1U5RA

Crystal structure of the tao2 kinase domain: activation and specifity of a ste20p map3k
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
309
structure length
308
Chain Sequence
DPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPALQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the TAO2 Kinase Domain; Activation and Specificity of a Ste20p MAP3K.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords serine/threonine protein kinase TAO2
total genus 99
structure length 308
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1u5rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1u5rA01
3TV6A 4FA2A 5HNBA 2W5HA 3UVQA 5J7HA 3QUDA 2RG6A 3DXNA 1PW2A 3AT2A 5K3YA 4GH2A 5EK7A 4K8AA 5D7VA 5E8WA 5JSMA 4RWJA 2W1GA 2YJRA 3R1QA 3HMPA 3RZBA 3HMNA 2QOHA 1W8CA 4BBFA 3CKXA 4YZMA 3MVMA 3DXQA 4WIHA 1PYEA 3GP0A 2JIIA 4ZSEA 3F2RA 5CVFA 2YCFA 2YIWA 3NNXA 4G17A 4GRBA 4OW8A 3ANQA 5KMJA 2J50A 3Q96A 2JITA 4QMSA 3TTIA 3IOKA 4DT9A 4NKSA 2BAKA 4YSJA 4HVGA 3COMA 2BHHA 2BZIB 3QQFA 4MXXA 3UQCA 3OEZA 2XIRA 4K1BA 5E8VA 2RFSA 3TKHA 1VYZA 2W9FB 2ZDTA 4TL0A 2C6TA 3CTQA 5CI7A 4I6QA 2C3IB 5C8NA 3DTCA 5DEWA 4NZWB 2IVVA 4IAIA 4MTAA 3W18A 4CKIA 4CFMA 5L6OA 4FOBA 4O0WA 2R2PA 2O63A 2PTKA 4JX3A 4U9AA 5AP4A 3W2OA 2WU7A 3QKKA 1S9IA 1W0XC 4YJVA 3FI2A 2V5QA 2X2KA 3IQ7A 4CZUA 5LWNA 1L3RE 2QLQA 3PY3A 4FZFB 4DGMA 2X9FA 2J5FA 4MBJA 3V5TA 4DFXE 2WEVA 4I0TA 4QTAA 2IPXA 5EOBA 3NUAA 5CSXA 4EOOA 3LLTA 2QODA 1NT2A 2ITZA 4E20A 3DAEA 2ZB1A 3QTXA 3ORZA 2W06A 5JZNA 4BIDA 2WQBA 3BKBA 3A2CA 4ACMA 4MXYA 3ZTXA 4BCQA 5FD2A 5JFXA 4OTRA 3OW3A 3I7CA 5CU4A 2EUFB 3DBFA 3MDYA 3O71A 3GU5A 3M11A 4OGRA 5CWZA 3LPBA 5E8XA 5M08A 2X1NA 3BWJA 2JD5A 4FIJA 4R3PA 4ZY5A 3IW5A 1PMUA 2Z2WA 4RT7A 3VUTA 3ZMMA 5AV4A 1ZWSA 2VN9A 3KXZA 4XG2A 4JXFA 3LOKA 4F70A 4G16A 4XOYA 1FINA 4BY9E 3UIXA 4QTCA 2QR7A 3FL4A 2GMXA 2XA4A 2X6EA 4HVDA 1PXPA 4IZ7A 1YKRA 3ORNA 4GK3A 4RFYA 4ALVA 2CCHA 4BCIA 4D4VA 4DG2E 3NZ0A 2XVDA 3Q5ZA 4UMTA 5IA0A 4H3BA 4G3CA 3F5PA 3PIYA 2P55A 4FT7A 4IHPA 2C0TA 4JRNA 4MXCA 3HAVA 5HICA 2HENA 4BDJA 5DMZA 3PJ3A 4EH7A 3DAJA 4AACA 4QNAA 2XEYA 4U43A 4C2VA 4CFXA 4DTBA 4RA4A 1JOWB 4IACA 4DFNA 4NKAA 3RPRA 3SW7A 4X2KA 3UP7A 5IMXA 2JKKA 2W7XA 3KGAA 4QQCA 4JLCA 3EFLA 3BCEA 4XG3A 5F20A 2UV2A 4LM5A 2KULA 1NVQA 2QURA 5F9EA 3JY0A 5J5TA 4CVAA 2IJMA 3TZ7A 3B2TA 4FTAA 2XK4A 1H01A 3WIKA 4EJNA 5K5XA 3G0FA 4BL1A 4DH7A 4EBVA 4HGLA 2OIBA 4JBVA 1BYGA 3FLNC 3ZCLA 2H9VA 5ACKA 1A9UA 4IJPA 5EYMA 3WZDA 4DE4A 2WIPA 4JBOA 5J8IA 3AMAA 4GFGA 4QOXA 2XNGA 4JBPA 4U42A 1NY3A 3C4XA 4O82A 2B7AA 1H26A 2XNEA 5CS6A 3FE3A 3DTWA 4KBAA 4DBNA 1YHWA 5JKGA 3GI3A 4ACCA 3I0OA 1BI8A 2WTWA 4EORA 1PXKA 3CQEA 4FNXA 4R7HA 4XV3A 3VW8A 4EOJA 5HIEA 3DXPA 3BWFA 5FG8A 2I6LA 3K3IA 3UVRA 4AWIA 2YZAA 3G9NA 4IDTA 4B7TA 3L9NA 3F5UA 3EZRA 3MFTA 1M52A 3QQGA 2B0QA 3QXOA 4C3PA 4HCTA 2UVYA 2B1PA 3MVHA 1T45A 3IDBA 3F6XA 4USEA 3NUXA 2ESMA 3FV8A 4RMZA 1STCE 4DEBA 5HTCA 3JYAA 4UB7A 5F94A 1WAKA 1WBTA 4H1JA 4J8NA 4JJRA 3FMDA 5AV1A 4C34A 2BILB 3CTHA 2UZDA 4L52A 2HW6A 4LGGA 4RIOA 5EM7A 4A7CA 3UZRA 4CTBA 2XBJA 4AZVA 4PX6A 4O1PA 2V22A 2V55A 4DF3A 2WHBA 4WUAA 4ZLYA 5CEMA 3MA6A 1O9UA 4BKYA 1WBOA 3AGLA 4FTNA 4QMTA 4WG3A 3ZRMA 2E9UA 4TWCA 4WKQA 4APCA 4CD0A 2RGPA 1UKIA 4F7LA 5A4TA 5KMLA 1W83A 4FZ7A 5KX8A 5IQGA 1WFCA 2F9GA 1NVSA 4TT7A 5I9XA 4QMQA 1FGKA 5FRIA 3OY3A 3HRFA 4D9UA 3OWLA 5A3XA 4BBEA 2G2HA 2QQ7A 4U97A 2WTKC 3LXKA 3OTVA 2QKRA 4M69B 4DEIA 4KRCA 3DFCB 4O91A 4M13A 4Y8DA 3I60A 4BCJA 3BHHA 3MFRA 1MQBA 3WZKA 3E8NA 3IW8A 3OUKA 3F7ZA 1OECA 5IEVA 1LEWA 4FSUA 3R8MA 5BNJA 2VTOA 4BCKA 3FMMA 2HZNA 4I5MA 1S9JA 1MP8A 2VO3A 2VTRA 1JWHA 5FXQA 4JS8A 4OTQA 3AT3A 4A9YA 2W4OA 3FXXA 1M2QA 4J71A 3MTFA 2BUJA 3BHYA 3QD3A 4I4EA 3OUNB 4YJOA 2W1EA 3AOXA 4I5CA 3QQHA 3R8ZA 4EYMA 4DH3A 3DBQA 4DEAA 3C13A 4XYFA 2BRBA 3O7LB 3CPCA 4MKCA 4CFNA 3PY0A 1SNXA 4L00A 2I40A 2WMSA 4WNMA 5EKNA 4MF0A 5FDPA 3LM5A 2IZSA 3VBQA 3EL7A 2VWZA 2O2UA 2PWLA 4ZJVA 4JDHA 2OSCA 3D7TB 4M7IA 5EFQA 2CLQA 3TKUA 3U6IA 5BX0A 4K0YA 3G2FA 2C3KA 3LCOA 4HPUE 5EYCA 4ANLA 4CFWA 4AN3A 5E9EA 3KKVA 3WF5A 3QQLA 4KABA 5CF8A 2B9FA 3F88A 5IDNA 5J95A 2R3MA 4GT3A 5KNJA 3O8PA 3HZTA 2WTJA 4KIQA 2OXDA 2PE1A 1VR2A 5C01A 4QMVA 5ITAA 3BLRA 4MF1A 1TQIA 3QYWA 3R7OA 2EB2A 4QYGA 3BEAA 5G1XA 2XF0A 3I0QA 4LFIA 3NCGA 2ETRA 4QMXA 3VS5A 5CVHA 2R3JA 1PXIA 2XRUA 4IB5A 4LRKA 5AJQA 3VBXA 4EOQA 5J79A 1YRPA 4PMTA 5HD7A 5DR9A 4ZJIA 3FKNA 1JQHA 3L9MA 1KV1A 4D0WA 4OBOA 3V8SA 4YLLA 4AU8A 4EK3A 3FMHA 2XYNA 3R7GA 3VS3A 4UN0C 3ZSHA 4EEVA 5HLNA 4QP3A 5CF5A 3V5PA 3S2PA 2VZ6A 5HNGA 4BWKA 3KRLA 3M2WA 2OJIA 3NRMA 4EOPA 2VGOA 4E1ZA 3NIZA 3SLSA 4GMYA 3O2MA 3PVBA 1Z57A 4AOJA 5AV2A 4W8EA 4IJ9A 5DA3A 4FTCA 2JKOA 4YP8A 4BB4A 3KVWA 3UMXA 4O27B 5BMMA 3UO5A 2JDRA 5LVNA 4NFMA 3AD5A 4OR5A 4Y72A 4D2PA 4UXLA 1ZYCA 4C3RA 2BROA 4CSVA 1GZOA 1YI3A 2P4IA 5IKWA 4AAAA 1KOAA 4C4GA 2YZLA 3QRKA 5E7RA 2PVKA 4FL2A 3BV3A 2ITYA 3JR1A 2ZM1A 5CT7A 4XP3A 2JIVA 3RMFA 3POZA 4N4SA 3F66A 3PXRA 1I09A 3VQHA 1PHKA 3TNIA 5B7VA 5IISA 4BCMA 1CDKA 4FGRA 4DCEA 4F09A 2CDZA 2GNIA 3ACKA 3LAUA 4ZSGA 3MVLA 4HW7A 4OBPA 2OZAA 4PTEA 3MWUA 3OY1A 3R8VA 3TI1A 1U54A 4C4HA 3MB7A 2C6IA 3E7OA 1GIJA 3RJCA 3PXQA 3ODZX 4PP9A 3FJQE 2IZUA 3LFFA 2JC6A 3H9RA 4XLIA 3IDCA 4EOSA 4FV7A 4EK4A 2PULA 1JSVA 1AD5A 3KRWA 3QZFA 4EZ5A 1ZAOA 2HZIA 3BZ3A 4AOTA 3KULB 3OTUA 2XBAA 2CNVA 3PSBA 3Q4TA 5H2UA 4IQ6A 4D2VA 3CIKA 4R6VA 4D55A 3ORMA 3F3VA 4XG4A 3HV4A 4P7EA 4XRLA 3LXNA 2X8DA 4WA9A 1O6LA 1XO2B 1B38A 1OIUA 4OT5A 4YJUA 4N57A 2BRHA 5M4FA 1JKLA 2HCKA 3TM0A 5IF1A 3V8TA 3U8WA 3HMIA 1H4LA 3C0IA 4E6CA 4FIEA 4ZP5A 2NRYA 2VTAA 1V0OA 4BZNA 5JFSA 4AZTA 2PMLX 4G2FA 2FUMA 4BZOA 2YCSA 2X7FA 4MXOA 4Q9SA 4E73A 2E9PA 1ZMUA 4QMNA 2F57A 2WMWA 3TJCA 5EW3A 1Z5MA 1CM8A 4GW8A 3CY3A 4GU9A 4F6UA 1OL2A 3PZEA 2GHGA 3CGFA 4RJ4A 3UBDA 4RZVA 3RK9A 2XIKA 2QD9A 4P4CA 1UU8A 1TVOA 3FSFA 4ZMFA 2ITQA 1KE7A 3FZPA 4JIKA 2R7IA 2QI8A 4X2FA 4CLJA 5KKRC 3C4CA 1J1BA 1XH5A 3TN8A 5HE3A 3DLZA 1H1QA 3ORKA 4D5KA 4EK5A 4ANSA 3OG7A 4O7YA 3N4TA 4BDGA 3LXLA 1Y6BA 4E4LA 3CS9A 4FZ6A 5AV0A 1PMVA 4BI1A 4BZDA 4F9WA 2UZWE 3C5IA 3ZZWA 4CT2A 5H8BA 5TT7A 4X2NA 3C4EA 1SM2A 2W5AA 4YZCA 5CXHA 3KL8A 3OXZA 3REPA 4YTHA 4J1RA 1HCKA 4FKLA 4I92A 3VF9A 4QMYA 2OJ9A 3EWHA 3MB6A 3VBWA 1YHSA 4JQ7A 3Q32A 4EZ3A 3O17A 4PL3A 4JI9A 5FTGA 5HE1A 4NSTA 3GQIA 2R3HA 5A4QA 4FZDB 4PPAA 1REJA 5DT0A 3ZLWA 1XJDA 4IAKA 5JH6A 3NVKI 5F4NA 3VWAA 3V01A 1OKWA 2Q0NA 3I79A 4I6BA 5CENA 2PMOX 4TYIA 4Y46A 4ZOGA 3RGFA 4DEDA 5IQDA 4MYGA 2UZBA 1CMKE 2XB7A 4AW1A 3OC1A 3BBWA 3HEGA 2CLXA 3QD2B 4EOMA 5CX9A 1OVEA 2W1ZA 1GZKA 3QBNA 2B4SB 5FP6A 3ETAA 4J8MA 1TQMA 4ITIA 3RP9A 3IS5A 2ERZE 2R3GA 2C6DA 3PY1A 3FLSA 4RBLA 3UOKA 1YXXA 3AD6A 4AA5A 2C47A 2PVNA 3R7EA 1RJBA 3IK3A 3NS9A 3OCTA 1P2AA 4K9YA 4U8ZA 5J87A 5CEKA 3SOAA 3KRJA 3LJ1A 5FEDA 5LVOA 4QQ5A 2BDWA 4KIOA 1FGIA 2GHLA 3C4ZA 3A7GA 2RSVA 3CC6A 2WOUA 3P5KA 4JT3A 4O7SA 5EYDA 2W4KA 4QQJA 1EH4A 2YFXA 5DOSA 3UOLA 3LJ2A 3PPZA 2YWPA 5CALA 4WG5A 5L4QA 3NPCA 2GQGA 4BFMA 5IUGA 4EHVA 3FMLA 3H0YA 1KSWA 5I3OA 3ORLA 3V5JA 3BGQA 2UW3A 2RFNA 5HQ0A 4YO4A 2X2MA 4CFUA 3UZTA 4M69A 4XJ0A 3LZBA 1DI8A 4XG6A 5C8MA 3LFCA 4F63A 1A06A 1DI9A 2RG5A 3CJGA 5AWMA 1ZY4A 4UEUA 5A4EA 2UW5A 1H27A 3PWDA 5CU3A 3ZRLA 3ZZEA 4H36A 3ZO3A 4XMOA 2G1TA 4J99A 2YIXA 4J95A 3GCVA 1YXTA 4MQ1A 4ITHA 2WMUA 5CAVA 2XEZA 3NAYA 3PJCA 3CJFA 3QRUA 4QTBA 3AG9A 3FPQA 3UPZA 2V0DA 3GC0A 3HUCA 3RVGA 3QQKA 5H9BA 5IQAA 5GIOE 2FB8A 2J6MA 1M7NA 2VTSA 3ZS5A 3NNVA 2YDJA 3UTOA 2CN5A 3T9TA 5J9LA 5TOZA 4PL5A 5IA3A 3UG1A 3OVVA 3E5AA 3NUNA 4LL5A 4HJOA 2BCJA 3R9OA 1AGWA 5IUIA 2WTDA 1GY3A 4FV0A 4L46A 1OUKA 3HECA 3RAWA 4XP2A 2I0YA 4FEWA 3DV3A 2JGZA 3U54A 2JDVA 4I20A 3D5VA 3DPKA 4WNPA 1XH7A 1YOMA 2VAGA 3KRXA 3K3JA 2OKRA 4PDSA 5F95A 2YHVA 5DRBA 2NNWB 4KKGA 1UKHA 3FHRA 4KKHA 4QMWA 4BVUA 5A14A 4PDYA 3ODYX 2VTPA 3SW4A 3VS7A 1JSTA 4UALA 4EWQA 5IA1A 1PYXA 4TYGA 1U54B 5EHLA 5D1JA 2DS1A 3R83A 2UZEA 4YLKA 2GPHA 1FVTA 2VO6A 4FYNA 5TO8A 3S00A 5BVWA 3V3VA 3P7AA 4OT6A 3UJGA 5LVLA 3DFAA 1Q8ZA 4PTCA 4EHGA 3ZUUA 5CZHA 1LPUA 4EH4A 2I0EA 3LQ3A 4RG0A 3RPVA 1ZOGA 4RJ7A 3D5WA 3RPYA 4L45A 3TNHA 3GEQA 4FNWA 4S2ZA 3TZ9A 4CV9A 3LCSA 4S33A 2ITUA 5M09A 1UU7A 2QNJA 2AC5A 4TTHB 2YIYA 4EK8A 3N9XA 3NYVA 4QMPA 4ASEA 3I6UA 3GU8A 4Z9LA 4FKOA 3FXWA 1U5RA 4JX7A 5M56A 3EQBA 2J0IA 3RWQA 5E8SA 3DKGA 2ZV8A 2VD5A 2PMNX 4FV2A 4KB8A 1H08A 2RF9A 2YDIA 4YPDA 3I5ZA 3AC1A 2P2HA 4ZK5A 4Q2AA 4ENYA 4D1SA 3KCKA 2ZMDA 4M14A 2B53A 2R3PA 5EKOA 4L7FA 4QYEA 4WNKA 3GCUA 1E1VA 3RNIA 4HVSA 3BYMA 5DT4A 5CAQA 4E6AA 4M97A 4F6SA 4IM2A 5G6VA 2X9EA 3W2RA 4OBQA 5HX6A 1OPJA 2WAJA 2YM8A 1Z9XA 3L8VA 4EOKA 2ITTA 3L1SA 3QTWA 2FGIA 5HI2A 4C58A 5AIRA 5DFPA 3WYYA 3CE3A 1GOLA 3GVUA 3MH2A 3QU0A 4R8QA 3FKLA 4K33A 1J7UA 4LOQA 4U41A 1QPEA 4QPSA 3QCSA 4DH1A 2GNFA 3A99A 4IIRA 4CTCA 1ZYLA 3JS2A 3NWWA 4RIWA 4TNDA 5AP1A 5M55A 3LMGA 4IFCA 5GIPE 5AUXA 1K9AA 3G90X 2IWIA 2QLUA 3DKFA 4RC4A 4J96A 2R3LA 2KTYA 3PXZA 4AGCA 4IM0A 1H8FA 3IGOA 3IOPA 4OTIA 2VO7A 5BYZA 3VAPA 3UOJA 3GNIB 3HMOA 4G6LA 1XWSA 4IADA 5E1EA 3QQJA 5M44A 5EI2A 4RGJA 3QZHA 3MJ1A 2H34A 1QL6A 4I0RA 4XCUA 5HVYA 5IEYA 4BDEA 3A62A 4YC8A 3OWPA 3DT1A 4FV1A 4JRVA 5CU0A 2XJ2A 3CGOA 4NTSA 3FZSA 4EZ7A 1FBNA 4JNWA 2C5NA 2G2IA 3OOGA 2OIDA 2JKMA 1DAWA 4MK0A 2HIWA 1YDTE 2ZOQA 1IG1A 3PLSA 1CSNA 3RM7A 4DHFA 4E7WA 4JDIA 2RL5A 5KKRB 3I5NA 3MPMA 1SYKA 2ITOA 4IB3A 1UNHA 4M15A 2C6EA 3WIGA 4OTDA 3NGAA 4L42A 4RQVA 2BZHB 2O0UA 1IEPA 4P2KA 2QOCA 3RNYA 3P08A 3EQCA 3COIA 5KHXA 4J53A 4I93A 2XNNA 1JBPE 3BQCA 5EM6A 4CLIA 3EL8A 5EDQA 2OIQA 3VF8A 5L8KA 4F9CA 5KMKA 3K5VA 4RFZA 5LVMA 4ZTHA 2BTRA 1V0PA 4YHFA 5IUHA 3EN4A 4FUXA 5JRQA 1YOJA 1Q97A 3ZLSA 4GL9A 4RQKA 4BHZA 4ZLZA 3LMIA 2P33A 4NJ3A 4MH7A 5DI1A 5DHJA 4E26A 2ONLC 4TY1A 5H3QA 3PSCA 4FG9A 3RHKA 4EH5A 5M4IA 3C0GA 4G1WA 4YU2A 2F4JA 1WVYA 3SRVB 5DPVA 3RAIA 4CFVA 2VX3A 2BALA 4JR7A 4D58A 4PMPA 4Q9ZA 3E8DA 2W1IA 5IQBA 5AX9A 4R77A 3VVHA 3W10A 3MGYA 2PVHA 4A9RA 4B6LA 1L8TA 2XRWA 2PHKA 5EM8A 4FTJA 3UG2A 1VJYA 3V5LA 1XQZA 4GVAA 2X39A 1ZYSA 4N6ZA 1A48A 4FT9A 5EHOA 4MNFA 4PMMA 3UIMA 3PG3A 3DA6A 4HZSA 3W55A 3LXPA 3FLWA 4U45A 4EL9A 2F2CB 4XHKB 2UW0A 4FIGA 5JZJA 4YSMA 2QCSA 5KE0A 1BUHA 3TEIA 4OLIA 3QWKA 5IDPA 2HAKA 2B55A 2ZB0A 2BFYA 2UZOA 2G15A 3R21A 3MFUA 3LFDA 4U79A 3U87A 5L2IA 4QMUA 4O0UA 4ASDA 3WYXA 3SX9A 2XYUA 2HZ0A 3KXXA 4PWNA 3NW6A 5K4JA 2PL0A 5HO6A 4I41A 4FT3A 2IG7A 4U3YA 4F7NA 5AM7A 4BGHA 2Z8CA 5CU2A 3BU6A 2Z7LA 4AN2A 3OBGA 4NU1A 3AQVA 4EH9A 4BHNA 3MV5A 3FZTA 1PMEA 1H25A 4FX3A 5BQ0A 5CAPA 4NT4A 1OIYA 2JDOA 5ANEA 5J9YA 1YWNA 5HTIA 1AQ1A 3FUPA 3JVRA 4D2RA 4L01A 3R9RA 2UZUE 1REKA 3NYOA 4NTTA 3VUHA 4ORKA 4FICA 1JVPP 4NK9A 3QRTA 5BPYA 3HDMA 1OUYA 3RCDA 3RTPA 4YTIA 2VUWA 3BELA 3PPKA 3FYJX 3TDWA 4IB1A 2VWUA 3D7ZA 5TF9A 2J51A 2O64A 3FAAA 4IAZA 4HNFA 2BDFA 4QYFA 4O7TA 3QC4A 2PVFA 1BL6A 4OTPA 4W4VA 1PMNA 3BI6A 3G5DA 3P7CA 1Q3WA 4D1ZA 4DG0E 4LL0A 1LR4A 3I6WA 2UW6A 3W8QA 3PUPA 1XH6A 4U3ZA 1WBVA 4L53A 3DJ7A 5DG5A 4RLKA 5CEOA 3LIJA 3H9OA 1WBNA 3MH0A 4YJQA 5DNRA 1W82A 4JOAA 5EQYA 3TIYA 1Y8YA 2LAVA 3EJ1A 2R3QA 5HG9A 3W2CA 4I21A 3Q52A 1Q99A 4JDKA 4ZY4A 5IU2A 5LARA 3MY5A 3M42A 2C6LA 3DDQA 3S0OA 4GJ2A 3P9JA 4CRLA 1GZNA 1KWPA 4FSTA 2W0JA 3GU7A 3NW5A 5CZIA 3ZO4A 4ZSJA 4AT5A 2VX1A 1W98A 2W99B 4XG8A 3NMUF 5LMBA 5GZ8A 2R3RA 3OD6X 3EN7A 4FTIA 1KE8A 4TWOA 5AX3A 3H4JA 3SDJA 4U7ZA 3T3VA 3MH3A 1OL7A 5T3QA 3B2WA 3BU3A 3R63A 5CEIA 3V51A 3RAHA 3O51A 2VV9A 4RJ3A 4CG8A 1BLXA 4FTRA 2HZ4A 4KINA 2PVMA 3UYTA 2OF4A 3E8EA 4X2GA 3D4QA 3V8WA 4IANA 3EHAA 4IDVA 4BTMA 4O7WA 3MSSA 4WNOA 2BAQA 2J0MB 3TNQB 5ICPA 4C62A 3OEFX 5J9ZA 4IBMA 4BKJA 4QTDA 1R78A 4UBAA 3IECA 2VWIA 3ZC5A 3ZUTA 4ANOA 3LFBA 1FOTA 1VZOA 3R7IA 1MRUA 5D11A 3T3UA 2RKUA 4M8TA 3HVCA 2J90A 3OHTA 2J7TA 3SGCA 4FSNA 5JMSA 1IA8A 3Q2JA 2UZNA 5AAFA 4C35A 2WEIA 4EH8A 3ALNA 2GU8A 3AMYA 2HW7A 4V0GA 4F1OA 4FEUA 3DS6A 3EYGA 4QP2A 2VWXA 2E9VA 4ZTLA 1URCA 2O8YA 3ZFXA 5JQ8A 4DA5A 4E6QA 3Q04A 1M17A 4FIIA 1PXJA 4AG8A 4JR3A 3SXSA 5FEQA 4ASZA 3KXNA 5HX8A 3HP2A 4AFJA 1QMZA 2VTQA 4EWHA 2WQEA 4G3DA 5EI6A 4CZTA 1Q24A 4AE6A 4DCAA 3IONA 4BRXA 5M06A 1ZZ2A 4MD8E 1QCFA 3C50A 5TR6A 5HCYA 2WPAA 3WF7A 4CZYB 2WXVA 5H8EA 4BYIA 1E1XA 2OH0E 2UVXA 3DJ6A 3RM6A 1BMKA 5KO1A 5KBRA 1MRYA 4YMJA 4J98A 3NR9A 4FOCA 1NXKA 4XV9A 3WZUA 2XM8A 2XJ1A 3VUKA 3EIDA 5AA9A 4FK3A 4IFGA 4DFUA 4TWNA 3O0GA 3PJ2A 5LMAA 4FKJA 3LKMA 5ETIA 5AMNA 3OT3A 3E92A 3G9LX 4FKUA 3D9VA 3KREA 3AC4A 3PYYA 3DQWA 4KA3A 3TWJA 3R04A 3FC1X 3VBVA 4E93A 4KRDA 1GAGA 5D41A 4NJDA 2OZAB 2XNBA 4K18A 5CTPA 4D4RA 2GS2A 4XBRA 1YXSA 2OBJA 3BGZA 3NX8A 3PJ8A 3TG1A 3W2QA 3QWJA 4R3CA 3VHEA 4AS0A 5AP7A 2ZM3A 2I0HA 3P0MA 5LQFA 4LYNA 4O7NA 2WQOA 3IW6A 2ZV2A 4H3QA 4E6DA 3ZYAA 1Q5KA 3G6HA 3Q4ZA 3KCFA 4PY1A 1UU3A 2QOBA 3FBVA 4RPVA 4YNEA 1OBGA 4F4PA 2XK6A 1Q8WA 3DBDA 3GCPA 3CPBA 4IC8A 3S4QA 3SRVA 5I9YA 3PE2A 2A0CX 3NUSA 4PNKA 4AW2A 3OXTA 4O0TA 1H24A 4FIFA 3LCDA 2QG7A 2WMAA 3E7VA 4ALUA 3ZLXA 4XNEA 2PK9A 3O7LD 4FNZA 3AC8A 4FNYA 4PRJA 2IVUA 2HY0A 2GQRA 3IGGA 3QXPA 3E3PA 4CMOA 3UE4A 5AR8A 3JY9A 5HTBA 4FV3A 4RWIA 3SXRA 5EHYA 4XOZA 1IA9A 4JG8A 4GFOA 5JFVA 4G3GA 5BYLA 3DGKA 3Q60A 4NM5A 5KUPA 4A9SA 4QP7A 3Q9YA 3R8LA 4GIHA 4TW9A 4FKIA 2FSTX 3BYVA 3PP0A 3VN9A 5A4LA 2VTJA 3BRBA 4GV1A 4GIIA 5AUTA 5B2LA 2J2IB 4WSYA 1PKGA 2GCDA 2Z7QA 3E3BX 4KNBA 3F5XA 4BIEA 4F64A 2W1HA 3QD4A 1UV5A 4FV5A 4JBQA 4X6QC 5L2SA 4Y95A 5FQDC 4L44A 4FV4A 2ZYBA 3ITZA 4WOVA 4KIKB 5ANJA 3R9HA 3L9PA 3OROA 4FYOA 5BVKA 5EM5A 4WBBB 2HK5A 3WE8A 3BQRA 3VNTA 4IWDA 4BWPA 3BIZA 1BL7A 4O2ZA 5L2TA 1UNGA 2JBOA 4UMUA 2WELA 4KBCA 3TT0A 4R78A 5HE0A 2NP8A 2VRXA 4C4IA 2OFUA 4MBIA 3DNDA 3DK6A 4UY9A 5I4NA 2ZDUA 3FHIA 3PFQA 3PP1A 4K2RA 1ZMWA 1YXVA 4S34A 2VTNA 4XUFA 4EH2A 4DFBA 3FZRA 1OIQA 4AOIA 4JVGA 2CN8A 4MXZA 3D0EA 4NCTC 3F9NA 1ZLTA 4C36A 3VUMA 4K77A 1P5EA 2GNLA 3SQQA 4RX9A 2OO8X 3DNEA 1P4OA 2HWPA 4AUAA 3QZIA 2EXMA 4BBMA 4RC2A 1X8BA 2XH5A 1J7LA 1IR3A 4EH3A 3ROYA 4YLJA 5E91A 4RSSA 2F2UA 3RAKA 3VJOA 2AUHA 2X2LA 3QZGA 4L3LA 4CMUA 4I3ZA 4UMQA 3EN5A 4IZ5A 4PF4A 2OG8A 4D5HA 4GCJA 4O84A 2R3IA 4FODA 4EK6A 4DTAA 1TKIA 3OBJA 4F7SA 4F0FA 2PUUA 3FLZA 5E92A 2AYPA 3LFNA 4HYHA 5AIKA 1OPKA 5JGDA 3BHUA 4EQUA 3SXFA 2R7BA 4FEXA 4CCUA 4AGWA 2Y0AA 3HLLA 3KU2A 3VBYA 2OWBA 1XBAA 2DQ7X 3PIXA 1ATPE 2VO0A 3ALOA 4JDJA 3TACA 3FKOA 3KMWA 3KULA 3P79A 5DR2A 4E8AA 3PDTA 3QD0A 3W16A 4CKRA 3V5WA 4DFYA 4O7LA 1VEBA 4LOPA 5ETAA 4ZXTA 4QRCA 3DCVA 2PPQA 3HV3A 3CP9A 2C0IA 3B8QA 3UGCA 1V1KA 2WB8A 3UNZA 2PY3A 3O50A 1CKJA 4BGGA 2BHEA 4O22A 4FL1A 2GFCA 3LM0A 2OH4A 3QGWA 5I9VA 2W1DA 5AP6A 5HESA 1FVRA 3QF9A 2PUIA 1TQPA 3V6RA 3DKCA 3FDNA 3GT8A 4XRJA 3POOA 3K5UA 3QKMA 4RA5A 3RCJA 4S31A 3VULA 3DQXA 2YM6A 3GUBA 3CR0A 3G33A 3KMUA 4Y5QA 5IQEA 1KOBA 3E64A 3NUUA 5CQWA 5HIBA 2Y9QA 3QA8A 3PZHA 4PMSA 4L3JA 4RVKA 3G0EA 1OBDA 4KSPA 2JIUA 2WMBA 2IN6A 3EKNA 4E4MA 2RFDA 3DY7A 3FEGA 1CKPA 4EC9A 1OB3A 3OP5A 4QD6A 4HVIA 5AADA 3ZLYA 3PSDA 3WZEA 4DGNA 4UV0A 2B9JA 3QRJA 3ERKA 4C3FA 3CLYA 5HU3A 1WCCA 3THBA 4QPAA 4DG3E 3PA3A 1JKKA 4W4XA 5B2KA 2PU8A 3LFAA 2WTKB 3VRZA 2W96B 1UNLA 2V62A 4ZZMA 3KK8A 5BVNA 3P78A 3QL8A 3ZBXA 3ZHPC 4RJ6A 4BCNA 2I7QA 1KV2A 2J0KA 3AC3A 3FMKA 4X3FA 5L3AA 1XR1A 1XH4A 4FMQA 4K11A 4YGAA 4U6RA 4AZFA 3CBLA 3SV0A 2X4ZA 2VNYA 4JG6A 3TV7A 2ETKA 4B9DA 4BCHA 2XKEA 5GJGA 3ZRKA 5DYJA 5AUYA 2YCQA 1J7IA 3KK9A 1ZXEA 2YAAA 4MX9A 3RK7A 5KMOA 4IE9A 2X7OA 3BYUA 3EFKA 1GNGA 4J52A 3T9IA 4IX5A 5KMMA 2XKFA 3E87A 1RE8A 4FG8A 4GFMA 3HV6A 3PXYA 2HYYA 3I81A 4D1XA 4E5WA 1ERKA 4IVCA 3C51A 3DBCA 4KBKA 3RPSA 3LLAA 2JAVA 4QMZA 2Z60A 3HKOA 3HRCA 4HGEA 4IVBA 3HNGA 4WRSA 4C59A 4JIAA 2UW9A 3L8XA 4MEDA 5CLPA 3WILA 4W4WA 4DLIA 3LQ8A 4EI4A 4RIYA 4TYHB 3W2PA 3QUPA 4BN1A 3N4VA 4J7BA 3QHRA 4TYEA 2ITWA 5IEXA 2QVSE 4ANQA 3QX2A 2IW6A 4I24A 4PV0A 5I9WA 3ID6C 1ZOHA 2XK9A 3F2AA 2VNWA 4LI5A 3A4OX 4J97A 4F9AA 3Q53A 5J5SA 4QP6A 3NVMB 3EQHA 4MCVA 4EUUA 2ETMA 5J1VA 5CAUA 3QTQA 4PTGA 3FMJA 4A4OA 4ZSAA 3K2LA 2JFMA 3QCXA 3V5QA 5LMKC 4LGHA 3OF0A 3MIAA 4CRSA 4BKZA 1R0EA 5FUTA 4YTCA 4AT3A 4BI2A 1T46A 4FG7A 5JK3A 3HX4A 5C27A 5D10A 4A9TA 3VUDA 1WVXA 1H1WA 1RW8A 3WZJA 1URWA 4R5YA 3BE9A 4Z7GA 4OTFA 3VS4A 4FGBA 4YBJA 3RWPA 5M4CA 3N51A 4IWOA 3ZSGA 4ONAA 4R5SA 3ANRA 3F5GA 5AP5A 3EOCA 1HOWA 2WQNA 3ZM4A 3UPXA 3F82A 4L67A 2F7EE 3MH1A 4IW0A 3HYHA 3A60A 4NW6A 3NYNA 3QTSA 4FKVA 2REIA 3AMBA 5T6KA 3EQFA 3RPOA 5IH5A 2HXLA 2FSMX 3DK3A 4ASXA 3R2BA 1JAMA 5DR6A 5EDPA 3ZXTA 5K5NA 1G5SA 3FLYA 2Q83A 3LCKA 2QO2A 2W05A 2R3FA 5FWKK 4FVQA 1YDSE 4CQEA 4FL3A 3KF7A 3ZDUA 2QKWB 2B9IA 4LGDA 3HV5A 5D7AA 3VS0A 2IZTA 4P5ZA 4C2WA 3LE6A 3BHTA 4FKRA 4BDAA 4IX4A 4RIWB 1ZRZA 2QC6A 4NWMA 4F1MA 4HYSA 2WGJA 2YAKA 3R8PA 5EQEA 4DTKA 3UO6A 5IQIA 5AR2A 4IWPA 3DAKA 4FEVA 3P23A 3NW7A 5E1SA 5I3RA 5LOHA 1WBWA 4CMTA 1OKVA 3WI6A 3HAMA 3F3UA 4EJ7A 2XNPA 4HCUA 2WU6A 3LQ5A 3QLFA 4O0YA 3VC4A 3NIEA 4AA4A 2GHMA 3W1FA 2VX0A 1PXMA 5IQFA 2VWWA 3Q9WA 4HGTA 4QTEA 4D2SA 4RX5A 1P14A 1WBPA 4WO5A 4LUEA 2X8EA 4X0MA 2ONLA 3SC1A 4ACDA 5EOLA 5ANIA 1FMKA 3ATSA 3FQSA 2F49A 3DZOA 4O21A 3QX4A 4X21A 3WARA 4BDIA 4EBWA 4BDHA 3SAYA 3AC2A 1I44A 4ZTRA 1H1PA 2Y8OA 2YDKA 3HRBA 4G6OA 2CGXA 3GXLA 5AUVA 3VS1A 4YC6A 1IAJA 5IQCA 3MYGA 3NAXA 3R9NA 3MJ2A 4ERKA 2FA2A 1ZOEA 3ORTA 4FKGA 3U9CA 4P90A 4WUNA 3MY1A 2GTMA 5CY3A 5F1ZA 2HWOA 3MFSA 5HBJA 3E93A 2GSFA 3QA0A 3NNWA 2PE0A 4QNYA 4DAWA 4C4FA 3F7WA 1J91A 2X0GA 4AW5A 4FTKA 3ZO2A 5LWMA 2P0CA 3LFQA 3UC4A 4FKWA 4WHZA 1YXUA 5I9UA 1MQ4A 1M7QA 2X8IA 2UZTA 4DITA 5B0XA 5HE2A 4PP7A 2PUPA 5BVEA 4LMUA 2BKZA 4XX9A 4D28A 5IPJA 3A7JA 1OI9A 3Q6WA 4M3QA 2DYLA 5IMEA 5TE0A 5C8KA 4NYEA 2YERA 4QO9A 5HBEA 2C68A 2VGPA 5L8JA 4FKTA 2YM4A 4FTUA 4DLJA 5IG1A 5CVGA 4RJ8A 4FSMA 3TZMA 4FT5A 4CT1A 5CSPA 4AGUA 3S1HA 2WMRA 3D7TA 3ORXA 5AAGA 1U4DA 3ULZA 1Y57A 3KFAA 4F99A 5E4HA 4FKSA 5C4LA 1PXLA 5HKMA 3IKAA 4BCOA 4CCBA 4AW0A 4D4YA 2ZV9A 1Y6AA 4NCTA 4U5JA 3OXIA 2JKQA 4GS6A 3DB6A 3ZEWA 4OTHA 3BPRA 3GFEA 4PDPA 3DDPA 4Y5HA 3R7VA 1YVJA 4CG9A 3QHWA 4ZTSA 3QAME 3EZVA 2Y4IB 4D0XA 4YHTA 4F9YA 4R1YA 4D9TA 4BCFA 5BMSA 2ZJWA 5BYYA 3G6GA 4JL9A 4Z7HA 5LXMA 4IMYA 3F2NA 4ZMEA 2OXXA 2BMCA 2DUVA 3NSZA 5FBOA 3BBTB 1U59A 5KHWA 3ZC6A 2QO7A 1Q3DA 3Q3BA 1BX6A 3GC8A 1H07A 1Q61A 2NRUA 4K6ZA 2C69A 2XKDA 5EH0A 4BTKA 2UZLA 3OCSA 2QOQA 5DWRA 3GCSA 2GFSA 3WBLA 4F0IA 5GZAA 3COKA 3SG9A 4QPMA 4UXQA 3C7QA 2VTLA 5FXSA 4ZIMA 4IWQA 2EB3A 4GYIA 4LRMA 4M12A 2Q0BA 2GNHA 3I4BA 3UVPA 2QG5A 3EFJA 2R4BA 4B4LA 4IC7A 5EQPA 4APPA 5CU6A 4FKPA 2CKOA 2C1BA 3R02A 4GT5A 2YWVA 4XBUA 2OLCA 4RIYB 4TYHA 4IH8A 4O83A 4II5A 4EYJA 4BTJA 4MD9E 2PVYA 3HA6A 5L6WL 4IX6A 4L6QA 2PYWA 3RINA 3OT8A 3R1SA 4NM0A 3GU4A 2NO3A 1FPUA 2ITXA 5HCZA 2A19B 1U46A 3QCQA 4I0SA 5DIAA 5M53A 3GENA 4PUZA 4WD5A 2ZAZA 2XKCA 4ANMA 3FL5A 2CNUA 2FSOX 2QO9A 3VUIA 2VTHA 1PXOA 4CFFA 3OCGA 5M51A 2BKKA 1SMHA 4RLLA 4TYJA 5HG7A 3ZEPA 4G9CA 2GS6A 3ZXZA 2YIRA 2WZJA 5C9CA 2WIHA 4W9XA 3F3TA 3PVWA 2UW4A 4O1OA 5E8YA 3OOMA 5AP0A 4USDA 1WZYA 4GJ3A 5KMNA 1H28A 4TZRA 3D5XA 4QQTA 3R71A 1APME 3NYXA 4X3FB 3COHA 3FPMA 2BVAA 3PA4A 4ANNA 2Z02A 3N4UA 3H9FA 3TCPA 5HO8A 3U51A 3C1XA 3DKOA 3KRRA 4ZS4A 4G31A 4ENXA 2C5YA 4WSQA 5DRDA 2CJMA 4AQCA 5AA8A 2ITNA 4UWCA 2YISA 5GJDA 4ZLOA 2R3KA 1XH9A 2EXCX 3IW4A 5HEZA 4ZJJA 4IZYA 2OICA 2YA9A 2DWBA 1LEZA 1QPDA 2YM3A 5E8ZA 2YCRA 2Y7JA 2B52A 2BIYA 1YWVA 2P2IA 3MPTA 4ARKA 4BWXA 4DGGA 2J5EA 2I1MA 4MNEB 2Y6MA 4KS7A 5FEEA 4E5BA 3R01A 4PDOA 3W32A 2PMIA 2PVRA 2ZV7A 5IH4A 3NUYA 3BYSA 3AT4A 5IA5A 2OU7A 3RZFA 4C7TA 4FK6A 5AV3A 2X6DA 4AZSA 3H30A 3G51A 3NLBA 3O96A 3R7YA 5HLWA 4L68A 2WFYA 1Q4LA 3QLGA 4O38A 4E5AX 4AFEA 2YITA 2XCKA 2A1AB 4M68A 1SVGA 2W1FA 2JDSA 3H10A 4QMOA 5GZ9A 2WMXA 5CEQA 3A7FA 4F7JA 4UMRA 3PG1A 4IEBA 2C4GA 3RKBA 2QONA 4N0SA 3FI3A 2SRCA 3BHVA 4FSRA 2QOFA 4YJNA 3U6HA 3DU8A 3KQ7A 4BR3A 4QP4A 2H8HA 3ENHA 4H1MA 4NIFB 4B99A 4Q5HA 2QU5A 1JKSA 3HDNA 3JUHA 4WRGA 2J0JA 3OZ6A 1R1WA 3PXKA 4IVAA 4NUSA 2ZMCA 4RVLA 2OF2A 4EKKA 5AR4A 3GB2A 5K0KA 4U81A 1PF8A 5GJFA 3DJ5A 3FY2A 3TIZA 3LJ0A 4AGDA 5JEBA 3FQHA 2ZVAA 4IZAA 4FTTA 2IVSA 3PRIA 5ANGA 2WMQA 5K9IA 3R30A 2G01A 3R6XA 5CSVA 5FP5A 2QOOA 3ORIA 3OFMA 4FSZA 3D2KA 3P86A 3QRIA 4CYIA 2BR1A 2XUUA 3DOGA 1K2PA 2C0OA 3QTIA 1OL5A 5LMKA 3BLQA 3QTUA 4Z55A 4QMLA 3T8OA 3A7IA 3EKKA 3FQEA 4NL0A 5FM2A 1E9HA 2XNOA 4G3FA 2G9XA 4H58A 3FXZA 3TTJA 2XIZA 2YN8A 3SHEA 1MUOA 3F61A 4CEGA 3WF6A 5JRSA 3ZH8A 4G9RA 3A8XA 3OMVA 3R28A 2R0IA 4UZDA 4Y85A 5CQUA 3CTJA 4ZSLA 4RIXB 4RC3A 1Q8UA 3CD3A 3CY2A 4XV2A 4ITJA 5C26A 2Y4PA 4MBLA 4DFZE 4WBOA 3VIDA 4ACHA 4UYNA 5LVPA 4O6LA 1XHAA 2XIXA 5DH3A 5HGIA 3F3ZA 4GT4A 2ZM4A 5FGKA 4C4EA 4IM3A 3MS9A 4BGQA 3SOCA 1F0QA 3R8UA 4O7VA 2WQMA 4MQ2A 4O86A 3CQWA 1LP4A 3KC3A 4I23A 2WMTA 3KN5A 3FMEA 2XMYA 3QGYA 4UWBA 4B0GA 2BFXA 2FVDA 3HMMA 4QP9A 5HG8A 4LUDA 4C4JA 1Q41A 4Y73A 3P1AA 2WTIA 4I5PA 2C6MA 4HCVA 5A54A 2W17A 5HZNA 4IVDA 4BI0A 2GS7A 1MRVA 4GKIA 2VWBA 2CGUA 3JXWA 4M0ZA 3ZUVA 1OZ1A 5HNIX 5E8UA 2WO6A 4DYMA 4RRVA 1SNUA 4NM7A 4D2TA 5CXZA 2V7OA 3ZDIA 2BZJA 4DBXA 4F9BA 4I22A 2PUNA 4IAYA 5CF6A 4S30A 1RQQA 1QPCA 3EQRA 3ORPA 4RFMA 5CYIA 2CCIA 4GK4A 2G2FA 5DLSA 4EC8A 4I94A 2OW3A 3KXMA 4F0GA 2UZVA 5AP3A 3I7BA 4I5HA 1CKIA 1LUFA 3MN3A 2J9MA 5AFVA 4ZY6A 4L7SA 3U9NA 4GUEA 1KE6A 4P5QA 3C4FA 3Q2MA 5EDRA 4CKJA 1DAYA 1UWJA 3NUPA 4OTGA 4KS8A 5J7BA 3U6JA 2OGVA 3L8SA 3LFSA 5JGBA 2YEXA 3D14A 4KKEA 4XS2A 1NA7A 1OM1A 3NEWA 3FY0A 4AF3A 5EW8A 4BDKA 3MY0A 5FTQA 3UMWA 4KWPA 2BIKB 5FXRA 2PVLA 4LG4A 3AGMA 3U55A 3ELJA 3QKLA 3UQGA 2PZPA 1IAHA 3VUGA 2JAMA 1J1CA 4G34A 1XH8A 5GINE 3LVPA 4ZEGA 4O2PA 2WMVA 2PZIA 4TNBA 4FC0A 5KZIA 4EHEA 5A9UA 5AAEA 5HHWA 2R0UA 4OAVB 5DT3A 3UNJA 3SVVA 3MPAA 5IA2A 5E8TA 3TV4A 3UC3A 4O0RA 3UO4A 1ZYJA 1YW2A 4QYHA 2I0VA 3R2YA 2YM7A 4RVTA 5K0XA 1H0WA 1HCLA 2QR8A 3OCBA 4AX8A 1ZY5A 5FTOA 4YURA 4TXCA 5KBQA 4O7ZA 3B8RA 1GZ8A 3ACJA 4GG7A 3D15A 4U80A 3HV7A 5AR5A 2OZOA 2VWVA 4FVPA 3VQUA 3MI9A 4BTFA 4D4SA 3MW1A 3IDPA 3TXOA 5IH6A 5BUIA 2P3GX 5C1QB 3LW0A 1BI7A 1O6YA 4PPBA 3QUEA 3KN6A 5CSWA 4EKLA 1PJKA 2PVJA 3AD4A 3KF4A 4JAIA 2YLFA 4YNOA 4YJPA 4L43A 3ZO1A 4RVMA 4G5JA 3E88A 3QFVA 3FC2A 2WOTA 1H1SA 3FSKA 3UYSA 3VO3A 4YJSA 2H6DA 5HCXA 2FO0A 1VYWA 4TN6A 4A4LA 4FTOA 4BCGA 4CGAA 4GVJA 2QU6A 3KVXA 4F6WA 2LGCA 3ROCA 4ZAUA 4JAJA 4AP7A 2YJSA 2FYSA 2VTMA 4Y83A 1U5QA 2A27A 3OWJA 4FSQA 4I4FA 4MWHA 1GJOA 3AXWA 3DZQA 2XJ0A 2OI4X 4AXAA 5J1WA 4IAFA 3QTZA 2YM5A 4G6NA 4W4YA 4N6YA 5LCKA 4GKHA 4R7BA 3FMNA 2GNGA 2CGWA 5KCVA 4X3FC 3KB7A 4S32A 3W2SA 4A06A 2NPQA 4I1ZA 1XBCA 4OUCA 4N70A 1R0PA 4X3JA 2CHLA 3LHJA 3U4UA 5M4UA 3TUBA 3RI1A 3IW7A 4X2JA 2R3NA 1OKZA 5HIDA 1Q8YA 4BC6A 5BVFA 3R1YA 2BRGA 4EONA 2YIQA 4JQ8A 4C57A 1PKDA 4NEUA 5DBXA 3PJ1A 3M1SA 5I9ZA 5AEPA 2EXEA 2CKQA 2F7XE 5KZ0A 4I6FA 4U40A 2YLEA 4O0SA 3QCYA 4NIFA 5AM6A 5AUWA 5M57A 2BZKB 4ERWA 1O6KA 2IW9A 4TKSA 4AZEA 3D5UA 4YZ9A 2ACXA 5HORA 3P7BA 5BVOA 1ZMVA 2E9OA 4C0TA 3WOWA 2X81A 2QHMA 3II5A 3S3IA 4X6RA 4NW5A 4TRLA 3FZOA 3R22A 5CNOA 2J0LA 4HVHA 5CEPA 1UVRA 3CKWA 3KXHA 2BTSA 4FEQA 3LFEA 4HYIA 3UDBA 2XZSA 1JNKA 3EMGA 3ZSIA 4RWKA 5HVJA 5D9HA 3ZM9A 3D94A 3HA8A 5JGAA 4NFNA 4FIHA 2BAJA 4FF8A 4IAAA 4FV8A 3PPJA 4GK2A 5HLPA 3TL8A 3EQIA 3CD8A 4R1VA 3Q5IA 3C9WA 4YZBA 5DEYA 3LCTA 2HXQA 4QT1A 3W8LA 5GHVA 3MTLA 3GU6A 2C5VA 3H0ZA 4ID7A 4MHAA 4NM3A 4YBKA 5EYKA 4DH8A 4RIXA 3OWKA 2VTTA 2Y4IC 4H39A 4FV9A 3P4KA 4BIBA 4EH6A 3Q4CA 2JBPA 2RFEA 3TNPC 3D83A 4DFLA 5BUJA 3UIBA 1JSUA 5HG5A 1J3HA 3G15A 1DM2A 3BX5A 1R3CA 2ITVA 2C30A 4U44A 1OIRA 1YDRE 2JEDA 5HU9A 1Y8GA 4V01A 4WG4A 4ZTMA 3UZPA 1SVHA 5HOAA 3C4WA 4AT4A 3PA5A 3GC7A 2PZ5A 3GFWA 3QTRA 4XP0A 5A46A 5B2MA 5K4IA 2GNJA 2BPMA 5CI6A 4GG5A 3S95A 4BF2A 3ZFYA 2V7AA 2FH9A 2XS0A 5AUZA 1ZARA 1IASA 4BICA 5EW9A 5C4KA 2R3OA 4EQMA 1ND4A 5L8LA 1WMKA 5CF4A 3KXGA 5L2QA 3C5UA 2AC3A 5CNNA 3FI8A 3ZU7A 1FMOE 1OKYA 5ANOA 4C33A 4CYJA 5EI8A 4DH5A 2E2BA 4IX3A 1ZYDA 3O8TA 1KUTA 4M67A 4B8LA 2XCHA 4FTLA 3Q4UA 1CTPE 2CNQA 4FSWA 5A4CA 3SKCA 3PE1A 3Q9XA 3TNWA 1F3MC 4YHJA 3ATTA 4KUJA 4L8MA 5AR7A 2WKMA 3WE4A 4YC3A 5I5ZA 1FVVA 2C6KA 2CKEA 3ENMA 3EB0A 3KEXA 3VS2A 4KD1A 5CT0A 4PPCA 4QP1A 4LRJA 4RWLA 3ULIA 1B6CB 4OAUC 3OW4A 4AZWA 4NH1A 3KA0A 5HVKA 4YR8A 1G8AA 4B8MA 5A6OA 1M14A 2GTNA 4C38A 5HD4A 2OJGA 4F1TA 1G8SA 4OTWA 4A07A 5HO7A 3VJNA 3L8PA 5A6NA 4O96A 4BDFA 4CV8A 3TUCA 5ETFA 2QOKA 4DEGA 2Z7RA 2GQSA 3NNUA 4XH6A 3C0HA 3DBEA 5CASA 4JG7A 3IG7A 2WD1A 5L2WA 4LMNA 4BCPA 3A4PA 4QMMA 5FM3A 4RZWA 1V0BA 4C02A 4HZRA 4FBXA 4CQGA 2PSQA 2EWAA 1UWHA 1JPAA 1OL6A 1UA2A 2PZRA 3JPVA 5CSHA 3K54A 2UUEA 2C5XA 3Q6UA 4M66A 3BEGA 2XNMA 5GNKA 4EOIA 4DGOA 5H8GA 3MA3A 2R9SA 1ZZLA 1GIHA 5DE2A 3ZONA 1K3AA 1W7HA 3GOKA 3QQUA 4GEOA 1YQJA 4YPSA 1GIIA 5DN3A 5EG3A 2OJFE 5LCJA 3ZOSA 3VW6A 3EN6A 3FLQA 1R39A 3GBZA 4HPTE 3BV2A 4IB0A 4R7IA 2ERKA 4XEYA 3EYHA 4KAOA 2CGVA 2W9ZB 3A7HA 5M07A 4E4NA 4JQEA 3BE2A 4PNIA 3UODA 3UOHA 4FZAB 5E90A 2XM9A 3FYKX 4YUQA 4HOKA 2H96A 4W9WA 4D2WA 3FZ1A 2UVZA 2F7ZE 4TWPA 2B9HA 3A8WA 3R7UA 3SA0A 4CXAA 4F08A 1IRKA 3PVUA 4FUYA 1OMWA 3A61A 2HOGA 2ITPA 3QALE 4BDBA 2O65A 2OJJA 4ZTQA 4V0GB 2VTIA 4R3RA 5JQ5A 2C6OA 3BYOA 4FSYA 4O0XA 3PIZA 2CPKE 3PTGA 5IQHA 3I1AA 4AA0A 2E9NA 2WTVA 2O5KA 2YABA 4XG9A 4UZHA 5FLFA 3EN9A 2OFVA 3PWYA 3EH9A 4GYGA 4TPTA 3IO7A 3EQPA 3RALA 1KE5A 4YJRA 2R5TA 2FSLX 3TUDA 4EUTA 4RJ5A 2CKPA 3BGPA 3EQGA 5JN2A 3RHXA 2VU3A 4G3EA 4PL4A 4V04A 4EQCA 3F69A 1M2RA 1SVEA 3R0TA 4RX7A 4XV1A 1W84A 4Z3VA 4YTFA 4YO6A 2UW7A 2XK7A 4MD7E 4W8DA 3CSVA 1YWRA 5ETCA 4ALWA 5BUEA 1PRYA 1OPLA 4HYUA 2VWYA 5AP2A 2PE2A 4FTQA 4KIPA 3D2IA 3OS3A 3LMHA 5FDXA 3UIUA 4GSBA 3PVGA 2Y6OA 1WVWA 2IZRA 3FWQA 3O23A 3NDMA 3Q9ZA 1UU9A 2IO6A 1H00A 4LQMA 5TKDA 3ZBFA 5CAOA 1JKTA 2JFLA 1Q8TA 3GOPA 1PXNA 3R00A 4XLVA 4E3CA 1YHVA 4I6HA 3BLHA 1YI4A 5LJJA 3IPHA 1M2PA 1OGUA 2XK8A 3PLAE 1FQ1B 5DGZA 4FVRA 3CEKA 4KIKA 3DB8A 3SD0A 1P4FA 4KSQA 4BYJA 1PY5A 5JT2A 4USFA 5T68A 1KE9A 3GQLA 4E4XA 4EHZA 3DK7A 5FBNC 5DVRA 4MAOA 2C3JA 3UP2A 1G3NA 3EFWA 4FI1A 2C3LA 3L9LA 4DGLC 5HBHA 2QOLA 4X7QA 3E63A 4U0IA 3R73A 2QHNA 1YI6A 5IZFA 1BKXA 4O81A 3SG8A 2HY81 2J4ZA 4EOLA 2OK1A 4M0YA 2YACA 3H3CA 4C8BA 1NVRA 3AC5A 3PXFA 2XIYA 4DEEA 4A4XA 4ZZOA 4CNHA 2CMWA 2RIOA 4UX9A 2IW8A 4HGSA 5ANKA 4WT6A 2XK3A 3UNKA 1SZMA 4MVFA 3HUBA 3PRFA 3V6SA 5L6PA 2EVAA 2PZYA 2CSNA 5JFWA 1B39A 3TJDA 5I0BA 3GCQA 3JVSA 4ZTNA 2UW8A 3HP5A 4XG7A 2OXYA 3R1NA 4YZDA 3FI4A 3VBTA 3W33A 4O7RA 4AN9A 2EU9A 1OL1A 4RX8A 2WTCA 4LV5A 4ANBA 2R64A 3V04A 5AUUA 3GC9A 3HL7A 3HGKA 3MBLA 4Q5EA 4V05A 4MNEA 5D12A 1QPJA 3R9DA 2IVTA 3CQUA 2GDOA 1Q62A 1WBSA 2B54A 4ACGA 1XBBA 1XKKA 2JDTA 3TDVA 4QP8A 4YJTA 5KMIA 5BVDA 4DINA 4QYYA 1H1RA 2HELA 2A4LA 4FKQA 3QC9A 4GU6A 4UWYA 3VHKA 2BRMA 4H3PA 3E62A 3VS6A 3TZ8A 2C1AA 4IXPA 4F65A 3U4WA 3BU5A 4UMPA 4H05A 5ACBC 2BDJA 4LOOA 4L3PA 4GUBA 4FR4A 2X4FA 2BRNA 3RBWA 3GGFA 1DS5A 4Z16A 3CXWA 4FT0A 2W4JA 3F3WA 3QYZA 3MESA 4FV6A 1H0VA 3ET7A 4ZS0A 4UYAA 3UQFA 5AR3A 4BDDA 1F5QA 3RK5A 3MIYA 4LV8A 4MXAA 4G5PA 2Z7SA 5CANA 4MWIA 3E8CA 4O0VA 1JLUE 3KY2A 4A9UA 5IA4A 3EQDA 3NCZA 2C5OA 2WNTA 3TKIA 4C61A 4DN5A 2JLDA 1YOLA 2X7GA 1Y91A 3CCNA 1OITA 4AE9A 5C03A 2A2AA 3KMMA 4O6EA 4FE2A 2W5BA 4M84A 4DT8A 1RDQE 2QOIA 3O8UA 4HNIA 4BDCA 4DEHA 3VRYA 5ANDA 4DC2A 4ZZNA 2O3PA 2W1CA 3ZFMA 4FTMA 4L9IA 2XP2A 4YZNA 4C37A 3DLSA 4PQNA 3WF9A 3MVJA 1NW1A 3WF8A
chains in the Genus database with same CATH superfamily
3TV6A 4FA2A 5HNBA 2W5HA 3UVQA 5J7HA 3QUDA 2RG6A 3DXNA 1PW2A 3AT2A 5K3YA 4GH2A 5EK7A 4K8AA 5D7VA 5E8WA 5JSMA 4RWJA 2W1GA 2YJRA 3R1QA 3HMPA 3RZBA 3HMNA 2QOHA 1W8CA 4BBFA 3CKXA 4YZMA 3MVMA 3DXQA 4WIHA 1PYEA 3GP0A 2JIIA 4ZSEA 3F2RA 5CVFA 2YCFA 2YIWA 3NNXA 4G17A 4GRBA 4OW8A 3ANQA 5KMJA 2J50A 3Q96A 2JITA 4QMSA 3TTIA 3IOKA 4DT9A 4NKSA 2BAKA 4YSJA 4HVGA 3COMA 2BHHA 2BZIB 3QQFA 4MXXA 3UQCA 3OEZA 2XIRA 4K1BA 5E8VA 2RFSA 3TKHA 1VYZA 2W9FB 2ZDTA 4TL0A 2C6TA 3CTQA 5CI7A 4I6QA 2C3IB 5C8NA 3DTCA 5DEWA 4NZWB 2IVVA 4IAIA 4MTAA 3W18A 4CKIA 4CFMA 5L6OA 4FOBA 4O0WA 2R2PA 2O63A 2PTKA 4JX3A 4U9AA 5AP4A 3W2OA 2WU7A 3QKKA 1S9IA 1W0XC 4YJVA 3FI2A 2V5QA 2X2KA 3IQ7A 4CZUA 5LWNA 1L3RE 2QLQA 3PY3A 4FZFB 4DGMA 2X9FA 2J5FA 4MBJA 3V5TA 4DFXE 2WEVA 4I0TA 4QTAA 2IPXA 5EOBA 3NUAA 5CSXA 4EOOA 3LLTA 2QODA 1NT2A 2ITZA 4E20A 3DAEA 2ZB1A 3QTXA 3ORZA 2W06A 5JZNA 4BIDA 2WQBA 3BKBA 3A2CA 4ACMA 4MXYA 3ZTXA 4BCQA 5FD2A 5JFXA 4OTRA 3OW3A 3I7CA 5CU4A 2EUFB 3DBFA 3MDYA 3O71A 3GU5A 3M11A 4OGRA 5CWZA 3LPBA 5E8XA 4JMQA 3W0NA 2X1NA 5M08A 3BWJA 2JD5A 4FIJA 4R3PA 4ZY5A 3IW5A 1PMUA 2Z2WA 4RT7A 3VUTA 3ZMMA 5AV4A 1ZWSA 2VN9A 3KXZA 4XG2A 4JXFA 3LOKA 4F70A 4G16A 4XOYA 1FINA 4BY9E 3UIXA 4QTCA 2QR7A 3FL4A 2GMXA 2XA4A 2X6EA 4HVDA 1PXPA 4IZ7A 1YKRA 3ORNA 4GK3A 4RFYA 4ALVA 2CCHA 4BCIA 4D4VA 4DG2E 3NZ0A 2XVDA 3Q5ZA 4UMTA 5IA0A 4H3BA 4G3CA 3F5PA 3PIYA 2P55A 4FT7A 4IHPA 2C0TA 4JRNA 4MXCA 3HAVA 5HICA 4FJVA 2HENA 4BDJA 5DMZA 3PJ3A 4EH7A 3DAJA 4AACA 4QNAA 2XEYA 4U43A 4C2VA 4CFXA 4DTBA 4RA4A 3O5AA 1JOWB 4IACA 4DFNA 4NKAA 3RPRA 3SW7A 4X2KA 3UP7A 5IMXA 2JKKA 2W7XA 3KGAA 4QQCA 4JLCA 3EFLA 3BCEA 4XG3A 5F20A 2UV2A 4LM5A 2KULA 1NVQA 2QURA 5F9EA 3JY0A 5J5TA 4CVAA 2IJMA 3TZ7A 3B2TA 4FTAA 2XK4A 1H01A 3WIKA 4EJNA 5K5XA 3G0FA 4BL1A 4DH7A 4EBVA 4HGLA 2OIBA 4JBVA 1BYGA 3FLNC 3ZCLA 2H9VA 5ACKA 1A9UA 4IJPA 5EYMA 3WZDA 4DE4A 2WIPA 4JBOA 5J8IA 3AMAA 4GFGA 4QOXA 2XNGA 4JBPA 4U42A 1NY3A 3C4XA 4O82A 2B7AA 1H26A 2XNEA 5CS6A 3FE3A 3DTWA 4KBAA 4DBNA 1YHWA 5JKGA 3GI3A 4ACCA 3I0OA 1BI8A 2WTWA 4EORA 1PXKA 3CQEA 4FNXA 4R7HA 4XV3A 3VW8A 4EOJA 5HIEA 3DXPA 3BWFA 5FG8A 2I6LA 3K3IA 4O4DA 3UVRA 4AWIA 2YZAA 3G9NA 4IDTA 4B7TA 3L9NA 3F5UA 3EZRA 3MFTA 1M52A 3QQGA 1OGYA 2B0QA 3QXOA 4C3PA 4HCTA 2UVYA 2B1PA 3MVHA 1T45A 3IDBA 3F6XA 4USEA 3NUXA 2ESMA 3FV8A 4RMZA 1STCE 4DEBA 5HTCA 3JYAA 4UB7A 5F94A 1WAKA 1WBTA 4H1JA 4J8NA 4JJRA 3FMDA 5AV1A 4C34A 2BILB 3CTHA 2UZDA 4L52A 2HW6A 4LGGA 4RIOA 5EM7A 4A7CA 3UZRA 4CTBA 2XBJA 4AZVA 4PX6A 4O1PA 2V22A 2V55A 4DF3A 2WHBA 4WUAA 4ZLYA 3BL7A 5CEMA 3MA6A 1O9UA 4BKYA 1WBOA 3AGLA 4FTNA 4QMTA 4WG3A 3ZRMA 2E9UA 4TWCA 4WKQA 4APCA 4CD0A 2RGPA 1UKIA 4F7LA 5A4TA 5KMLA 1W83A 4FZ7A 5KX8A 5IQGA 1WFCA 2F9GA 1NVSA 4TT7A 5I9XA 4QMQA 1FGKA 3PFYA 5FRIA 3OY3A 3HRFA 4D9UA 3OWLA 5A3XA 4BBEA 2G2HA 2QQ7A 4U97A 2WTKC 3LXKA 3OTVA 2QKRA 4M69B 4DEIA 4KRCA 3DFCB 4O91A 4M13A 4Y8DA 3I60A 4BCJA 3BHHA 3MFRA 1MQBA 3WZKA 3E8NA 3IW8A 3OUKA 3F7ZA 1OECA 5IEVA 1LEWA 4FSUA 3R8MA 5BNJA 2VTOA 4BCKA 3FMMA 2HZNA 4I5MA 1S9JA 1MP8A 2VO3A 2VTRA 1JWHA 5FXQA 4JS8A 4OTQA 3AT3A 4A9YA 2W4OA 3FXXA 1M2QA 4J71A 3MTFA 2BUJA 3BHYA 3QD3A 4I4EA 3OUNB 4YJOA 2W1EA 3AOXA 4I5CA 3QQHA 3R8ZA 4EYMA 4DH3A 3DBQA 4DEAA 3C13A 4XYFA 2BRBA 3O7LB 3CPCA 4MKCA 4CFNA 3PY0A 1SNXA 4L00A 2I40A 2WMSA 4WNMA 5EKNA 4MF0A 5FDPA 3LM5A 2IZSA 3VBQA 3EL7A 2VWZA 4BJJA 2O2UA 2PWLA 4ZJVA 4JDHA 2OSCA 3D7TB 4M7IA 5EFQA 2CLQA 3TKUA 3U6IA 5BX0A 4K0YA 3G2FA 2C3KA 3LCOA 4HPUE 5EYCA 4ANLA 4CFWA 4AN3A 5E9EA 3KKVA 3WF5A 3QQLA 4KABA 5CF8A 2B9FA 3F88A 5IDNA 5J95A 2R3MA 4GT3A 5KNJA 3O8PA 3HZTA 2WTJA 4KIQA 2OXDA 2PE1A 1VR2A 5C01A 4QMVA 5ITAA 3BLRA 4MF1A 1TQIA 3QYWA 3R7OA 2EB2A 4QYGA 3BEAA 5G1XA 2XF0A 3I0QA 4LFIA 3NCGA 2ETRA 4QMXA 3VS5A 5CVHA 2R3JA 1PXIA 2XRUA 4IB5A 4LRKA 5AJQA 3VBXA 4EOQA 5J79A 1YRPA 4PMTA 5HD7A 5DR9A 4ZJIA 3FKNA 1JQHA 3L9MA 1KV1A 4D0WA 4OBOA 3V8SA 4YLLA 4AU8A 1G8JA 4EK3A 3FMHA 2XYNA 3R7GA 3VS3A 4UN0C 3ZSHA 4EEVA 5HLNA 4QP3A 5CF5A 3V5PA 3S2PA 2VZ6A 5HNGA 4BWKA 3KRLA 3M2WA 2OJIA 3NRMA 4EOPA 2VGOA 4E1ZA 3NIZA 3SLSA 4GMYA 3O2MA 3PVBA 1Z57A 4AOJA 5AV2A 4W8EA 4IJ9A 5DA3A 4FTCA 2JKOA 4YP8A 4BB4A 3KVWA 3UMXA 4O27B 5BMMA 3UO5A 2JDRA 5LVNA 4NFMA 3AD5A 4OR5A 4Y72A 4D2PA 4UXLA 1ZYCA 4C3RA 2BROA 4CSVA 1GZOA 1YI3A 2P4IA 5IKWA 4AAAA 1KOAA 4C4GA 2YZLA 3QRKA 5E7RA 2PVKA 4FL2A 3BV3A 2ITYA 3JR1A 2ZM1A 5CT7A 4XP3A 2JIVA 3RMFA 3POZA 4N4SA 3F66A 3PXRA 3W0SA 1I09A 3VQHA 1PHKA 3TNIA 5B7VA 5IISA 4BCMA 1CDKA 4FGRA 4DCEA 4F09A 2CDZA 2GNIA 3ACKA 3LAUA 4ZSGA 3MVLA 4HW7A 4OBPA 2OZAA 4PTEA 3MWUA 3OY1A 3R8VA 3W0QA 1W2CA 1U54A 3TI1A 4C4HA 3MB7A 2C6IA 3E7OA 1GIJA 3RJCA 3PXQA 3ODZX 4PP9A 3FJQE 2IZUA 3LFFA 2JC6A 3H9RA 4XLIA 2XALA 3IDCA 4EOSA 4FV7A 4EK4A 2PULA 1JSVA 1AD5A 3KRWA 3QZFA 4EZ5A 1ZAOA 2HZIA 3BZ3A 4AOTA 3KULB 3OTUA 2XBAA 2CNVA 3PSBA 3Q4TA 5H2UA 4IQ6A 4D2VA 3CIKA 4R6VA 4D55A 3ORMA 3F3VA 4XG4A 3HV4A 4P7EA 4XRLA 3LXNA 2X8DA 4WA9A 1O6LA 1XO2B 1B38A 1OIUA 4OT5A 4YJUA 4N57A 3NFFB 2BRHA 5M4FA 1JKLA 2HCKA 3TM0A 5IF1A 3V8TA 3U8WA 3UDTA 3HMIA 1H4LA 3C0IA 4E6CA 4FIEA 4ZP5A 2NRYA 2VTAA 1V0OA 4BZNA 5JFSA 4AZTA 2PMLX 4G2FA 2FUMA 4BZOA 2YCSA 2X7FA 4MXOA 4Q9SA 4E73A 2E9PA 1ZMUA 4QMNA 2F57A 2WMWA 3TJCA 5EW3A 1Z5MA 1CM8A 4GW8A 3CY3A 4GU9A 4F6UA 1OL2A 3PZEA 2GHGA 3CGFA 4RJ4A 3UBDA 4RZVA 3RK9A 2XIKA 2QD9A 4P4CA 1UU8A 1TVOA 3FSFA 4ZMFA 2XARA 2ITQA 1KE7A 3FZPA 4JIKA 2R7IA 2QI8A 4X2FA 4CLJA 5KKRC 3C4CA 1J1BA 1XH5A 3TN8A 5HE3A 3DLZA 1H1QA 3ORKA 4D5KA 4EK5A 4ANSA 3OG7A 4O7YA 3N4TA 4BDGA 3LXLA 1Y6BA 4E4LA 3CS9A 4FZ6A 5AV0A 1PMVA 4BI1A 4BZDA 4F9WA 2UZWE 3C5IA 3ZZWA 4CT2A 5H8BA 5TT7A 4X2NA 3C4EA 1SM2A 2W5AA 4YZCA 5CXHA 3KL8A 3OXZA 3REPA 4YTHA 4J1RA 1HCKA 4FKLA 4I92A 3VF9A 2X0QA 4QMYA 2OJ9A 3EWHA 3MB6A 3VBWA 1YHSA 4JQ7A 3Q32A 4EZ3A 3O17A 4PL3A 4JI9A 5FTGA 5HE1A 4NSTA 3GQIA 2R3HA 5A4QA 4FZDB 4PPAA 1REJA 5DT0A 3ZLWA 1XJDA 4IAKA 5JH6A 3NVKI 5F4NA 3VWAA 3V01A 1OKWA 2Q0NA 3I79A 4I6BA 5CENA 2PMOX 4TYIA 4Y46A 4ZOGA 3RGFA 4DEDA 5IQDA 4MYGA 3AKKA 2UZBA 1CMKE 2XB7A 4AW1A 3OC1A 3BBWA 3HEGA 2CLXA 3QD2B 4EOMA 5CX9A 1OVEA 2W1ZA 1GZKA 3QBNA 2B4SB 5FP6A 3ETAA 4J8MA 1TQMA 4ITIA 3RP9A 3IS5A 2ERZE 2R3GA 2C6DA 3PY1A 3FLSA 4RBLA 3UOKA 1YXXA 3AD6A 4AA5A 2C47A 2PVNA 3R7EA 1RJBA 3IK3A 3NS9A 3OCTA 1P2AA 4K9YA 4U8ZA 5J87A 5CEKA 1W2DA 3KRJA 3SOAA 3LJ1A 5FEDA 5LVOA 4QQ5A 2BDWA 4KIOA 1FGIA 2GHLA 3C4ZA 3A7GA 2RSVA 3CC6A 2WOUA 3P5KA 4JT3A 4O7SA 5EYDA 2W4KA 4QQJA 1EH4A 2YFXA 5DOSA 3UOLA 3LJ2A 3UDSA 3PPZA 2YWPA 5CALA 4WG5A 5L4QA 3NPCA 2GQGA 4BFMA 5IUGA 4EHVA 3FMLA 3H0YA 1KSWA 5I3OA 3ORLA 3V5JA 3BGQA 2UW3A 2RFNA 5HQ0A 4YO4A 2X2MA 4CFUA 3UZTA 4M69A 4XJ0A 3LZBA 1DI8A 4XG6A 5C8MA 3LFCA 4F63A 1A06A 1DI9A 2RG5A 3CJGA 5AWMA 1ZY4A 4UEUA 2ZFYA 5A4EA 2UW5A 1H27A 3PWDA 3AKJA 5CU3A 3ZRLA 3ZZEA 4H36A 3ZO3A 4XMOA 2G1TA 4J99A 2YIXA 4J95A 3GCVA 1YXTA 4MQ1A 4ITHA 2WMUA 2AEGA 5CAVA 2XEZA 3NAYA 3PJCA 3CJFA 3QRUA 4QTBA 3AG9A 3FPQA 3UPZA 2V0DA 3GC0A 3HUCA 3RVGA 3QQKA 5H9BA 5IQAA 5GIOE 2FB8A 2J6MA 1M7NA 2VTSA 3ZS5A 3NNVA 2YDJA 3UTOA 2CN5A 3T9TA 5J9LA 5TOZA 4PL5A 5IA3A 3UG1A 3OVVA 3E5AA 3NUNA 4LL5A 4HJOA 2BCJA 3R9OA 4DDIA 1AGWA 5IUIA 2WTDA 1GY3A 4FV0A 4L46A 1OUKA 3HECA 3RAWA 4XP2A 2I0YA 4FEWA 3DV3A 2JGZA 3U54A 4BJJB 2JDVA 4I20A 3D5VA 3DPKA 4WNPA 1XH7A 1YOMA 2VAGA 3KRXA 3K3JA 2OKRA 4PDSA 5F95A 2YHVA 5DRBA 2NNWB 4KKGA 1UKHA 3FHRA 4KKHA 4QMWA 4BVUA 5A14A 4PDYA 3ODYX 2VTPA 3SW4A 3VS7A 1JSTA 4UALA 4EWQA 5IA1A 1PYXA 4TYGA 1U54B 5EHLA 5D1JA 2DS1A 3R83A 2UZEA 4YLKA 2GPHA 1FVTA 2VO6A 4FYNA 5TO8A 3S00A 5BVWA 3V3VA 3P7AA 4OT6A 3UJGA 5LVLA 3DFAA 1Q8ZA 4PTCA 4EHGA 3ZUUA 5CZHA 1LPUA 4EH4A 2I0EA 3LQ3A 4RG0A 3RPVA 1ZOGA 4RJ7A 3D5WA 3RPYA 4DDGA 4L45A 3TNHA 3GEQA 4FNWA 4S2ZA 3TZ9A 4CV9A 3LCSA 4S33A 2ITUA 5M09A 1UU7A 2QNJA 2AC5A 4TTHB 2YIYA 4EK8A 3N9XA 3NYVA 4QMPA 4ASEA 3I6UA 3GU8A 4Z9LA 4FKOA 3FXWA 1U5RA 4JX7A 5M56A 3EQBA 2J0IA 3RWQA 5E8SA 3DKGA 2ZV8A 2VD5A 2PMNX 4FV2A 4KB8A 1H08A 2RF9A 2YDIA 4YPDA 3I5ZA 3AC1A 2P2HA 4ZK5A 4Q2AA 4ENYA 4D1SA 3KCKA 2ZMDA 4M14A 2B53A 2R3PA 5EKOA 4L7FA 4QYEA 4WNKA 3GCUA 1E1VA 3RNIA 4HVSA 3BYMA 5DT4A 5CAQA 4E6AA 4M97A 4F6SA 4IM2A 5G6VA 2X9EA 3W2RA 4OBQA 5HX6A 1OPJA 2WAJA 2YM8A 1Z9XA 3L8VA 4EOKA 2ITTA 3L1SA 3QTWA 2FGIA 5HI2A 4C58A 5AIRA 5DFPA 3WYYA 3CE3A 1GOLA 3GVUA 3MH2A 3QU0A 4R8QA 3FKLA 4K33A 1J7UA 4LOQA 4U41A 1QPEA 4QPSA 3QCSA 4DH1A 2GNFA 3A99A 4IIRA 4CTCA 1ZYLA 3JS2A 3NWWA 4RIWA 4TNDA 5AP1A 5M55A 3LMGA 4IFCA 5GIPE 5AUXA 1K9AA 3G90X 2IWIA 2QLUA 3DKFA 4RC4A 4J96A 2R3LA 2KTYA 3PXZA 4AGCA 4IM0A 1H8FA 3IGOA 3IOPA 4OTIA 2VO7A 5BYZA 3VAPA 3UOJA 1XMMA 3GNIB 3HMOA 4G6LA 1XWSA 4IADA 5E1EA 3QQJA 5M44A 5EI2A 4RGJA 3QZHA 3MJ1A 2H34A 1QL6A 4I0RA 4XCUA 5HVYA 5IEYA 4BDEA 3A62A 4YC8A 3OWPA 3DT1A 4FV1A 4JRVA 5CU0A 2XJ2A 3CGOA 4NTSA 3W0OA 3FZSA 4EZ7A 1FBNA 4JNWA 2C5NA 2G2IA 3OOGA 2OIDA 2JKMA 1DAWA 4MK0A 2HIWA 1YDTE 2ZOQA 1IG1A 3PLSA 1CSNA 3RM7A 4DHFA 4E7WA 4JDIA 2RL5A 5KKRB 3I5NA 3MPMA 1SYKA 2ITOA 4IB3A 1UNHA 4M15A 2C6EA 3WIGA 4OTDA 3NGAA 4L42A 4RQVA 2BZHB 2O0UA 1IEPA 4P2KA 2QOCA 3RNYA 3P08A 3EQCA 3COIA 5KHXA 4J53A 4I93A 2XNNA 1JBPE 3BQCA 5EM6A 4CLIA 3EL8A 5EDQA 2OIQA 3VF8A 5L8KA 4F9CA 5KMKA 3K5VA 4RFZA 5LVMA 4ZTHA 2BTRA 1V0PA 4YHFA 5IUHA 3EN4A 4FUXA 5JRQA 1YOJA 1Q97A 3ZLSA 4GL9A 4RQKA 4BHZA 4ZLZA 3LMIA 2P33A 4NJ3A 4MH7A 5DI1A 5DHJA 4E26A 2ONLC 4TY1A 5H3QA 3PSCA 4FG9A 3RHKA 4EH5A 5M4IA 3C0GA 4G1WA 4YU2A 2F4JA 1WVYA 3SRVB 5DPVA 3RAIA 4CFVA 2VX3A 2BALA 4AXCA 4JR7A 4D58A 4PMPA 4Q9ZA 3E8DA 2W1IA 5IQBA 5AX9A 4R77A 3VVHA 3W10A 3MGYA 2PVHA 4A9RA 4B6LA 1L8TA 2XRWA 2PHKA 5EM8A 4FTJA 3UG2A 1VJYA 3V5LA 1XQZA 4GVAA 2X39A 1ZYSA 2IEWA 4N6ZA 4FT9A 5EHOA 4MNFA 1A48A 4PMMA 3UIMA 3PG3A 3DA6A 4HZSA 3W55A 3LXPA 3FLWA 4U45A 4EL9A 2F2CB 4XHKB 2UW0A 4FIGA 5JZJA 4YSMA 2QCSA 5KE0A 1BUHA 3TEIA 4OLIA 3QWKA 5IDPA 4AAYA 2HAKA 2B55A 2ZB0A 2BFYA 2UZOA 2G15A 3R21A 3MFUA 3LFDA 4U79A 3U87A 5L2IA 4QMUA 4O0UA 4ASDA 3WYXA 3SX9A 2XYUA 2HZ0A 3KXXA 4PWNA 3NW6A 5K4JA 2PL0A 5HO6A 4I41A 4FT3A 2IG7A 4U3YA 4F7NA 5AM7A 4BGHA 2Z8CA 5CU2A 3BU6A 2Z7LA 4AN2A 3OBGA 4NU1A 3AQVA 4EH9A 4BHNA 3MV5A 3FZTA 1PMEA 1H25A 4FX3A 5BQ0A 5CAPA 4NT4A 1OIYA 2JDOA 5ANEA 5J9YA 1YWNA 5HTIA 1AQ1A 3FUPA 3JVRA 4D2RA 4L01A 3R9RA 2UZUE 1REKA 3NYOA 4NTTA 3VUHA 4ORKA 4FICA 1JVPP 4NK9A 3QRTA 5BPYA 3HDMA 1OUYA 3RCDA 3RTPA 4YTIA 2VUWA 3BELA 3PPKA 3FYJX 3TDWA 4IB1A 2VWUA 3D7ZA 5TF9A 2J51A 2O64A 3FAAA 4IAZA 4HNFA 2BDFA 4QYFA 4O7TA 3QC4A 2PVFA 1BL6A 4OTPA 4W4VA 1PMNA 3BI6A 3G5DA 3P7CA 1Q3WA 4D1ZA 4DG0E 4LL0A 3NFGB 1LR4A 3I6WA 2UW6A 3W8QA 3PUPA 1XH6A 4U3ZA 1WBVA 4L53A 3DJ7A 5DG5A 4RLKA 5CEOA 3LIJA 3H9OA 1WBNA 3MH0A 4YJQA 5DNRA 1W82A 4JOAA 5EQYA 3P5JC 3TIYA 1Y8YA 2LAVA 3EJ1A 2R3QA 5HG9A 3W2CA 4I21A 3Q52A 1Q99A 4JDKA 4ZY4A 5IU2A 5LARA 3MY5A 3M42A 2C6LA 3DDQA 3S0OA 4GJ2A 3P9JA 4CRLA 1GZNA 1KWPA 4FSTA 2W0JA 3GU7A 3NW5A 5CZIA 3ZO4A 4ZSJA 4AT5A 2VX1A 1W98A 2W99B 4XG8A 3NMUF 5LMBA 5GZ8A 2R3RA 3OD6X 3EN7A 4FTIA 1KE8A 4TWOA 5AX3A 3H4JA 3SDJA 4U7ZA 3T3VA 3MH3A 1OL7A 5T3QA 3B2WA 3BU3A 3R63A 5CEIA 3V51A 3RAHA 3O51A 2VV9A 4RJ3A 4C59A 4CG8A 1BLXA 4FTRA 2HZ4A 4KINA 2PVMA 3UYTA 2OF4A 3E8EA 4X2GA 3D4QA 3V8WA 4IANA 3EHAA 4IDVA 4BTMA 4O7WA 3MSSA 4WNOA 2BAQA 2J0MB 3TNQB 5ICPA 4C62A 3OEFX 5J9ZA 4IBMA 4BKJA 4QTDA 1R78A 4UBAA 3IECA 2VWIA 3ZC5A 3ZUTA 4ANOA 4DHIB 3LFBA 1FOTA 1VZOA 3R7IA 1MRUA 5D11A 3T3UA 2RKUA 4M8TA 3HVCA 2J90A 3OHTA 2J7TA 3SGCA 4FSNA 5JMSA 1IA8A 3Q2JA 2UZNA 5AAFA 4C35A 2WEIA 4EH8A 3ALNA 2GU8A 3AMYA 2HW7A 4V0GA 4F1OA 4FEUA 3DS6A 3EYGA 4QP2A 2VWXA 2E9VA 4ZTLA 1URCA 2O8YA 3ZFXA 5JQ8A 4DA5A 4E6QA 3Q04A 1M17A 4FIIA 1PXJA 4AG8A 4JR3A 2AQXA 3SXSA 5FEQA 4ASZA 3KXNA 5HX8A 3HP2A 4AFJA 1QMZA 2VTQA 4EWHA 2WQEA 4G3DA 5EI6A 4CZTA 1Q24A 4AE6A 4DCAA 3IONA 4BRXA 5M06A 1ZZ2A 4MD8E 1QCFA 3C50A 5TR6A 5HCYA 4LV7A 2WPAA 3WF7A 4CZYB 2WXVA 5H8EA 4BYIA 1E1XA 2OH0E 2UVXA 3DJ6A 3RM6A 1BMKA 5KO1A 5KBRA 1MRYA 1W2FA 4YMJA 1ST4A 4J98A 3NR9A 4FOCA 1NXKA 4XV9A 3WZUA 2XM8A 2XJ1A 3VUKA 3EIDA 5AA9A 4FK3A 4IFGA 4DFUA 4TWNA 3O0GA 3PJ2A 5LMAA 4FKJA 3LKMA 5ETIA 5AMNA 3OT3A 2XANA 3E92A 3G9LX 4FKUA 3D9VA 3KREA 3AC4A 3PYYA 3DQWA 4KA3A 3TWJA 3R04A 3FC1X 3VBVA 4E93A 4KRDA 1GAGA 5D41A 4NJDA 2OZAB 2XNBA 4K18A 5CTPA 4D4RA 2GS2A 4XBRA 1YXSA 2OBJA 3BGZA 3NX8A 3PJ8A 3TG1A 3W2QA 3QWJA 4R3CA 3VHEA 4AS0A 5AP7A 2ZM3A 2I0HA 3P0MA 5LQFA 4LYNA 4O7NA 2WQOA 3IW6A 2ZV2A 4H3QA 4E6DA 3ZYAA 1Q5KA 3G6HA 3Q4ZA 3KCFA 4PY1A 1UU3A 2QOBA 3FBVA 4RPVA 4YNEA 1OBGA 4F4PA 2XK6A 1Q8WA 3DBDA 3GCPA 3CPBA 4IC8A 3S4QA 3SRVA 5I9YA 3PE2A 2A0CX 3NUSA 4PNKA 4AW2A 3OXTA 4O0TA 1H24A 4FIFA 3LCDA 2QG7A 2WMAA 3E7VA 4ALUA 3ZLXA 4XNEA 2PK9A 3O7LD 4FNZA 3AC8A 4FNYA 4PRJA 2IVUA 2HY0A 2GQRA 3IGGA 3QXPA 3E3PA 4CMOA 3UE4A 5AR8A 3JY9A 5HTBA 4FV3A 4RWIA 3SXRA 5EHYA 4XOZA 1IA9A 4JG8A 4GFOA 5JFVA 4G3GA 5BYLA 3DGKA 3Q60A 4NM5A 5KUPA 4A9SA 4QP7A 3Q9YA 3R8LA 4GIHA 4TW9A 4FKIA 2FSTX 3BYVA 3PP0A 3VN9A 5A4LA 2VTJA 3BRBA 4GV1A 4GIIA 5AUTA 5B2LA 2J2IB 4WSYA 1PKGA 2GCDA 2Z7QA 3E3BX 4KNBA 3F5XA 4BIEA 4F64A 2W1HA 3QD4A 1UV5A 4FV5A 4JBQA 4X6QC 5L2SA 4Y95A 5FQDC 4L44A 4FV4A 2ZYBA 3ITZA 4WOVA 4KIKB 5ANJA 3R9HA 3L9PA 3OROA 4FYOA 5BVKA 5EM5A 4WBBB 2HK5A 3WE8A 3BQRA 3VNTA 4IWDA 4BWPA 3BIZA 1BL7A 4O2ZA 5L2TA 1UNGA 2JBOA 4UMUA 2WELA 4KBCA 3TT0A 4R78A 5HE0A 2NP8A 2VRXA 4C4IA 2OFUA 4MBIA 3DNDA 3DK6A 4UY9A 5I4NA 2ZDUA 3FHIA 3PFQA 3PP1A 4K2RA 1ZMWA 1YXVA 4S34A 2VTNA 4XUFA 4EH2A 4DFBA 3FZRA 1OIQA 4AOIA 4JVGA 2CN8A 4MXZA 3D0EA 4NCTC 3F9NA 1ZLTA 4C36A 3VUMA 4K77A 1P5EA 2GNLA 3SQQA 4RX9A 4O4CA 2OO8X 3DNEA 1P4OA 2HWPA 4AUAA 3QZIA 2EXMA 4BBMA 4RC2A 1X8BA 2XH5A 1J7LA 1IR3A 4EH3A 3ROYA 4YLJA 5E91A 4RSSA 2F2UA 3RAKA 3VJOA 2AUHA 2X2LA 3QZGA 4L3LA 4CMUA 4QEBA 4I3ZA 4UMQA 3EN5A 4IZ5A 4PF4A 2OG8A 4D5HA 4GCJA 4O84A 2R3IA 4FODA 4EK6A 4DTAA 1TKIA 3OBJA 4F7SA 4F0FA 2PUUA 3FLZA 5E92A 2AYPA 3LFNA