDRA 4PX6A 5L2TA 2WD1A 3MH2A 4FSQA 4DLJA 3PDTA 3LFDA 1SVGA 3FBVA 3OUNB 2YWVA 3IGGA 5B2KA 3RZBA 3W2OA 4L46A 3HECA 1STCE 4O4FA 4RA5A 3C4CA 4LOOA 5TOZA 3ORNA 2ZFYA 4ZZMA 2PPQA 1YDRE 2YFXA 4WG5A 4Q9SA 4MQ1A 3BGPA 3MVJA 4PQNA 4XP3A 5AIKA 2OXXA 2PMLX 2XYUA 4FTLA 4QMMA 3W32A 4EWHA 4DFXE 3OCSA 4YP8A 5J9LA 1BL6A 1YXXA 2HXLA 4J7BA 3W2RA 1BI7A 5CF8A 4YC3A 4LGHA 4R78A 4O38A 2W1FA 3DGKA 4I0RA 2W99B 5EW8A 2WU6A 3HMMA 3F3ZA 1G8SA 4XLVA 5HEZA 1JSUA 3GCVA 5C8NA 4O0XA 3TJCA 4AZWA 5BVWA 1QCFA 4HPUE 4DEBA 4W9WA 3V01A 3SX9A 2YLFA 3OUKA 4PDYA 1YOJA 3FLNC 3QAME 3HP5A 1M7QA 3A7FA 1SVHA 3G90X 3B8QA 3DKFA 3LIJA 4GH2A 3BHHA 3PPJA 2BZIB 4GT4A 3SRVB 4CLIA 5KX8A 5LWNA 1Z57A 2WTVA 4IC8A 4ZS0A 4FZDB 1A9UA 4N4SA 3UQCA 5TKDA 4GL9A 5D12A 5E8SA 3UGCA 5BVNA 2BROA 5IQHA 4AACA 4ONAA 5IDNA 2JIIA 2PUNA 2OWBA 2QO2A 2VTPA 5AFVA 2YDJA 3TKHA 4EOKA 4DFBA 1H25A 4IAFA 4JDJA 5DEYA 4ACGA 4IB1A 3BZ3A 4G3DA 4IAZA 3WZJA 3ZM4A 2EXMA 3V8WA 3FKLA 4CFMA 2XK3A 4YZMA 3LVPA 5AADA 1PRYA 5EQYA 3O7LB 2HZ0A 4R3CA 3ZM9A 1ZZ2A 5FG8A 3WF9A 4CKIA 3E7VA 3E5AA 4GKIA 3DNDA 3O23A 5EYMA 3LXKA 2AQXA 4E20A 5IKWA 4E8AA 4O7TA 4KRCA 2B53A 4AU8A 4YTCA 4CMUA 3EN7A 2HK5A 4N6ZA 1HOWA 2HIWA 4EHZA 3PP1A 2R3KA 4YLLA 3GU5A 2QNJA 3U51A 3ZH8A 1PKGA 2X8IA 4U79A 5M09A 4ZTNA 4Y73A 4HYIA 5GHVA 3MYGA 4XH6A 2B52A 5TF9A 2Z7LA 4A4XA 3MS9A 4PTGA 3LFBA 5FRIA 1M14A 3UNKA 2ITVA 3O0GA 4KIQA 4UZDA 4B9DA 4BKJA 3IW8A 1YOLA 2W7XA 3UG2A 4Z55A 3ULZA 4I94A 2FSOX 2QKRA 3TNWA 5JFXA 3CJGA 5DRBA 1OI9A 3ORIA 2W5AA 3U6JA 2QD9A 4FIFA 3HV3A 2GQRA 3QQGA 4UALA 1PMEA 3VHEA 2IZTA 4TT7A 4UX9A 2XF0A 3FI8A 3EB0A 4XG3A 3VS4A 5HQ0A 3D5UA 3JY9A 4BTMA 4QP8A 2XK4A 4DEHA 1GAGA 3D7TA 5E1EA 1CM8A 3GVUA 4IDTA 5HCXA 1ZOEA 4B8MA 4G5JA 5J5SA 4KBAA 3UOKA 4EK5A 4IX6A 3MTFA 3BX5A 3IG7A 4FKPA 4GUBA 5JFVA 2CN5A 3CQEA 4DBNA 2OO8X 4RX5A 2XS0A 1NVSA 5H8BA 3KN5A 4O0WA 5HLNA 2W9ZB 5I3OA 3VS3A 5KMJA 3BWFA 3RHKA 2GMXA 4IDVA 3KVWA 4DGLC 3LMGA 4IWQA 4F78A 2B9FA 2C4GA 5CZIA 4TPTA 3ZEPA 4NM3A 3AKLA 3FZOA 5HBEA 2WTJA 4E7WA 4F1OA 4IFCA 3OWJA 3DAKA 3QQFA 2OSCA 1XJDA 4F7LA 3O8UA 4JQEA 4D1ZA 5M4CA 3TEIA 3POZA 5HVKA 4CVAA 3RK5A 5HU9A 1IEPA 1OPJA 5AV3A 1J7LA 4LDTA 2CSNA 3UDZA 5IQGA 4X3JA 2IZSA 1CKIA 3QWJA 5CAQA 5FLFA 4OT5A 4WBOA 5GIPE 3PE1A 3GCPA 4QMZA 1Q61A 1PMNA 1SVEA 3QRTA 3QTXA 4BGGA 2BFYA 1G8KA 1QPJA 3LJ0A 3QYZA 4RWIA 3CQUA 2HZNA 4D2SA 3V6SA 2J9MA 4TYHA 4D2RA 3R8VA 4F65A 4OAVB 1YXVA 4DG3E 4ZLOA 5IA0A 3OCBA 5KMOA 1P2AA 3I79A 4RQKA 3EQFA 4A9SA 4DH8A 5CU6A 5CEKA 2F2CB 3PSBA 4YJNA 3ZRLA 4M0ZA 4H05A 2C3KA 2AUHA 3IPHA 4K2RA 1PY5A 4MF0A 3QTIA 3O17A 4FJVA 4NL0A 2I0HA 2QHMA 4RSSA 5EW9A 1RE8A 1CDKA 1HCLA 4G16A 3DK7A 4UXQA 3UMXA 5L2IA 5CZHA 2UZEA 5DEWA 4FKUA 3ZFXA 3QTRA 5HX8A 3G51A 2JIUA 3NCGA 3PA4A 5KUPA 2JGZA 1F0QA 3DDPA 1UU9A 2J4ZA 3JVSA 4W8EA 3ZO4A 3ZXTA 4RIOA 5D9HA 3PLSA 4FIJA 2RL5A 4BDJA 4BYJA 2JKKA 1T46A 3EWHA 4EH8A 1G8JA 3HNGA 5AX9A 3QRJA 3DAJA 3TNIA 3WF5A 4AGDA 2XALA 3GU4A 5CWZA 4RJ3A 1P14A 4FOCA 4AXDA 4IFGA 1OIYA 1ZMUA 2NRUA 3KF4A 2YN8A 4TNDA 3ZRKA 3TIZA 1YWVA 4BICA 2VWYA 2G9XA 3NUYA 3PY3A 4BWPA 3W33A 1A06A 5IQDA 3BKBA 4YO6A 3WYXA 2C5NA 5IDPA 3SC1A 2ZDTA 1KE5A 1W7HA 5AP6A 3R7IA 2XP2A 4MHAA 2CLXA 2IPXA 3P5JC 2PE1A 4CT2A 4GIHA 1H1WA 5DR6A 2C5VA 2O3PA 1UKHA 5M53A 3ZUVA 1W2DA 2WB8A 3DFAA 2XKCA 4FKWA 4AOTA 1OIRA 1JQHA 2CNVA 3CTQA 2HENA 3CGFA 4FEXA 4EBVA 4DH5A 3S0OA 3ATTA 1YWRA 3F5GA 4GVJA 4USDA 4O0UA 5EDPA 4CRSA 5LMKA 3EH9A 5FBNC 4EJNA 4HPTE 4MNEB 4PDSA 5CEPA 1Q24A 3P7BA 5CSXA 3VUHA 4O7WA 5HVJA 3QRIA 1WVYA 5BVEA 2R2PA 4BF2A 5JFSA 4MX9A 1GZ8A 3JUHA 4QNAA 5I9YA 3G0EA 3V3VA 1GJOA 3JY0A 3UIBA 3BCEA 3ROCA 3ML1A 2GTMA 3EKKA 3F2RA 3PPZA 4O7NA 4R3PA 4XRLA 3HMNA 4ZSEA 4FKSA 2KTYA 2YAKA 2OJJA 1H1PA 3GC9A 4IW0A 5DRDA 5EYKA 3VS7A 3PJCA 2F7EE 4AWIA 1PXJA 4EI4A 1UWJA 2C5YA 4PDOA 4CT1A 4G2FA 5CF6A 3SG9A 3NW5A 4QOXA 4NFNA 2CGUA 4UB7A 2VGPA 3T9IA 4DGMA 3GEQA 3H4JA 4FKRA 3ZLSA 3HKOA 4JS8A 2WO6A 4FV8A 3QQLA 3RK7A 3ORTA 3WZUA 3F82A 1PHKA 2BMCA 4F63A 3OXTA 4LUDA 2PVHA 4MNFA 4YO4A 4QRCA 2RIOA 2XK7A 3VS5A 4F64A 2Z02A 3NAXA 4ITHA 2HXQA 2UW8A 4RPVA 4YR8A 2FYSA 3C4EA 3VUTA 3WZEA 5EG3A 3DJ6A 5HCYA 3VHKA 2PMOX 4O0SA 4GK2A 4KAOA 3FYKX 2EWAA 5CI6A 4D2PA 3WARA 3ZUTA 3ZLYA 3JYAA 5AP4A 4BDDA 2ZV8A 2GSFA 4MYGA 4HVIA 4U42A 3TV7A 3MPAA 5LMBA 4UXLA 4ACDA 3QGYA 1LPUA 5B2MA 4OTIA 4OTPA 1ZOGA 3S95A 1IRKA 2VTHA 3SXFA 2XA4A 3KXMA 5J7BA 4G3GA 4GU6A 1K3AA 2OICA 2WMTA 4RIXA 4BY9E 1RW8A 4AZVA 1Z5MA 3RVGA 5J5TA 3NFFB 3NSZA 3R00A 1APME 5CVHA 3FLYA 5AR3A 2B54A 2NP8A 3DY7A 4UYNA 3OY3A 4Q5HA 1YDTE 3M2WA 5F94A 2CHLA 3FKOA 4PP9A 1UNHA 1J91A 4MK0A 4NYEA 4ID7A 3A7IA 4TL0A 2QR8A 2VO7A 3QTWA 2ONLA 4DEGA 4IHPA 3ORPA 3EZVA 3C51A 1BKXA 3OBGA 4AAYA 4C4EA 4MBIA 4YHFA 3K3JA 3HEGA 5DA3A 3SKCA 1ND4A 4JOAA 4CFFA 4AFEA 4BHZA 3TZ7A 4DYMA 2XK9A 3D5WA 4O7ZA 4WG4A 3VBVA 3CPBA 3MDYA 3KRWA 4LRMA 4O4BB 2XMYA 3RPSA 2R3OA 2YIQA 3LFNA 4O27B 4I6FA 4ZSLA 5K0KA 4BGHA 1VLRA 5IEVA 5EQEA 5CEMA 3O5AA 1NVQA 2W1ZA 3QRKA 4S2ZA 1PXOA 2DQ7X 2XANA 2QLUA 2VN9A 1XO2B 5KMLA 2GHLA 3UP2A 2IVSA 1H27A 2XVDA 3LOKA 1TVOA 2OJGA 5LARA 2PZYA 4WA9A 4XX9A 5FXQA 5FTGA 2KULA 4AW5A 4PDPA 2GFCA 3BGQA 5FEQA 2WU7A 3R7OA 4QDEA 4LV8A 2W06A 4OLIA 3KL8A 4JBQA 3I0QA 3R63A 3FHRA 4UN0C 2OZAB 5JRQA 3BWJA 3L8PA 1XH6A 4BDHA 3VJOA 4F6SA 3LXLA 2JDTA 5JGAA 3N4VA 4XMOA 4Q9ZA 2PUUA 5EK7A 3FQHA 5J95A 3U87A 3VVHA 3TTJA 2YAAA 4OGRA 4GCJA 3E3BX 5M4UA 4RJ5A 1JSTA 3P78A 2V7AA 3P1AA 1K2PA 3TZMA 3HDMA 4O1OA 4WNOA 4RFYA 5DYJA 1AD5A 5BYZA 1KV1A 3UBDA 4BKYA 1JVPP 3UIXA 2YIWA 2GNIA 3RPVA 5EM8A 4EH6A 3ORLA 5LMAA 3ZSIA 2J2IB 3DS6A 5AUUA 1XHAA 5DOSA 2C69A 5I9XA 3HDNA 5DN3A 4AW0A 5AIRA 4CXAA 2VWIA 1GZOA 5AUTA 4ASZA 2UW9A 5DT4A 3SLSA 1H1RA 5J9ZA 4C02A 4BR3A 5HKMA 4QP7A 5CEIA 3G0FA 2VTAA 5D41A 2R3GA 5AAFA 1E1VA 2OXYA 4EQMA 5CI7A 2QOCA 4H1JA 3RWPA 2XNPA 4EONA 5BUIA 1J1CA 3FLWA 1OL2A 1WAKA 3W0OA 4BTJA 3REPA 2X1NA 3QTZA 4L53A 3V5QA 4O81A 3GU7A 3TV6A 2BTRA 4FL2A 4U97A 5DG5A 1JKKA 2XNEA 3AT2A 4EH3A 5LVMA 4F0FA 4D4YA 2C0TA 2ETKA 3KA0A 3R04A 4OTQA 2CGVA 2IEWA 2PE2A 1URCA 3MJ2A 4QMLA 1PXLA 3ZRMA 3R1NA 3LJ2A 2WKMA 3DJ7A 4YPSA 2PVNA 4L3JA 4D55A 4E6QA 3FI3A 4I93A 4LL0A 2JAVA 4F09A 1R0EA 4LQMA 3VS6A 4BI1A 3QTUA 3PJ1A 4BCOA 5BVDA 3DXPA 1SNUA 4XEYA 5BPYA 3RTPA 4HVSA 5BV3A 4A9TA 2VUWA 3ZFYA 3S4QA 5HNIX 2GNHA 5CU4A 2QO7A 3QA8A 3T3UA 3C9WA 3CEKA 5EI6A 4RBLA 4TXCA 2I0VA 4YJSA 4O4CA 3TXOA 3EQBA 4F7JA 2SRCA 4X3FC 4KD1A 3KXGA 4F9CA 4FTNA 2W05A 3UZRA 5A4EA 4QMPA 3HAMA 2C5XA 4MD8E 4S34A 1WFCA 3BIZA 4AW2A 2F49A 5GJDA 3LXNA 3R1QA 2W5HA 1UA2A 2W4OA 4XG4A 3K2LA 4F9WA 4FTTA 5JSMA 2CDZA 3R73A 2XUUA 5DH3A 3TWJA 4ITIA 2ZM3A 3EQCA 2J0IA 2ZV7A 4AA5A 2XK6A 3L8XA 5E91A 5C4KA 2RSVA 2XB7A 5M08A 3IW4A 4RLLA 5DWRA 3I81A 4C3PA 3AKJA 4JJRA 4QTDA 5TT7A 3QLGA 2XRWA 4NM0A 1CSNA 5C4LA 4B7TA 1CMKE 2CKPA 4G1WA 1SMHA 2PUPA 3KQ7A 4RZVA 2UZDA 2YHVA 2O5KA 1JKTA 2ZM4A 5IEXA 2V0DA 2J51A 3PIYA 2PMIA 4FICA 5HO8A 5J1VA 1YOMA 4C36A 4PNKA 3C1XA 3F2AA 4BIDA 4D0XA 3CQWA 5BYLA 4ACCA 1E1XA 2ITWA 2VTJA 1H1QA 2IZUA 2UVYA 4R1VA 4YJQA 2ITTA 4O2ZA 4AF3A 1ATPE 4V0GB 5LCKA 3ANQA 4DBXA 4Q5EA 4J96A 1IA9A 2YDIA 5EDRA 4WT6A 4DEDA 4IAAA 3EQRA 1TQPA 3RAWA 3GENA 2DUVA 5A6NA 4BDGA 4QYFA 3CIKA 3NX8A 3R9OA 3FSFA 4YBKA 2I0EA 4RIYB 3RCDA 5BVFA 4CKRA 4YSMA 1CKPA 3KMWA 2XKEA 4XBUA 4DLIA 2R7BA 4TY1A 3QQKA 4JG7A 5IH4A 4FGRA 1NXKA 4BCNA 4PL3A 2J0JA 4IANA 3COMA 3CKXA 2BIYA 3KMMA 3LCOA 3ANRA 3ENMA 3L9LA 3QD2B 4IX3A 4KKHA 4BB4A 2XKDA 5FP5A 4DH1A 4BKZA 1UU7A 3NUNA 4BJJB 5DVRA 3M1SA 4KS7A 4JR3A 4ZSGA 4A9RA 4CSVA 1OUKA 2XIRA 4AXAA 2A27A 2YISA 2J5EA 4FC0A 4ZZOA 4DH7A 4D9UA 2X81A 4IJPA 3VW6A 4HVHA 3PXKA 3ZU7A 4JRVA 2WQEA 4NCTA 4KABA 4PL5A 5DIAA 3ZSHA 4JG6A 3MA6A 1W2FA 4YTIA 4TTHB 3WF7A 5AP1A 4QYYA 4C33A 2HW6A 3I6UA 3MN3A 3C5IA 1B6CB 3HA8A 3CJFA 2V62A 5JN2A 3CP9A 1KUTA 3UG1A 4ARKA 4C0TA 3EYHA 4FG7A 1T45A 2YM7A 4D58A 4CV9A 3EN6A 2RG6A 4O2PA 2R4BA 4FIGA 4ORKA 1OPLA 3UTOA 5HCZA 2QOBA 2V7OA 4RT7A 3F69A 3WF6A 2VD5A 1KSWA 3OVVA 2OFUA 3DTWA 5KE0A 4USFA 4AN2A 4X3FB 5KMMA 2LAVA 4BL1A 4C4HA 4BCIA 4KIOA 1FVTA 3PYYA 4Z7HA 4LMNA 4C34A 4N57A 1OGUA 4U6RA 4PPCA 3E93A 2OG8A 4XRJA 5EYDA 3CBLA 2QLQA 4GV1A 3R7GA 1UWHA 3CLYA 1YXUA 3KK8A 3ATSA 4RIWB 4AAAA 2VX1A 5I9VA 2WOTA 3NGAA 3QD3A 5E8VA 3WBLA 4CFVA 3U54A 3HX4A 1J7IA 2XJ1A 5EDQA 2VGOA 4AT4A 4DHFA 5EKNA 5KCVA 4OTHA 2XJ2A 3ALOA 5E8UA 4GYGA 4DCAA 4WUAA 2R3QA 2VWXA 3PWYA 4G3CA 4WSYA 4C3RA 4LV7A 4O96A 5BMSA 2OXDA 3FMDA 4G34A 5HICA 4X2NA 3ERKA 3Q9XA 3CKWA 4XV1A 3G15A 4ZY4A 4BGQA 1IR3A 3BEGA 1OKVA 4IM3A 3HMPA 5EW3A 5CALA 3FKNA 1TZDA 4DEIA 3T8OA 1WBSA 3F7ZA 4LG4A 3TKUA 2JKQA 4QMYA 4YBJA 2W1DA 3CXWA 3DXNA 4QQ5A 3OP5A 1VEBA 2EB2A 3IONA 4FTIA 3UZPA 4EOLA 3IK3A 3V8TA 1Q5KA 2X0PA 2P4IA 3Q4ZA 3HL7A 2X6EA 4MXOA 3PA3A 5CY3A 5F4NA 4EHEA 3W0QA 2PU8A 3GFEA 5HTCA 4JX3A 3FL4A 4NSTA 5FUTA 4F6WA 2XIXA 4FYNA 1H0VA 3VIDA 1UNLA 2CJMA 3P7CA 4I24A 5I4NA 4CG8A 1JLUE 4O21A 3FJQE 4APCA 4TNBA 4ALUA 4GKHA 5B7VA 3FYJX 4UV0A 2IJMA 3GC7A 3GFWA 5DHJA 2IVTA 4G9CA 1FOTA 3UJGA 3ZSGA 2QOOA 3DPKA 3L9MA 5DBXA 4NTSA 5AR8A 4EYJA 4IH8A 1OL5A 3HRCA 4K33A 5E8XA 3U6IA 1IASA 1XH5A 4F1MA 5AM6A 4YSJA 4CTBA 4U40A 5CEOA 4C2VA 2VRXA 2PL0A 1UV5A 4U45A 5ANEA 2XYNA 4EUTA 2WQNA 5AUZA 4QO9A 3R7YA 3V5PA 4YZCA 5EOLA 1XMLA 4ZLYA 3COKA 3MH1A 3Q2MA 2R7IA 3HLLA 4FEUA 2WIHA 3LJ1A 4HCUA 2C6MA 2XKFA 4LUEA 4EH2A 4JBVA 4AXFA 5FTOA 2YLEA 4ACMA 2XIYA 2X7OA 3R6XA 1ZXEA 1BI8A 5AX3A 4I4EA 2WOUA 5ANJA 3H30A 4FG9A 2XJ0A 2A2AA 4RZWA 4UEUA 3ORKA 4LL5A 5ACBC 1RQQA 5FDPA 4MCVA 3GBZA 3HUBA 4M67A 4Z7GA 3D7ZA 3BU6A 3DK6A 3VWAA 3ZZWA 3ODYX 3OEFX 3HMIA 5HZNA 3DLSA 1JAMA 4C38A 4D28A 3RJCA 4BVUA 2CCIA 3AC5A 1Y8YA 2J0KA 5AR7A 3W0RA 4PUZA 2Y4IC 4CFWA 1ST0A 3BPRA 2C6OA 4JRNA 3LLTA 2R3LA 4EL9A 2C1BA 4J1RA 3E62A 4XG6A 3IOPA 4XUFA 3EJ1A 4R7IA 4HGTA 3G9NA 3T3VA 4DHZA 4FUYA 1UU8A 3EN4A 4PL4A 3C13A 4YZNA 3AGMA 5J9YA 2W5BA 3RALA 5M51A 3KGAA 4AOJA 1H8FA 3WE4A 3D9VA 3C0GA 4ZJIA 5L3AA 4AG8A 1G8AA 4ZIMA 3W1FA 2BALA 5A4CA 5J8IA 2Y8OA 3HMOA 2W4KA 4AGUA 2JD5A 1GNGA 4J53A 4FSYA 3F3WA 2J0LA 3AG9A 3MY1A 3DKGA 3GCUA 4AUAA 4EH7A 5LMKC 3EQDA 3QQHA 5L6PA 2H96A 3ALNA 2GS7A 5JH6A 3DZQA 3MFUA 5TE0A 4CZYB 3R22A 4AN9A 2W1IA 4DTKA 4E6DA 3CSVA 3O96A 5I3RA 3AMYA 4WRSA 1MQ4A 3D7TB 4DFYA 4UMTA 4IZ7A 5CQWA 2B7AA 2E9OA 4IWOA 4IWPA 3CCNA 4EKKA 2XNMA 3GOKA 4NUSA 3RKBA 2YEXA 3QU0A 4GU9A 1BMKA 5LVOA 4OTFA 3C0HA 4FKIA 3VUIA 4DN5A 3CD3A 4KBKA 2UZVA 5M56A 3VONA 1ERKA 4FIHA 2A1AB 5E8TA 4EQUA 3PP0A 4YJVA 3GXLA 2UZWE 3QL8A 4BWKA 3TUCA 5C01A 2ITOA 2PK9A 3G6GA 4RJ6A 3LQ3A 2VO6A 4WSQA 4XV2A 3FMNA 5C1QB 4EZ7A 4JAJA 4BBMA 4QTAA 1A48A 2PUIA 4HW7A 5CASA 3DBDA 2UW6A 4AT5A 4ANBA 3W18A 3NYXA 3BHYA 3VBWA 2HY0A 5JGDA 4F0IA 4FA2A 4D4SA 3MJ1A 4E4XA 3F9NA 3BE9A 2Y6MA 4QYHA 4QMSA 2YM8A 1MQBA 4CYJA 3POOA 1MRVA 3CY3A 4L42A 3KIOC 1VR2A 3FDNA 3LFAA 5HX6A 4DG2E 5ACKA 3MI9A 4OTDA 3ZDIA 1U4DA 4ZTLA 3DV3A 2P2HA 3UC3A 4R7BA 4KINA 4PV0A 2PZIA 4YJTA 5E4HA 4E93A 5GNKA 3SHEA 3FC2A 1DAWA 3OCTA 4FSMA 4H58A 4ASEA 4E3CA 3MGYA 2PVLA 4TYHB 5E8WA 4R77A 2G2IA 3FXWA 3WF8A 2ZOQA 3C0IA 4FTRA 3II5A 4GW8A