1U5RA

Crystal structure of the tao2 kinase domain: activation and specifity of a ste20p map3k
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
308
Chain Sequence
DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords serine/threonine protein kinase TAO2
publication title Crystal Structure of the TAO2 Kinase Domain; Activation and Specificity of a Ste20p MAP3K.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 99
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u5rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u5rA01
2X4FA 2J0KA 3CR0A 3OOMA 4ZEGA 4AACA 4F0IA 3JYAA 3R7GA 2EB3A 3NX8A 2JFMA 4AA0A 1SVHA 2F9GA 4BCNA 2OZAA 4LRKA 3CGOA 4EZ7A 4XX9A 2YA9A 3VUGA 3NPCA 4ZMFA 3GFEA 3UVQA 1CSNA 3OY1A 1F3MC 4PPCA 3JY9A 5CU0A 3KQ7A 2CMWA 4O7LA 4BDHA 3ZO3A 2QR7A 5DMZA 3DU8A 3ZXZA 4F64A 4RWIA 4AAAA 5DI1A 3V04A 4X6RA 3FKNA 3S00A 4ZJVA 2HZNA 4QP2A 4HCVA 4MF1A 5E7RA 3UO6A 4C59A 5GZ8A 5HO7A 5HTIA 5EYCA 4DA5A 4BIEA 2OJGA 3MY1A 4KS7A 4MBJA 3MB7A 3O8PA 4EBWA 4NM7A 5BNJA 3QLGA 5IA3A 3FHRA 4U5JA 3LKMA 1I09A 4FODA 4NM5A 4FNXA 1E1VA 3I4BA 4YHJA 2Y7JA 3NW7A 3U4UA 3C1XA 2UW8A 2X9FA 5JSMA 2WMSA 3PJ8A 4M67A 5EM7A 3VF9A 1PHKA 3UDBA 1U5RA 3LM5A 3LHJA 4EK3A 3RZBA 4AGUA 4DTAA 4HZSA 5EKNA 3L8VA 3Q60A 5HO6A 2ZMDA 2PL0A 3FC1X 3QKMA 1PJKA 3CEKA 5BUIA 4BCGA 4DH3A 3O17A 2QU6A 4W4YA 4FIJA 4N0SA 4BB4A 2X7GA 3BBWA 3ZZWA 3QQJA 2OXXA 2B9JA 2J90A 3UMWA 1Q8WA 3Q2MA 5FLFA 2HOGA 4C36A 3FZ1A 4XUFA 3VRYA 4G6NA 3A99A 1OBDA 1IA8A 2XZSA 4CYIA 2B1PA 3BE2A 3OOGA 5H8BA 5FM2A 4TNDA 3CQUA 3R04A 2P2IA 2UW3A 5E1SA 4OTFA 5E8ZA 3PXYA 3VC4A 2R2PA 3A61A 2ZB0A 4BBFA 3ORZA 2AC3A 1JSVA 3GBZA 2XRWA 4O0VA 4USFA 3PSBA 4F6SA 3RVGA 5CEOA 3BBTB 3P7BA 5B0XA 2LGCA 3DNEA 2CN5A 4BN1A 4FSRA 4FTAA 3E88A 2BMCA 5CAVA 4OW8A 3U9NA 4I5CA 4D4RA 4B6LA 4BI0A 4B99A 4ZSEA 4RA4A 3OWJA 2OSCA 4AQCA 2PE2A 4JRVA 4EJ7A 1KE6A 2R7BA 2XK6A 4NIFB 2UZDA 2W5BA 3A7GA 2WTIA 4X3FB 1PKGA 2BKZA 3ZFYA 5IQHA 4U97A 4XG4A 3EYGA 3Q04A 2E9PA 4U42A 4XNEA 2F2CB 3O96A 4RIXB 5BUEA 3VS1A 3WE4A 3ZU7A 5ANJA 1A9UA 3KRLA 3PIZA 4IH8A 3GNIB 3O8TA 5DG5A 3ROCA 4W8DA 4BKJA 2CNUA 4FR4A 3TCPA 2W1EA 5CF6A 1SVGA 4RVLA 1YDSE 3AMYA 5CI7A 5L2SA 2Y8OA 3UQCA 4Q9ZA 3ORNA 2Y6OA 5AUVA 5HLPA 3MIAA 5J9LA 3CQEA 3NLBA 2R3LA 4K6ZA 2QOQA 4JVGA 2OF4A 4ENYA 5KUPA 5I9WA 4NL0A 3Q52A 1JQHA 2J51A 3H9OA 3OY3A 5EI2A 3S4QA 2B53A 5IDNA 1SNUA 3CE3A 4IVCA 2XBAA 4Z7HA 3H0ZA 3LXLA 5AMNA 3AC4A 3UTOA 3MI9A 5M09A 3OCTA 2IWIA 1VYZA 4BCPA 3LZBA 4AX8A 3QHWA 4J95A 4L7FA 4GJ3A 3T9IA 3BLHA 4TXCA 4RA5A 4XG9A 2AC5A 4AS0A 2IZUA 3O2MA 1OL7A 3DBDA 4O21A 4U80A 4YJQA 5I3OA 4EZ3A 3QZIA 2P0CA 4FEVA 3OBJA 3QQKA 1M2PA 5CAQA 5JRSA 4QMMA 5FM3A 4QTAA 2PZ5A 4F99A 2BHHA 3SA0A 3A60A 3IK3A 3WF7A 4AZTA 2W4KA 3A7HA 4I22A 2XM9A 4I5PA 4TYHA 4CZTA 3LQ5A 1CDKA 2WD1A 2VU3A 4IAZA 3U6JA 3UPZA 3R7YA 4EK5A 1JLUE 3BHHA 4II5A 3KXZA 3HL7A 4JT3A 2Z7LA 5EKOA 3FBVA 1TQIA 4JBVA 4MXCA 4PL3A 2PWLA 4XBUA 4TYJA 3IGGA 2WMUA 2R7IA 2Q0BA 4TWPA 4ZY5A 1E9HA 1WZYA 5HICA 4DHFA 4ACGA 4MTAA 5IF1A 5CVGA 2OI4X 4OGRA 4OTDA 3ZCLA 5TF9A 3LXNA 2Y4PA 3TJDA 3W2QA 2PTKA 3FMMA 5LXMA 3F3UA 3PJ1A 5TR6A 3FQSA 3GQLA 3PVBA 3ODZX 1R78A 5E8WA 4Z3VA 5CNOA 2XK3A 5KHWA 3JVRA 4KSPA 1ZLTA 2UW4A 3ODYX 4PTCA 3R9NA 4BDCA 4FT9A 2JC6A 3TNQB 1H1RA 4YHTA 1W7HA 4QMWA 4BZDA 5HU9A 2QC6A 2YAAA 2PVLA 4QTBA 3FZRA 3OXIA 2YIRA 5C26A 4I6BA 2BZKB 4GJ2A 3UGCA 4F7SA 3IW7A 3VUDA 4R7BA 5HORA 2X2MA 2C6IA 3ZLWA 3SG8A 2VWYA 4IC8A 3FV8A 4RSSA 1OMWA 2ZV7A 4YJTA 4JIKA 2WU7A 3HGKA 2ZV8A 4GKIA 5AX9A 3F7ZA 3QZHA 4DINA 3KK8A 3BHYA 3DQWA 2VTSA 3ZFMA 1WVYA 3DB6A 4QMUA 1CTPE 4QQTA 4FV0A 3GU7A 2UZLA 3PPZA 3NS9A 1JSTA 1ZYDA 2YCRA 4O84A 3JUHA 3O0GA 4PL4A 3EN7A 1PXJA 3E3PA 5AV2A 2V7OA 2XKDA 3G6GA 2OFVA 3OEFX 3PSCA 4QOXA 4RT7A 3ZRMA 5IDPA 3P08A 3R8ZA 1YWRA 4RIOA 4I3ZA 4XMOA 4MBLA 5EDPA 2YIXA 3I1AA 1OL6A 3EQRA 3FY2A 2ZOQA 4KIOA 5J9ZA 1G5SA 4C4JA 1UU9A 4IVAA 3VUKA 4D9TA 4ASDA 3DTWA 4GVAA 5KO1A 2BRBA 3FLYA 2BFXA 4A06A 1W82A 4I4FA 3A2CA 3NUSA 3NUUA 1KSWA 4D5HA 3CTQA 3VAPA 4E4NA 5AV1A 5EI8A 2QNJA 3TKIA 3UODA 3EYHA 3ORIA 3MFSA 3BLRA 3AGLA 2OKRA 2OJJA 3QTSA 3F69A 3SAYA 5CQWA 1GY3A 4EOJA 4DFUA 1GJOA 5CSWA 4PMPA 2WXVA 4QO9A 5A4QA 2W7XA 2WMTA 3B8RA 3OZ6A 3KL8A 1BYGA 3F66A 3KMWA 4LOPA 4EBVA 5M07A 3ZO2A 3R63A 4B8LA 3QA0A 4GH2A 3HDMA 3NNXA 4E6AA 1NXKA 1TQPA 3SGCA 4CG9A 3ORKA 3SRVA 1ZYLA 3QKLA 1H08A 4MQ2A 5IPJA 1FVVA 1Q41A 2REIA 3HMIA 3QD0A 4DT9A 4WRGA 4MXYA 5KMNA 3FZSA 4DGOA 4J1RA 2VWVA 2P33A 3QBNA 4JRNA 3TN8A 4JDIA 4HVHA 5HE3A 4O86A 2VGPA 4ANSA 4CTBA 4ZOGA 4FGRA 4I20A 2BIYA 1L3RE 1HCKA 1CKIA 4OAUC 4FZFB 4RC3A 3QLFA 4J96A 4X2JA 4YZDA 5CSHA 5CU6A 2YITA 2WIPA 3ZSIA 3ZLXA 1YW2A 2BDWA 2W1GA 3MVJA 4JAJA 4C35A 1O6YA 4J8MA 5LCKA 2WEVA 3R9OA 5ETAA 1Q24A 5T6KA 4CT1A 2YDJA 4X3FC 3D5XA 5H2UA 3SQQA 4O0WA 1F5QA 4BR3A 4ANLA 1Z57A 2QI8A 4LRMA 4E4XA 2QO9A 3NAXA 3W8LA 4QP3A 4ITJA 3QRJA 3BRBA 1OUYA 2IZRA 2PMIA 4ANQA 5KMIA 1Q4LA 4Y72A 2X9EA 3R2YA 3V8WA 2IZSA 3EHAA 1PKDA 4EONA 4TYIA 1M2QA 1PXMA 5M4CA 1J1CA 3OS3A 2W1FA 4M0ZA 5AP6A 3RZFA 2X1NA 4L45A 4KAOA 4G9CA 4LV5A 5IU2A 5CAUA 3R9HA 1A06A 4UBAA 4QNAA 2XP2A 4CQGA 4CQEA 3KXGA 2BZJA 2ITUA 2J0JA 5AX3A 1WBSA 3E5AA 4C61A 4BDFA 2ZM4A 5CSVA 4CCBA 3MJ1A 2ZB1A 4U7ZA 3F88A 5AFVA 4L53A 5F20A 2XJ1A 1Q62A 3WARA 4QYEA 2PHKA 3C5IA 2OK1A 4BBEA 4DT8A 4AU8A 4L01A 4DITA 4FT7A 4BDIA 5DR2A 4AW0A 2GFCA 5ACKA 1UNHA 2ESMA 2WKMA 4TY1A 5GINE 4LL0A 4PNIA 4Y46A 5GIPE 3R8PA 1KOAA 1MRUA 4O27B 3VN9A 3BIZA 3CD3A 3G15A 2JIIA 2XNPA 3IW8A 3DBFA 2GTMA 4KNBA 3S1HA 4MH7A 4ZLZA 4M66A 1YVJA 3R01A 5HVKA 3UZRA 3H0YA 4KA3A 1FVTA 2VO3A 4RVMA 4ZSLA 4V05A 1QPEA 4Q5EA 3F7WA 4FZDB 3FMEA 1ZYSA 4J98A 5CWZA 2B55A 3HUCA 2R3FA 3RGFA 5CEMA 4XBRA 3R8MA 5JRQA 3PE2A 3FLWA 2GNGA 2HELA 2QOCA 5DA3A 3D5VA 4CFWA 3BU3A 1TVOA 2PSQA 1PMVA 1DAWA 3DY7A 2WMBA 3E7VA 3EFKA 3LJ1A 4FKWA 4YPDA 3KREA 4LYNA 3W2SA 4S33A 3F2RA 2OW3A 3D83A 4M69A 1UA2A 4TWCA 3W10A 2EVAA 2R3NA 2WPAA 3AD6A 2BFYA 3BGQA 4QPMA 4RWLA 1T46A 2P55A 4I0SA 4ALUA 4DF3A 3MY5A 5KCVA 3HECA 2WIHA 3FLNC 4AF3A 1APME 4OT5A 4BCQA 4YR8A 5I5ZA 2J5FA 4FUXA 1U4DA 2PMLX 1RE8A 1P14A 1ZARA 2OBJA 5JFSA 5ETCA 5JN2A 3K3IA 5FP6A 3RPOA 4R78A 3MS9A 4FL3A 4PDSA 4RJ3A 5H3QA 4O1PA 2OJFE 4I41A 3MA3A 3FQEA 2UZTA 3VS6A 4RFMA 4FKLA 1H0WA 2RSVA 2VWBA 4QP8A 4ZLYA 1K3AA 4O38A 2DUVA 4DGGA 4RVKA 3F3WA 4IXPA 3VUMA 4JI9A 3OUNB 4EH5A 3VS3A 2C3KA 2R64A 2J0MB 4HNFA 4D1SA 4DH5A 1GZKA 5HU3A 3ENHA 3PLSA 4L6QA 4WO5A 3GU4A 5AR7A 3PY3A 4B0GA 2GHLA 2XS0A 4FIEA 2WMQA 3DAJA 2Z02A 2ITYA 2W5HA 4DCAA 4RPVA 5IQIA 3OROA 3SDJA 2X8IA 3QKKA 3GU5A 5DGZA 2XF0A 3AD5A 2IW9A 3GUBA 2ZDUA 4YJVA 4XV1A 4YZ9A 1BL6A 3SXFA 4BC6A 2CGXA 3N4TA 4EHVA 4IJ9A 4U44A 4OTPA 2C6DA 5C4KA 3QQLA 2B9HA 5CEQA 4U81A 1OKVA 2ITZA 4RJ6A 4W4VA 1OVEA 3HMOA 5DT4A 4LUEA 3S2PA 3V5TA 3VS4A 4ANMA 3QWKA 2C1BA 4DLIA 2VX0A 4BTMA 4QMQA 5HTCA 2JDVA 4FUYA 4A07A 2UW6A 2AYPA 5FTOA 5J8IA 2VTMA 4L68A 3VUIA 2EXMA 2WTWA 3MJ2A 3MPTA 3Q4ZA 3R8VA 5HG8A 3SV0A 3RPSA 1BMKA 3GENA 2X8DA 2VD5A 4R7HA 4RC2A 4RVTA 5AP4A 3P5KA 1KE9A 5AP5A 5HIBA 4FSWA 2VWZA 1K2PA 3P86A 4D58A 5E8XA 1PXPA 4L52A 5JFVA 3TIZA 4F9WA 1YQJA 5AUUA 2O63A 4IIRA 2JGZA 3DQXA 4O7SA 1WBPA 2EXEA 4X3JA 4UX9A 3FXXA 1UU7A 3GCSA 3I7BA 3AC1A 2WMWA 3POOA 3QHRA 4M12A 4QP9A 1H25A 5CF4A 3OCBA 3R30A 3HYHA 1Y8GA 3UNJA 3MVLA 4AGWA 5L3AA 1M2RA 3BEAA 3Q2JA 4NJDA 3DKGA 3NGAA 5GNKA 5LWMA 3TT0A 3NWWA 4CFVA 2QO7A 1YXVA 4DTBA 4N57A 5EG3A 4YU2A 5C4LA 3JPVA 4AWIA 3Q4CA 3RHKA 3A62A 5IEXA 4EH6A 4DFBA 1ZMWA 1FMKA 2GNJA 3KN6A 3MW1A 4RZWA 3PXZA 3F5PA 3JS2A 4GVJA 4YO6A 5E1EA 3RNIA 4M13A 5KBRA 4XG8A 2HZIA 2IN6A 1XHAA 3A4PA 4BTKA 3QXPA 5HX8A 4A7CA 3RNYA 3Q32A 4F6UA 1OUKA 4GK2A 5EQYA 1NVRA 3MH3A 5D10A 3W8QA 4YNOA 4AW5A 3QAME 5IMXA 3HP5A 4L00A 3RINA 4DFNA 4CT2A 3MSSA 4QYFA 3KK9A 2CDZA 5H8EA 2X39A 4C0TA 2IO6A 5C9CA 2OXYA 4R1VA 3W55A 5DR6A 1REJA 2B7AA 4UYAA 2I40A 4ITIA 4O0TA 5EK7A 1H1WA 4IX6A 2F7ZE 2LAVA 1KOBA 5BPYA 2W96B 3ACKA 1P2AA 5J9YA 2PZYA 4KIQA 4AOTA 2VWXA 4YTIA 2HXQA 3ZOSA 3EQCA 2UZOA 1NY3A 3I60A 2HY0A 3UNKA 1X8BA 2OGVA 2C0TA 1Q3DA 4UALA 4FTJA 4U41A 1G8AA 3MA6A 3OT8A 3Q53A 3CTJA 1KE7A 1U46A 2XKCA 3FEGA 3CD8A 3KY2A 3IG7A 2B52A 2YDKA 5HI2A 5IMEA 4FG8A 3D5WA 4H1MA 2C6MA 4J8NA 2IVVA 1YDTE 2C0IA 4UWBA 5FBNC 4EH8A 3EL8A 1SMHA 3QZGA 4FKUA 4Z55A 3DKFA 5FQDC 4DBXA 2DS1A 2DYLA 3V5QA 1M14A 4MCVA 5AR5A 4FIFA 5AR4A 1URWA 3KVWA 3F5GA 3LFSA 4O91A 3PJCA 4ANBA 4X3FA 3ZDIA 3ZONA 3PYYA 2QVSE 4GK4A 3FYJX 4I21A 4ZTNA 5FP5A 1W83A 4QD6A 1ZYCA 1XR1A 2IW6A 1R0PA 4E4LA 4EEVA 2CLQA 4NM0A 3UPXA 4BHNA 3FLSA 3HMPA 4NFNA 4OUCA 5J1WA 2J4ZA 2A0CX 5L2TA 3NSZA 5EDRA 4ZMEA 3PJ3A 4DEBA 2JFLA 3QCXA 3UQFA 5EW3A 1H01A 4F70A 3ZLYA 5EYMA 2UZBA 4J52A 4EC9A 3UZTA 2FA2A 3CIKA 5AP3A 5AP1A 3H10A 3GB2A 4DLJA 3E7OA 4PDOA 4QTDA 2PUIA 5A4EA 5I9VA 4H05A 1XBCA 3R71A 3MFRA 2VWIA 4LG4A 4HCTA 4QNYA 2IZTA 5ANKA 3PIXA 3EFWA 3IDCA 5HOAA 2CLXA 3WYYA 5FDPA 5D7AA 4XOZA 4ZJIA 4F63A 2ZV2A 2BDFA 2F2UA 4UXLA 4BDBA 4FSTA 1SVEA 1DAYA 1ZY5A 3LJ0A 3RBWA 4R3RA 3VRZA 1J3HA 3SXRA 4EZ5A 5K3YA 2OIDA 4I6QA 1AD5A 4EH9A 2J7TA 4NZWB 1I44A 5GHVA 3FY0A 3G6HA 4O6LA 5DHJA 3NNWA 5TT7A 4O2PA 4C38A 2BZHB 3QX4A 2H96A 2I0HA 4OTGA 3TUCA 3HV4A 5AIRA 4JS8A 4CGAA 3T9TA 1SM2A 2X2LA 4NUSA 4CCUA 2PK9A 2JKOA 4C4GA 1Q3WA 3ANRA 2RKUA 3MVMA 4JLCA 4BDKA 3E8CA 4I6HA 3U9CA 1YWVA 4EHEA 2BR1A 2WTDA 4YJRA 4O22A 3FXZA 3V3VA 3VBWA 3E63A 4E6QA 3DLZA 2XA4A 4ZTSA 3RJCA 3BX5A 3TNHA 4S30A 5J7BA 4NK9A 1V0BA 5E90A 3K5VA 3OG7A 3C4CA 2JKKA 3GOKA 3LFEA 3NEWA 4ANNA 4CKRA 2C6TA 5BMMA 5HEZA 4D2RA 2O64A 2YLEA 1TQMA 3UOKA 3AC8A 5LVLA 4RFYA 1T45A 1IAHA 5CANA 3MB6A 3JVSA 4HYUA 4FEXA 1IEPA 4PTEA 4DE4A 3EQDA 5HHWA 5IQGA 3OC1A 3FSKA 2YJRA 4FTMA 4O2ZA 3EN4A 3ANQA 4MXXA 3VW8A 5LVNA 4CRSA 1RQQA 4WOVA 1AGWA 1M52A 4I4EA 4QP6A 1OPKA 4ZSGA 3GC8A 4WNKA 2BKKA 4F7NA 1CKJA 4DCEA 3DXPA 2E9VA 4FTUA 5H9BA 1H1QA 2V62A 3D94A 1DI8A 4NKSA 3H4JA 4Z9LA 3I79A 3I81A 4D2PA 3GCVA 4FV6A 3FMKA 1OIYA 4R3PA 3KA0A 3DFCB 3MBLA 2QOHA 5I0BA 3ZC6A 2XEZA 2ETRA 2JITA 2W05A 4ZY4A 2OICA 4XG3A 3PP1A 2XVDA 4G2FA 5AM7A 4IZYA 5GJDA 4JQ8A 3W2CA 3BYSA 3NVKI 2WTKB 4RFZA 2V5QA 3GC0A 4YBKA 2FB8A 3COHA 3UJGA 5CEKA 4BKZA 2C5XA 2I0VA 4PMSA 1SNXA 4YJUA 1RDQE 4GKHA 3MH0A 3E8EA 3CXWA 4BTFA 4BCMA 3NYVA 2QODA 3HKOA 4YO4A 1V1KA 4YJNA 5D9HA 1KV2A 4AFJA 4AFEA 3BGZA 3HVCA 2XKFA 5B2MA 5LVOA 3ET7A 5M4IA 1VR2A 5AWMA 4EJNA 1GZ8A 5ICPA 2OLCA 2VX1A 4OTWA 4F1MA 1PXLA 4W4XA 5JQ8A 5AUTA 4CMTA 3H30A 2XEYA 4BDDA 4MXAA 4AA4A 5D41A 4CFMA 2X8EA 3KFAA 3ORMA 3TKHA 3S0OA 4QPAA 1URCA 3OXZA 3BYVA 3QUEA 3II5A 4B7TA 4C37A 1PYXA 4F4PA 1NW1A 1JNKA 4RIYB 3B2TA 3PPJA 3UVPA 4XV3A 3NIEA 1CM8A 4N4SA 5H8GA 1OKWA 3SXSA 2JBOA 4Y5HA 4FSQA 3FWQA 4RLKA 4C57A 4TKSA 4PL5A 5C03A 2XKEA 5FD2A 3BU6A 4R6VA 2OH4A 2QU5A 1ATPE 4RIWB 5DBXA 3QTQA 3TZ8A 4ALVA 4M0YA 5T3QA 1MUOA 4KKEA 3SOCA 4O0RA 5EW9A 4G34A 5A14A 3ITZA 3F5XA 3PWDA 4IX5A 1KE5A 2E9NA 2FUMA 3EQPA 3U54A 4IC7A 3ORLA 4P5ZA 5EOLA 5EYKA 2HY81 2FSMX 3WOWA 4E6CA 4NTSA 2UW0A 4BZNA 3EB0A 2PMOX 3R7UA 3L9NA 5CAPA 3PVWA 4QTEA 1B39A 3O71A 4FEUA 1GZOA 5K0KA 3D9VA 4EYMA 5M53A 1ZOEA 3SW7A 3LFFA 4KWPA 3U87A 2R5TA 4C4IA 2NO3A 3MPMA 1XO2B 3QQHA 4BF2A 4R8QA 4EC8A 5F1ZA 2PUPA 1QPCA 4JR3A 4MHAA 2JDTA 2VTTA 3F2NA 1PY5A 3QC9A 2HENA 5IA5A 4C8BA 4UEUA 1Q61A 1U54B 3GFWA 1UWHA 3ZZEA 1PXIA 1FGIA 3BU5A 3LFDA 2WQMA 4WBBB 3ALNA 4X2NA 5CASA 3ORPA 4HGTA 4UMUA 2R3RA 3EKNA 4FKVA 3AOXA 4PP7A 2HZ4A 2HW6A 3ORXA 4KS8A 3H9FA 5JGDA 4R77A 2BVAA 2XK4A 4TYGA 4ASEA 1WVXA 3D7ZA 2VTNA 4FSNA 4JJRA 2R3GA 3UIUA 4D2SA 4DFZE 4DH1A 3U6IA 4D1XA 3CJGA 3PG1A 4W9WA 3QFVA 4S31A 1Q5KA 5AJQA 5FTGA 2PUNA 2VNWA 1MRVA 3LIJA 2FSOX 2RFDA 3QRUA 2BROA 4JDJA 4HGLA 2JDRA 5CU3A 4IX3A 4MK0A 5HNBA 5IA1A 2BILB 4QT1A 3VBYA 2C5NA 1CKPA 1OM1A 1WBOA 4LM5A 3ELJA 2JIUA 3FMJA 4PPAA 4RMZA 4ZTRA 4FVPA 2PVMA 3COIA 4BCHA 4YNEA 3MFUA 5HD4A 5KX8A 3L8PA 2WMXA 4IAIA 3KKVA 2W1DA 5CS6A 2W9ZB 3BELA 5IA4A 5CU4A 3DK3A 2B54A 4O7NA 1BI7A 2VTOA 2R0UA 2A4LA 3PXKA 4DG2E 3OWLA 4RWJA 5HIDA 2WGJA 5CTPA 5ETFA 5GZAA 3QTXA 5BVFA 4XG2A 4CLJA 2VTHA 1YXTA 3QQUA 3Q5IA 4DEGA 5CEPA 3RK9A 2GPHA 4CRLA 3Q9XA 4FV1A 4OBQA 4OTQA 5HE1A 3UIMA 3BWJA 1QPJA 3O7LD 3ZSHA 2XK7A 3KU2A 4U9AA 3ZHPC 1YOLA 3C4XA 5M08A 2XNEA 5EFQA 4TYEA 4UMRA 3PTGA 2CSNA 4F7JA 2OZAB 2YIQA 1JSUA 3C51A 4IB5A 4ZZMA 3RI1A 3RM7A 5CALA 4FEWA 5E8YA 4PDYA 4YZMA 4FSMA 5F4NA 3TI1A 3TG1A 3BGPA 5M4UA 4D4VA 5CX9A 5B2KA 2C6KA 3C0GA 1OIRA 3FXWA 1B6CB 4GYGA 4KRDA 3LQ3A 5JEBA 5CNNA 2Z2WA 3ZSGA 3VULA 3FSFA 2VGOA 4BFMA 3UIXA 5K5NA 2R3IA 2IVTA 5HD7A 2RIOA 4FGBA 4H1JA 4G5PA 4MD9E 5A46A 3KULB 4A4XA 2WQNA 3U8WA 4FKIA 2R3HA 3ATTA 3AXWA 4TPTA 5HG5A 2WQBA 4FC0A 5FDXA 4U0IA 4BI2A 4EOIA 3VWAA 4Z16A 4FX3A 4G1WA 2UW7A 1L8TA 4HGSA 4BCFA 5FG8A 2C5VA 4QPSA 4MBIA 4BIBA 4BYIA 4EUUA 4PQNA 4F65A 3SKCA 4CVAA 4C3PA 5DT3A 2ZMCA 2VWWA 5E8TA 4QP1A 5KKRB 3MH1A 4IEBA 4YTFA 4M8TA 1H8FA 2ITVA 4D55A 5L2IA 3E3BX 3PG3A 3Q4TA 1UWJA 2CKPA 2WTJA 5CLPA 2QHNA 3O50A 4ZIMA 3ZUUA 4EH4A 3R73A 3OBGA 5FBOA 3ULIA 3V01A 1JKLA 3KMMA 3E92A 2YACA 4L46A 4A9UA 2Z8CA 2WTKC 1NVQA 4FNZA 4TN6A 3PSDA 4GUEA 4RWKA 1PW2A 3IW6A 3D2KA 2WO6A 3QGWA 4EOKA 2HIWA 4QMTA 4E73A 2ITXA 5M4FA 2ONLC 2PPQA 3DK6A 3R83A 5CZHA 1PXOA 3F61A 3AQVA 3QCQA 5LARA 1XKKA 3R21A 4E5AX 2QKRA 3DDQA 4JG7A 4BZOA 4CMUA 4ZZNA 4D5KA 4E6DA 5L8LA 5B2LA 4RLLA 2UZVA 1WVWA 4LRJA 4WSQA 5T68A 3V8SA 1ZRZA 2E9UA 4AG8A 2G2IA 3G51A 3TJCA 5LMKC 1GIHA 3HV7A 5ANIA 2JEDA 3ZBFA 3TWJA 2JAMA 2ZM1A 5AR2A 3OW4A 4F0FA 3OVVA 2G2FA 3NVMB 4ASXA 2IW8A 1PYEA 2AUHA 1H1SA 3BI6A 1OPJA 5JH6A 4C7TA 2Q83A 4V0GA 3KCFA 4C3FA 3M42A 3W2RA 3G9LX 4MEDA 3ZLSA 5I3RA 3DJ5A 4G6OA 4FNYA 3WYXA 5M51A 3VBTA 3PRFA 4UWYA 1BLXA 1QL6A 3NUAA 2WTCA 3MVHA 3RCJA 5DNRA 3WF6A 4ZK5A 3NMUF 5BX0A 4FBXA 2HK5A 3A7FA 3SC1A 4AZWA 2WHBA 3HNGA 4PWNA 3LXKA 3V6RA 2PZRA 1BKXA 3R0TA 1LR4A 2WAJA 4IAFA 4QMZA 4DBNA 1UKHA 4S32A 4RX7A 1H27A 4RX9A 3PA4A 1WBVA 3LCKA 3KN5A 2C3JA 2VN9A 4QMXA 1GAGA 5FUTA 5C27A 1XWSA 4EKLA 5LVPA 2VTPA 4FTCA 2CJMA 3O23A 2YJSA 4CLIA 4TT7A 1PXKA 1OI9A 4H58A 4X2KA 1J7LA 3AC2A 1YDRE 5E9EA 4IX4A 4FA2A 3AG9A 2EWAA 5HCYA 3ZXTA 3DV3A 3NYXA 4QYHA 4BCOA 3Q9ZA 5IH5A 5B7VA 4YSJA 3WF8A 1BX6A 5F94A 4GS6A 5HNIX 4FEQA 2FSLX 4BCKA 1BL7A 3DAEA 1JAMA 2QR8A 2X81A 2YDIA 3R1NA 4WG5A 4O7ZA 5K9IA 4ENXA 3WZJA 2JLDA 3NAYA 4JG8A 4NJ3A 1WBWA 5AP2A 4BGGA 4Z7GA 2JIVA 2W99B 3CBLA 3EIDA 3EQFA 2Y4IB 3LCDA 3LE6A 2EU9A 3BHTA 3HMMA 3PA5A 4IADA 4O6EA 4DFYA 5BVOA 5LVMA 1UU8A 1BUHA 3BE9A 4HOKA 1WBTA 4APPA 4QQCA 3DXNA 2XK9A 4EH3A 4NYEA 2PVKA 3KB7A 4GT3A 3TNIA 2PVHA 5LCJA 3D7TA 4DC2A 2C30A 4OBPA 1FMOE 5HKMA 3DNDA 2YFXA 3EQIA 4EOSA 4X2GA 3G33A 4QYYA 2RG6A 5K5XA 4XG7A 3P1AA 3CLYA 4IFCA 5HESA 4IB3A 4A4LA 3VF8A 4B9DA 1U59A 3QD3A 5GJGA 4L7SA 5FRIA 1XJDA 3IDBA 2OZOA 5EHYA 4PMMA 3WIGA 4NCTC 4NU1A 4DEHA 4L8MA 2B0QA 3FDNA 3V5PA 1O6KA 4HVIA 3HRFA 2WNTA 2ZJWA 4CFUA 4D0XA 1YXSA 2QLUA 3QRKA 4JL9A 3SHEA 4R1YA 3EFLA 3LFQA 1Z5MA 3Q9WA 2H34A 3R6XA 1Y8YA 4FMQA 2YN8A 5I9UA 2G15A 4D0WA 4CEGA 5IEYA 4GT5A 3DDPA 3JY0A 3GU6A 3NUPA 4FTOA 4GFMA 4RC4A 5HBHA 2R3QA 4AZEA 3PY0A 2J5EA 2C47A 3BYOA 2RG5A 3L9MA 4BDAA 2R0IA 4MYGA 4C58A 4ORKA 2JKQA 4N70A 3VUHA 4BDJA 2CGUA 4GK3A 5EQPA 3E8DA 1MP8A 4IVDA 4NW6A 3MIYA 4S2ZA 4MNEA 5BMSA 4AA5A 4D4SA 5E92A 5DEWA 4JNWA 4B8MA 4EOMA 4O7TA 3VBQA 3D2IA 4FSYA 4PY1A 5JQ5A 2I0YA 5L6OA 2ITNA 3RCDA 1LUFA 1PRYA 5HGIA 3L1SA 2WOTA 2OFUA 3ATSA 4FKTA 4BCIA 2IVUA 2NPQA 3KXMA 3QD2B 3FE3A 4IVBA 3I7CA 4O0SA 3WF5A 1OL2A 3SW4A 1GOLA 1UU3A 2GCDA 4IW0A 4LMUA 2BPMA 2DQ7X 2XCHA 4ZLOA 3QZFA 4NM3A 4FTLA 4KD1A 2VNYA 3HA6A 2BIKB 5AIKA 3QC4A 4AGDA 5D11A 4AT3A 5IQFA 3LMHA 3CKWA 4I92A 2C5OA 5DE2A 4BRXA 4FV8A 2KTYA 5KKRC 3TDVA 2ITWA 3BYUA 4MAOA 2YM4A 2XNNA 1OKYA 1OIQA 3P4KA 3FZOA 3M1SA 4FL2A 4MKCA 2F7XE 1XBAA 1AQ1A 5K4JA 4FYNA 1P5EA 4GU9A 4OTRA 2QOBA 4ZTMA 5DRDA 3GXLA 3A4OX 3GCUA 4FL1A 2Z60A 5DH3A 5HIEA 3DS6A 2Y0AA 4G3DA 4H39A 2RGPA 4QMYA 4ZXTA 4F9CA 4ANOA 3SOAA 3UQGA 3G9NA 2CKQA 3NUNA 2YERA 4LL5A 2NRUA 5HCZA 4GUBA 4EL9A 2YWPA 4KKGA 3PZEA 3E8NA 5HNGA 3P0MA 4LGHA 4ZAUA 1XQZA 2XMYA 5KE0A 3E87A 3VBXA 3SRVB 3GT8A 4GIHA 3SVVA 5FGKA 4D4YA 2H8HA 4IB0A 3BQRA 3UBDA 4XLVA 3FC2A 3QUDA 3KVXA 4XV2A 4GFGA 5DVRA 3W1FA 4CG8A 4IZ5A 1NVSA 3R28A 4OBOA 4ACDA 2ZVAA 4Y85A 1ZAOA 1YOMA 3OTUA 4FKJA 1GIJA 2I0EA 3THBA 3QTZA 3ULZA 5CAOA 4MNFA 5DPVA 4DYMA 1ZXEA 2VZ6A 3NYOA 4F9YA 3TV4A 3OD6X 3FI2A 3FMDA 4UXQA 4BWXA 5C1QB 2BAKA 3ERKA 5L8JA 3CCNA 4RX5A 2VRXA 3NCGA 4FIHA 5JFXA 4HYHA 4DN5A 4WT6A 3R7IA 1B38A 2HYYA 4G3EA 4DH7A 5IUHA 3CQWA 3ALOA 4O81A 5CZIA 3FKOA 3SD0A 3P23A 5AR3A 4IAYA 5BVDA 4G6LA 5CVFA 4FVRA 4FYOA 1KE8A 4PDPA 4M15A 1JKTA 4ZS4A 2QKWB 3PFQA 4EOPA 3ZM4A 3UP7A 4YTCA 4H3PA 2WZJA 4JIAA 3MYGA 4HYSA 4LOQA 5CT0A 4AUAA 4DEIA 5M56A 3RMFA 5LQFA 1UNGA 3RPRA 4CV8A 2QO2A 3PZHA 4W4WA 4HPTE 5EDQA 4UN0C 4I0RA 4C2VA 2J50A 2PVNA 1U5QA 1O6LA 4FK3A 4LGGA 3TZ7A 3UVRA 4C62A 4O1OA 4V04A 3U55A 5KZIA 2F49A 2ZV9A 2RFEA 4ARKA 2GU8A 3OXTA 1ZMVA 2UV2A 2PVYA 5DIAA 4O7RA 4C4EA 5CQUA 3ZRLA 4QQ5A 5IA0A 4MXOA 3AT2A 3ZO4A 3R02A 4XOYA 4WD5A 4J97A 3E93A 3UC3A 2YM8A 3GGFA 5HVYA 3T8OA 1JVPP 2QLQA 2Z7SA 4HVSA 4M68A 5A9UA 3WZKA 3VS2A 3HV3A 4F0GA 2Y4IC 3LLTA 3ROYA 3COKA 3R00A 4U43A 1FQ1B 3DB8A 4PP9A 2P3GX 4QMOA 2OO8X 2I6LA 3DZOA 1QPDA 1FGKA 3BYMA 3GEQA 3P78A 5AV0A 5GIOE 5DOSA 4RIYA 2ITPA 4G31A 2YIWA 2XIRA 5ANGA 4BVUA 2Y9QA 4U6RA 3UG1A 4NIFA 2CGVA 3VHKA 4HYIA 5TKDA 3T3UA 2J2IB 4EQMA 5BVNA 2BTRA 2WELA 3LQ8A 3C9WA 4R7IA 4I0TA 4U3ZA 2YZLA 2QG7A 4RIWA 2VO0A 2X4ZA 5D7VA 4JBPA 3D0EA 2O3PA 4RIXA 3SLSA 4IBMA 1E1XA 4FKOA 4AOJA 1OL1A 3FMLA 3NRMA 4MXZA 3CTHA 4NW5A 5D12A 2GS6A 5EW8A 2HCKA 3QGYA 4IM3A 5CXHA 5BVEA 4L3JA 5EM5A 4QMVA 1KWPA 2HXLA 4WRSA 3CGFA 3GP0A 3HV6A 5EQEA 3Q96A 4I93A 1Q8UA 4FKRA 4PPBA 4RQVA 4JBOA 5I4NA 1WCCA 3Q9YA 4Y95A 3L8SA 4BY9E 3EOCA 2BTSA 2QG5A 4AZVA 2UVZA 5ETIA 4ACHA 2O0UA 2J0LA 2C4GA 4JX7A 2UVYA 4E93A 4BI1A 3OW3A 4FE2A 2R3MA 3KGAA 5DFPA 3MESA 2OJ9A 4CFXA 3WZEA 3IO7A 5KMJA 1PF8A 2XNMA 4CFNA 4G3GA 3ID6C 3D14A 4F08A 4AW1A 5ITAA 3QU0A 5FWKK 4XRJA 2YAKA 3D15A 1PMNA 4FZAB 2ITQA 2CNQA 3DBQA 3I0QA 1R3CA 4LQMA 3WILA 3QWJA 4F6WA 3G0EA 5G6VA 3EJ1A 4E4MA 3BV2A 2VX3A 4IM2A 4BKYA 2A27A 2IG7A 3QF9A 4EQCA 2V7AA 2O2UA 4DEAA 3F9NA 3LJ2A 2GFSA 2X0GA 3NUXA 4AW2A 3LFBA 3PXQA 4KBCA 3GVUA 4YLKA 2B9IA 3FL5A 3TKUA 5AV4A 2GMXA 2VTJA 5I9YA 3A8WA 4HJOA 2PZIA 3IW5A 3FUPA 4YHFA 3R1YA 5AA9A 3MFTA 3KF4A 2CN8A 4M84A 1ZY4A 2ETKA 3I6WA 4K0YA 2VTQA 4M3QA 4I94A 1OKZA 3VO3A 2W9FB 4K77A 3DKCA 5AV3A 3RAIA 5IQAA 4PF4A 1M7QA 1IR3A 4NCTA 2ETMA 4NTTA 2XYUA 5DT0A 3NZ0A 4PRJA 4MX9A 2HZ0A 1XH4A 2WU6A 3LAUA 3OF0A 2YCFA 3EFJA 3FLQA 4QTCA 4XP2A 5TE0A 3TL8A 3WI6A 5FEDA 5EHOA 2PE1A 5AEPA 3UO5A 2BRHA 2ZAZA 3OWPA 1H24A 2VTLA 4JBQA 4U40A 1MRYA 5KMMA 4IZAA 5IQEA 3FKLA 3QCYA 4ZTHA 2DWBA 5IUGA 4O0UA 2Q0NA 4HVGA 4ZP5A 4NKAA 1ZOHA 3HAVA 4EORA 3L8XA 4QP4A 1GNGA 4GEOA 4FOCA 4USEA 4U45A 4O83A 2I7QA 2ACXA 3C13A 4IACA 3ZMMA 4BGHA 4EOOA 3UOJA 2GQGA 2BCJA 3R2BA 4EYJA 4TL0A 2RFNA 3LLAA 2X2KA 5KBQA 3PWYA 4K2RA 3ZH8A 3E64A 3HLLA 4XLIA 4PTGA 5M55A 3RALA 2WFYA 5IEVA 4FTKA 4GL9A 4X6QC 4YC8A 2C0OA 4OLIA 2OXDA 4FTIA 3R7EA 1XH9A 4PMTA 4AZSA 4FV4A 3KULA 1PMUA 3FPMA 1XBBA 1J7UA 5HBEA 4GCJA 5DLSA 4BWKA 1FBNA 2YM3A 1WFCA 1XH7A 4QMPA 3PUPA 3R8UA 4CMOA 3AT3A 4H3BA 3TXOA 1BI8A 2XCKA 4IWPA 5HE2A 3QUPA 1JPAA 3D5UA 4EWHA 4BCJA 2WQEA 3AMBA 4FKQA 4OR5A 3RWPA 4Q2AA 3UOHA 4E7WA 4BYJA 3R7OA 3CY3A 5HVJA 5L4QA 4ONAA 3TM0A 4WSYA 2XB7A 4ID7A 5DEYA 4XG6A 3ZC5A 2YZAA 2GS7A 4R5SA 4UMTA 3TIYA 5A54A 3R9RA 4ZSAA 4C34A 5IH6A 1ZZLA 3OCGA 3ZEPA 4WNMA 3S3IA 1YXXA 4UB7A 4G5JA 3HRCA 4U8ZA 2W06A 2W0JA 2PYWA 1J1BA 2WB8A 5AA8A 2J9MA 3MPAA 4EH7A 2QOOA 2UZWE 3RPVA 2FH9A 3NYNA 5C01A 4EH2A 1H26A 5CY3A 4H3QA 4KSQA 3O8UA 3KCKA 4FTNA 3NUYA 4XJ0A 5CENA 3P79A 3MWUA 3E62A 4TZRA 1XH5A 3WZUA 4CZUA 1R1WA 1V0OA 3Q6UA 5AUXA 2G01A 4OTIA 2YM6A 3WE8A 3W2PA 5JK3A 3PVGA 2FSTX 2R3JA 4WBOA 4CFFA 3AC5A 4E1ZA 2PY3A 2FYSA 4D2VA 4A9TA 1W0XC 5CF5A 3LCTA 4KIKB 3RWQA 2C5YA 4P90A 4WA9A 5HBJA 2G9XA 3R1QA 3T3VA 5G1XA 5AR8A 4G3CA 3UOLA 3P9JA 2XNOA 5L2QA 3RP9A 4PV0A 4A9SA 3SX9A 2IPXA 4FVQA 2JDOA 5KMLA 4A9RA 4EK8A 4R3CA 4BIDA 1K9AA 5K4IA 3KF7A 5J5TA 3U6HA 3VW6A 3HAMA 1J91A 2X7OA 4PX6A 4C2WA 4I24A 1QMZA 4EWQA 4YUQA 2PZPA 5F9EA 3REPA 2SRCA 3UC4A 4HZRA 3OUKA 3KMUA 3V6SA 1PMEA 4PNKA 2W5AA 4AGCA 4K33A 4NSTA 1Y6BA 4BHZA 4KUJA 3PXRA 4GRBA 1MQBA 2G2HA 4YSMA 2YEXA 3DFAA 4RJ8A 3IONA 5BYZA 4HGEA 5JZJA 3BV3A 1SYKA 5ACBC 3VUTA 5M57A 3LVPA 3B8QA 3NR9A 2BUJA 1NA7A 2QOFA 2HW7A 2YCSA 4I23A 4ZY6A 2YISA 4TTHB 4G17A 3R7VA 2NNWB 4GT4A 4Y8DA 3QL8A 1YHVA 3FJQE 4OAVB 3AC3A 2CKOA 5JGAA 2BRMA 4X0MA 1UV5A 3IGOA 3QTUA 5KMOA 1YI6A 3F3ZA 5JT2A 2JBPA 4CXAA 5HZNA 3OP5A 1H07A 1ZYJA 4DAWA 3TV6A 2C6OA 3V8TA 4BWPA 3QRTA 4O0YA 4FT3A 4G3FA 2XNBA 3ORTA 1W98A 3GOPA 5JFWA 3PDTA 1Q8YA 3MDYA 3Q6WA 3QD4A 4KBKA 4CKIA 4F9AA 1EH4A 3FQHA 3FI3A 2V55A 4DFXE 1VEBA 4IM0A 3QCSA 4ACMA 3QXOA 4FTTA 4EHZA 3R8LA 3IKAA 4ITHA 4BDEA 4BICA 5IUIA 3BZ3A 4RGJA 4YPSA 3FAAA 4UWCA 4WNPA 5EH0A 3I0OA 5C8MA 3FPQA 2G1TA 4I5MA 2IVSA 2Y6MA 4NEUA 5CSXA 1ND4A 3I5ZA 3EMGA 1Q97A 3VVHA 3GC7A 2VO6A 2OU7A 1OL5A 3NW6A 3GCQA 3HEGA 1TKIA 3NNUA 2QOIA 4L3PA 3DBEA 4XCUA 5FXSA 5M44A 2UZEA 1P4FA 4JDHA 4OTHA 4MVFA 5J95A 3KEXA 2H6DA 2OJIA 4AXAA 3LXPA 4FIGA 4IWQA 3V5JA 5KHXA 3UYSA 4XEYA 5HCXA 3S95A 5E8UA 2YHVA 2CGWA 3C0IA 4B4LA 3C4WA 4UZHA 5AAEA 3OHTA 4AN9A 5I9ZA 3GU8A 2VO7A 3DAKA 3PA3A 2QOKA 4NWMA 2P4IA 5AUWA 2XUUA 3CC6A 4AP7A 5AP7A 2XNGA 5KNJA 4O7YA 4ERWA 3L9PA 4D2WA 1GZNA 5ANEA 4RJ4A 3COMA 4QYGA 1RW8A 3BHUA 3IPHA 4AN2A 4O7WA 3H3CA 2VTRA 3G5DA 1Y6AA 4L67A 5HG9A 4ASZA 2X7FA 4FOBA 2QONA 4DTKA 4PUZA 1W8CA 3DJ7A 4XP3A 1H1PA 4GU6A 2YWVA 3FZTA 4YBJA 4GMYA 5BVKA 4D1ZA 3ZDUA 2FO0A 3EWHA 4L3LA 4IANA 3QA8A 3LFNA 5I9XA 5EOBA 4WUNA 5FXQA 4C33A 2X6DA 2OH0E 3UYTA 4GIIA 2W4OA 3MV5A 5ANOA 2CNVA 4L44A 4E20A 2UW9A 4FZ6A 4JAIA 2W1CA 2PU8A 3L9LA 3FI8A 4IWDA 3CSVA 3LOKA 4N6ZA 4WUAA 3TNPC 3IQ7A 5IQDA 3IECA 4DGLC 2YABA 2JD5A 4DG3E 4DH8A 5IZFA 2BHEA 3MTFA 3UE4A 3VS7A 4D28A 2YM7A 1FVRA 4DEDA 1JKSA 4S34A 2XJ0A 2IJMA 3F5UA 4XHKB 5HLNA 5L6WL 4FTRA 5LMBA 3HA8A 4KBAA 2R3PA 3AMAA 2GHGA 3HRBA 4FKPA 4MWIA 2C69A 3DCVA 4A4OA 3LMIA 4BTJA 4QMSA 4IMYA 4APCA 1ZMUA 3PVUA 2F7EE 5EM8A 3DJ6A 3Q3BA 1FINA 1LPUA 4FG7A 2ERKA 3OTVA 1JOWB 1P4OA 3BQCA 4L42A 3AGMA 4IDTA 4YZCA 4IDVA 5DYJA 4WG4A 4XV9A 3BCEA 4IJPA 4KINA 3N9XA 4FV3A 4P7EA 4EI4A 1YRPA 4QP7A 4EK6A 2XIZA 3HP2A 5HLWA 2YCQA 2A1AB 3ZS5A 4WKQA 3GC9A 4YZBA 2I1MA 4FKGA 4BBMA 4Y5QA 3DLSA 4K11A 2UZNA 4JQEA 2ITOA 3CPCA 4FTQA 3QTWA 4AN3A 2Z7RA 4BGQA 2BALA 4EHGA 5D1JA 3G0FA 1NT2A 5JGBA 4K9YA 4WNOA 4C4HA 4K18A 5EHLA 2JAVA 1VZOA 3RAKA 3OCSA 3TUDA 1XH8A 2WMVA 3BWFA 2PVJA 2UW5A 3RK7A 3JXWA 5E4HA 3VJNA 3SG9A 1ZWSA 1DS5A 4M97A 5BVWA 2VTIA 4HW7A 4F09A 4J53A 5HX6A 1IA9A 2QQ7A 3WZDA 4IAAA 1YI3A 4IE9A 5DRBA 3FHIA 2W1ZA 3R1SA 4TWOA 1S9JA 2XRUA 3JR1A 2V22A 3CJFA 3DKOA 3DGKA 4HNIA 2C3LA 4CD0A 4F1OA 3C50A 3H9RA 4AE9A 4C4FA 5E8SA 4CZYB 3F3TA 3U4WA 5JZNA 1KUTA 3VQHA 2CCIA 3W33A 4GYIA 2C6EA 4AOIA 2CHLA 2ZDTA 3FL4A 4RBLA 5CYIA 1OPLA 2VUWA 4DGMA 4P2KA 3CP9A 5LMAA 5F95A 3KRJA 4BL1A 4DEEA 5K0XA 3OWKA 2CPKE 4O7VA 5CXZA 4LFIA 2PMNX 4J99A 5DR9A 4DGNA 2CKEA 4I5HA 5FXRA 4H36A 3TNWA 2PVRA 3EL7A 5A4LA 1OGUA 4YTHA 2V0DA 4QRCA 3HX4A 1LEWA 4W8EA 5CF8A 4KKHA 4R5YA 4TYHB 5M06A 4XYFA 4E5WA 2NP8A 3PPKA 5J5SA 1R0EA 5ANDA 4I1ZA 3DXQA 4F7LA 3QYWA 4YJSA 4K8AA 4YP8A 2FGIA 3PXFA 5A4TA 2XYNA 2C1AA 4LOOA 4XRLA 4FV2A 3G90X 1Q8ZA 5CEIA 4F9BA 4RRVA 1WAKA 3LFAA 4M7IA 4HVDA 1V0PA 4ZZOA 5E8VA 5KMKA 3QQFA 2R3OA 3O51A 2GNIA 2YLFA 1YKRA 5LJJA 4TNBA 3GI3A 1PXNA 1DM2A 4FICA 4FT0A 2F4JA 5EM6A 5FTQA 5AP0A 3UIBA 2C6LA 3QYZA 5A3XA 1OZ1A 3RPYA 2GQSA 3WIKA 4G16A 4YURA 3ENMA 3HUBA 3PP0A 4ZS0A 4D9UA 2XM8A 4LUDA 5DN3A 1A48A 3M2WA 3FLZA 1H0VA 4J71A 4L43A 4RQKA 2VV9A 4QMLA 3LCOA 5LWNA 2PE0A 3BKBA 3F2AA 2EXCX 3I5NA 4FV7A 2RL5A 3PIYA 3VQUA 4CKJA 4YJPA 3A7JA 3VHEA 3BHVA 3EQHA 1O9UA 3ACJA 3PE1A 2XH5A 4MQ1A 3N4UA 5AM6A 2X6EA 3ETAA 5EYDA 5AUZA 2R4BA 3U51A 1UKIA 1YWNA 3DK7A 3DZQA 4YZNA 3KRRA 5IA2A 5CSPA 2QURA 3TZMA 3N4VA 3LW0A 3A7IA 2BAQA 4O96A 4UV0A 2O5KA 2WMAA 1UVRA 3R9DA 4FI1A 3FMHA 4NT4A 4P4CA 2C3IB 5TO8A 3NDMA 3ZYAA 3QTRA 3EQBA 2OWBA 4ERKA 1UNLA 4LGDA 3BPRA 4DG0E 4ALWA 3CPBA 2XIXA 3MY0A 4IZ7A 4C3RA 3MTLA 4Q5HA 3F6XA 5HG7A 3RTPA 3EN5A 2HWPA 3TACA 3VJOA 2OF2A 3EZVA 3TDWA 5AAGA 4FZ7A 2YIYA 1M7NA 1YHWA 4GG7A 1Q99A 4YC6A 5AUYA 1GIIA 3W2OA 4W9XA 5FEQA 3NIZA 4L9IA 1FPUA 2W17A 2PUUA 3W32A 3UP2A 5C8NA 2JKMA 5CU2A 2GNLA 5BYLA 5A6OA 4A9YA 2WOUA 5JMSA 4IHPA 3Q4UA 3K2LA 2A2AA 5J1VA 1Y91A 4XH6A 2XBJA 3NW5A 3VS5A 3N51A 5J87A 3RAHA 4MF0A 3G2FA 3ZRKA 3TTIA 3K3JA 2R3KA 2XJ2A 2GDOA 4FK6A 3VIDA 4RX8A 2GSFA 4FV9A 4MWHA 4O82A 3ZTXA 4KRCA 4YLJA 3FI4A 3IDPA 4JQ7A 3C4ZA 4JOAA 4LI5A 4FSUA 4FV5A 2R9SA 3FMNA 1IASA 2W1IA 5GZ9A 4DFLA 3UG2A 4RJ5A 2BZIB 3HMNA 3OEZA 1MQ4A 4MD8E 2WQOA 4OT6A 3QTIA 4IWOA 3C5UA 4X7QA 3W18A 4FIIA 2OG8A 5HQ0A 1H00A 1RJBA 3TUBA 2EUFB 4AE6A 2F57A 4MD7E 3UMXA 1HCLA 4QMNA 4E3CA 4EUTA 4M14A 3OMVA 3BLQA 4CYJA 2BAJA 1H28A 1VJYA 5J79A 2XIYA 5L8KA 2VAGA 4YLLA 1Z9XA 3RAWA 4YC3A 3R22A 5TOZA 4V0GB 2HWOA 2O65A 1JKKA 3C4FA 3DA6A 4RG0A 2UVXA 4GG5A 5HO8A 4ZJJA 2NRYA 1IRKA 4JX3A 1QCFA 3ZFXA 2GNFA 4E5BA 4GV1A 4JG6A 5IISA 1OITA 4U3YA 2O8YA 4WG3A 4F1TA 4CSVA 1ZOGA 2GNHA 5A4CA 4AT5A 1VYWA 3C7QA 2QOLA 3EKKA 4UYNA 5IKWA 1WBNA 3ZM9A 1IG1A 1FOTA 3WBLA 3PY1A 4IB1A 2VWUA 4C02A 2ONLA 3NNVA 5AAFA 2GHMA 3VNTA 5HE0A 2H9VA 4IQ6A 3A8XA 5L2WA 3P7AA 1F0QA 3ZUVA 3TZ9A 4UMQA 4CTCA 2YM5A 2QHMA 3LM0A 5E91A 3UO4A 3GCPA 5L6PA 4UMPA 4GW8A 2UZUE 3HDNA 4IAKA 2E9OA 4J7BA 4V01A 3F82A 2Z7QA 1IAJA 2J6MA 1OIUA 4JXFA 3LPBA 5BQ0A 5LMKA 2WMRA 5IQCA 4IFGA 3RM6A 3RKBA 1G3NA 4YJOA 2VTAA 5BYYA 3LFCA 4FKSA 3EH9A 4UY9A 4JDKA 3MN3A 4AT4A 3UZPA 4FNWA 2ZM3A 2ITTA 4GFOA 4EKKA 5IG1A 3FZPA 3PJ2A 1Y57A 4G9RA 3MH2A 1KV1A 5KZ0A 5IQBA 5DWRA 4YMJA 2UUEA 5LOHA 2XK8A 2GQRA 4EK4A 3EQGA 3D7TB 4U79A 3NCZA 1LEZA 2FVDA 1XH6A 1YI4A 3MGYA 5HTBA 1W84A 4KIKA 4AZFA 4BDGA 3LCSA 3ZUTA 3ZO1A 3BEGA 4NFMA 4GSBA 4Y83A 3EZRA 1HOWA 3VS0A 1ERKA 1H4LA 1J7IA 2KULA 4KB8A 4HPUE 3LMGA 1Q8TA 4XS2A 2RF9A 4M69B 4TWNA 4EOLA 3KXXA 3K5UA 3IOKA 5C8KA 2EB2A 5CT7A 4CNHA 5CI6A 2JDSA 3V51A 4WHZA 4RJ7A 1OBGA 3W16A 2RFSA 3DPKA 1S9IA 4N6YA 5FEEA 3CKXA 2QD9A 1LP4A 3F3VA 4EOQA 1DI9A 3FYKX 4KABA 4EQUA 2PULA 4UZDA 2GTNA 1U54A 3EN9A 4FT5A 3TTJA 3C0HA 4TRLA 3V5LA 4FSZA 3QQGA 2BRNA 5AADA 4USDA 3O7LB 1JBPE 4ZSJA 5A6NA 3KXNA 3HV5A 3DT1A 2CCHA 3POZA 4Y73A 3HZTA 4X2FA 4YGAA 3AD4A 3IOPA 2ERZE 2OIBA 3DOGA 4LV8A 3RK5A 3ZBXA 4E8AA 3GQIA 4QQJA 3VBVA 1OECA 5IH4A 5JKGA 3UNZA 5BUJA 1R39A 3P7CA 4RZVA 2B4SB 3V5WA 4MNEB 1STCE 4CV9A 3PLAE 3M11A 4P5QA 3KRXA 4FG9A 3CS9A 3K54A 2W4JA 2HAKA 2QCSA 4KIPA 4ZTQA 4ACCA 3TEIA 3DBCA 4K1BA 2E2BA 2C68A 3CY2A 2B9FA 4WIHA 2BDJA 3TV7A 2BRGA 4D2TA 5J7HA 1SZMA 3OFMA 1WMKA 1CMKE 3QALE 3I6UA 4JR7A 3D4QA 5CVHA 3B2WA 1M17A 1REKA 2PVFA 1YXUA 3KRWA 4LMNA 4ZTLA 2WTVA 2J0IA 4O0XA 2GS2A 1OB3A 2WEIA 3DTCA 2OIQA 4Q9SA 4XP0A 4E26A 3ZEWA 1G8SA 3KXHA 1JWHA 3IW4A 3IS5A 3PRIA 1YOJA 3OT3A 2W1HA 2P2HA 1ZZ2A 2XIKA 5EI6A 3EN6A 3C4EA 3QX2A 3AT4A 4NH1A 4X21A 2ZYBA 4HCUA 4I6FA 3Q5ZA 3QRIA 4FF8A 3KC3A 4TW9A 2A19B 5GJFA 3RHXA 3WF9A 1YHSA
chains in the Genus database with same CATH superfamily
2X4FA 2J0KA 3CR0A 3OOMA 4ZEGA 4AACA 4F0IA 3JYAA 3R7GA 4DDGA 2EB3A 3NX8A 2JFMA 4AA0A 1W2FA 1SVHA 2F9GA 4BCNA 2OZAA 4LRKA 4FRFA 3CGOA 4EZ7A 4XX9A 2YA9A 3VUGA 3NPCA 4ZMFA 3GFEA 3UVQA 1CSNA 3OY1A 1F3MC 4PPCA 3JY9A 5CU0A 3KQ7A 2CMWA 4O7LA 4BDHA 3ZO3A 2QR7A 5DMZA 3DU8A 3ZXZA 4F64A 4RWIA 4AAAA 5DI1A 3V04A 4X6RA 3FKNA 3S00A 4ZJVA 2HZNA 4QP2A 4HCVA 4MF1A 5E7RA 3UO6A 4C59A 5GZ8A 5HO7A 5HTIA 5EYCA 4DA5A 4BIEA 2OJGA 3MY1A 4KS7A 4MBJA 3MB7A 3O8PA 4EBWA 4NM7A 5BNJA 3QLGA 5IA3A 3FHRA 4U5JA 3LKMA 2X0OA 1I09A 4FODA 4NM5A 4FNXA 1E1VA 3I4BA 4YHJA 2Y7JA 3NW7A 3U4UA 5BV3A 3C1XA 2UW8A 2X9FA 5JSMA 2WMSA 3PJ8A 4M67A 5EM7A 3VF9A 1PHKA 3UDBA 1U5RA 3LM5A 3LHJA 4EK3A 3RZBA 4AGUA 4DTAA 4HZSA 5EKNA 3L8VA 3Q60A 5HO6A 2ZMDA 2PL0A 3FC1X 3QKMA 1PJKA 3CEKA 5BUIA 4BCGA 4DH3A 3O17A 2QU6A 4W4YA 4FIJA 4N0SA 4BB4A 2X7GA 3BBWA 3ZZWA 3QQJA 2OXXA 2B9JA 2J90A 3UMWA 1Q8WA 3Q2MA 5FLFA 2HOGA 4C36A 3FZ1A 4XUFA 3VRYA 4G6NA 3A99A 1OBDA 1IA8A 2XZSA 4CYIA 2B1PA 3BE2A 3OOGA 5H8BA 5FM2A 4TNDA 3CQUA 3R04A 2P2IA 2UW3A 5E1SA 4OTFA 5E8ZA 3PXYA 3VC4A 2R2PA 3A61A 2ZB0A 4BBFA 3ORZA 2AC3A 1JSVA 3GBZA 2XRWA 4O0VA 4USFA 3PSBA 3UDSA 4F6SA 3RVGA 5CEOA 3BBTB 3P7BA 5B0XA 2LGCA 3DNEA 2CN5A 4BN1A 4FSRA 4FTAA 3E88A 2BMCA 5CAVA 4OW8A 3U9NA 4I5CA 4D4RA 4B6LA 4BI0A 4B99A 4ZSEA 4RA4A 3OWJA 2OSCA 4AQCA 2PE2A 4JRVA 4EJ7A 1KE6A 2R7BA 2XK6A 4NIFB 2UZDA 2W5BA 3A7GA 2WTIA 4X3FB 1PKGA 2BKZA 3ZFYA 5IQHA 4U97A 4XG4A 3EYGA 3Q04A 2E9PA 4U42A 4XNEA 2F2CB 3O96A 4RIXB 5BUEA 3VS1A 3WE4A 3ZU7A 5ANJA 1A9UA 3KRLA 3PIZA 4IH8A 3AKLA 3GNIB 3O8TA 5DG5A 3ROCA 4BJJB 4W8DA 4BKJA 2CNUA 4FR4A 3TCPA 2W1EA 5CF6A 1SVGA 4RVLA 1YDSE 3AMYA 5CI7A 5L2SA 2Y8OA 3UQCA 4Q9ZA 3ORNA 2Y6OA 5AUVA 5HLPA 3MIAA 5J9LA 3CQEA 3NLBA 2R3LA 4K6ZA 2QOQA 4JVGA 2OF4A 4ENYA 5KUPA 5I9WA 4NL0A 3Q52A 1JQHA 2J51A 3H9OA 3OY3A 5EI2A 3S4QA 2B53A 5IDNA 1SNUA 3CE3A 4IVCA 2XBAA 4Z7HA 3H0ZA 3LXLA 5AMNA 3AC4A 3UTOA 3MI9A 5M09A 3OCTA 2IWIA 1VYZA 4BCPA 3LZBA 4AX8A 3QHWA 4J95A 4L7FA 4GJ3A 3T9IA 3BLHA 4TXCA 4RA5A 4XG9A 2AC5A 4AS0A 2IZUA 1XMMA 3O2MA 1OL7A 3DBDA 4O21A 1TFFA 4U80A 4YJQA 5I3OA 4EZ3A 3QZIA 2P0CA 4FEVA 3OBJA 3QQKA 1M2PA 5CAQA 5JRSA 4QMMA 5FM3A 4QTAA 2PZ5A 4F99A 2BHHA 3SA0A 3A60A 3IK3A 3WF7A 4AZTA 2W4KA 3A7HA 4I22A 2XM9A 3W0QA 4I5PA 4TYHA 4CZTA 3LQ5A 1CDKA 2WD1A 2VU3A 4IAZA 3U6JA 3UPZA 3R7YA 4EK5A 1JLUE 3BHHA 4II5A 3KXZA 3HL7A 4JT3A 2Z7LA 5EKOA 3FBVA 1TQIA 4JBVA 4MXCA 4PL3A 2PWLA 1VLRA 4XBUA 4TYJA 3IGGA 2WMUA 2R7IA 2Q0BA 4TWPA 4ZY5A 1E9HA 1WZYA 5HICA 4DHFA 4ACGA 4MTAA 5IF1A 5CVGA 2OI4X 4OGRA 4OTDA 3ZCLA 5TF9A 3LXNA 2Y4PA 3TJDA 3W2QA 2PTKA 3FMMA 5LXMA 3F3UA 3PJ1A 5TR6A 3FQSA 3GQLA 3PVBA 3ODZX 1R78A 5E8WA 4Z3VA 5CNOA 2XK3A 5KHWA 3JVRA 4KSPA 1G8KA 4F78A 1ZLTA 2UW4A 3ODYX 4PTCA 3R9NA 4BDCA 4FT9A 2JC6A 3TNQB 1H1RA 4YHTA 1W7HA 4QMWA 4BZDA 5HU9A 2QC6A 2YAAA 2PVLA 4QTBA 3FZRA 3OXIA 2YIRA 5C26A 4I6BA 2BZKB 4GJ2A 3UGCA 4F7SA 3IW7A 3VUDA 4R7BA 5HORA 2X2MA 2C6IA 3ZLWA 3SG8A 2VWYA 4IC8A 3FV8A 4RSSA 1OMWA 2ZV7A 4YJTA 4JIKA 2WU7A 3HGKA 2ZV8A 4GKIA 5AX9A 3F7ZA 3QZHA 4DINA 3KK8A 3BHYA 3DQWA 2VTSA 3ZFMA 1WVYA 3DB6A 4QMUA 1CTPE 4QQTA 4FV0A 3GU7A 2UZLA 3PPZA 3NS9A 1JSTA 1ZYDA 2YCRA 4O84A 3JUHA 3O0GA 4PL4A 3EN7A 1PXJA 3E3PA 5AV2A 2V7OA 2XKDA 3G6GA 2OFVA 3OEFX 3PSCA 4QOXA 4RT7A 3ZRMA 5IDPA 3P08A 3R8ZA 1YWRA 4RIOA 4I3ZA 4XMOA 4MBLA 5EDPA 2YIXA 3I1AA 1OL6A 3EQRA 3FY2A 2ZOQA 4KIOA 5J9ZA 1G5SA 4C4JA 1UU9A 4IVAA 3VUKA 4D9TA 4ASDA 3DTWA 4GVAA 5KO1A 2BRBA 3FLYA 2BFXA 4A06A 1W82A 4I4FA 3A2CA 3NUSA 3NUUA 1KSWA 4D5HA 3CTQA 3VAPA 4E4NA 5AV1A 5EI8A 2QNJA 3TKIA 3UODA 3EYHA 3ORIA 3MFSA 3BLRA 3AGLA 2OKRA 2OJJA 3QTSA 3F69A 3SAYA 5CQWA 1GY3A 4EOJA 4DFUA 1GJOA 5CSWA 4PMPA 2WXVA 4QO9A 5A4QA 2W7XA 2WMTA 3B8RA 3OZ6A 3KL8A 1BYGA 3F66A 3KMWA 4LOPA 4EBVA 2AEGA 5M07A 3ZO2A 3R63A 4B8LA 3QA0A 4GH2A 3HDMA 3NNXA 4E6AA 1NXKA 1TQPA 3SGCA 4CG9A 3ORKA 3SRVA 1ZYLA 3QKLA 1H08A 4MQ2A 5IPJA 1FVVA 1Q41A 2REIA 3HMIA 3QD0A 4DT9A 4WRGA 4MXYA 5KMNA 3FZSA 4DGOA 4J1RA 2VWVA 2P33A 3QBNA 4JRNA 3TN8A 4JDIA 4HVHA 5HE3A 4O86A 2VGPA 4ANSA 4CTBA 4ZOGA 4FGRA 4I20A 2BIYA 1L3RE 1HCKA 1CKIA 4OAUC 4FZFB 4RC3A 3QLFA 4J96A 4I6LA 4X2JA 4YZDA 5CSHA 5CU6A 2YITA 2WIPA 3ZSIA 3ZLXA 1YW2A 2BDWA 2W1GA 3MVJA 4JAJA 4C35A 1O6YA 4J8MA 5LCKA 2WEVA 3R9OA 5ETAA 3TYKA 1Q24A 5T6KA 4CT1A 4AQKA 2YDJA 4X3FC 3D5XA 5H2UA 3SQQA 4O0WA 1F5QA 4BR3A 4ANLA 1Z57A 2QI8A 2XAOA 4LRMA 4E4XA 2QO9A 3NAXA 3W8LA 4QP3A 4ITJA 3QRJA 3BRBA 1OUYA 2IZRA 2PMIA 4ANQA 5KMIA 1Q4LA 4Y72A 2X9EA 3R2YA 3V8WA 2IZSA 3EHAA 1PKDA 4EONA 4TYIA 1M2QA 1PXMA 5M4CA 1J1CA 3OS3A 2W1FA 4M0ZA 5AP6A 3RZFA 2X1NA 4L45A 4KAOA 4G9CA 4LV5A 5IU2A 5CAUA 3R9HA 1A06A 4UBAA 4QNAA 2XP2A 4CQGA 4CQEA 3KXGA 2BZJA 2ITUA 2J0JA 5AX3A 1WBSA 3E5AA 4C61A 4BDFA 2ZM4A 5CSVA 4CCBA 3MJ1A 2ZB1A 4U7ZA 3PUFC 3F88A 5AFVA 4L53A 5F20A 2XJ1A 1Q62A 3WARA 4QYEA 2PHKA 3C5IA 2OK1A 4BBEA 4DT8A 4AU8A 4L01A 4DITA 4FT7A 4BDIA 5DR2A 4AW0A 2GFCA 5ACKA 1UNHA 2ESMA 4DHZA 2WKMA 4TY1A 5GINE 4LL0A 4PNIA 4Y46A 5GIPE 3R8PA 1KOAA 1MRUA 4O27B 3VN9A 3BIZA 3CD3A 3G15A 2JIIA 2XNPA 3IW8A 3DBFA 2GTMA 4KNBA 3S1HA 4MH7A 4ZLZA 4M66A 1YVJA 3R01A 5HVKA 3UZRA 3H0YA 4KA3A 1FVTA 2VO3A 4RVMA 4ZSLA 4V05A 1QPEA 4Q5EA 3F7WA 4FZDB 3FMEA 1ZYSA 4J98A 5CWZA 2B55A 3HUCA 2R3FA 3RGFA 5CEMA 4XBRA 3R8MA 5JRQA 3PE2A 3FLWA 2GNGA 2HELA 2QOCA 5DA3A 3D5VA 4CFWA 3BU3A 1TVOA 2PSQA 1PMVA 1DAWA 3DY7A 2WMBA 3E7VA 3EFKA 3LJ1A 4FKWA 1TZDA 4YPDA 3KREA 4LYNA 3W2SA 4S33A 3F2RA 2OW3A 3D83A 4M69A 1UA2A 4TWCA 3W10A 2EVAA 2R3NA 2WPAA 3AD6A 2BFYA 3BGQA 4QPMA 4RWLA 1T46A 2P55A 4I0SA 4ALUA 4DF3A 3MY5A 5KCVA 3HECA 2WIHA 3FLNC 4AF3A 1APME 4OT5A 4BCQA 4YR8A 5I5ZA 2J5FA 4FUXA 1U4DA 2PMLX 1RE8A 1P14A 1ZARA 2OBJA 5JFSA 5ETCA 5JN2A 3K3IA 5FP6A 3RPOA 4R78A 3MS9A 4FL3A 4PDSA 4RJ3A 5H3QA 4O1PA 2OJFE 4I41A 3MA3A 3FQEA 2UZTA 3VS6A 4RFMA 4FKLA 1H0WA 2RSVA 2VWBA 4QP8A 4ZLYA 1K3AA 4O38A 2DUVA 4DGGA 4RVKA 3F3WA 4IXPA 3VUMA 4JI9A 3OUNB 4EH5A 3VS3A 2C3KA 2R64A 2J0MB 4HNFA 4D1SA 4DH5A 1GZKA 5HU3A 3ENHA 3PLSA 4L6QA 4WO5A 3GU4A 5AR7A 3PY3A 4B0GA 2GHLA 2XS0A 4FIEA 2WMQA 3DAJA 2Z02A 2ITYA 2W5HA 4DCAA 4RPVA 5IQIA 3OROA 3SDJA 2X8IA 3QKKA 3GU5A 5DGZA 2XF0A 3AD5A 2IW9A 3GUBA 2ZDUA 4YJVA 4XV1A 4YZ9A 1BL6A 3SXFA 4BC6A 2CGXA 3N4TA 3W0MA 4EHVA 4IJ9A 4U44A 4OTPA 2C6DA 5C4KA 3QQLA 2B9HA 5CEQA 4U81A 1OKVA 2ITZA 4RJ6A 4W4VA 1OVEA 3HMOA 5DT4A 4LUEA 3S2PA 3V5TA 3VS4A 4ANMA 3QWKA 2C1BA 4DLIA 2VX0A 4BTMA 4QMQA 5HTCA 2JDVA 4FUYA 4A07A 4DHJA 2UW6A 2AYPA 5FTOA 5J8IA 2VTMA 4L68A 3VUIA 2EXMA 2WTWA 3MJ2A 3MPTA 3Q4ZA 3R8VA 5HG8A 3SV0A 3RPSA 1BMKA 3GENA 2X8DA 2VD5A 4R7HA 4RC2A 4RVTA 5AP4A 3P5KA 1KE9A 5AP5A 5HIBA 4FSWA 2VWZA 1K2PA 3P86A 4D58A 5E8XA 1PXPA 4L52A 5JFVA 3TIZA 4F9WA 1YQJA 5AUUA 2O63A 4IIRA 2JGZA 2X0QA 3DQXA 1WBPA 2EXEA 4X3JA 4UX9A 4O7SA 3FXXA 1UU7A 3GCSA 3I7BA 3AC1A 2WMWA 3POOA 3QHRA 4M12A 4QP9A 1H25A 5CF4A 3OCBA 3R30A 3HYHA 4FJVA 1Y8GA 3UNJA 3MVLA 4AGWA 5L3AA 1M2RA 3BEAA 3Q2JA 4NJDA 3DKGA 3NGAA 5GNKA 5LWMA 3TT0A 3NWWA 4CFVA 2QO7A 1YXVA 4DTBA 4N57A 5EG3A 4YU2A 5C4LA 3JPVA 4AWIA 3Q4CA 3RHKA 3A62A 5IEXA 4EH6A 4DFBA 1ZMWA 1FMKA 2GNJA 3KN6A 3MW1A 4RZWA 3PXZA 3F5PA 3JS2A 1W2DA 4GVJA 4YO6A 5E1EA 4M13A 3RNIA 5KBRA 1G8JA 4AXCA 4XG8A 2HZIA 2IN6A 1XHAA 3A4PA 4BTKA 3QXPA 5HX8A 4A7CA 3RNYA 3Q32A 4F6UA 1OUKA 4GK2A 5EQYA 1NVRA 3MH3A 5D10A 3W8QA 4YNOA 4AW5A 3QAME 5IMXA 3HP5A 4L00A 3RINA 4DFNA 4CT2A 3MSSA 4QYFA 3KK9A 2CDZA 5H8EA 2X39A 4C0TA 2IO6A 5C9CA 2OXYA 4R1VA 3W55A 5DR6A 1REJA 2B7AA 4UYAA 2I40A 4ITIA 4O0TA 5EK7A 1H1WA 1ST0A 4IX6A 2F7ZE 2LAVA 1KOBA 5BPYA 4JMQA 2W96B 3ACKA 1P2AA 5J9YA 2PZYA 4KIQA 4AOTA 2VWXA 4YTIA 2HXQA 3ZOSA 3EQCA 2UZOA 1NY3A 3I60A 2HY0A 3UNKA 1X8BA 2OGVA 2C0TA 1Q3DA 4UALA 4FTJA 4U41A 1G8AA 3MA6A 3OT8A 3Q53A 3CTJA 1KE7A 1U46A 2XKCA 3FEGA 3CD8A 3KY2A 3IG7A 2B52A 2YDKA 5HI2A 5IMEA 4FG8A 3D5WA 4H1MA 2C6MA 4J8NA 2IVVA 1YDTE 2C0IA 4UWBA 5FBNC 4EH8A 3EL8A 1SMHA 3QZGA 4FKUA 4Z55A 3DKFA 5FQDC 4DBXA 2DS1A 2DYLA 3V5QA 1M14A 4MCVA 5AR5A 4FIFA 5AR4A 1URWA 3KVWA 3F5GA 3LFSA 4O91A 3PJCA 4ANBA 4AXDA 4X3FA 3ZDIA 3ZONA 3PYYA 2QVSE 4GK4A 3FYJX 4I21A 4ZTNA 5FP5A 1W83A 4QD6A 1ZYCA 1XR1A 2IW6A 1R0PA 4E4LA 4EEVA 2CLQA 4NM0A 3UPXA 4BHNA 3FLSA 3HMPA 4NFNA 4OUCA 5J1WA 4BJJA 2J4ZA 2A0CX 5L2TA 3NSZA 5EDRA 4ZMEA 3PJ3A 4DEBA 2JFLA 3QCXA 3UQFA 5EW3A 1H01A 4F70A 3ZLYA 5EYMA 2UZBA 4J52A 4EC9A 3UZTA 2FA2A 3CIKA 5AP3A 5AP1A 3H10A 3GB2A 4DLJA 3E7OA 4PDOA 4QTDA 2PUIA 5A4EA 5I9VA 4H05A 1XBCA 3R71A 3MFRA 2VWIA 4LG4A 4HCTA 4QNYA 2IZTA 5ANKA 3PIXA 3EFWA 3IDCA 5HOAA 2CLXA 3WYYA 5FDPA 5D7AA 4XOZA 4ZJIA 4F63A 2ZV2A 2BDFA 2F2UA 4UXLA 4BDBA 4FSTA 1SVEA 1DAYA 1ZY5A 3LJ0A 3RBWA 4R3RA 3VRZA 1J3HA 3SXRA 4EZ5A 5K3YA 2OIDA 4I6QA 1AD5A 4EH9A 2J7TA 4NZWB 1I44A 5GHVA 3FY0A 3G6HA 4O6LA 5DHJA 3NNWA 5TT7A 4O2PA 4C38A 2BZHB 3QX4A 2H96A 2I0HA 4OTGA 3TUCA 3HV4A 5AIRA 4JS8A 4CGAA 3T9TA 1SM2A 2X2LA 4NUSA 4CCUA 2PK9A 2JKOA 4C4GA 1Q3WA 3ANRA 2RKUA 3MVMA 4JLCA 4BDKA 3E8CA 4I6HA 3U9CA 1YWVA 4EHEA 2BR1A 2WTDA 4YJRA 4O22A 3FXZA 3V3VA 3VBWA 3E63A 4E6QA 3DLZA 2XA4A 4ZTSA 3RJCA 3BX5A 3TNHA 4S30A 5J7BA 4NK9A 3BL9A 1V0BA 5E90A 3K5VA 3OG7A 3C4CA 2JKKA 3GOKA 3LFEA 3NEWA 4ANNA 4CKRA 2C6TA 5BMMA 5HEZA 4D2RA 2O64A 2YLEA 1TQMA 3UOKA 3AC8A 5LVLA 4RFYA 1T45A 1IAHA 5CANA 3MB6A 3JVSA 4HYUA 4FEXA 1IEPA 4PTEA 4DE4A 3EQDA 5HHWA 5IQGA 3OC1A 3FSKA 2YJRA 4FTMA 4O2ZA 3EN4A 3ANQA 4MXXA 3VW8A 5LVNA 3O5AA 4CRSA 1RQQA 4WOVA 1AGWA 1M52A 4I4EA 4QP6A 4DHIB 1OPKA 4ZSGA 3GC8A 4WNKA 2BKKA 4F7NA 1CKJA 4DCEA 3DXPA 2E9VA 4FTUA 5H9BA 1H1QA 2V62A 3D94A 1DI8A 4NKSA 3H4JA 4Z9LA 3I79A 3I81A 4D2PA 3GCVA 4FV6A 3FMKA 1OIYA 4R3PA 3KA0A 3DFCB 3MBLA 2QOHA 5I0BA 3ZC6A 2XEZA 2ETRA 2JITA 2W05A 4ZY4A 2OICA 4XG3A 3PP1A 2XVDA 4G2FA 5AM7A 4IZYA 5GJDA 4JQ8A 3W2CA 3BYSA 3NVKI 2WTKB 4RFZA 2V5QA 3GC0A 4YBKA 2FB8A 3COHA 3UJGA 5CEKA 4BKZA 2C5XA 2I0VA 4PMSA 1SNXA 4YJUA 1RDQE 4GKHA 3MH0A 3E8EA 3CXWA 4BTFA 4BCMA 3NYVA 2QODA 2XANA 3HKOA 4YO4A 1V1KA 4YJNA 5D9HA 1KV2A 4AFJA 4AFEA 3BGZA 3HVCA 2XKFA 5B2MA 5LVOA 3ET7A 5M4IA 1VR2A 5AWMA 4EJNA 1GZ8A 5ICPA 2OLCA 2VX1A 4OTWA 4F1MA 1PXLA 4W4XA 5JQ8A 5AUTA 4CMTA 3H30A 2XEYA 4BDDA 4MXAA 4AA4A 5D41A 4CFMA 2X8EA 3KFAA 3ORMA 3TKHA 3S0OA 4QPAA 1URCA 3OXZA 3BYVA 3QUEA 3II5A 4B7TA 4C37A 1PYXA 4F4PA 1NW1A 1JNKA 4RIYB 3B2TA 3PPJA 3UVPA 4XV3A 3NIEA 1CM8A 4N4SA 5H8GA 1OKWA 3SXSA 2JBOA 4Y5HA 4FSQA 3FWQA 4RLKA 4C57A 4TKSA 4PL5A 5C03A 2XKEA 5FD2A 3BU6A 4R6VA 2OH4A 2QU5A 1ATPE 4RIWB 5DBXA 3QTQA 3TZ8A 4ALVA 4M0YA 5T3QA 1MUOA 4KKEA 3SOCA 4O0RA 5EW9A 4G34A 5A14A 3ITZA 3F5XA 3PWDA 4IX5A 1KE5A 2E9NA 2FUMA 3EQPA 3U54A 4IC7A 3ORLA 1ST4A 4P5ZA 5EOLA 2IF8A 5EYKA 2HY81 2FSMX 3WOWA 4E6CA 4NTSA 2UW0A 4BZNA 3EB0A 2PMOX 3R7UA 3L9NA 5CAPA 3PVWA 4QTEA 1B39A 3O71A 4FEUA 1GZOA 5K0KA 3D9VA 4EYMA 5M53A 1ZOEA 3SW7A 3LFFA 4KWPA 3U87A 2R5TA 4C4IA 2NO3A 3MPMA 1XO2B 3QQHA 4BF2A 4R8QA 4EC8A 5F1ZA 2PUPA 1QPCA 4JR3A 4MHAA 2JDTA 2VTTA 3F2NA 1PY5A 3QC9A 2HENA 5IA5A 4C8BA 3NFFB 4UEUA 1Q61A 1U54B 3GFWA 1UWHA 3ZZEA 1PXIA 1FGIA 3BU5A 3LFDA 2WQMA 4WBBB 3ALNA 4X2NA 5CASA 3ORPA 4HGTA 4UMUA 2R3RA 1XMLA 3EKNA 4FKVA 3AOXA 4PP7A 2HZ4A 2HW6A 3ORXA 4KS8A 3H9FA 5JGDA 4R77A 2BVAA 2XK4A 4TYGA 4ASEA 1WVXA 3D7ZA 2VTNA 4FSNA 4JJRA 2R3GA 3UIUA 4O4FA 4D2SA 4DFZE 4DH1A 3U6IA 4D1XA 3CJGA 3PG1A 4W9WA 3QFVA 4S31A 1Q5KA 5AJQA 5FTGA 2PUNA 2VNWA 1MRVA 3LIJA 2FSOX 2RFDA 3QRUA 2BROA 4JDJA 4HGLA 2JDRA 5CU3A 4IX3A 4MK0A 5HNBA 5IA1A 2BILB 4QT1A 3VBYA 2C5NA 1CKPA 1OM1A 1WBOA 4LM5A 3ELJA 2JIUA 3FMJA 4PPAA 4RMZA 4ZTRA 4FVPA 2PVMA 3COIA 4BCHA 4YNEA 3MFUA 5HD4A 5KX8A 3L8PA 2WMXA 4IAIA 3KKVA 2W1DA 5CS6A 2W9ZB 3BELA 5IA4A 5CU4A 3DK3A 2B54A 4O7NA 1BI7A 2VTOA 2R0UA 2A4LA 3PXKA 4DG2E 3OWLA 4RWJA 5HIDA 2WGJA 5CTPA 5ETFA 5GZAA 3QTXA 5BVFA 4XG2A 3P5JC 4CLJA 2VTHA 1YXTA 3QQUA 3Q5IA 4DEGA 5CEPA 3RK9A 2GPHA 4CRLA 3Q9XA 4FV1A 4OBQA 4OTQA 5HE1A 3UIMA 3BWJA 1QPJA 3O7LD 3ZSHA 2XK7A 3KU2A 4U9AA 3ZHPC 1YOLA 3C4XA 5M08A 2XNEA 5EFQA 4TYEA 4UMRA 3PTGA 2CSNA 4F7JA 2OZAB 2YIQA 1JSUA 3C51A 4IB5A 4ZZMA 3RI1A 3RM7A 5CALA 4FEWA 5E8YA 4PDYA 4YZMA 4FSMA 5F4NA 3TI1A 3TG1A 3BGPA 5M4UA 4D4VA 5CX9A 5B2KA 2C6KA 3C0GA 1OIRA 3FXWA 1B6CB 4GYGA 4KRDA 3LQ3A 5JEBA 5CNNA 2Z2WA 3ZSGA 3VULA 3FSFA 2VGOA 4BFMA 3UIXA 5K5NA 2R3IA 2IVTA 5HD7A 2RIOA 4FGBA 4H1JA 4G5PA 4MD9E 5A46A 3KULB 4A4XA 2WQNA 3U8WA 4FKIA 2R3HA 3ATTA 3AXWA 4TPTA 5HG5A 2WQBA 4FC0A 5FDXA 4U0IA 4BI2A 4EOIA 3VWAA 4Z16A 4FX3A 4G1WA 2UW7A 1L8TA 4HGSA 4BCFA 5FG8A 2C5VA 4QPSA 4MBIA 4BIBA 4BYIA 4EUUA 4PQNA 4F65A 3SKCA 4CVAA 4C3PA 5DT3A 2ZMCA 2VWWA 5E8TA 4QP1A 5KKRB 3MH1A 4IEBA 4YTFA 4M8TA 1H8FA 2ITVA 4D55A 5L2IA 3E3BX 3PG3A 3Q4TA 1UWJA 2CKPA 2WTJA 5CLPA 2QHNA 4O4DA 3O50A 4ZIMA 3ZUUA 4EH4A 3R73A 3OBGA 5FBOA 3ULIA 3V01A 1JKLA 3KMMA 3E92A 2YACA 4L46A 4A9UA 2Z8CA 2WTKC 1NVQA 4FNZA 4TN6A 3PSDA 4GUEA 4RWKA 1PW2A 3IW6A 3D2KA 2ZFYA 2WO6A 3QGWA 4EOKA 2HIWA 4QMTA 4E73A 2ITXA 5M4FA 2ONLC 2PPQA 3DK6A 3R83A 5CZHA 1PXOA 3F61A 3AQVA 3QCQA 5LARA 1XKKA 3R21A 4E5AX 2QKRA 3DDQA 4JG7A 4BZOA 4CMUA 4ZZNA 4D5KA 4E6DA 2IEWA 5L8LA 5B2LA 4RLLA 2UZVA 1WVWA 4LRJA 4WSQA 5T68A 3V8SA 1ZRZA 2E9UA 2XARA 4AG8A 2G2IA 3G51A 3TJCA 5LMKC 3AKJA 1GIHA 3HV7A 5ANIA 2JEDA 3ZBFA 3TWJA 2JAMA 2ZM1A 5AR2A 3UDZA 3OW4A 4F0FA 3OVVA 2G2FA 3NVMB 4ASXA 2IW8A 1PYEA 2AUHA 1H1SA 3BI6A 1OPJA 2XALA 5JH6A 4C7TA 2Q83A 4V0GA 3KCFA 4C3FA 3M42A 3W2RA 3G9LX 4MEDA 3ZLSA 5I3RA 3DJ5A 4G6OA 4FNYA 3WYXA 5M51A 3VBTA 3PRFA 4UWYA 1BLXA 1QL6A 3NUAA 2WTCA 3MVHA 3RCJA 5DNRA 3WF6A 4ZK5A 3NMUF 5BX0A 4FBXA 2HK5A 3A7FA 3SC1A 4AZWA 2WHBA 3HNGA 4PWNA 3LXKA 3V6RA 2PZRA 1BKXA 3R0TA 1LR4A 2WAJA 4IAFA 4QMZA 4DBNA 1UKHA 4S32A 4RX7A 1H27A 4RX9A 3PA4A 1WBVA 3LCKA 3KN5A 2C3JA 2VN9A 4QMXA 1GAGA 5FUTA 5C27A 1XWSA 4EKLA 5LVPA 2VTPA 4FTCA 2CJMA 3O23A 2YJSA 4CLIA 4TT7A 1PXKA 1OI9A 4H58A 4X2KA 1J7LA 3AC2A 1YDRE 5E9EA 4IX4A 4FA2A 3AG9A 2EWAA