1U5RA

Crystal structure of the tao2 kinase domain: activation and specifity of a ste20p map3k
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
308
Chain Sequence
DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords serine/threonine protein kinase TAO2
publication title Crystal Structure of the TAO2 Kinase Domain; Activation and Specificity of a Ste20p MAP3K.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 99
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u5rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u5rA01
2Z02A 3MIYA 4A07A 1Q8YA 3FAAA 2ETMA 3G6GA 3UNJA 2XK7A 3PXYA 5AP0A 1WBTA 2QO2A 5IKWA 5BX0A 1Q8WA 3R9DA 4P90A 3SQQA 3KB7A 3KXGA 5FDXA 4UX9A 5EDPA 4FR4A 4FNWA 2YM7A 5M4FA 2UZEA 4JVGA 2C69A 3FL5A 2EB2A 4MX9A 1IA9A 1BUHA 4MKCA 3MW1A 3AMAA 5DFPA 2QNJA 1NVRA 4FSYA 5ANGA 1FGKA 5EYKA 3W2SA 3DLZA 4EHEA 5E8WA 2QOLA 3AGLA 4QPMA 4W4WA 2QODA 4QPAA 1H1RA 2GTNA 3FZRA 2XBJA 5E8XA 5JFWA 2PZIA 3GCQA 1ZARA 4I1ZA 4E7WA 5L2TA 2A2AA 1QCFA 3KN6A 3NR9A 5KE0A 2OZAB 2QOBA 2JDTA 3UVPA 3PJ2A 3FI4A 5J79A 5KBQA 5IDNA 3ORZA 2X2MA 5IA3A 3EKNA 4FTAA 2BDJA 3PP0A 4U42A 4RVKA 5BVNA 4CG9A 3SHEA 2JEDA 3PRFA 5HIBA 5AV0A 4ID7A 1JKLA 3UOHA 4AFJA 4BF2A 1CTPE 1H4LA 1Q8TA 4FK3A 3FMMA 4WNPA 3RMFA 2W7XA 3KEXA 1IG1A 3FLSA 3NS9A 5DI1A 4IVBA 1Q8UA 4CLIA 3TTJA 4JAJA 3JVSA 4NM7A 4XMOA 2VTSA 2WIPA 5FUTA 1ZMUA 2O65A 2WB8A 3SG9A 3CSVA 3LAUA 4FODA 3F5XA 4C7TA 2X8DA 5J95A 3CTQA 5HE1A 3RM6A 3ZYAA 1FGIA 5IZFA 3BGZA 1YHSA 3DBDA 3JPVA 4BCKA 5M08A 2UZBA 2XEZA 2B52A 4X6RA 4F0FA 3ZBXA 3F2NA 4F7JA 2UVXA 2BZHB 4FUYA 3LMGA 3WF9A 2IZSA 5ITAA 4GK3A 3ZU7A 5HD7A 5KKRC 5CANA 4DE4A 3QQKA 4Q5HA 4C3PA 4HVSA 3S1HA 3TL8A 3F82A 4QP3A 3VS0A 3PPZA 4EEVA 5LVMA 1Q3DA 1DAWA 2C1AA 4GS6A 3Q5ZA 3NX8A 4L6QA 2IW8A 3P86A 4JQ7A 2C3JA 2UW7A 5DHJA 2XA4A 5B2MA 3QUDA 5DMZA 2WMBA 4NWMA 3DT1A 3V04A 1FMKA 5ANEA 3VW8A 3ZFXA 3OOMA 3PPKA 4G5PA 5HVKA 4X3FA 3UGCA 4KAOA 4P2KA 4I5MA 3OFMA 3KREA 4WUNA 1JPAA 5F20A 3UODA 2PVNA 3HGKA 5HG8A 1H07A 3POOA 5ANDA 3OCBA 4FSMA 4O22A 5AUXA 4HVDA 5JFVA 1UNGA 2W5BA 3LHJA 3LPBA 4YTIA 2R4BA 4R1VA 3RHKA 4BCQA 5LWNA 3VBTA 3BV2A 4GFMA 4CV8A 3OUKA 5KBRA 2X9FA 3QGYA 5IH4A 4BKJA 3R9RA 4K2RA 3BBWA 4QP2A 1PXNA 2HZNA 4MBJA 3MA6A 4TNDA 4DEHA 5LVOA 5HQ0A 3D7TA 1FBNA 4QMTA 4R78A 2R64A 3UO4A 3E93A 1VEBA 2XIXA 4U9AA 3G15A 4CFNA 2OIQA 3JY0A 2EUFB 3ORXA 4BYIA 3FE3A 3R73A 4J96A 4IC7A 4F1OA 3HYHA 4Z9LA 1YWNA 3CGOA 4FEQA 2WQBA 3MI9A 4G5JA 4HPTE 3TKHA 4C58A 3ETAA 3R21A 2QG7A 3UTOA 4LQMA 3SGCA 1WCCA 4EH4A 1BX6A 5EM5A 3V5LA 1B39A 3ZZEA 3CQUA 2YISA 3TUDA 1AQ1A 4H58A 1YXSA 5FTGA 2CMWA 2R3GA 3GOPA 4IAFA 2YIYA 1P4OA 2PE2A 4M84A 3I5NA 4YC6A 3C5UA 4ITIA 4AW1A 4YJOA 5J9YA 2ITQA 4FV5A 5M07A 4B8LA 2G9XA 4I41A 4BCHA 4RSSA 3ZXZA 3QRJA 4C4FA 4F4PA 4MHAA 4FTMA 1GZ8A 1BKXA 1WMKA 1Y8GA 2WIHA 4W4VA 5CF6A 2CGUA 3O50A 1XJDA 4D58A 3KK8A 4MK0A 3QYZA 3SA0A 1URCA 3DB8A 3FYJX 3MPMA 4S30A 1XH7A 3BELA 3ULIA 2ZDTA 4WRSA 3FI2A 3JR1A 4FEUA 3RVGA 3SW4A 3FY2A 1WBNA 2CSNA 3OT3A 5D1JA 4AOTA 4GFOA 4RT7A 4I93A 1SM2A 3EN5A 3IOKA 4ZMEA 4A4LA 3GQIA 2CLQA 5K5XA 3CR0A 3QXPA 3Q9YA 3UE4A 3ZFYA 4K1BA 2QO7A 2XK6A 5FG8A 5FEEA 2AC3A 3GOKA 4CFMA 2BMCA 3QLGA 4F1MA 4ANQA 3S00A 1ATPE 2R0IA 4GMYA 4XG9A 2JFLA 4G16A 1OZ1A 4O7LA 2XKDA 5L6WL 1HOWA 3GCVA 3FZPA 1YXVA 2BZKB 1V1KA 2VO7A 2HENA 3AT4A 4RC3A 4RFYA 4WIHA 5DOSA 2GNJA 4ZZMA 4ACMA 1PMUA 5HTIA 5L2IA 3HV5A 3O17A 4PPBA 4QMUA 5JGAA 1ZOHA 2XS0A 1BLXA 3NRMA 1WZYA 4PTCA 3GEQA 2XF0A 3KXHA 5AEPA 3P4KA 1ZYDA 1UU7A 3R22A 5LVLA 4APPA 3EL7A 4ZTHA 2R3IA 3U9CA 1V0OA 4IJPA 4JRNA 3TNQB 5L4QA 4EUTA 4RIXB 4C4GA 3GC8A 4U41A 5CSVA 5DRBA 3EH9A 4F9AA 3KA0A 5IUGA 5CU6A 4TY1A 2QG5A 4D1XA 3ERKA 2PVRA 3LFBA 4FE2A 1Q61A 2VWUA 4CT1A 3ZMMA 3MH3A 3BU6A 4O7WA 4QNYA 2UZWE 4N57A 1PKDA 4IJ9A 5AR3A 3Q53A 5FP5A 2UW6A 2NP8A 3EWHA 4YZDA 4DGLC 4FNXA 3V3VA 4O7TA 2CKOA 4JQ8A 3KXZA 3WILA 5AMNA 4EHZA 5HBEA 4O1OA 2NO3A 4GW8A 4IWPA 5AAGA 2C6TA 4Q2AA 2C3KA 4YMJA 4L8MA 3ZDUA 1UWJA 4IAZA 1KUTA 5ANJA 4DFXE 4N6ZA 4AT4A 3BU5A 1RDQE 5IPJA 4PPAA 4E4NA 5M4IA 3BCEA 4BDIA 5DR2A 4EJ7A 1URWA 5ETFA 2UVYA 2RFSA 5L8KA 4EWHA 4ERWA 3VAPA 2JIVA 4QMVA 3ZLSA 3CD3A 4CYIA 4ZP5A 1KWPA 4I92A 5TO8A 4AW2A 4YHFA 4FX3A 4O2ZA 4U45A 3DZOA 4WNMA 3PE1A 4CFVA 2ERKA 1DM2A 3QTZA 4J99A 5AUUA 4F70A 5EDRA 4NM3A 4J97A 4FV7A 2J50A 3DK6A 4C62A 4O7NA 4YR8A 3MN3A 4WUAA 4EQMA 5J1VA 1IA8A 5CEIA 2WMRA 3FQHA 5I0BA 2GNGA 4RC4A 4DFZE 2ITNA 5BUEA 4FSRA 2WGJA 3GU6A 2G1TA 2GPHA 4NJ3A 1ZMVA 2REIA 3EFLA 4L7FA 4GYIA 4LG4A 4OTDA 2BRGA 5KZ0A 3LLTA 5F1ZA 5LOHA 3RPRA 4CZTA 3JS2A 3NYVA 4U97A 5AP7A 1IRKA 3EQHA 2UW0A 3LOKA 3AG9A 3FI3A 4L67A 1DAYA 5KZIA 1Z57A 2W5AA 1MQ4A 4DEIA 5E7RA 2Z7RA 4E26A 3KF4A 3DY7A 4KIQA 2QKWB 4ZTMA 4E1ZA 5DVRA 3C0GA 4GSBA 1H25A 2C4GA 2R3QA 4O81A 5CZHA 5D41A 2ZM1A 3QQLA 3UBDA 2XEYA 4DGNA 1MRVA 1G8SA 3OT8A 4B0GA 3I6WA 4YJTA 3LQ8A 5I9YA 3KCKA 3MY0A 4IB5A 3QKMA 2KTYA 1CKIA 2C30A 4ANSA 3TM0A 3EZRA 3TIZA 2YIQA 4JG6A 2ITZA 3TIYA 4XP3A 4M14A 5DRDA 3FC2A 3ZXTA 4DG0E 5HBHA 5IQBA 4LRKA 1GNGA 3PVUA 3MB7A 3OMVA 1Q5KA 2OF2A 4PL5A 5CU4A 4FOBA 5G6VA 3D14A 5A4EA 3GCPA 2CGVA 1UV5A 3R8MA 2WU6A 3DK3A 3QFVA 5T6KA 3F5UA 4LL0A 4IB1A 4QPSA 4QYFA 3QF9A 4RA4A 5I9WA 2PU8A 4R7BA 3M2WA 2QLQA 3F7WA 3HUCA 2HXLA 2YM3A 3LM5A 3LCKA 4AT3A 3E7OA 4U6RA 3A2CA 3R04A 1PMVA 4HGEA 1ZAOA 4DEGA 5IMXA 4QQCA 3I4BA 4Z16A 5IQFA 4RJ5A 4B8MA 1XBAA 3PG1A 3BRBA 3CIKA 3RPVA 1OGUA 3OWJA 2DQ7X 3BYMA 4DITA 4K6ZA 2B9HA 3LVPA 2E9NA 3L9NA 4BDCA 5K4JA 3FZSA 4BDKA 2YN8A 1PYXA 2OH4A 3M1SA 4PDPA 4BBFA 5I4NA 3PDTA 2BTRA 4EOLA 1G5SA 3EJ1A 4BIEA 3DJ7A 3S0OA 2CGXA 1FVTA 3H4JA 3IW7A 3BIZA 4I5CA 5EI6A 3I1AA 3R30A 3CTHA 3VNTA 5IA0A 4IMYA 4HYHA 4C4HA 1S9JA 1YOJA 4BTKA 2VWZA 2R9SA 2YJSA 3HZTA 3LJ0A 4KS7A 3RCJA 3U55A 3EN4A 5C8NA 2QOQA 2RFNA 4JJRA 1J7LA 5EYMA 4FIJA 4UXLA 3GCSA 4ZTLA 4DFYA 4I24A 4RWJA 4C0TA 5AP4A 2GU8A 3EQIA 2X9EA 5BVOA 2ZJWA 3HRBA 1U54A 3V5JA 5CAUA 3KC3A 1VYWA 3SXSA 3Q4UA 3LXPA 2YLEA 3A8XA 3ET7A 4WSYA 4YJUA 2B55A 3QTSA 5HG9A 4IVAA 4AW5A 5EFQA 4MTAA 5JMSA 3NUYA 4EK5A 3P23A 2FYSA 4IM2A 2EXCX 3ZSIA 4E5WA 4R3RA 4DFNA 2Q0NA 1SVGA 2I6LA 5IF1A 4Y73A 3QUEA 3P5KA 4TPTA 5IQEA 4IB0A 3BYUA 2G01A 3D83A 4CMUA 2R7BA 5FBNC 4FV6A 5HO8A 2X2KA 3VULA 3EYGA 4FV9A 4DGOA 3SG8A 2BROA 5C4KA 4G6NA 2OSCA 1QMZA 4P4CA 4RVLA 5EH0A 4YZBA 5FTOA 3HDMA 4F6UA 3LFFA 3RP9A 3A8WA 5CZIA 3ZO3A 4C61A 4I94A 1LEWA 4CVAA 3GVUA 5AUTA 3ZTXA 1KE5A 2JGZA 4X2GA 3WF8A 3ZDIA 5JZJA 3SRVB 3F66A 5JRSA 4DFBA 1PW2A 3COHA 5D10A 5IDPA 2XKFA 2C6IA 4O86A 4C4IA 2ITPA 4I6BA 3HRFA 3QLFA 4LL5A 2OJIA 4D2TA 2QO9A 1F5QA 1KSWA 4EZ7A 4ZAUA 3BYOA 4U7ZA 4IFGA 1BI7A 5CVGA 5K3YA 3WYXA 2I7QA 2XK3A 3GFEA 2VZ6A 2XKEA 5CT7A 2Q0BA 4UY9A 5IQIA 1PHKA 3CS9A 1E9HA 3K54A 4EBWA 3ZC5A 2R3RA 5JRQA 2XB7A 5HBJA 1E1XA 3UO6A 4EONA 4OR5A 2UVZA 2PZ5A 3T9TA 5EW8A 5M51A 3FHIA 5JFXA 3C5IA 4XG6A 3QKKA 4RIWA 4BCNA 4NFNA 5M53A 3FQSA 1YW2A 4QD6A 4ZK5A 3PJ1A 1Z5MA 3R1SA 5LJJA 2O64A 3NYXA 3ODZX 2PUUA 5CENA 2Z60A 3PUPA 3C50A 3ZSGA 5CAPA 4BDEA 4AZVA 4B99A 4DTAA 5J8IA 1UA2A 4CD0A 2VTIA 4OBQA 4I0SA 1P4FA 4A9YA 1OB3A 4HYUA 4DFLA 3H3CA 5EM8A 3FHRA 4U3YA 1W82A 3R7IA 3HRCA 4G31A 4GK4A 2OFUA 3QRIA 4H1JA 2GFSA 3P9JA 3UNZA 5JN2A 4O0UA 5DIAA 5CEPA 3G51A 4KIKB 3IONA 5BUIA 5FXQA 3VIDA 4ACHA 4ZY5A 3ZRMA 4DGGA 1YI3A 4ENYA 3VUDA 4FSUA 3PXQA 3PA4A 1V0PA 3DBCA 4I23A 4V01A 3TWJA 5IU2A 4DF3A 1YOLA 2UW8A 3OF0A 5TT7A 4UEUA 3W10A 1YWVA 3NZ0A 3NAYA 3O7LB 2OJ9A 2VWWA 1DI9A 3F7ZA 4FKWA 4RFMA 1H1SA 3W33A 4FYOA 3ZUUA 2CKQA 4IB3A 2OF4A 2WTVA 2YLFA 2HK5A 3EZVA 3KULB 3M11A 4L52A 4C3RA 2XIRA 4ZJIA 3UG1A 1YDSE 1IEPA 2ITYA 4O0VA 3OP5A 5FM2A 5HG5A 5HLNA 5IA1A 3ENHA 3LM0A 4O0WA 2RG5A 3HMIA 3O2MA 3S2PA 2PMOX 4EI4A 4FOCA 5FM3A 5A4TA 4BCMA 4YPSA 1H26A 4PX6A 3OVVA 4ANLA 4EH7A 4PUZA 2HW6A 2BALA 3MPTA 5AP2A 1PXJA 5EI8A 3BLQA 4Y5QA 1FOTA 4GEOA 3ZLYA 3E3PA 4AZTA 3OCGA 2B9IA 3CC6A 3NNWA 4IX3A 3FPQA 3TG1A 3W2PA 3IW4A 1QPJA 1OIYA 4F09A 3U8WA 1R0PA 3O23A 4FV1A 5E92A 4PWNA 1AD5A 4UN0C 2JD5A 5CY3A 3D5WA 3LMHA 1OI9A 4QTDA 3QXOA 4AZWA 1OITA 5KMOA 2BIKB 3FMHA 3PIZA 2XK9A 3HV6A 4RMZA 4EC9A 4R77A 4GV1A 5CS6A 5FTQA 2Z7LA 3PG3A 4R3CA 4ALWA 4BY9E 4HZRA 4CV9A 3N4UA 3DAJA 4NYEA 1QPCA 3UPZA 2VX0A 4B6LA 1MRUA 4LRJA 1HCLA 4LYNA 1P5EA 3R71A 4PMPA 4O82A 1JSTA 5LMKC 1NVQA 1RW8A 3R01A 4BDDA 4S33A 3VC4A 2PE0A 1VJYA 3KXXA 4XOZA 4AT5A 2PVHA 2YCRA 3NNXA 1CKJA 3UIXA 5JH6A 3IW5A 5IQGA 1O6LA 4XG8A 4BGQA 4B4LA 4PV0A 3ENMA 4D4SA 4ENXA 5A14A 4DA5A 2FB8A 4NKAA 3KU2A 4EOSA 1OL1A 4F1TA 4UZHA 4QMPA 2Z7QA 4GVAA 2ZB0A 2YACA 1WBWA 2X7OA 5DGZA 3U4WA 3ZUVA 1Y57A 3V5WA 3KRLA 3NGAA 3D5UA 5A4LA 4Y95A 4EQCA 3EN6A 3W55A 4BCPA 2JDSA 4OTQA 4YP8A 3ACKA 3GI3A 2OBJA 3DNEA 3AXWA 4CQGA 4U80A 1H8FA 5KMJA 2J5FA 4IM3A 4CMOA 4DH5A 2VTPA 3HA6A 2IWIA 3MYGA 4DH7A 1IAJA 3QRUA 5AIKA 3AD6A 3K3JA 4FTKA 4JOAA 5HLPA 4AP7A 3FY0A 4GG5A 5K5NA 4HGLA 3SVVA 4EH6A 5CAOA 3H9RA 2ITVA 3FXZA 4JQEA 3NVMB 4ANNA 4QT1A 3ZM9A 1OUKA 3WZKA 5H9BA 3ZO2A 3PPJA 3OY1A 4NW6A 5T3QA 4EK4A 1NA7A 4JRVA 2OZOA 4XV3A 3NMUF 2PVMA 2QOOA 3E8DA 2V7OA 5K0KA 5C4LA 2FSOX 4Z7HA 5I9ZA 1R3CA 3VF9A 4DBNA 1KE9A 3IGGA 4IZ7A 5JGBA 3T8OA 4EOJA 5M4UA 4YJVA 2CJMA 1SMHA 2OJFE 3DJ6A 3FMKA 3NUAA 2WOTA 4NTSA 2IJMA 2VNWA 4WG5A 3VBWA 4MQ1A 4OTGA 3QD3A 3R6XA 4BHZA 3F3ZA 4ZOGA 3GU5A 2BRNA 4JBPA 5L2WA 3D2IA 1OIQA 3VBVA 4ZTSA 4LFIA 4ORKA 2Z7SA 4IANA 4LMUA 5E8SA 5EOLA 4E4XA 4EHVA 3MV5A 4CT2A 4L01A 3AC4A 1SZMA 2XIKA 2PYWA 4TWNA 5HIEA 2W4OA 1OPKA 4O0YA 4XLVA 4QP6A 4A4XA 4UMRA 3P7CA 4L9IA 2VV9A 1NW1A 2HXQA 4BDJA 2YCFA 4ZTQA 3D4QA 3RINA 3DXPA 4X2NA 3NNUA 3C7QA 1BL7A 5CF8A 2QC6A 4YUQA 4PY1A 1JKTA 1Q24A 4XBUA 2EXEA 3PLSA 4FI1A 2QU6A 4IFCA 4MXAA 4ANOA 4C37A 2CGWA 1YVJA 2J0MB 4G34A 4FV3A 1ZXEA 4LGGA 5KHXA 2Z2WA 4JBVA 3MDYA 3QGWA 3QTXA 3E8EA 5LVNA 2BDWA 2ITWA 3DK7A 5GIOE 1LP4A 4QMOA 5H3QA 3RBWA 4EH9A 2JDRA 3GBZA 3N9XA 4CKJA 5HTBA 5EQYA 4YBJA 2XRWA 2XH5A 2W9FB 3Q52A 1GJOA 5AR5A 2CNQA 2ZMCA 1WFCA 3CJGA 4H1MA 3HP2A 4AA4A 4KBKA 4ITJA 2YM6A 4YC8A 4HYSA 4FV2A 4QTEA 4JX3A 4S34A 1UNLA 3AMBA 3BHTA 2WHBA 3VS2A 3AQVA 4OW8A 4YZ9A 3KF7A 2HZ0A 2JBPA 4X3FB 3RNYA 3W2RA 4IVCA 4D4VA 3VUIA 3SXRA 2J5EA 2PMNX 2WD1A 3FQEA 4QYGA 3OCTA 1NY3A 4CFWA 4NT4A 2W1DA 2P33A 2HELA 3MJ2A 4QMZA 2JKOA 3PJ3A 5HEZA 4F9WA 1MUOA 4U44A 4BKZA 4CFFA 2FSLX 4OTHA 5JZNA 3EFKA 5CU0A 5EQPA 4YTHA 4BB4A 2G2FA 4NH1A 1U4DA 4DH3A 4FTQA 2YABA 3CXWA 3L8VA 4UMQA 3QCXA 2OU7A 5I9XA 3C4WA 3LJ1A 3D7TB 4QYHA 2GTMA 4PQNA 5JSMA 3DPKA 5DH3A 3QBNA 2W1ZA 3ANQA 3HLLA 1OIUA 2C3LA 4DCAA 1Q99A 2IN6A 3B2TA 3P79A 4TW9A 3LZBA 3VBYA 1J91A 5IQDA 4XG4A 2GHLA 4XEYA 4ONAA 2YERA 5EHOA 3H30A 2R3LA 4WG3A 3FXXA 3P7BA 4AXAA 1OL7A 3ODYX 3FKOA 3MY1A 4JIAA 2W1FA 3OTVA 2QI8A 3F3TA 2UW4A 1XH5A 1M7NA 2XNBA 3TEIA 2BHEA 2IO6A 3DS6A 1XQZA 4FVPA 4J1RA 4L3JA 3P78A 3R8PA 2OXDA 5FD2A 2Y7JA 3O51A 1OKYA 4P7EA 4U79A 2B4SB 4M13A 3JUHA 4I0TA 5EM6A 2OG8A 3VS7A 1PF8A 3A4PA 4BBEA 5FRIA 2WTDA 4BZNA 4EOOA 3SXFA 3QALE 1EH4A 4QTAA 1G3NA 3BYVA 3QTRA 5GHVA 4ZLYA 5JFSA 4OBOA 1SNXA 4J98A 3QQHA 4NKSA 5AADA 3MVMA 2OFVA 3WE4A 1JQHA 1YRPA 4FKSA 4O7YA 3KGAA 4D1ZA 4DCEA 4FV8A 5BVWA 4TYGA 3R7GA 5AX3A 4IAIA 3OZ6A 4A9RA 5EI2A 1O6YA 3LCTA 5HVJA 2OLCA 4QP4A 2VAGA 3D15A 4FTLA 4FTOA 4TKSA 5C27A 4CKIA 3EHAA 3WF5A 2QVSE 2XNMA 4HCVA 5DBXA 3UZTA 4WRGA 3LFAA 4IZYA 3TNWA 3O8TA 1XWSA 3DZQA 2H9VA 3BWFA 5H8EA 2EU9A 4O38A 3FPMA 4MNFA 5AR7A 4HVIA 4DT8A 1UU3A 2GCDA 3G6HA 4ZSGA 3T3VA 5IEVA 1ZY4A 4CLJA 2J90A 4FC0A 2B9JA 5AWMA 3VVHA 2WU7A 2V5QA 5CU3A 2XNOA 2GS6A 4V0GA 3R9NA 5IH6A 5HIDA 3ZSHA 5EM7A 4Y85A 4AN2A 4H3PA 5LMAA 2JAMA 4BCJA 2BPMA 2C5VA 3ANRA 4DTKA 3KMUA 1NT2A 1K3AA 2EWAA 5F4NA 3FDNA 4GKIA 1T46A 2J6MA 4YGAA 4RJ8A 3E63A 3THBA 2QOKA 4FKPA 4ZJJA 3IS5A 3C51A 1OIRA 3FMNA 3HKOA 2JBOA 4FKGA 4FL2A 5I9UA 5HKMA 3HECA 3V8TA 5IMEA 1H28A 3VJNA 3ALNA 2YDIA 5HE3A 1Q41A 4FV0A 4HNFA 3KVWA 2PVLA 5AR8A 5EYDA 3ZEPA 3T9IA 2C3IB 4BI0A 5L2SA 4HNIA 3K5UA 2W0JA 2PK9A 4CFXA 2I0VA 2GMXA 4KA3A 3DTWA 5TKDA 3Q5IA 3R7EA 4MXZA 4IH8A 2BZIB 3NUPA 4JAIA 4WNKA 4AZFA 3Q4ZA 1WVXA 2B54A 5E1SA 4OTRA 4FG8A 3R0TA 3HV3A 4USEA 4AOIA 2VTTA 4BCOA 3RTPA 4OTIA 4FZDB 2BHHA 1M2QA 4G1WA 1LEZA 4ASZA 4D4YA 3PY1A 3C1XA 3FBVA 4YU2A 4NUSA 1G8AA 1H00A 4R6VA 4QP8A 5M06A 4UALA 3EIDA 4TYEA 3Q6WA 4BN1A 2WQMA 3BX5A 2WMQA 4M7IA 4JR7A 4OTWA 4O84A 3EB0A 4BL1A 3QZFA 4XG2A 3L8XA 3PIYA 3R00A 2IG7A 4I0RA 3GT8A 1MQBA 5A4CA 1I09A 1YOMA 5HU9A 4TNBA 1Y6BA 2VNYA 5K4IA 4YSMA 5AFVA 1R1WA 4FA2A 2WQNA 1PJKA 3CD8A 3DTCA 3TKIA 4ZTRA 3W8LA 4E73A 3DKCA 3UPXA 5CSWA 4GU9A 1GZNA 3PXZA 3S3IA 3WF7A 4O21A 3RKBA 3ZLWA 5TOZA 4F7SA 4FIEA 2IZTA 3M42A 2V55A 3U6JA 3HVCA 3UYTA 4R3PA 4DHFA 1AGWA 4JBOA 4RQKA 4FZAB 5BPYA 2PVYA 4ERKA 4NIFA 4YHJA 4FZ6A 4ZS4A 4H36A 1QL6A 3OG7A 2PY3A 5DLSA 5AR2A 3N4VA 1VR2A 1BI8A 4GT4A 1GIHA 3COIA 2GNFA 5ANKA 4FL1A 3EYHA 4TN6A 2XNPA 5TE0A 4KWPA 4F64A 1GAGA 2G15A 3UP7A 5GNKA 4QMQA 4USDA 2OW3A 4RVMA 3HNGA 3NW5A 5AP6A 4C4EA 2JKQA 4EK8A 5KMKA 5GZ9A 4QYEA 3SKCA 4C3FA 2XUUA 3LQ3A 1YXXA 3B2WA 5BNJA 4JXFA 2QCSA 3DBQA 5KHWA 1OBDA 4FGRA 4C8BA 5CVHA 5HE0A 4YTFA 5BVKA 4MYGA 3C0IA 4U5JA 1CMKE 3KQ7A 2OJJA 3CPBA 4E6DA 2BDFA 5LMKA 4A9TA 3BHYA 3II5A 4MQ2A 4TYHA 2XK8A 5JKGA 5L6OA 2OJGA 3GC0A 4XV9A 1WVYA 4F7LA 2Y6MA 1XH4A 3Q60A 4RLLA 2O2UA 4L42A 1ERKA 2X7GA 4GU6A 3H0ZA 1UWHA 3O8UA 4O0SA 5EKOA 3ACJA 2I0EA 4LMNA 3VUTA 2R2PA 4A9UA 4DGMA 5J1WA 1H08A 2F9GA 2X4ZA 3EKKA 3OUNB 3DKOA 3RM7A 3IDCA 4M67A 2H6DA 4C59A 2BVAA 4ZZOA 2PZPA 2VWIA 3NSZA 2IVSA 2WTJA 4ITHA 5AM7A 3VHKA 3R8VA 5E1EA 3W2QA 4X7QA 4EZ5A 4HCUA 4H3BA 1M7QA 5FQDC 3ZZWA 3UG2A 2C1BA 4NFMA 4L3PA 4YPDA 3AC1A 4U3ZA 2WMVA 3FI8A 3ID6C 4LOQA 1PXPA 4YZCA 5FXSA 3V01A 5LXMA 4IBMA 2JDVA 3L8SA 2HAKA 2VWVA 4CQEA 2PPQA 5HICA 4G9RA 4AE9A 3BWJA 5CQUA 3N51A 5ETIA 5JGDA 3SD0A 2AC5A 1GIJA 1UU9A 4RGJA 4G3FA 1ZYLA 3PIXA 2CKEA 4TZRA 4BIDA 4NW5A 3S4QA 1KOAA 3CP9A 2X4FA 5CAVA 1YKRA 2WEVA 2X6EA 2W1GA 2C47A 4ZS0A 2C5XA 2F49A 3EMGA 3FKLA 4IIRA 4Y5HA 3TUBA 2VGPA 5AA9A 4BHNA 3BQRA 3TT0A 2ZV8A 3A7IA 2DUVA 4KSPA 3LLAA 1U54B 3OWPA 3RJCA 4O83A 4J8NA 1W98A 2CHLA 4GT5A 4QMMA 2YAAA 4UMUA 4AN3A 2PHKA 4E6CA 4XRJA 3ZOSA 5HX6A 2WELA 2WTCA 4LGDA 1ZYSA 4HOKA 3KY2A 4FVRA 5AM6A 3TZMA 5A6OA 3R83A 2X1NA 1IR3A 3V5QA 2YFXA 3Q9WA 5DT4A 2CPKE 5BYZA 2ITXA 3L1SA 3W32A 1O6KA 4KSQA 2QU5A 3KN5A 3DXNA 2VUWA 2P3GX 2YM4A 4XHKB 4FT0A 5HCYA 3V5TA 1Q4LA 2W06A 4IX6A 5M55A 1XH8A 1UVRA 4QO9A 4YC3A 2W9ZB 4F6SA 3IO7A 3SV0A 3HL7A 3R1YA 3WIKA 2PTKA 5ANIA 4C02A 3CKWA 3QA8A 5BMMA 1FINA 4GVJA 1B6CB 4RLKA 4D2PA 3PXFA 3PXRA 4LV8A 2HZIA 4FZ7A 3WZDA 1CDKA 2WXVA 4KS8A 4QYYA 3TUCA 3EN9A 4OGRA 2OH0E 4GG7A 3ZBFA 4EJNA 2QURA 4K9YA 3VO3A 3EQCA 4G3DA 1E1VA 3MH0A 4GJ3A 4HGTA 3DDQA 2OK1A 5CI7A 4EK3A 3NVKI 3PY3A 4U0IA 4IXPA 5IEYA 3IG7A 3PE2A 5M4CA 2NRUA 5BMSA 4BYJA 2VWBA 3LXKA 2GFCA 3FMDA 4NZWB 4KKGA 4XS2A 4D5HA 4XUFA 5J5TA 5KKRB 4MEDA 5BQ0A 1OL5A 4CYJA 4DEEA 4EKKA 4AU8A 5I9VA 5LMBA 1PXOA 4JS8A 4KKEA 4HVHA 2C5YA 3FLZA 4BWXA 3L9PA 4E20A 4YTCA 4WBBB 2BKKA 4FUXA 3G2FA 3UQFA 1REJA 4M66A 4YURA 5IISA 2R7IA 3GU8A 3QCSA 4TWCA 3TV6A 4ACDA 5C8KA 5ACKA 2E9OA 4D2SA 2GNHA 3ORIA 3HUBA 4RIWB 2XRUA 3UQGA 2E9UA 3NEWA 3NIZA 4O7ZA 3QX4A 3G33A 4IZAA 1XH9A 4FTRA 4Q9ZA 3CJFA 1KE8A 2YIRA 4JG7A 4D55A 1YDRE 4R7IA 4BDFA 1BMKA 2WO6A 4FSWA 3MFRA 3MWUA 3R02A 2H8HA 4I21A 2A27A 4O7VA 1OBGA 5ANOA 3UMXA 2R0UA 3PY0A 4C2VA 5D12A 2ZV7A 3LE6A 2R3NA 4A9SA 2F2CB 2C6EA 2F7EE 4XBRA 3G9NA 2P4IA 2WEIA 1CM8A 5KMMA 4KKHA 3GFWA 1OECA 4BTMA 1ZWSA 1Y91A 5I3OA 2HZ4A 4EC8A 1SVEA 3RCDA 2C6DA 2YITA 4V05A 2W1CA 1H0WA 1OKVA 3EN7A 4FKOA 3UOJA 2C6LA 5BVDA 4FV4A 4W9XA 2HCKA 2VWXA 4I6FA 2I0HA 1JSVA 1PMEA 3VQHA 4PDSA 4HW7A 4PMTA 4IQ6A 3VS6A 3GB2A 4IM0A 4GKHA 4I4FA 1OM1A 3QWKA 4DEBA 3H9FA 2WFYA 4JIKA 3UZRA 3KMMA 4O1PA 5D7VA 4N4SA 1DS5A 2XNGA 4BI1A 4F9CA 2ZDUA 4QQTA 2WMWA 1JSUA 4EOQA 4EH5A 2BFXA 4EYJA 4MH7A 2PUIA 4MBIA 4QNAA 1GOLA 4U43A 4MD7E 4Y72A 4C34A 2BFYA 3F69A 5DN3A 3DXQA 1WBOA 4Y46A 4UYNA 2WMUA 3K5VA 3MFTA 3K2LA 4FTJA 3F5GA 4IADA 2ONLA 2X81A 4DC2A 3A60A 4X0MA 3ELJA 1XKKA 3BU3A 4AN9A 5DT3A 4JI9A 3PTGA 4MWHA 1OPJA 3GU7A 2WKMA 4FKJA 4JDJA 4XH6A 4BFMA 3KRXA 5JK3A 4ANBA 4GK2A 3C13A 3DV3A 3OEZA 3CKXA 4G3CA 2ITTA 3EFWA 4O0RA 4R1YA 4FVQA 3MESA 2R5TA 4PPCA 3I60A 3I6UA 4A06A 3ZRLA 4RX9A 2FVDA 4W9WA 2FA2A 4UWYA 2CLXA 3F9NA 3FZTA 5BVEA 4AWIA 2JKKA 3QZIA 4YSJA 2YHVA 4W8EA 1K9AA 2C5OA 2VD5A 4O6LA 3FUPA 3AC8A 2B1PA 4O91A 2IVTA 2QR8A 2J9MA 2C68A 4KINA 3IDBA 3FXWA 3A7JA 4TYIA 1WBSA 2UUEA 4AF3A 4JL9A 3GQLA 3O96A 3WOWA 3UC4A 3NAXA 3PRIA 4NEUA 4YZMA 3WE8A 3I81A 5BYLA 1UNHA 2B7AA 4K8AA 5CASA 1OL6A 4TYJA 4UWCA 5ETAA 3FLNC 3PYYA 5HTCA 3ATTA 3CE3A 2EB3A 4K18A 1JNKA 3C0HA 1GZKA 3U9NA 4KBAA 3GUBA 4RJ7A 3BHHA 4DFUA 3ZO1A 4MNEA 3NW7A 4PTGA 4RJ6A 5IG1A 4EH3A 1B38A 2R3MA 2HOGA 2VTLA 3DKFA 3RK7A 4F65A 2E2BA 2WTIA 5JQ8A 2YCSA 2VO6A 5C26A 5GZ8A 3LFEA 1YXTA 2HY81 5C03A 3Q9XA 4ZXTA 3GCUA 2A0CX 1FVVA 2PMIA 4FTTA 5CSHA 2OWBA 3AOXA 3TZ7A 1H1QA 3SW7A 3HAVA 2GHMA 1R78A 3O0GA 1YI6A 4PL4A 2ZV2A 3L9LA 4Q5EA 4MXCA 4D5KA 2PVJA 5CAQA 1W0XC 2PL0A 3EFJA 2WQOA 3PVWA 4L45A 4QMXA 4GIHA 3ZLXA 4C4JA 1JLUE 3SLSA 2XBAA 3DBEA 4XX9A 3GU4A 2GQGA 3F3UA 1FMOE 3FJQE 4H39A 3NW6A 4J52A 3F5PA 4WBOA 3V51A 4E5BA 4BKYA 3H0YA 4MF0A 4JG8A 4BRXA 3G9LX 2GNIA 4G3EA 4I5HA 1XR1A 4IWDA 2BAQA 2XM9A 3BGPA 2FSTX 3P7AA 4BI2A 2QKRA 4RIYA 4CFUA 3BKBA 4IVDA 3RHXA 4CXAA 5CF4A 3DU8A 4CCUA 3U54A 4U8ZA 4CMTA 3BV3A 1PRYA 4Q9SA 3OS3A 3RWQA 4L53A 4NSTA 2W4KA 5HCXA 4YBKA 3UQCA 4UYAA 3FSKA 4TT7A 4HJOA 3R8UA 2F2UA 2PVFA 3DBFA 3W2CA 4CZUA 4L00A 1XO2B 3EQGA 4NK9A 5GJDA 5J7HA 5HOAA 3LQ5A 3QQFA 1H24A 1GY3A 3P08A 3QQGA 2ETKA 1Z9XA 3LFSA 4D2VA 1WVWA 4UMPA 1PMNA 3FSFA 5L6PA 5KMLA 4FKVA 2W1IA 5IQHA 5ICPA 3LW0A 3BEAA 3EQPA 1S9IA 4EOKA 5FBOA 5EW3A 4JNWA 3ZEWA 4DAWA 4AG8A 2C0TA 4E6AA 4L3LA 2CDZA 2XMYA 4F0IA 1LR4A 2RIOA 3AT3A 5FEQA 5HE2A 3C4XA 4AACA 3CY3A 5TF9A 4F63A 3QD2B 5EHYA 4QP7A 4FIIA 4GH2A 4UXQA 4RFZA 5FP6A 1SNUA 4XV1A 4PMSA 4ASDA 4N0SA 5E8YA 2BTSA 4JDKA 2F7XE 1YI4A 2YIWA 1YDTE 4PF4A 5ACBC 4DLJA 5M44A 1WBVA 3EQBA 3TZ8A 3A62A 3IK3A 3UYSA 5EQEA 5AR4A 4MD9E 4OTPA 5DWRA 5AUWA 5DEWA 2PZYA 3CGFA 4KRCA 4TWOA 4YLLA 1XHAA 4DBXA 2R3KA 3Q32A 1FPUA 3A4OX 4FZFB 4OUCA 5CU2A 5HI2A 3MVJA 2X39A 2JDOA 3MPAA 4L46A 2GSFA 2YZAA 3BEGA 4FL3A 4NCTA 4RWKA 4F99A 5EKNA 2A4LA 4ANMA 1TQPA 4IDTA 5AAEA 3G5DA 4QRCA 3U51A 4XOYA 3UIUA 4NM5A 4ALUA 3PXKA 5CWZA 3AD5A 3QKLA 3ROCA 2WPAA 1J1BA 3PJCA 2VGOA 5HNBA 1W8CA 3PZHA 1JAMA 4QQJA 3S95A 2CN8A 1PYEA 4BGHA 3EQRA 5DG5A 3QTQA 2PUPA 3KMWA 5C8MA 1M14A 4PDYA 3D7ZA 4FSTA 3OHTA 2O5KA 1Q3WA 2ZVAA 3D5XA 4MF1A 2YAKA 5HNIX 3PP1A 5CVFA 2FO0A 2ZAZA 1TKIA 4RC2A 3OW4A 5CI6A 4IAKA 4M68A 4RRVA 5EHLA 5A4QA 1VYZA 2Y4IC 1ZLTA 1R39A 3E8NA 3FC1X 5HNGA 4FEXA 4FTNA 1YHVA 2QR7A 3A99A 3MH2A 3H9OA 5GZAA 2OGVA 4AZSA 2W99B 4RX5A 3FZOA 3MVHA 3V8SA 4FMQA 5GJFA 4ZSEA 3WZEA 3BHVA 4M97A 5F94A 4BDHA 3RGFA 3QC9A 1YXUA 4U81A 4UB7A 3G0FA 1UKHA 5FWKK 3CY2A 3BHUA 4GYGA 3REPA 3VS3A 3OXZA 5L8LA 2ZM3A 2ZV9A 5DYJA 4ZSAA 4DTBA 4YJRA 3BQCA 2C0IA 4YNOA 2YCQA 2ERZE 3DKGA 4J53A 3JYAA 4RZVA 3MY5A 4B7TA 2Y8OA 4D0WA 2GQSA 4N70A 4XRLA 3FV8A 3LFNA 2UV2A 3OW3A 1HCKA 4IEBA 4PNIA 5CALA 4O96A 1JOWB 2X2LA 5E90A 4R5SA 2F4JA 1JKKA 3P1AA 3R1QA 4C2WA 4DINA 2ZB1A 3ORNA 4X2FA 3FLQA 2OZAA 4IAAA 4AGUA 3ZFMA 2WMSA 4F6WA 3BLHA 2W05A 4FTCA 4Z3VA 3UZPA 4F0GA 2P55A 2V62A 3MS9A 2VO0A 4IC8A 5IQCA 5CX9A 5DA3A 2BRMA 2VX1A 1VZOA 3KCFA 3TNIA 5AP3A 3GENA 4E5AX 3V8WA 4X2KA 3TN8A 3E7VA 3BE2A 1ZY5A 4F7NA 3DCVA 1Y8YA 1H1PA 3R1NA 5J87A 3WYYA 5KMIA 1FVRA 2V0DA 3ZCLA 4FF8A 3VUMA 2OO8X 4EK6A 2XK4A 4EL9A 4CGAA 1Y6AA 2JIIA 4O6EA 2HWPA 3QCQA 3WZUA 3I7BA 3RWPA 3RAIA 2H96A 2BR1A 2VU3A 4J95A 4QOXA 4AW0A 3IGOA 4CG8A 5DR6A 4V0GB 4HZSA 2QHMA 5E4HA 2J0IA 5HCZA 5A46A 3WIGA 3LCDA 1H1WA 2ONLC 5E8VA 3DAKA 3RK5A 1U5RA 4BBMA 4IW0A 2Y4PA 3VS1A 5HX8A 4MVFA 4XG3A 4J7BA 4YJPA 3OY3A 3UIBA 2ZM4A 4MXYA 1IASA 3KRRA 3MSSA 4I22A 2XNEA 4V04A 3RZBA 3UVQA 5CEKA 4CTCA 5K9IA 2VN9A 3IDPA 3F3WA 4FIGA 2XCHA 3E64A 2YA9A 3VUGA 4O7SA 4FTUA 3DFAA 5H8BA 4PNKA 4R5YA 1OKZA 4RG0A 4ZSLA 3R8ZA 3LKMA 3F3VA 1UKIA 3UP2A 4MXOA 4JLCA 1L8TA 1YQJA 4I6HA 3Q2JA 3TV7A 3EQDA 2PSQA 5IUHA 2RFEA 2DYLA 4WOVA 4CSVA 4EBVA 5FXRA 4C57A 4FYNA 4FEWA 3TDVA 4BR3A 3NNVA 4G6LA 3ITZA 5BVFA 3AT2A 3IW6A 2BCJA 3GP0A 3LCOA 4YHTA 4BDBA 3Q4CA 5TR6A 3Q4TA 4CCBA 4EOPA 3VWAA 2HWOA 2QOCA 1JWHA 2ZOQA 5CTPA 5AV4A 2OXYA 4USFA 5KX8A 3VBXA 2RFDA 1U46A 3OD6X 1QPEA 5L8JA 4Z7GA 1KV1A 2UW5A 1ZOEA 4G3GA 3ATSA 2ACXA 2UZNA 1A48A 3MH1A 2RGPA 3QYWA 4QTBA 4X2JA 5B2KA 1TQIA 3RI1A 3E87A 1K2PA 5AJQA 1T45A 2P2IA 3PFQA 4FNYA 2YJRA 3GC9A 5CXZA 3DB6A 5KNJA 1SYKA 4YLJA 2VTOA 3DNDA 4IWQA 5CQWA 5AUZA 3CEKA 4FKUA 2X7FA 3AGMA 3FWQA 5CNNA 3FMLA 5KCVA 4M0ZA 2PVKA 4GIIA 1H0VA 3KRJA 3VQUA 4EUUA 2BZJA 4EOMA 5GJGA 3IPHA 2LGCA 3ORPA 2OICA 4RX8A 1XH6A 3F6XA 1ZZLA 2VRXA 3ZUTA 5CEQA 4OLIA 4D2WA 4AAAA 4Y83A 4NL0A 4K77A 3U6IA 1IAHA 3EQFA 2X8EA 5AV3A 2J0JA 1F3MC 5CSXA 3BZ3A 2XM8A 4YO6A 2PUNA 1J7UA 4JDHA 5CLPA 4M3QA 4FKLA 3VUHA 5LWMA 1GZOA 2QHNA 4I6QA 4NIFB 4RX7A 4EQUA 2XYUA 1W83A 3HMMA 3FZ1A 4FG9A 4GFGA 4D28A 4D9UA 4LUDA 4L68A 2IPXA 2Y9QA 4LI5A 2XJ1A 5AX9A 4ZZNA 4QMWA 2JAVA 3ORMA 4QMSA 4PDOA 3ULZA 4D0XA 4MXXA 4QQ5A 3PLAE 5GINE 3VJOA 4OAUC 2VTAA 2ZMDA 4DG3E 3ZRKA 4YNEA 3E8CA 2WAJA 4EHGA 3OWKA 1OL2A 3I0OA 2C5NA 2CKPA 4RJ4A 3H10A 4R7HA 5FDPA 4EKLA 3WI6A 3CBLA 2XYNA 1ZYJA 3UDBA 2BRHA 4UV0A 2X0GA 3TACA 2FH9A 4NU1A 3WF6A 4OBPA 4RWLA 2DWBA 5FEDA 5AAFA 4L43A 4TYHB 2RG6A 3PA3A 4EZ3A 5CSPA 4FIHA 2RKUA 2VO3A 3CTJA 4KD1A 3RPOA 5CEOA 4ZY6A 4FT3A 3G90X 1PXMA 1OVEA 2WTKC 4WSQA 2VTQA 2BILB 5DR9A 1DI8A 5EG3A 4D4RA 3LFCA 2R3PA 1RJBA 3VS4A 3R9OA 3F61A 3Q2MA 3RPSA 3TI1A 2J7TA 4W4YA 1RE8A 3QTIA 5HD4A 4AOJA 3QHWA 3NCZA 4FIFA 1M2RA 3VW6A 2NPQA 5EOBA 3W18A 1YWRA 4JDIA 3QRTA 4IHPA 3TJCA 2NRYA 2YZLA 2VTMA 3ORKA 2UZTA 3R8LA 5A54A 4HYIA 2BAKA 5F95A 3OCSA 4YJQA 1PXKA 4RIXA 5H8GA 3DGKA 4MCVA 4D1SA 4I4EA 5HGIA 4RVTA 3ZC6A 4AGWA 1P14A 4QMNA 4QMYA 2QD9A 3QA0A 4RA5A 4E4MA 5HLWA 3CQWA 3ZH8A 3QTWA 3QQUA 4GJ2A 4KBCA 2JC6A 3VN9A 2YWVA 1OUYA 3BPRA 1MRYA 2IVUA 4NCTC 5ETCA 3V5PA 4CTBA 4FKTA 2HW7A 2XVDA 3BI6A 4BICA 3QL8A 5IH5A 5B0XA 4XNEA 5M57A 4XV2A 5AA8A 1KE6A 4S2ZA 4D2RA 4XJ0A 3UNKA 4UMTA 2UZLA 1OPLA 3MFSA 3Q9ZA 1H27A 1JVPP 3SOCA 5DT0A 5HZNA 4EOIA 4P5ZA 3VF8A 3OBJA 3Q96A 3JXWA 2UZOA 3CPCA 4RBLA 5DE2A 5DNRA 2ZYBA 3L8PA 3R7OA 3MIAA 2CN5A 3RNIA 4HCTA 4ZLOA 1I44A 1KE7A 1Q8ZA 4IX5A 2CCHA 4BDGA 2HYYA 3IQ7A 3QD0A 2J51A 4C33A 4GUEA 3DOGA 4YZNA 3T3UA 4IX4A 3SC1A 3VUKA 3MTLA 2PE1A 5KMNA 4H05A 4K11A 3BYSA 3VS5A 2Y6OA 5IEXA 4IE9A 3D94A 3MJ1A 5CNOA 4EWQA 2YIXA 4G17A 3RZFA 2SRCA 3IKAA 4HPUE 5DPVA 4BZDA 4NTTA 3GNIB 5AIRA 4M69B 3UC3A 3CQEA 3PZEA 2XP2A 4O27B 2Q83A 2VTJA 2UZDA 3RAWA 3LFDA 5CEMA 4KB8A 4G2FA 3UMWA 3F2RA 3KKVA 4QP1A 3DQWA 3FL4A 4M12A 3U4UA 3CLYA 3QUPA 5F9EA 3O7LD 4PMMA 1Q62A 2OXXA 1W84A 3LXLA 3ROYA 5FGKA 1F0QA 4XLIA 4FGBA 3A7GA 1P2AA 1APME 3ZO4A 4AA5A 4O7RA 4MD8E 3HAMA 2BKZA 4GUBA 2R3OA 2VTHA 1BYGA 3TKUA 2YEXA 2WMAA 4LV5A 2GDOA 3E5AA 4XP0A 3HV7A 4FICA 2QOFA 1PKGA 2BUJA 4BWPA 3NUNA 3VBQA 3V6SA 4NJDA 4NM0A 2V22A 2YWPA 4K0YA 4MBLA 5E8ZA 3CCNA 3PWYA 4KRDA 4M69A 3DAEA 2J2IB 3MFUA 3COKA 4OAVB 5HU3A 3W1FA 4TL0A 4AX8A 3DJ5A 3NDMA 2R3FA 4WKQA 3Q04A 4H3QA 3SX9A 3WARA 2CCIA 4IACA 3F2AA 4JBQA 4YLKA 2Y4IB 4S32A 5AUYA 2BIYA 2XIYA 4FSQA 1M52A 4A4OA 2UW3A 1W7HA 4G6OA 3R2BA 4O2PA 4U40A 3SDJA 4HVGA 4KUJA 4DT9A 5CXHA 4FT9A 3KK9A 3OXTA 2A19B 4B9DA 3R7YA 5M09A 3W8QA 2OI4X 3C4ZA 5LCKA 2O3PA 3JVRA 4X3FC 3KVXA 1WAKA 3TCPA 3HX4A 3AMYA 3KXNA 3IW8A 3IECA 3PJ8A 4ZY4A 4QMLA 3E88A 4XCUA 4FKIA 5C9CA 4FT5A 4BCGA 5BYYA 3NYNA 2GHGA 2J0LA 4LM5A 3VRZA 3QWJA 2AUHA 3WBLA 3B8RA 2WNTA 1MP8A 3E62A 2Y0AA 3TV4A 2KULA 4GRBA 2OIDA 2ITOA 3EOCA 4ALVA 3FMJA 5J9ZA 2W5HA 4WD5A 5KO1A 1QPDA 5HESA 4M8TA 3HMOA 3HEGA 4RWIA 1A06A 5A9UA 1BL6A 2RF9A 3KRWA 3WZJA 3I7CA 4C38A 2EXMA 1JBPE 5HVYA 4G9CA 4A7CA 4CKRA 2CNUA 4Z55A 2IVVA 3QTUA 4J8MA 4KABA 2O63A 2NNWB 3UOKA 2XJ0A 3A7HA 4OTFA 4F08A 3NUXA 4CRLA 2IZUA 3W16A 1PXLA 2UZVA 1NXKA 3U87A 4WHZA 3FLYA 3I0QA 3E92A 3POZA 3O8PA 3R63A 3OTUA 5I3RA 1ZYCA 4EORA 5E8UA 3ORLA 1U5QA 3AC2A 3OC1A 1YHWA 2W1HA 1KOBA 3DFCB 4OT5A 4WG4A 3PSDA 4ZSJA 2GS2A 2B9FA 4BCIA 5LARA 1L3RE 4X3JA 3ZS5A 4AS0A 2H34A 3DDPA 3L9MA 4II5A 3GC7A 2PZRA 4WA9A 4WT6A 2FUMA 2B0QA 2F7ZE 3PSBA 3D5VA 3LFQA 3OEFX 4PTEA 5H2UA 2O0UA 2C6MA 3I5ZA 4EH2A 3ZM4A 2PMLX 4AFEA 2JIUA 3PVBA 4YJSA 5L3AA 2FGIA 2UZUE 4F9BA 5JQ5A 4RPVA 3QZGA 3UIMA 1GIIA 4DH8A 2VTRA 1O9UA 3OOGA 3P0MA 5I5ZA 4AGCA 5KUPA 4S31A 2ESMA 3KFAA 3OWLA 4UBAA 4N6YA 3F88A 3OROA 3QAME 5HO7A 3AC3A 4PL3A 5AV2A 2WOUA 2XNNA 3KXMA 4X21A 3RALA 3MA3A 4PP9A 1M2PA 5J5SA 4E93A 1R0EA 4O0XA 4UZDA 2XJ2A 4EH8A 3UOLA 1CSNA 4P5QA 3BLRA 3TNPC 4LRMA 2JLDA 5JT2A 3SRVA 2DS1A 3MB6A 1PY5A 4I5PA 4XP2A 3BGQA 3DQXA 3NCGA 4E8AA 1XBCA 3LJ2A 1U59A 2WZJA 4AQCA 4E6QA 4MWIA 3BBTB 4XG7A 4ZTNA 4RQVA 5E9EA 4GCJA 1CKPA 4AZEA 4DN5A 3UJGA 3PVGA 3C4FA 2HY0A 2I40A 2OIBA 3DLSA 2PULA 4J71A 4E4LA 2J0KA 3D2KA 1FQ1B 3B8QA 2P0CA 3PSCA 4DH1A 4IDVA 2R3JA 2XCKA 3O71A 5B2LA 1OMWA 3TTIA 5D11A 4PP7A 4FEVA 5T68A 2QONA 3C4CA 4MNEB 4O0TA 4F9YA 4BTFA 3C9WA 2QLUA 2OKRA 2FSMX 4BCFA 3D9VA 3BE9A 5IUIA 3TNHA 2ITUA 3MTFA 3Q6UA 4WNOA 3PWDA 3AD4A 2W96B 4ZIMA 2X8IA 3E3BX 2PWLA 4M0YA 3FYKX 2LAVA 3RK9A 3QRKA 4DEDA 3AC5A 5A6NA 3U6HA 2E9PA 3TXOA 2C0OA 4C36A 1ZOGA 4FTIA 1J1CA 1XBBA 2RSVA 3MBLA 3HMPA 3ORTA 1UU8A 2O8YA 2P2HA 3DA6A 2W4JA 2E9VA 2WMXA 3NUSA 4LGHA 4TTHB 3UO5A 2C6OA 3LMIA 4C35A 3RAKA 5LCJA 1J3HA 5AP5A 4R8QA 4LOPA 3ZONA 4ACCA 5CF5A 5EYCA 2X6DA 4ZEGA 3W2OA 1SVHA 4DLIA 2WQEA 4D9TA 2F57A 2B53A 4BZOA 4FT7A 2WMTA 5GIPE 3HV4A 4BIBA 2YDKA 3LXNA 2IZRA 4FG7A 5EDQA 4RIYB 5AV1A 4L7SA 4OT6A 2R3HA 1A9UA 2UW9A 4GL9A 4KIKA 5E8TA 3VRYA 4FSNA 2I0YA 5D9HA 5CT0A 1TVOA 2V7AA 4JT3A 1Q97A 1TQMA 4IAYA 3LCSA 2JITA 2VX3A 1M17A 4GT3A 3C4EA 1WBPA 3GXLA 4AUAA 3NWWA 3TZ9A 3FMEA 3PA5A 2Z8CA 3KULA 1LUFA 3HA8A 3MVLA 4BGGA 2GNLA 4AE6A 5M56A 3VHEA 1X8BA 4ACGA 4BDAA 3JY9A 1PXIA 3I79A 3OBGA 4CNHA 4FKQA 2A1AB 4PRJA 4QTCA 3TJDA 4QP9A 4FNZA 1JKSA 3HDNA 2YM5A 3FLWA 3QD4A 3R7VA 4X6QC 3HP5A 5LQFA 2GQRA 4EYMA 2WTKB 2YM8A 3A61A 3NUUA 3QCYA 3NLBA 4W4XA 4MAOA 4ZMFA 4FBXA 1H01A 3HMNA 5HHWA 3RAHA 3RPYA 5AP1A 2EVAA 5G1XA 1ZMWA 3QZHA 4KNBA 4TRLA 4W8DA 5C1QB 2GS7A 5C01A 3SOAA 5DEYA 4AGDA 1STCE 3SAYA 3NYOA 2QOIA 4BC6A 2XIZA 2BRBA 3LIJA 3UVRA 5LVPA 3N4TA 5IQAA 5HO6A 5BUJA 1V0BA 3COMA 3K3IA 4WO5A 4KIOA 3KL8A 4UWBA 5JEBA 2JFMA 1ZZ2A 5J9LA 3QHRA 3R9HA 4I3ZA 4AA0A 2C6KA 4JR3A 2W17A 4FSZA 2VWYA 5J7BA 3OXIA 5D7AA 3A7FA 1OKWA 4M15A 5HG7A 2QOHA 3ZHPC 4APCA 3IOPA 5FLFA 4DG2E 4E3CA 2YDJA 1ND4A 3FKNA 5K0XA 4BVUA 3G0EA 4K33A 2IW6A 2J4ZA 3NIEA 4IZ5A 4ARKA 2VTNA 5IA5A 4ZJVA 4LUEA 1RQQA 2ETRA 1ZRZA 3ALOA 3R28A 1LPUA 2JKMA 1KV2A 3QQJA 2CNVA 3TDWA 4RIOA 4FK6A 2XZSA 4KIPA 3D0EA 3EL8A 5IA2A 4HGSA 2XKCA 4YJNA 3NPCA 4ASEA 2IW9A 4DYMA 3QU0A 4CRSA 3FEGA 2QQ7A 5AUVA 2AYPA 4CZYB 3Q3BA 5IA4A 4ZLZA 2G2IA 5EK7A 1NVSA 1REKA 2RL5A 4I20A 5CYIA 2W1EA 5B7VA 4IWOA 4FKRA 5E91A 2BAJA 2HIWA 3R2YA 2WTWA 4L44A 5L2QA 4JX7A 3QC4A 4LOOA 1J7IA 5A3XA 4TXCA 4ASXA 2I1MA 3V6RA 4DEAA 4CEGA 4YO4A 4TWPA 5EW9A 2G2HA 4BWKA 3MGYA 3R7UA 4XYFA 4RJ3A 4Y8DA 4BTJA 3GGFA 4RZWA 5HORA 3QX2A
chains in the Genus database with same CATH superfamily
2Z02A 3MIYA 4A07A 1Q8YA 3FAAA 2ETMA 3G6GA 3UNJA 2XK7A 3PXYA 5AP0A 1WBTA 2QO2A 5IKWA 5BX0A 1Q8WA 3R9DA 4P90A 3SQQA 3KB7A 3KXGA 5FDXA 4UX9A 5EDPA 4FR4A 4FNWA 2YM7A 5M4FA 2UZEA 4JVGA 2C69A 3FL5A 2EB2A 4MX9A 1IA9A 1BUHA 4MKCA 3MW1A 3AMAA 5DFPA 2QNJA 1NVRA 4FSYA 5ANGA 1FGKA 5EYKA 3W2SA 3DLZA 4EHEA 5E8WA 2QOLA 3AGLA 4QPMA 4W4WA 2QODA 4QPAA 1H1RA 2GTNA 3FZRA 2XBJA 5E8XA 5JFWA 2PZIA 3GCQA 1ZARA 4I1ZA 4E7WA 5L2TA 3PUFC 2A2AA 1QCFA 3KN6A 3NR9A 5KE0A 2OZAB 2QOBA 2JDTA 3UVPA 3PJ2A 3FI4A 3KIOC 5J79A 5KBQA 5IDNA 3ORZA 2X2MA 5IA3A 3EKNA 4FTAA 2BDJA 3PP0A 4U42A 4RVKA 5BVNA 3AKLA 3SHEA 2JEDA 3PRFA 4CG9A 5HIBA 5AV0A 4ID7A 1JKLA 3UOHA 4AFJA 4BF2A 1CTPE 1H4LA 1Q8TA 4FK3A 3FMMA 4WNPA 3RMFA 2W7XA 3KEXA 3W0NA 1IG1A 3FLSA 3NS9A 5DI1A 4IVBA 1Q8UA 4CLIA 3VONA 3TTJA 4JAJA 2AQXA 3JVSA 4NM7A 4XMOA 2VTSA 2WIPA 5FUTA 1ZMUA 2O65A 2WB8A 3SG9A 3CSVA 3LAUA 4FODA 3F5XA 4C7TA 2X8DA 5J95A 3CTQA 5HE1A 3RM6A 3ZYAA 1FGIA 5IZFA 3BGZA 1YHSA 3DBDA 3JPVA 4BCKA 5M08A 2UZBA 2XEZA 2B52A 4X6RA 4F0FA 3ZBXA 3F2NA 4F7JA 2UVXA 2BZHB 4FUYA 3LMGA 3WF9A 2IZSA 5ITAA 4GK3A 3ZU7A 5HD7A 5KKRC 5CANA 4DE4A 3QQKA 4Q5HA 4C3PA 4HVSA 3S1HA 3TL8A 3F82A 4QP3A 3VS0A 3PPZA 4EEVA 5LVMA 1Q3DA 1DAWA 2C1AA 4GS6A 3Q5ZA 3NX8A 4L6QA 2IW8A 3P86A 4JQ7A 2C3JA 2UW7A 5DHJA 2XA4A 5B2MA 3QUDA 5DMZA 2WMBA 4NWMA 3DT1A 3V04A 1FMKA 5ANEA 3VW8A 3ZFXA 3OOMA 3PPKA 4G5PA 5HVKA 4X3FA 3UGCA 4KAOA 4P2KA 4I5MA 3OFMA 3KREA 4WUNA 1JPAA 5F20A 3UODA 2PVNA 3HGKA 5HG8A 1H07A 3POOA 5ANDA 3OCBA 4FSMA 4O22A 5AUXA 4HVDA 5JFVA 1UNGA 2W5BA 3LHJA 3LPBA 4YTIA 2R4BA 4R1VA 3RHKA 4BCQA 5LWNA 3VBTA 3BV2A 4GFMA 4CV8A 3OUKA 5KBRA 2X9FA 3QGYA 5IH4A 4BKJA 3R9RA 4K2RA 3UDSA 3BBWA 4QP2A 1PXNA 2HZNA 4MBJA 3MA6A 4TNDA 4DEHA 5LVOA 5HQ0A 3D7TA 1FBNA 4QMTA 4R78A 2R64A 3UO4A 3E93A 1VEBA 2XIXA 4U9AA 3G15A 4CFNA 2OIQA 3JY0A 2EUFB 3NFFB 3ORXA 4BYIA 3FE3A 3R73A 4J96A 4IC7A 4F1OA 3HYHA 4Z9LA 1YWNA 3CGOA 4FEQA 2WQBA 3MI9A 4G5JA 4HPTE 3TKHA 4C58A 3ETAA 3R21A 2QG7A 3UTOA 4LQMA 3SGCA 1WCCA 4EH4A 1BX6A 5EM5A 3V5LA 1B39A 3ZZEA 3CQUA 2YISA 3TUDA 1AQ1A 4H58A 1YXSA 5FTGA 2CMWA 2R3GA 3GOPA 4IAFA 2YIYA 1P4OA 2PE2A 4M84A 3I5NA 4YC6A 3C5UA 4ITIA 4AW1A 4YJOA 5J9YA 2ITQA 4FV5A 5M07A 4B8LA 2G9XA 4I41A 4BCHA 4RSSA 3ZXZA 3QRJA 4C4FA 4F4PA 4MHAA 4FTMA 1GZ8A 1BKXA 1WMKA 1Y8GA 2WIHA 4W4VA 5CF6A 2CGUA 3O50A 1XJDA 4D58A 3KK8A 4MK0A 3QYZA 3SA0A 1URCA 3DB8A 3FYJX 3MPMA 2X0QA 4S30A 1XH7A 3BELA 3ULIA 2ZDTA 4WRSA 3FI2A 3JR1A 4FEUA 3RVGA 3SW4A 3FY2A 1WBNA 2CSNA 3OT3A 5D1JA 4AOTA 4GFOA 4RT7A 4I93A 1SM2A 3EN5A 3IOKA 4ZMEA 4A4LA 3GQIA 2CLQA 5K5XA 3CR0A 3QXPA 3Q9YA 3UE4A 3ZFYA 4K1BA 2QO7A 2XK6A 5FG8A 5FEEA 2AC3A 3GOKA 4CFMA 2BMCA 3QLGA 4F1MA 4ANQA 3S00A 1ATPE 2R0IA 4GMYA 4XG9A 2JFLA 4G16A 1OZ1A 4O7LA 2XKDA 5L6WL 1HOWA 3GCVA 3FZPA 1YXVA 2BZKB 1V1KA 2VO7A 2HENA 3AT4A 4RC3A 4RFYA 4WIHA 5DOSA 2GNJA 4ZZMA 4ACMA 1PMUA 5HTIA 5L2IA 3HV5A 3O17A 4PPBA 4QMUA 5JGAA 1ZOHA 2XS0A 1BLXA 3NRMA 1WZYA 4PTCA 3GEQA 2XF0A 3KXHA 5AEPA 3P4KA 1ZYDA 1UU7A 3R22A 5LVLA 4APPA 3EL7A 4ZTHA 2R3IA 3U9CA 1V0OA 4IJPA 4JRNA 3TNQB 5L4QA 4EUTA 4RIXB 4C4GA 3GC8A 4U41A 5CSVA 5DRBA 3EH9A 4F9AA 3KA0A 5IUGA 5CU6A 4TY1A 2QG5A 4D1XA 3ERKA 2PVRA 3LFBA 4FE2A 1Q61A 2VWUA 4CT1A 3ZMMA 3MH3A 3BU6A 4O7WA 4QNYA 2UZWE 4N57A 1PKDA 4IJ9A 5AR3A 3Q53A 5FP5A 2UW6A 2NP8A 3EWHA 4YZDA 4DGLC 4FNXA 3V3VA 4O7TA 2CKOA 4JQ8A 3KXZA 3WILA 5AMNA 4EHZA 5HBEA 4O1OA 2NO3A 4GW8A 4IWPA 5AAGA 2C6TA 4Q2AA 2C3KA 2XARA 4YMJA 4L8MA 3ZDUA 1UWJA 4IAZA 1KUTA 5ANJA 4DFXE 4N6ZA 4AT4A 3BU5A 1RDQE 5IPJA 4PPAA 4E4NA 5M4IA 4I6LA 3BCEA 4BDIA 5DR2A 4EJ7A 1URWA 5ETFA 2UVYA 2RFSA 5L8KA 4EWHA 4ERWA 3VAPA 2JIVA 4QMVA 3ZLSA 3CD3A 4CYIA 4ZP5A 1KWPA 4I92A 5TO8A 4AW2A 4YHFA 4FX3A 4O2ZA 4U45A 3DZOA 4WNMA 3PE1A 4CFVA 2ERKA 1DM2A 3QTZA 4J99A 5AUUA 4F70A 5EDRA 4NM3A 4J97A 4FV7A 2J50A 3DK6A 4C62A 4O7NA 4YR8A 3MN3A 4WUAA 4EQMA 5J1VA 1IA8A 5CEIA 2WMRA 3FQHA 5I0BA 2GNGA 4RC4A 4DFZE 2ITNA 5BUEA 4FSRA 2WGJA 3GU6A 2G1TA 2GPHA 4NJ3A 1ZMVA 2REIA 3EFLA 4L7FA 4GYIA 4LG4A 4OTDA 1G8KA 2BRGA 5KZ0A 3LLTA 5F1ZA 5LOHA 3RPRA 4CZTA 3JS2A 3NYVA 4U97A 5AP7A 1IRKA 3EQHA 2UW0A 3LOKA 3AG9A 3FI3A 4L67A 1DAYA 5KZIA 1Z57A 2W5AA 1MQ4A 4DEIA 5E7RA 2Z7RA 4E26A 3KF4A 3DY7A 4KIQA 2QKWB 4ZTMA 4E1ZA 5DVRA 3C0GA 4GSBA 1H25A 2C4GA 2R3QA 4O81A 5CZHA 5D41A 2ZM1A 3QQLA 3UBDA 2XEYA 4DGNA 1MRVA 1G8SA 3OT8A 4B0GA 3I6WA 4YJTA 3LQ8A 5I9YA 3KCKA 3MY0A 4IB5A 3QKMA 2KTYA 1CKIA 2C30A 4ANSA 3TM0A 3EZRA 3TIZA 2YIQA 4JG6A 2ITZA 3TIYA 4XP3A 4M14A 5DRDA 3FC2A 3ZXTA 4DG0E 5HBHA 5IQBA 4LRKA 1GNGA 3PVUA 3MB7A 3OMVA 1Q5KA 2OF2A 4PL5A 5CU4A 4FOBA 5G6VA 3D14A 5A4EA 3GCPA 2CGVA 1UV5A 3R8MA 2WU6A 3DK3A 3QFVA 5T6KA 3F5UA 4LL0A 4IB1A 4QPSA 4QYFA 3QF9A 4RA4A 5I9WA 2PU8A 4R7BA 3M2WA 2QLQA 3F7WA 3HUCA 2HXLA 2YM3A 3LM5A 3LCKA 4AT3A 3E7OA 4U6RA 3A2CA 3R04A 1PMVA 4HGEA 1ZAOA 4DEGA 5IMXA 4QQCA 3I4BA 4Z16A 5IQFA 4RJ5A 4B8MA 1XBAA 3PG1A 3BRBA 3CIKA 3RPVA 1OGUA 3OWJA 2DQ7X 3BYMA 4DITA 4K6ZA 2B9HA 3LVPA 2E9NA 3L9NA 4BDCA 5K4JA 3FZSA 4BDKA 2YN8A 1PYXA 2OH4A 3M1SA 4PDPA 4BBFA 5I4NA 3PDTA 2BTRA 4EOLA 1G5SA 3EJ1A 4BIEA 3DJ7A 3S0OA 2CGXA 1FVTA 3H4JA 3IW7A 3BIZA 4I5CA 5EI6A 3I1AA 3R30A 3CTHA 3VNTA 5IA0A 4IMYA 4HYHA 4C4HA 3BL7A 1S9JA 1YOJA 4BTKA 2VWZA 2R9SA 2YJSA 3HZTA 3LJ0A 4KS7A 3RCJA 3U55A 3EN4A 5C8NA 2QOQA 2RFNA 4JJRA 1J7LA 5EYMA 4FIJA 4UXLA 3GCSA 4ZTLA 4DFYA 4I24A 4RWJA 4C0TA 5AP4A 2GU8A 3EQIA 2X9EA 5BVOA 2ZJWA 3HRBA 1U54A 3V5JA 5CAUA 3KC3A 1VYWA 3SXSA 3Q4UA 3LXPA 2YLEA 3A8XA 3ET7A 4WSYA 4YJUA 2B55A 3QTSA 5HG9A 4IVAA 4AW5A 5EFQA 4MTAA 5JMSA 3NUYA 4EK5A 3P23A 2FYSA 4IM2A 2EXCX 3ZSIA 4E5WA 4R3RA 4DFNA 2Q0NA 1SVGA 2I6LA 5IF1A 4Y73A 3QUEA 3P5KA 4TPTA 5IQEA 4IB0A 3BYUA 2G01A 3D83A 4CMUA 2R7BA 5FBNC 4DDIA 4FV6A 5HO8A 2X2KA 3VULA 3EYGA 4FV9A 4DGOA 3SG8A 2BROA 5C4KA 4G6NA 3P5JC 2OSCA 1QMZA 4P4CA 4RVLA 5EH0A 4YZBA 5FTOA 3HDMA 4F6UA 3LFFA 3RP9A 3A8WA 5CZIA 3ZO3A 4C61A 4I94A 1LEWA 4CVAA 3GVUA 5AUTA 3ZTXA 1KE5A 2JGZA 4X2GA 3WF8A 3ZDIA 5JZJA 3SRVB 3F66A 5JRSA 4DFBA 1PW2A 3COHA 5D10A 5IDPA 2XKFA 2C6IA 4O86A 4C4IA 2ITPA 4I6BA 3HRFA 3QLFA 4LL5A 2OJIA 4D2TA 2QO9A 1F5QA 1KSWA 4EZ7A 4ZAUA 3BYOA 4U7ZA 4IFGA 1BI7A 5CVGA 5K3YA 3WYXA 2I7QA 2XK3A 3GFEA 2VZ6A 2XKEA 5CT7A 4F78A 2Q0BA 4UY9A 5IQIA 1PHKA 3CS9A 1E9HA 3K54A 4EBWA 3ZC5A 2R3RA 5JRQA 2XB7A 5HBJA 1E1XA 3UO6A 4EONA 4OR5A 2UVZA 2IF8A 2PZ5A 3T9TA 5EW8A 5M51A 3FHIA 5JFXA 3C5IA 4XG6A 3QKKA 4RIWA 4BCNA 4NFNA 5M53A 3FQSA 1YW2A 4QD6A 4ZK5A 3PJ1A 1Z5MA 3R1SA 5LJJA 2O64A 3NYXA 3ODZX 2PUUA 5CENA 2Z60A 4AQKA 3PUPA 3C50A 3ZSGA 5CAPA 4BDEA 4AZVA 4B99A 4DTAA 5J8IA 1UA2A 4CD0A 2VTIA 4OBQA 4I0SA 1P4FA 4A9YA 1OB3A 4HYUA 4DFLA 3H3CA 5EM8A 3FHRA 4U3YA 1W82A 3R7IA 3HRCA 4G31A 4GK4A 2OFUA 3QRIA 4H1JA 1VLRA 2GFSA 3P9JA 3UNZA 5JN2A 4O0UA 5DIAA 5CEPA 3G51A 4KIKB 3IONA 5BUIA 5FXQA 3VIDA 4ACHA 4ZY5A 3ZRMA 4DGGA 1YI3A 4ENYA 3VUDA 4FSUA 3PXQA 3PA4A 1V0PA 3DBCA 4I23A 4V01A 3TWJA 5IU2A 4DF3A 1YOLA 2UW8A 3OF0A 5TT7A 4UEUA 3W10A 1YWVA 3NZ0A 3NAYA 3O7LB 2OJ9A 2VWWA 1DI9A 3F7ZA 4FKWA 4RFMA 1H1SA 3W33A 4FYOA 3ZUUA 2CKQA 4IB3A 2OF4A 2WTVA 2YLFA 2HK5A 3EZVA 3KULB 3M11A 4L52A 4C3RA 2XIRA 4ZJIA 1W2FA 1YDSE 1IEPA 2ITYA 4O0VA 3OP5A 5FM2A 5HG5A 3UG1A 5HLNA 5IA1A 3ENHA 3LM0A 4O0WA 2RG5A 3HMIA 3O2MA 3S2PA 2PMOX 4EI4A 4FOCA 5FM3A 5A4TA 4BCMA 4YPSA 1H26A 4PX6A 3OVVA 4ANLA 4EH7A 4PUZA 2HW6A 2BALA 3MPTA 5AP2A 1OGYA 1PXJA 5EI8A 3BLQA 4Y5QA 2XANA 1FOTA 4GEOA 3ZLYA 3E3PA 4AZTA 3OCGA 2B9IA 3CC6A 3NNWA 4IX3A 3FPQA 3TG1A 3W2PA 3IW4A 1QPJA 1OIYA 4F09A 3U8WA 1R0PA 3O23A 4FV1A 5E92A 4PWNA 1AD5A 4UN0C 2JD5A 5CY3A 3D5WA 3LMHA 1OI9A 4QTDA 3QXOA 4AZWA 1OITA 5KMOA 2BIKB 3FMHA 3PIZA 2XK9A 3HV6A 4RMZA 4EC9A 4R77A 4GV1A 5CS6A 5FTQA 2Z7LA 3PG3A 4R3CA 4ALWA 4BY9E 4HZRA 4CV9A 3N4UA 3DAJA 4NYEA 1QPCA 3UPZA 2VX0A 1W2DA 1MRUA 4B6LA 4LRJA 1HCLA 4LYNA 1P5EA 3R71A 4PMPA 4O82A 1JSTA 5LMKC 1NVQA 1RW8A 3R01A 4BDDA 4S33A 3VC4A 2PE0A 1VJYA 3KXXA 4XOZA 4AT5A 2PVHA 2YCRA 3NNXA 1CKJA 3UIXA 5JH6A 3IW5A 5IQGA 1O6LA 4XG8A 4BGQA 4B4LA 4PV0A 3ENMA 4D4SA 4ENXA 5A14A 4DA5A 2FB8A 4NKAA 3KU2A 4EOSA 1OL1A 4F1TA 4UZHA 4QMPA 2Z7QA 4GVAA 2ZB0A 2YACA 1WBWA 2X7OA 5DGZA 3U4WA 3ZUVA 1Y57A 3V5WA 3KRLA 3NGAA 3D5UA 5A4LA 4Y95A 4EQCA 3EN6A 3W55A 4BCPA 2JDSA 4OTQA 4YP8A 3ACKA 3GI3A 2OBJA 3DNEA 3AXWA 4CQGA 4U80A 1H8FA 5KMJA 2J5FA 4IM3A 4CMOA 4DH5A 2VTPA 3HA6A 2IWIA 3MYGA 4DH7A 1IAJA 3QRUA 5AIKA 3AD6A 3K3JA 4FTKA 4JOAA 5HLPA 4AP7A 3FY0A 4GG5A 5K5NA 4HGLA 3SVVA 4EH6A 5CAOA 3H9RA 2ITVA 3FXZA 4JQEA 3NVMB 4ANNA 4QT1A 3ZM9A 1OUKA 3WZKA 5H9BA 3ZO2A 3PPJA 3OY1A 4NW6A 5T3QA 4EK4A 1NA7A 4JRVA 2OZOA 4XV3A 3NMUF 2PVMA 2QOOA 3E8DA 2V7OA 5K0KA 5C4LA 2FSOX 4Z7HA 5I9ZA 1R3CA 3VF9A 4DBNA 1KE9A 3IGGA 4IZ7A 5JGBA 3T8OA 4EOJA 5M4UA 4YJVA 2CJMA 1SMHA 2OJFE 3DJ6A 3FMKA 3NUAA 2WOTA 4NTSA 2IJMA 2VNWA 4WG5A 3VBWA 4MQ1A 4OTGA 3QD3A 3R6XA 4BHZA 3F3ZA 4ZOGA 3GU5A 2BRNA 4JBPA 5L2WA 3D2IA 1OIQA 3VBVA 4ZTSA 4LFIA 4ORKA 3TYKA 2Z7SA 4IANA 4LMUA 5E8SA 5EOLA 4E4XA 4EHVA 3MV5A 4CT2A 4L01A 3AC4A 1SZMA 2XIKA 2PYWA 4TWNA 5HIEA 2W4OA 1OPKA 4O0YA 4XLVA 4QP6A 4A4XA 4UMRA 3P7CA 4L9IA 2VV9A 1NW1A 2HXQA 4BDJA 2YCFA 4ZTQA 3D4QA 3RINA 3DXPA 4X2NA 3NNUA 3C7QA 1BL7A 5CF8A 2QC6A 4YUQA 4PY1A 1JKTA 1Q24A 4XBUA 2EXEA 3PLSA 4FI1A 2QU6A 4IFCA 4MXAA 4ANOA 4C37A 2CGWA 1YVJA 2J0MB 4G34A 4FV3A 1ZXEA 4LGGA 5KHXA 2Z2WA 4JBVA 3MDYA 3QGWA 3QTXA 3E8EA 5LVNA 2BDWA 2ITWA 3DK7A 4QEBA 1LP4A 4QMOA 5H3QA 3RBWA 5GIOE 4EH9A 2JDRA 3GBZA 3N9XA 4CKJA 5HTBA 5EQYA 4YBJA 2XRWA 2XH5A 2W9FB 3Q52A 1GJOA 5AR5A 2CNQA 2ZMCA 1WFCA 3CJGA 4H1MA 3HP2A 4AA4A 4KBKA 4ITJA 2YM6A 4YC8A 4HYSA 4FV2A 4QTEA 4JX3A 4S34A 1UNLA 3AMBA 3BHTA 2WHBA 3VS2A 3AQVA 4OW8A 4YZ9A 3KF7A 2HZ0A 2JBPA 4X3FB 3RNYA 3W2RA 4IVCA 4D4VA 3VUIA 3SXRA 2J5EA 2PMNX 2WD1A 3FQEA 4QYGA 3OCTA 1NY3A 4CFWA 4NT4A 2W1DA 2P33A 2HELA 3MJ2A 4QMZA 2JKOA 3PJ3A 5HEZA 4F9WA 1MUOA 4U44A 4BKZA 4CFFA 2FSLX 4OTHA 5JZNA 3EFKA 5CU0A 4O4DA 5EQPA 4YTHA 4AXEA 4BB4A 2G2FA 4NH1A 1U4DA 4DH3A 4FTQA 2YABA 3CXWA 3L8VA 4UMQA 3QCXA 2OU7A 5I9XA 3C4WA 3LJ1A 3D7TB 4QYHA 2GTMA 4PQNA 5JSMA 3DPKA 5DH3A 3QBNA 2W1ZA 3ANQA 3HLLA 1OIUA 2C3LA 4DCAA 1Q99A 2IN6A 3B2TA 3P79A 4TW9A 3LZBA 3VBYA 1J91A 5IQDA 4XG4A 2GHLA 4XEYA 4ONAA 2YERA 5EHOA 3H30A 2R3LA 4WG3A 3FXXA 3P7BA 4AXAA 1OL7A 3ODYX 3FKOA 3MY1A 4JIAA 2W1FA 3OTVA 2QI8A 3F3TA 2UW4A 1XH5A 1M7NA 2XNBA 3TEIA 2BHEA 2IO6A 3DS6A 1XQZA 4FVPA 4J1RA 4L3JA 3P78A 3R8PA 2OXDA 5FD2A 2Y7JA 3O51A 1OKYA 4P7EA 4U79A 2B4SB 4M13A 3JUHA 4I0TA 5EM6A 2OG8A 3VS7A 1PF8A 3A4PA 4BBEA 5FRIA 2WTDA 4BZNA 4EOOA 3SXFA 3QALE 1EH4A 4QTAA 1G3NA 3BYVA 3QTRA 5GHVA 4ZLYA 5JFSA 4OBOA 1SNXA 4J98A 3QQHA 4NKSA 5AADA 3MVMA 2OFVA 3WE4A 1JQHA 1YRPA 4FKSA 4O7YA 3KGAA 4D1ZA 4DCEA 4FV8A 5BVWA 4TYGA 3R7GA 5AX3A 4IAIA 3OZ6A 4A9RA 5EI2A 1O6YA 3LCTA 5HVJA 2OLCA 4QP4A 2VAGA 3D15A 4FTLA 4FTOA 4TKSA 5C27A 4CKIA 3EHAA 3WF5A 3BL9A 2QVSE 2XNMA 4HCVA 5DBXA 3UZTA 4WRGA 3LFAA 4IZYA 3TNWA 3UDTA 3O8TA 1XWSA 3DZQA 2H9VA 3BWFA 5H8EA 2EU9A 4O38A 3FPMA 4MNFA 5AR7A 4HVIA 4DT8A 1UU3A 2GCDA 3G6HA 4ZSGA 3T3VA 5IEVA 1ZY4A 4CLJA 2J90A 4FC0A 2B9JA 5AWMA 3VVHA 2WU7A 2V5QA 5CU3A 2XNOA 2GS6A 3W0PA 4V0GA 3R9NA 5IH6A 5HIDA 3ZSHA 5EM7A 4Y85A 4AN2A 4H3PA 5LMAA 2JAMA 4BCJA 2BPMA 2C5VA 3ANRA 4DTKA 3KMUA 1NT2A 1K3AA 2EWAA 5F4NA 3FDNA 4GKIA 1T46A 2J6MA 4YGAA 4RJ8A 3E63A 3THBA 2QOKA 4FKPA 4ZJJA 3IS5A 3C51A 1OIRA 3FMNA 3HKOA 2JBOA 4FKGA 4FL2A 5I9UA 5HKMA 3HECA 3V8TA 5BV3A 5IMEA 1H28A 3VJNA 3ALNA 2YDIA 5HE3A 1Q41A 4FV0A 4HNFA 3KVWA 2PVLA 5AR8A 5EYDA 3ZEPA 3T9IA 2C3IB 4BI0A 5L2SA 4HNIA 3K5UA 2W0JA 2PK9A 4CFXA 2I0VA 2GMXA 4KA3A 3DTWA 4O4BB 3Q5IA 5TKDA 3R7EA 4MXZA 4IH8A 2BZIB 3NUPA 4JAIA 4WNKA 4AZFA 3Q4ZA 1WVXA 2B54A 5E1SA 4OTRA 4FG8A 3R0TA 4DHIB 3HV3A 4USEA 4AOIA 2VTTA 4BCOA 3RTPA 4OTIA 4FZDB 2BHHA 1M2QA 4G1WA 1LEZA 4ASZA 4D4YA 3PY1A 3C1XA 3FBVA 4YU2A 4NUSA 1G8AA 1H00A 4R6VA 4QP8A 5M06A 4UALA 3EIDA 4TYEA 3Q6WA 4BN1A 2WQMA 3BX5A 2WMQA 4M7IA 4JR7A 4OTWA 4O84A 3EB0A 4BL1A 3QZFA 4XG2A 3L8XA 3PIYA 3R00A 2IG7A 4I0RA 3GT8A 1MQBA 5A4CA 1I09A 1YOMA 5HU9A 4TNBA 1Y6BA 2VNYA 5K4IA 4YSMA 5AFVA 1R1WA 4FA2A 2WQNA 1PJKA 3CD8A 3DTCA 3TKIA 4ZTRA 3W8LA 4E73A 3DKCA 3UPXA 5CSWA 4GU9A 1GZNA 3PXZA 3S3IA 3WF7A 4O21A 3RKBA 3ZLWA 5TOZA 4F7SA 4FIEA 2IZTA 3M42A 2V55A 3U6JA 3HVCA 3UYTA 4R3PA 4DHFA 1AGWA 4JBOA 4RQKA 4FZAB 5BPYA 2PVYA 4ERKA 4NIFA 4YHJA 4FZ6A 4ZS4A 4H36A 1QL6A 3OG7A 2PY3A 5DLSA 5AR2A 3N4VA 1VR2A 3W0OA 1BI8A 4GT4A 1GIHA 3COIA 2GNFA 5ANKA 4FL1A 3EYHA 4TN6A 2XNPA 5TE0A 4KWPA 4F64A 1GAGA 2G15A 3UP7A 5GNKA 4QMQA 4USDA 2OW3A 4RVMA 3HNGA 3NW5A 5AP6A 4C4EA 2JKQA 4EK8A 5KMKA 5GZ9A 4QYEA 3SKCA 4C3FA 1ST0A 2XUUA 3LQ3A 1YXXA 3B2WA 5BNJA 4JXFA 2QCSA 3DBQA 5KHWA 1OBDA 4FGRA 4C8BA 5CVHA 5HE0A 4YTFA 5BVKA 4MYGA 3C0IA 4U5JA 1CMKE 3KQ7A 2OJJA 3CPBA 4E6DA 2BDFA 5LMKA 4A9TA 3BHYA 3II5A 4MQ2A 4TYHA 2XK8A 5JKGA 5L6OA 2OJGA 3GC0A 4XV9A 1WVYA 4F7LA 2Y6MA 4BJJA 1XH4A 3Q60A 4RLLA 2O2UA 4L42A 1ERKA 2X7GA 4GU6A 3H0ZA 1UWHA 3O8UA 4O0SA 5EKOA 3ACJA 2I0EA 4LMNA 3VUTA 2R2PA 4A9UA 4DGMA 5J1WA 1H08A 2F9GA 2X4ZA 3EKKA 3OUNB 3DKOA 3RM7A 3IDCA 4M67A 2H6DA 4C59A 2BVAA 4ZZOA 2PZPA 2VWIA 3NSZA 2IVSA 2WTJA 4ITHA 5AM7A 3VHKA 3R8VA 5E1EA 3W2QA 4X7QA 4EZ5A 4HCUA 4H3BA 1M7QA 5FQDC 3ZZWA 3UG2A 2C1BA 4NFMA 4L3PA 4YPDA 3AC1A 4U3ZA 2WMVA 3FI8A 3ID6C 4LOQA 1PXPA 4YZCA 5FXSA 3V01A 5LXMA 4IBMA 2JDVA 3L8SA 2HAKA 2VWVA 4CQEA 2PPQA 5HICA 4G9RA 4AE9A 3BWJA 5CQUA 3N51A 5ETIA 5JGDA 3SD0A 2AC5A 1GIJA 1UU9A 4RGJA 3PFYA 4G3FA 1ZYLA 3PIXA 2CKEA 4TZRA 4BIDA 4NW5A 3S4QA 1KOAA 3CP9A 2X4FA 5CAVA 1YKRA 2WEVA 2X6EA 2W1GA 2C47A 4ZS0A 2C5XA 2F49A 3EMGA 3FKLA 4IIRA 4Y5HA 3TUBA 2VGPA 5AA9A 4BHNA 3BQRA 3TT0A 2ZV8A 3A7IA 2DUVA 4KSPA 3LLAA 1U54B 3OWPA 3RJCA 4O83A 4J8NA 1W98A 2CHLA 4GT5A 4QMMA 2YAAA 4UMUA 4AN3A 2PHKA 4E6CA 4XRJA 3ZOSA 5HX6A 2WELA 2WTCA 4LGDA 1ZYSA 4HOKA 3KY2A 4FVRA 5AM6A