2WTDA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
303
structure length
285
Chain Sequence
SVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 285
sequence length 303
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtdA01
4EYMA 4L42A 2ITXA 3EKKA 4ENXA 4K33A 4CSVA 2VTMA 1YRPA 3D94A 4EEVA 4LYNA 2W1HA 2XNOA 3UQFA 2B9HA 4OBOA 5FP6A 4ZS4A 3LQ8A 3C4XA 2XNGA 2RSVA 4PNIA 4YTFA 5FRIA 3O8UA 4UXLA 4LGHA 2OZOA 4LOOA 5E8TA 4J98A 3SQQA 3EN7A 5L8KA 4IDTA 1ZYCA 1UV5A 4I3ZA 2C1AA 2REIA 3R04A 2OXXA 2HW6A 4AQCA 3MYGA 4EQMA 1LEZA 3LFQA 2VTQA 3ZSHA 2OJGA 1R1WA 4O84A 4JQ8A 2RFEA 1JSUA 4DGNA 4FNYA 2YWPA 4NUSA 3ZEPA 4GKHA 3Q52A 1UU7A 2Z02A 3CGFA 3B2WA 4ANMA 2C0TA 1YDSE 4L52A 4NH1A 4G3GA 3TZ8A 5JT2A 1ZYSA 3LAUA 2JKMA 1FVRA 4IX4A 3MPMA 4HGSA 2HK5A 4FZ7A 4J96A 5IPJA 3ODYX 4BRXA 5KUPA 3BQRA 3O51A 4Z3VA 1WVWA 3QTZA 1LUFA 4ITHA 3OCSA 3QU0A 1H27A 1OKYA 4KS7A 2E9NA 1H0VA 4FIFA 3HA6A 4XG6A 3Q6WA 4FGRA 3Q60A 4O0XA 2HWOA 5BVDA 4QTEA 3IW7A 4WT6A 5KKRB 4RX5A 3I7CA 3PJCA 5EW3A 2VTTA 2C6KA 4JIKA 2R3FA 4WBOA 3VAPA 3FSKA 3H9RA 3U6JA 4IWDA 2JKQA 3EQFA 4AZFA 3FZTA 4QQCA 5E90A 1IA9A 1UKHA 2PVKA 3E8DA 2XIRA 5LOHA 2AYPA 1DAYA 3FL5A 3G6HA 4GW8A 2YIYA 4M12A 4N0SA 4RX9A 4G5JA 2Z8CA 3PG1A 4N6ZA 4OTFA 2WGJA 5DFPA 1PYEA 4QMNA 4LMNA 3VC4A 4PMSA 2EUFB 2OFVA 3FKNA 3F5XA 5A46A 2CGWA 1Y6AA 2ESMA 3SW4A 3BYUA 4RQKA 1PMNA 3F5PA 1RW8A 2VGOA 4XV9A 2IVUA 5AV3A 5T68A 3RKBA 1CKJA 4DA5A 2PVRA 3D5XA 3I60A 4LFIA 5I3OA 5HG9A 2AC3A 1W83A 2WU6A 2VO0A 5F1ZA 3UQGA 3DCVA 2C6LA 4BDFA 2QLQA 4WHZA 4A9RA 2BPMA 5CU2A 2YJSA 4YJSA 4BR3A 1BUHA 3DLSA 4RJ6A 4QYYA 4O1PA 2KTYA 3PIXA 2W1ZA 4OR5A 4L9IA 4X6RA 3CLYA 4QNYA 2VGPA 2X8IA 3BBWA 3LZBA 5IEVA 5KHXA 3RPOA 1JLUE 2YLEA 3Q2JA 5EH0A 4MD8E 5CEPA 4DG3E 2UV2A 4FEXA 4JBQA 2QURA 4DTAA 3C1XA 3UIXA 3C4WA 5KMMA 3POZA 2EVAA 3QC4A 5DI1A 2F2CB 3UVRA 4IH8A 2H8HA 3QTUA 5LWMA 2R3QA 4X7QA 3MS9A 2GTNA 3MIYA 1XH9A 1P2AA 1WAKA 2HW7A 1SNXA 1YI6A 4FKWA 3ZM9A 1HCLA 4JI9A 1V0PA 3ZONA 3I79A 3W18A 4KIKB 1Y8YA 4F9CA 5IQHA 5CF6A 3MTFA 2WAJA 3GCUA 2I6LA 4YZDA 4RIWA 5LVNA 5LWNA 2YFXA 4JS8A 3D15A 4DGLC 3VS3A 3CEKA 2O65A 2GS2A 3GENA 2Y4PA 4DCEA 4GCJA 3MH3A 3IDCA 4O21A 4ARKA 3VUDA 4KABA 2HCKA 2BRBA 5FDPA 3IQ7A 3L8PA 2B4SB 3QWKA 1FVVA 4IWOA 4WG3A 2WOTA 4KSPA 3QTQA 3W2SA 4MCVA 2B55A 2UZUE 2VTAA 2E9VA 3EL8A 4KBAA 5AV1A 4QMVA 4RFZA 3TNWA 4BTKA 4M68A 3DK7A 3CKWA 1MQ4A 5HG7A 3R8UA 4F63A 1U5RA 2ITWA 3GFEA 4QMPA 5L2WA 1URCA 4RX8A 4FEVA 1RE8A 3FQSA 3KRLA 3UOJA 2J0KA 3EMGA 2RF9A 1WBTA 1A06A 4BIEA 4Y46A 2ERKA 4YO6A 2GFSA 3TV4A 2XK8A 3DQWA 4BZNA 4UZHA 1TKIA 3NPCA 3MH1A 5AUZA 2QOOA 4ACDA 1KE8A 2WD1A 3RAHA 3T8OA 4WSQA 3LPBA 3C13A 5FTQA 4AWIA 2WMVA 3HKOA 2RL5A 4TRLA 4ERKA 3NW5A 5J5TA 4BYJA 4FT5A 3LMHA 4OTGA 2ONLA 5IG1A 4BKZA 2OGVA 3FE3A 4GUEA 3TUBA 3GVUA 2WNTA 4HYSA 2PUNA 1NY3A 2Z7QA 5HE3A 3R2YA 4ASDA 4F6UA 4TL0A 3TTIA 3BWJA 4FBXA 2OLCA 2VWIA 1OIYA 2XK6A 3QC9A 2UVZA 3R0TA 2C6MA 4MKCA 3WF6A 4BIBA 2J0LA 3TV6A 5D41A 3A7IA 5BVNA 4IB5A 3UO4A 4Y73A 5EM8A 5LQFA 3DXNA 2VWXA 2YIWA 3EQPA 2VTJA 4QNAA 3NYVA 4ANBA 3UQCA 3SG9A 4FKJA 2XK9A 3AT3A 3R73A 4QMWA 5EKOA 1WCCA 3FLSA 5E1EA 2YCFA 3HZTA 4X6QC 4MH7A 4FV1A 3HRBA 4E5AX 3VNTA 2GDOA 4P7EA 3JPVA 5KE0A 5KZIA 4FVQA 3EWHA 4OTRA 3W32A 1V0OA 3DKCA 3F3TA 5HLPA 4E4MA 4EH4A 3AOXA 1GAGA 3EQGA 4FV6A 1JVPP 3FDNA 3C7QA 4GEOA 3PIYA 4IWPA 2F4JA 2B9IA 4BB4A 5HBHA 1H07A 4ITJA 1GY3A 3P9JA 3W2PA 4C0TA 1M2PA 4FKUA 5AUUA 5HLWA 2R4BA 2VUWA 2XNEA 1FMKA 3Q96A 4G3CA 4ID7A 5DT4A 4MF0A 1YWNA 4HYUA 5HIDA 2OIBA 1H1WA 3AD6A 4AT5A 5DA3A 3UODA 2P2HA 3ALOA 5LCKA 4DEBA 2VTOA 2Y4IB 4CT1A 4DH5A 3CQWA 2Z60A 1O6KA 4BBMA 3PSDA 5LMKC 2GQGA 4DLJA 3DK6A 4FIIA 5T3QA 5IQBA 4KB8A 5IMXA 3HNGA 4RX7A 4R7BA 3GBZA 5ETIA 4ACCA 2IG7A 2RG5A 2RIOA 3K54A 4FK3A 2G2FA 3IOPA 3LCDA 4I1ZA 3FMJA 4OW8A 5CZHA 2HY81 4NM3A 4BDDA 4EOMA 5IEYA 4K2RA 4A9SA 5IUHA 5CXZA 1IASA 2PZIA 3EN4A 4TNDA 4XP3A 4BCGA 5AA8A 3TACA 4C02A 3QZIA 3HP5A 4NJ3A 3UIMA 4GT3A 2GQRA 2R0UA 5FP5A 3LCKA 4N70A 4ASZA 5IUGA 5IQAA 5CEMA 1U54B 4FSYA 4X3FC 3GFWA 1KE7A 5AADA 1Q3DA 5FXQA 4FOBA 2YA9A 3Q53A 5KMJA 3EJ1A 1FGKA 3MY1A 3LCSA 4RJ4A 2X4ZA 3H9OA 5CF4A 2PMNX 3TZMA 3OFMA 2PVNA 1SM2A 3D7ZA 3FBVA 1IA8A 3OF0A 4DTKA 2Z2WA 3D14A 3F66A 4F6SA 3OROA 4AX8A 4K11A 2ERZE 3W10A 2WIHA 3NEWA 2VO7A 5CSXA 5JZNA 4DAWA 2BTSA 4QP8A 2BAQA 4LRMA 5ANKA 3ELJA 3QRUA 4O0SA 4FVRA 4UV0A 3RGFA 3DAKA 1CSNA 4PUZA 3QX4A 4CG9A 1Q4LA 4D0WA 2YHVA 3N4TA 4BKYA 2W1GA 2F57A 3HMIA 4G34A 3MA6A 4WNOA 3TG1A 3KK9A 5CTPA 3V01A 1M2QA 1PXIA 4L53A 4Y72A 3VQHA 4EH6A 5FUTA 5DBXA 2V62A 3EFWA 3PXQA 5G1XA 1K3AA 3ZO3A 4DGGA 2PZ5A 3PSCA 3MW1A 1LPUA 5BX0A 4XJ0A 3LKMA 2XK4A 1KOAA 4IAYA 3NW6A 4F9AA 2RG6A 3OWJA 4MTAA 4BTMA 4MQ1A 2QONA 4IJPA 5CAPA 5E1SA 4CYJA 4FZFB 4L3LA 5H3QA 3R28A 5K0KA 4PTCA 2G9XA 3RHKA 4EK3A 3OT8A 4HGLA 4I4EA 3HAMA 4BHNA 5J5SA 4ZSLA 1BL6A 4TYGA 4PX6A 3TI1A 5HX6A 4I6FA 4RPVA 5HVJA 4AW0A 4PRJA 5FBNC 4HVIA 1M7NA 4G3EA 4KIKA 1XH6A 2CSNA 4PTGA 3FMLA 4D9UA 3WF7A 2WTJA 2RGPA 3LQ5A 5BVEA 5E8WA 4EWQA 5IISA 3FHIA 4FSZA 1YWRA 3HEGA 4F0GA 4AFEA 2X6DA 2YISA 3OWLA 4ZIMA 5A4QA 4E5BA 2YEXA 5EOLA 3VS7A 1MQBA 4O7ZA 1JKKA 3Q9ZA 5B2MA 4WD5A 2XIKA 4D0XA 2QO2A 3WZEA 4X21A 4R3PA 4EORA 5CY3A 2R3OA 3PPJA 4YNOA 3I6WA 4NFNA 2R3PA 2QVSE 2XNMA 4ZS0A 2OH4A 2WO6A 4CV8A 4D55A 4ERWA 2CGXA 4XG4A 5DR2A 4QMUA 4FT9A 3CR0A 5GNKA 3ZSGA 3LCOA 1ZARA 4UWCA 3HVCA 4EBWA 2P0CA 4D4VA 2Y6MA 3O7LD 4RC4A 2GHMA 4AGUA 4DFBA 3L9PA 4A4XA 2OH0E 3VW8A 2WQBA 3M42A 5LXMA 4CCBA 5M4IA 3ULZA 3FV8A 1FOTA 1ZAOA 2BDJA 1QL6A 3OBGA 3QHRA 3MVLA 5ANGA 3PSBA 5EYCA 2CNVA 3ANQA 4FV0A 4A9UA 4FKLA 3QKKA 4XRJA 4NSTA 5IA0A 2O3PA 3EH9A 4XG7A 3V8SA 3C4EA 4UZDA 4O6LA 3A7FA 4FSRA 4D5KA 2E9PA 3BHHA 3CSVA 3W2QA 2WPAA 2B0QA 3OXTA 3ZO2A 4BDGA 4DEHA 4W4VA 1J1CA 3FMDA 5C01A 4CZYB 1W98A 3WARA 4FTRA 1J3HA 3PG3A 4HCVA 2R3RA 4L6QA 3UGCA 1H26A 4J71A 5E8VA 3DNDA 3F6XA 3TM0A 3WE4A 2J50A 3COIA 3PYYA 3BV2A 4HYHA 3BIZA 1F0QA 3MIAA 4IHPA 5BUIA 3GC7A 2YERA 4OAVB 2F9GA 5FXSA 3R7EA 4C57A 4OTHA 4QRCA 3EFJA 2WIPA 4H3BA 4I24A 5M08A 4U3ZA 4ZTRA 2UW4A 5A4CA 1WBOA 3DBFA 3LIJA 3KKVA 3GEQA 3NNWA 2XNPA 3QX2A 2C6IA 2JAMA 2WEIA 4IWQA 4KINA 5DT3A 3P7BA 3E63A 3GCVA 5ETCA 3VUIA 4PDSA 3VUKA 3OWKA 1YI4A 2C3KA 5H9BA 3DTWA 2YN8A 2X81A 3A61A 5CYIA 5AR3A 2IZTA 4QPMA 5FGKA 3RK9A 4RC3A 3OD6X 3DS6A 3L9NA 4MQ2A 4AZEA 4HCTA 1P14A 1Q97A 3BCEA 2F7XE 3BKBA 4FTIA 4PDOA 4IAAA 5IH5A 3AC5A 3TN8A 3HDNA 4F9WA 1JKSA 4FSTA 4JIAA 3R7GA 5TKDA 5JEBA 2HXQA 3VQUA 4AZSA 5JN2A 1XJDA 4FT3A 4ZZNA 3FI2A 4UWYA 1H00A 3RI1A 5L8LA 3NLBA 3VHKA 4D9TA 3U4UA 3QRTA 4UMTA 5KMLA 3R1YA 3RK7A 5E4HA 4G3DA 5JFSA 5AM6A 1XO2B 4TYIA 4R5YA 2VX0A 4F1OA 2VWYA 3KXGA 4I92A 2GNFA 1ZWSA 1CKPA 3DGKA 4AOJA 4FL2A 3FXWA 2EB3A 4JBPA 2QHNA 1Q8TA 4ALUA 3F82A 4QTBA 4U0IA 4FNZA 4MD7E 2XB7A 1SVHA 5CI7A 5KBQA 3R9RA 3NUYA 3TJDA 4F1TA 4O0UA 5J1WA 3CS9A 3R9HA 5FEQA 5J9YA 3EHAA 1YOJA 1R39A 3ZYAA 4G5PA 1U54A 3MVJA 2WQOA 4IVAA 4FV9A 1WFCA 2PY3A 2VWBA 5HO8A 3H9FA 4NM7A 5D10A 3ZC5A 2A27A 2WMUA 3D7TB 5CEIA 3PP1A 3QTRA 3N4UA 2OJJA 3ORTA 3BGZA 1RJBA 2YCQA 2WTWA 4FIGA 5HE2A 3ROYA 5AX3A 4YPDA 5EM7A 3PY1A 4EYJA 4I0RA 4FMQA 3FPQA 3LJ0A 3HV3A 2YDKA 3QQUA 5I9ZA 2QI8A 1H28A 3W8QA 5JGAA 3SA0A 2PHKA 3DLZA 5HIEA 2UW6A 4L8MA 4ZEGA 4FV4A 3A2CA 2WTCA 1OBDA 5KZ0A 2Q0BA 3QQKA 4JQ7A 3M1SA 3RMFA 4ZLZA 2YM5A 2V55A 3PXFA 5DR6A 3ZLYA 4QP4A 4G6OA 3QHWA 4Y5HA 1PXNA 2BUJA 3L9MA 4PMMA 4ZY5A 4YJPA 2XZSA 4L01A 4AU8A 2B1PA 4NCTC 3A4OX 4MYGA 4P4CA 1GZ8A 2EU9A 4UXQA 1TQIA 4ZY6A 5A3XA 4F99A 3VS6A 4EC8A 4YR8A 2QOFA 3CPCA 3RALA 3R7UA 4GYIA 3MPTA 2X8EA 5JFWA 4CNHA 4ASXA 3I0OA 4R3CA 5JH6A 2QU6A 4LUEA 3QZGA 3TXOA 4C62A 4IB0A 4KIOA 5K4JA 5BUJA 4YMJA 1H0WA 4E6AA 1ZY5A 2PSQA 3LQ3A 5LJJA 2W4OA 3C4CA 3FZ1A 3P4KA 5BVWA 3UMWA 5M07A 5AFVA 3UZRA 4O2ZA 4G9CA 3LFSA 2DS1A 4UYNA 3QQGA 4EH3A 3ZOSA 3TIZA 2YZLA 5EHOA 2I0HA 1ZXEA 2FB8A 5CI6A 3O23A 4XLVA 2UW7A 5EYDA 5JRSA 3I4BA 4QMQA 2XEZA 2VV9A 4R1YA 3DB8A 4EWHA 4ANNA 1GOLA 4BWXA 3LXKA 4YJQA 3EN5A 3RVGA 1CDKA 4B9DA 3HP2A 3OCTA 5A6NA 5EQPA 3TWJA 3DBEA 2UZVA 3RCJA 2YM8A 5C9CA 2WTKC 3SHEA 1HCKA 4P90A 2GQSA 3ZLXA 5EI8A 3L9LA 4I6HA 3TKIA 3CC6A 2VWWA 3LCTA 3ZM4A 5GZAA 4AGCA 2J7TA 4BF2A 3NVMB 4EUTA 3AQVA 1H25A 4C3RA 5IQGA 3QALE 4Q5EA 4KD1A 4P2KA 4UY9A 5C8MA 3R83A 4WUNA 1XBCA 4V04A 4KIPA 5DHJA 5EK7A 3HMNA 5EYKA 5HNIX 5ANJA 2NPQA 2VWVA 1OKWA 2J51A 4TNBA 4B0GA 4R1VA 4CEGA 4O1OA 2X2KA 3SAYA 4PF4A 4G6LA 5B7VA 2XJ2A 2ACXA 4MXYA 3TIYA 3PVWA 1I44A 3EKNA 2HXLA 3HGKA 4NK9A 3G2FA 4YBJA 5K5NA 4PL3A 5LCJA 4R77A 3QF9A 5I9UA 5HICA 3COKA 1OL7A 4F4PA 4GS6A 4O0RA 3I7BA 4HZRA 2JITA 3WIKA 5FBOA 4CLJA 4Y83A 3COMA 2VWUA 4Y85A 3Q9XA 4IM0A 5KBRA 5LVMA 1S9IA 2BDWA 2QNJA 4JG8A 3OP5A 3OY1A 4QP9A 2QG5A 4G3FA 5L2QA 2ONLC 4MXOA 2GS7A 2P55A 4ZJIA 4TN6A 3R2BA 3C51A 3B8QA 4CRLA 5J79A 5L6OA 3HA8A 5JRQA 2WMAA 3CTJA 2YIRA 3KF4A 4MXZA 3RAWA 3F7ZA 4CVAA 3O0GA 3BLHA 5M56A 4FTJA 4BCHA 4F08A 2PVYA 2QD9A 2R9SA 4YURA 4ZP5A 2QR8A 4C2WA 3K5VA 5IQCA 4LQMA 4FEQA 2P4IA 1B38A 3NR9A 3IGGA 4GG5A 5HESA 1SMHA 3LFAA 2UZOA 5BVFA 2J9MA 4IQ6A 3G0EA 3T9TA 1VZOA 4Z16A 4USEA 5IDNA 3IGOA 5EYMA 4I22A 4C4FA 4QMZA 5HEZA 3EN9A 3Q4UA 3E7VA 4APCA 2WB8A 1OL5A 4WG4A 4TKSA 1OL6A 3WIGA 2Y9QA 1IAJA 3QUPA 3QLGA 2HIWA 4FR4A 4DC2A 4JX3A 3IW5A 5J9LA 3AC4A 2QOLA 3KFAA 1TVOA 4OBQA 5H8GA 4DH7A 5IMEA 5CU6A 5CS6A 1PF8A 3P08A 4KKEA 3DA6A 3O8PA 4JRNA 2QOHA 3RNIA 3RPYA 3WZDA 2JIVA 4AG8A 2SRCA 1VYWA 2IJMA 2VX1A 3HX4A 3OC1A 4M7IA 1YI3A 3DKOA 3NUPA 4J1RA 3CIKA 4A7CA 3RPRA 3PRIA 3FWQA 1WBPA 2C5VA 3T3VA 1J1BA 2VN9A 3TKHA 4BFMA 2OF2A 2O64A 4IB3A 2R3GA 1OPLA 2VO6A 4H05A 1H1QA 1PMVA 4JDHA 3HYHA 5HCZA 3HDMA 2X6EA 1FVTA 4R5SA 3FZRA 4I0TA 2C6OA 2ETMA 3KQ7A 4IX5A 3NZ0A 2ZB1A 3QCXA 3Q9WA 3BEGA 3D7TA 3DTCA 4IB1A 4AFJA 5AAGA 3UO6A 1WBSA 3WE8A 4RJ5A 4MNEB 4AA0A 4O7RA 2UZBA 1BKXA 4IX6A 3E3BX 5AWMA 5C1QB 3JR1A 2I0VA 4G31A 2NRUA 5A14A 3SD0A 1ZYLA 1VEBA 1I09A 2NO3A 3UC4A 3ZSIA 3VBYA 4O7LA 4O96A 4BDHA 2VRXA 2WMSA 5CSWA 2B52A 5I9WA 2JAVA 3QWJA 2PVHA 4NYEA 4FKRA 1KE6A 4C4GA 4EZ3A 5KCVA 5EFQA 5DYJA 3PLSA 4RFYA 4C61A 4NT4A 2CGUA 2QOKA 1K2PA 5FEEA 2XF0A 2R3IA 4QYEA 5E9EA 5DE2A 1GZNA 1BX6A 3V5LA 1DI8A 3KN5A 3KRJA 3LVPA 4CKIA 3TUDA 2XYUA 3QKLA 3VBTA 1KSWA 4UEUA 2WEVA 4R7HA 4W4XA 3QTSA 2XS0A 5AP1A 4C35A 1TQPA 4JDKA 4AZWA 3V5QA 2DUVA 4TWOA 3OT3A 5AV2A 1JNKA 1KOBA 1QCFA 5KNJA 1Y6BA 1U46A 2C69A 2FA2A 2VTSA 2ZV2A 4JAJA 4S33A 5EM6A 3EQDA 3W2OA 5A54A 4NM5A 2UZEA 4L43A 4OT5A 2VTRA 2V7OA 2R3KA 3KCKA 4I23A 4D2VA 4CFNA 1OM1A 2WELA 3VHEA 4DG2E 5M4FA 3DV3A 4EJ7A 2BCJA 4XOZA 2YM3A 3AD5A 2GNGA 1OL1A 4IDVA 1Z9XA 4EQCA 3PY3A 2BRMA 4OBPA 4L46A 4GUBA 5I9YA 2ZOQA 1J7UA 5CZIA 4GT5A 2OJFE 4BDJA 3NNXA 4AN9A 4JVGA 3L8SA 4I6BA 4D1XA 4Z55A 2PYWA 2R3NA 3HV4A 1ZYDA 3QCQA 2ITPA 1PJKA 1PMUA 1SVGA 2VTIA 4F0IA 4M14A 3PFQA 2IO6A 4O0YA 3N4VA 5GZ8A 3DFAA 4JAIA 3BLRA 4FTMA 1G8AA 4IVCA 4TW9A 3F2NA 4X2KA 2JBOA 2JDOA 4F7JA 1MP8A 4BCIA 5M51A 4XV1A 2GNJA 3UOKA 1YOMA 4FKTA 1CKIA 3V5JA 4J97A 2YITA 3Q4ZA 4LOQA 4I5HA 4E20A 2XRWA 4D4SA 4FG8A 3UP7A 4DGMA 5L6PA 1ZYJA 3HMPA 2NNWB 4E1ZA 2X1NA 4FV7A 4GT4A 3ENHA 2YIXA 3E64A 4FF8A 4XX9A 5ANDA 4E7WA 2FSLX 3ZO4A 1P4OA 3OXIA 1Q24A 2W5HA 4ANQA 3E8CA 4PL4A 2H6DA 5HGIA 1Q62A 3VJOA 4BI2A 2X9FA 1MUOA 3ZHPC 1F3MC 4UALA 4C59A 3TV7A 4DHFA 4YU2A 2IVSA 3UPZA 4IMYA 1A9UA 2GFCA 4EOPA 3DU8A 3R21A 2XIYA 4IAKA 4CMOA 4RRVA 4HCUA 4TPTA 3ZRKA 3AC8A 4KRDA 3SG8A 1QPJA 4NM0A 4BCPA 3LXLA 4S32A 2QO9A 2ZVAA 3VBWA 4BGGA 5I9XA 4ZSAA 2RFDA 2Z7LA 5HBJA 3UTOA 3FY2A 3PJ8A 5AV0A 3RTPA 2FYSA 2VX3A 3D5UA 1WVXA 4FIEA 5J95A 3ZH8A 4A4OA 4WBBB 4CKRA 5M4CA 5LVLA 3NRMA 3U8WA 5EOBA 1JQHA 3E88A 4DH3A 4XLIA 3GXLA 5JSMA 2F49A 1UA2A 3K5UA 3MVHA 2PE1A 2X7OA 4BTFA 2BZKB 1KUTA 1H4LA 4M3QA 3I5ZA 4L45A 4M0YA 1Q5KA 3RPSA 2V22A 5K5XA 4ZTQA 5D7AA 3SC1A 4ZLOA 4W8DA 4I0SA 2RFNA 2VTLA 4K9YA 5C03A 4K0YA 1M52A 4KKGA 2PU8A 4WRSA 4EK8A 2VTPA 1ERKA 3K3IA 2R7IA 4LV8A 4AE9A 5B2KA 5HX8A 3KMUA 1KE5A 5HIBA 2XH5A 4NEUA 3NAXA 3DXQA 1EH4A 2OJ9A 5M06A 3IDBA 3RJCA 4Z7HA 2EXMA 5IA3A 3BYMA 3ZBFA 2PE2A 4P5ZA 3TDWA 2QR7A 1DAWA 4YUQA 4KBCA 4C3PA 3SDJA 3O96A 3HLLA 2J5FA 4YPSA 2XYNA 5GINE 3Q32A 2BVAA 2JDVA 3P78A 4N4SA 4KIQA 1STCE 4O91A 2QOCA 4AA4A 4CLIA 3EYHA 2GPHA 3GNIB 2W1IA 4B4LA 4BZDA 2BZHB 2ITOA 2ITYA 5I9VA 2C4GA 3BZ3A 4K1BA 3TJCA 2R3JA 2ZV8A 3KRXA 3FC1X 3G0FA 2I40A 3BQCA 3IPHA 2FH9A 4BBFA 2LAVA 2C3LA 2Z7RA 4PQNA 1NVQA 4D2PA 4U81A 5HOAA 3ZUVA 5A4EA 5AIKA 3OUNB 3UYSA 3ZO1A 5F4NA 1OUYA 2W17A 1OIQA 3CP9A 4M13A 4ZZMA 4E8AA 4PDYA 1YXXA 4IZ5A 4YJRA 4MNEA 2GNHA 4UMUA 4XNEA 2W9FB 3R30A 3KXZA 1ATPE 3V6RA 3KVXA 2X8DA 4EH7A 2CLQA 3E8EA 5E7RA 2BAKA 5JQ8A 2IZSA 1QPCA 5BYYA 2XCHA 4D2WA 4H3PA 2IZUA 2JC6A 4KA3A 4HVHA 4FA2A 1P5EA 3TT0A 5GJGA 1BI7A 3VUHA 4EK5A 4YTIA 3VJNA 4RG0A 4XEYA 3SXRA 3V8TA 4AACA 3MN3A 4YO4A 4XCUA 4X3FB 5DG5A 2CKPA 4WIHA 3NYXA 5AMNA 2JEDA 2Y6OA 4D58A 2R3LA 3DT1A 3QUEA 4KNBA 4AW5A 4O86A 4ZMEA 5AUVA 1R78A 1VR2A 3ORIA 1XBAA 4FIJA 4HNIA 5AR4A 5IQIA 4LMUA 3VW6A 2QODA 4DYMA 3NW7A 2OIQA 4XBUA 5JMSA 4QMTA 3RAIA 2UW5A 3O71A 4PP7A 3UJGA 1UWHA 3PZEA 1KV1A 1JAMA 4KKHA 4O0VA 3F69A 1M7QA 4FVPA 1WBNA 2PZPA 5J8IA 4RA4A 4Q9ZA 1NT2A 3U9CA 2OJIA 5DEYA 3IG7A 2YAAA 5A9UA 5BVOA 4FSMA 4BC6A 3EQHA 4IE9A 4FZDB 4AOTA 5LVPA 3Q04A 4JDJA 4DT8A 1KWPA 4U97A 5DPVA 4EQUA 4NIFB 5CAUA 3F3WA 4AZVA 4DT9A 3CJGA 5ETAA 4W4YA 2UZWE 3VRYA 4B6LA 3E93A 1PKDA 2C5XA 5I4NA 4BVUA 3VIDA 5HU9A 5CASA 1PMEA 3W55A 4FX3A 2IZRA 5AUWA 5HHWA 4U3YA 3DXPA 3F7WA 5DN3A 2WMXA 3UZPA 5JK3A 4IVBA 3MB6A 4WNKA 2XIZA 1XH7A 3NUXA 1H01A 3UO5A 3R63A 4X0MA 4ANSA 5J87A 1H8FA 3DNEA 3FI8A 3UOHA 3E62A 3NWWA 3AD4A 3LFDA 4J99A 2QOQA 3A8WA 4FTTA 4CFWA 4U42A 2JDTA 4B99A 4M84A 2BMCA 3R6XA 5IA1A 4G6NA 3PPZA 5BPYA 3AT2A 3R1NA 4CQEA 2JFLA 1KE9A 2XP2A 3A7GA 2IW8A 4DINA 3S3IA 3F2AA 1CTPE 3QL8A 2XK7A 4JG7A 2OXYA 5CEKA 4HW7A 1W7HA 2HAKA 3PXKA 3U6HA 2CN8A 3EZRA 4JNWA 3TNHA 1Q61A 1F5QA 3LFCA 3GOKA 1H08A 3SOCA 3LMGA 4F7LA 1YXVA 3N51A 5CU0A 3QFVA 2R3HA 3AC1A 4KRCA 2EXEA 1IRKA 4F6WA 3FMKA 2BRHA 3ORZA 4MD9E 5ANIA 2ZV9A 4IAFA 3BV3A 3OS3A 3DJ5A 1ZRZA 3A4PA 4FKIA 4U45A 4FOCA 5HI2A 5CF5A 4BI1A 3AXWA 2LGCA 4C33A 4M0ZA 4PL5A 3U87A 3NIZA 3BBTB 4EOIA 1DM2A 4W8EA 5CENA 5C8NA 4JOAA 3P5KA 3MVMA 4KUJA 3FAAA 3DBDA 4UMQA 3TZ9A 2DYLA 1Q8YA 3FMEA 5JGBA 3G51A 4EH5A 5DLSA 4F65A 3HAVA 4QP3A 2BRNA 4ZSGA 3NUSA 3ORPA 3QXOA 3ULIA 3EQIA 5HG5A 2BIYA 3EQCA 3O7LB 3W1FA 2V5QA 5TF9A 5HCXA 2GMXA 5L2IA 4TTHB 5BMMA 4EHGA 3HRCA 3GT8A 5FTGA 3REPA 5TT7A 5IQDA 2C5OA 3NCGA 2J6MA 2C5NA 2UW3A 2XEYA 5AP4A 5DH3A 3L8XA 1Q41A 3O8TA 4ANOA 5L3AA 4YBKA 2J0MB 4J95A 5IKWA 1ZOGA 4IM2A 3HMMA 3I81A 5HD7A 1R3CA 4RIYB 4MBIA 4QMYA 4QP1A 5LMAA 5BNJA 4FEWA 3WILA 2YCSA 2WTIA 4WKQA 4R6VA 4RC2A 3QTWA 3MA3A 2C6DA 3KXHA 5ACKA 4BN1A 1UVRA 3B2TA 4V05A 4A06A 5C4KA 3I0QA 3I6UA 2PUPA 3U51A 1M17A 3WZKA 4DFNA 3BU5A 3OVVA 3LHJA 4EK6A 4BDBA 2VZ6A 3TTJA 3VBXA 4CD0A 4YHTA 2H96A 5CQWA 3ZU7A 4YJVA 3LFBA 1CMKE 4UX9A 2W5AA 3LOKA 3LM0A 3RZBA 3SV0A 4CQGA 4WUAA 5AR8A 4M67A 4E73A 3RK5A 4CFFA 3UIBA 4IX3A 5F20A 4ANLA 2WOUA 5M55A 4ZTLA 2HENA 1PYXA 4YZNA 1OECA 4XS2A 4AF3A 4ACHA 4AW1A 4E6CA 4ITIA 1HOWA 1PXJA 3KXMA 2JBPA 2RFSA 3ORKA 4EOJA 4GK3A 4MBJA 4U7ZA 2W1DA 3TNPC 4DEIA 2XUUA 4ACMA 4RIOA 4PPAA 3MFSA 3TL8A 4NFMA 4E26A 3Q4CA 4BDKA 3VS0A 2CN5A 4BGHA 2ZDTA 4O7VA 3P0MA 1SVEA 3E3PA 3QRIA 4X2GA 5LMKA 4GK4A 4XYFA 2XKDA 3P7CA 4O7TA 3DBQA 1XH8A 2YJRA 4MNFA 3U6IA 3CGOA 3FYKX 1YKRA 3ID6C 4BDIA 1YW2A 2QOBA 3FZSA 3KN6A 3VO3A 2ITNA 5CNOA 4YTHA 4D5HA 4E93A 2XBAA 4ZSJA 4FE2A 3KXNA 3GU6A 3HRFA 3WYXA 4GKIA 2OIDA 4C3FA 2XMYA 2WMQA 5G6VA 4EHZA 3TCPA 3F9NA 4RJ7A 4PDPA 5HVYA 3HV7A 3ZFXA 5F94A 5HORA 4X3FA 1GZOA 2XIXA 2WMWA 3QQJA 5IA5A 3H0ZA 3KRWA 4MWHA 3V8WA 3VS2A 4B7TA 3CCNA 3R1SA 4IZYA 4ZY4A 3SW7A 2VU3A 3JXWA 2C3JA 4LL0A 1ZMUA 3MFRA 2Y0AA 1JOWB 4Z9LA 3TNQB 5CT0A 3DPKA 3SXFA 3IDPA 5A6OA 3U55A 5E8SA 2PL0A 3VUGA 2JKKA 3PJ1A 5GZ9A 4O38A 3OTUA 4ZSEA 3R8PA 4C36A 4DFLA 3AMBA 5DMZA 3JVSA 4ZLYA 2W4KA 5K3YA 4CGAA 4HPTE 3GC8A 2C6EA 3PWDA 3DQXA 3GOPA 3NUUA 3R8VA 4CKJA 3BYSA 2FSMX 3KU2A 5D9HA 2YM4A 3DAJA 4F70A 4YHJA 1JSTA 2C0IA 3WF8A 2YCRA 4L7FA 4PP9A 1OZ1A 1XHAA 4E4XA 1G8SA 2I0YA 1XWSA 4IVDA 3VUMA 3A62A 4NIFA 3D0EA 1GNGA 2PUUA 1H1RA 2H34A 3ZZWA 4CMUA 5HZNA 4FUYA 3VRZA 1Y8GA 5C26A 4HOKA 3E87A 5TE0A 4IW0A 4U6RA 5CSHA 4CT2A 5IQFA 1UKIA 3HECA 3R8MA 2B53A 5AX9A 2ZJWA 4HJOA 4CXAA 3KY2A 3LM5A 4YJOA 3ZRMA 4ASEA 5IA4A 4E4NA 4ZJVA 4RJ8A 5ETFA 3ANRA 4RVLA 5EI2A 5HG8A 3UMXA 5CWZA 1WBWA 3NUAA 2JLDA 3TEIA 2CHLA 3OZ6A 5JFVA 2I7QA 4DGOA 4FKPA 5ACBC 4XV3A 3MH2A 3CY2A 4J52A 4RZWA 3DAEA 3E7OA 3QUDA 4FKGA 4QYHA 1AGWA 2OKRA 3LE6A 2PVLA 5J7HA 2Y7JA 5C27A 3EFLA 2OICA 3COHA 4X2NA 4C38A 1PHKA 4W9XA 4FC0A 4N6YA 4YZBA 2ITQA 3ITZA 4A07A 2C30A 1FBNA 3ODZX 5IF1A 4IEBA 3PXYA 2BHHA 2W99B 3AG9A 4JXFA 4JX7A 3F88A 1ZOHA 4GL9A 2UUEA 3GU5A 3TUCA 3FL4A 3JY9A 3R7IA 1J7IA 4UYAA 3G9NA 2WTKB 4JRVA 3BHVA 5DNRA 3BRBA 5E8ZA 5FD2A 3S4QA 3UG1A 3ZCLA 4E6QA 5M44A 3QXPA 3A60A 3QKMA 4W9WA 5EQEA 5GIOE 2V7AA 2VAGA 3LLTA 4Q9SA 3SLSA 1YXSA 3VBQA 5M53A 3PE1A 5GJFA 3NMUF 5IQEA 3JUHA 3R02A 4FSWA 3QZFA 3G15A 4APPA 3LMIA 4O7YA 4X3JA 4XH6A 1BI8A 1LP4A 2OSCA 2WTDA 2BZIB 4BDCA 2UZTA 1CM8A 4OT6A 4V01A 5CU3A 5CSPA 1W0XC 1ND4A 1OIRA 4FSUA 1O9UA 4RWIA 4UBAA 3OBJA 2H9VA 2PMLX 2G1TA 4A9TA 2ZM4A 3PJ2A 2WKMA 1UU9A 3HV6A 3UDBA 3P86A 1YQJA 2QU5A 1AD5A 4BYIA 2X39A 2XKFA 5HTBA 2R0IA 4DLIA 4EI4A 3ROCA 3WBLA 3VUTA 1J7LA 1OIUA 4Q2AA 2UZLA 3NIEA 5DWRA 4DEDA 5JFXA 3GGFA 3BHTA 2X9EA 2JIUA 4IBMA 2J90A 5HO6A 2ETRA 2WQEA 3UZTA 4GYGA 4RIYA 4KSQA 3QD3A 3PPKA 4I21A 3ZBXA 2C5YA 4GFMA 4EZ7A 3R00A 4S34A 3KMMA 4G17A 2XJ0A 5BVKA 3GQIA 3FXXA 1JKLA 5EDRA 3PA3A 1BYGA 3GB2A 4E3CA 4EH8A 3BELA 1XH4A 2W5BA 4FTLA 4MXCA 1YXUA 5AUTA 3NUNA 4EONA 1UU8A 2OU7A 4AUAA 1SYKA 1FINA 4BTJA 5AAEA 4G16A 2HZ0A 3PXRA 3K3JA 3F2RA 3NGAA 2IWIA 1Q3WA 2WTVA 2W06A 4LL5A 2OO8X 4V0GB 5DGZA 3NCZA 3OW4A 1P4FA 5EW8A 2Q0NA 5F95A 5FQDC 1YOLA 2CLXA 4LOPA 4OTWA 3VF9A 3CY3A 4AXAA 4Q5HA 5I3RA 1WMKA 3ACKA 3GC0A 5KMOA 4ZMFA 4GVJA 4ZTNA 3L1SA 2BILB 5JGDA 2HY0A 3MY5A 3S00A 4DN5A 4YLLA 4D4YA 3RP9A 5A4LA 3EYGA 2X7FA 3A99A 4FG9A 5KKRC 2BIKB 2WMRA 2QHMA 3QGYA 2AUHA 3PVGA 4FT0A 2JDSA 2Y8OA 5CVHA 3ZEWA 3LLAA 4YGAA 2WMTA 4ACGA 4AGDA 4O7NA 3KVWA 4FEUA 4R78A 4RWKA 2JGZA 4EOLA 1XBBA 1NA7A 3PVBA 3FUPA 4J53A 5HBEA 5IDPA 1G5SA 2J5EA 3V5TA 4FI1A 2PMIA 5FG8A 4O6EA 4ZTHA 3RNYA 3JS2A 3HL7A 2XCKA 2DWBA 2E9OA 4HGEA 4YTCA 4USFA 4YJNA 4O81A 4KWPA 3RWQA 4O83A 5AIRA 2F2UA 4I5MA 1Z5MA 1OBGA 4JG6A 4U80A 3GC9A 2BFYA 3Q2MA 3CE3A 3JYAA 2ZM3A 4DE4A 2BTRA 1OVEA 4K6ZA 1E1VA 3KEXA 4JR7A 4ALWA 2CMWA 2UZDA 4FV2A 5D1JA 4EZ5A 3O50A 3TKUA 2FGIA 4F09A 4PY1A 3BLQA 4MK0A 4I20A 4PPCA 2WMBA 4RFMA 5CAOA 2R3MA 5L8JA 1NXKA 3D2IA 2QCSA 3DZOA 4X2FA 1Q8UA 3PJ3A 4J8NA 2FSTX 4BCMA 3R71A 4TYHB 5AP7A 1RQQA 4H3QA 2YM7A 4QQJA 4OTIA 1PXKA 5AJQA 4G2FA 3R9OA 4YSJA 3OMVA 1UNHA 4EOSA 3DDPA 3MB7A 3FLNC 2P2IA 5AUXA 4E4LA 4ENYA 4NL0A 4OAUC 1T45A 3OCGA 2QQ7A 3DKFA 4NCTA 4N57A 3FYJX 4D28A 1E1XA 4IANA 1Y57A 3BU6A 1GIHA 5JQ5A 4LGDA 2I1MA 2W7XA 3R7YA 3VWAA 3S2PA 4FL1A 4YZ9A 3IS5A 1YHVA 4ZXTA 3WI6A 4BICA 4BCOA 4DFUA 5BQ0A 1GIIA 1Y91A 1ZZ2A 1SZMA 2JKOA 4DEAA 4QTDA 3MESA 5EHLA 4RWLA 5ITAA 4DFZE 3AC3A 4KS8A 2ZM1A 2QC6A 4YZCA 4ZOGA 3KGAA 5AP5A 5AR5A 3UNZA 4CYIA 3UIUA 4GMYA 4ZTSA 5CEQA 3U54A 3RM7A 4RVTA 3GCPA 3QQFA 5CNNA 4F7NA 3CTHA 2VNYA 2G2HA 5C8KA 4QYFA 3BEAA 3PXZA 4IFCA 3QBNA 4AOIA 3NYOA 3T3UA 3RAKA 4UMPA 5HVKA 3MFTA 5FM2A 2JFMA 3OHTA 3KMWA 4M97A 3QRJA 4I41A 2A4LA 3MGYA 3SOAA 2IVVA 3DJ7A 4TXCA 4YLJA 3O17A 3VF8A 4PMTA 1PXPA 3BE9A 5EG3A 5D12A 1R0EA 2ZYBA 1GJOA 2GHLA 3GU8A 3H0YA 4RIXB 3W2RA 2CKQA 2J2IB 3CBLA 3MFUA 3Q9YA 3IOKA 2UVYA 4QT1A 3LFNA 4KAOA 2P3GX 3D4QA 4NTSA 4D1ZA 1FGIA 1OB3A 3QD2B 2WHBA 5DT0A 2XNBA 2O2UA 4NW6A 2XKEA 2PVFA 3HUBA 3NNVA 4LRJA 4QP2A 4K77A 2GU8A 4G1WA 3IKAA 3RINA 4S31A 4CCUA 4EUUA 3T9IA 3GCSA 4LUDA 4D2RA 4RGJA 5DR9A 5M57A 3GP0A 3QZHA 4IZAA 5HE1A 3F5UA 4FZAB 4QP7A 5HO7A 5L4QA 3DB6A 3ZXZA 2G15A 3BWFA 4L44A 5I0BA 5JZJA 3BE2A 3I1AA 3THBA 5DEWA 3S95A 4NWMA 3KREA 2BZJA 2JD5A 4YP8A 4D2SA 1L8TA 2OFUA 3KB7A 1OGUA 4OLIA 4QMMA 2YABA 3KF7A 1MRUA 2FUMA 1B39A 3ZDIA 4QYGA 4FK6A 4EL9A 3HUCA 2PVMA 3PDTA 4Y8DA 4RMZA 4XG9A 4DEEA 1S9JA 5AEPA 3M2WA 4RLKA 3LJ2A 5IU2A 3S1HA 3LXPA 3V3VA 3KL8A 3EIDA 2X4FA 3DDQA 4BIDA 3GU7A 3ORXA 2NP8A 3PY0A 3Q5ZA 3Q5IA 1MRVA 4PNKA 5IH6A 3FI4A 4EKKA 5HLNA 5KMIA 4FNXA 2YDJA 4XMOA 5CVFA 4C8BA 2VWZA 4EKLA 3BPRA 3PWYA 4HGTA 4B8MA 5J9ZA 3UNJA 3C0HA 2ZV7A 3RWPA 3CTQA 3KA0A 4AA5A 5BYLA 3QD0A 4WO5A 3UVPA 3AMYA 5CT7A 1O6LA 1IAHA 3NDMA 4H1MA 4ORKA 4BDAA 3MSSA 3MI9A 2HWPA 1JKTA 3PE2A 2CDZA 2BKZA 4IJ9A 3I5NA 4FTOA 1VJYA 3QA8A 4EOKA 4QP6A 5E8YA 3AGMA 3EQBA 2ZDUA 5B0XA 4EHEA 1T46A 1DS5A 1ZZLA 4LGGA 4YNEA 4O2PA 3A7HA 2A2AA 2GCDA 4XV2A 4UN0C 3U4WA 4D2TA 3QQHA 1YHSA 2OZAB 3PA5A 3C5UA 4CMTA 4V0GA 2OXDA 2X2MA 4MEDA 4FG7A 5FEDA 1M2RA 4O7WA 2GTMA 2WQMA 4BWPA 4L3JA 4DFYA 3ET7A 3DZQA 3ORMA 2C3IB 3D5VA 4M69B 3OY3A 4U43A 2Y4IC 5HNBA 1YWVA 2BALA 4C4IA 2XNNA 1MRYA 3DBCA 3MBLA 4U79A 3AGLA 4H58A 1H1PA 3NVKI 2VO3A 4L3PA 2BFXA 4AT4A 2XK3A 3CJFA 5M4UA 2KULA 3C50A 4QOXA 5FLFA 1WZYA 3ZDUA 2XKCA 2Z7SA 4TWPA 3LFFA 4IADA 4CTBA 4DEGA 2YZAA 3U9NA 4DBXA 1FPUA 3OUKA 4NKSA 5HCYA 2PK9A 3KULB 5CVGA 3ZUUA 4H1JA 5AP3A 3RPVA 3UBDA 3FMMA 1SNUA 5EDQA 4YLKA 3C4ZA 2ZMDA 4LV5A 5EM5A 5E8XA 3C4FA 3KCFA 5DIAA 4RVMA 2PVJA 1BL7A 1REKA 2QOIA 4XG8A 4DTBA 3FSFA 2ITUA 4H39A 4TWNA 5KO1A 3G9LX 1YVJA 4TY1A 5CSVA 3PRFA 3A8XA 4QPAA 4WNPA 4GJ2A 5C4LA 4GFGA 5TR6A 3IO7A 1PY5A 3OEZA 2O63A 4XG3A 4FKVA 3R7VA 5FDXA 4JLCA 4C34A 4DBNA 4DH8A 2I0EA 1NVSA 3L8VA 3RCDA 3ZTXA 3QTIA 5AM7A 4USDA 5K0XA 2CCIA 4BCFA 5AV4A 4DF3A 3F3UA 2GHGA 3FLZA 4U9AA 4M66A 2G01A 4CTCA 3GU4A 4UMRA 5CF8A 4TYJA 2W96B 1PXMA 1URWA 5HE0A 1IEPA 3DKGA 3EZVA 3D5WA 5ICPA 3DK3A 2J4ZA 4BGQA 3PIZA 1K9AA 2XVDA 2YDIA 3MY0A 4F1MA 1ZLTA 4PPBA 5FWKK 3AT4A 5LMBA 4TYHA 2PE0A 3HMOA 3OCBA 2CKOA 5LVOA 1APME 4RWJA 2PWLA 4TZRA 3UYTA 2VNWA 5ANOA 4F9BA 2PULA 5EHYA 4CZTA 1JWHA 3NAYA 1Z57A 4II5A 3OOMA 4EH2A 4OGRA 3UC3A 4OUCA 3DY7A 4I5CA 3D2KA 3ZFMA 2WFYA 3ALNA 4MF1A 3OG7A 3OTVA 2CNUA 3FMHA 5BUEA 1YXTA 1H24A 4F0FA 3ORLA 3C0IA 4W4WA 2ZMCA 3UOLA 3MJ1A 2YM6A 3O2MA 1U59A 1OKVA 2GSFA 3Q3BA 3QD4A 1FQ1B 4AW2A 4BCNA 5EW9A 3R7OA 4PTEA 4TWCA 3RZFA 3WF9A 2J0IA 4JDIA 4AP7A 5HQ0A 2CJMA 3SRVB 3SX9A 4AZTA 3PZHA 4IAZA 4FSNA 3SGCA 3UG2A 4LM5A 2QLUA 2XA4A 4JBOA 3F3VA 1JBPE 4O82A 2XBJA 4FKSA 4RSSA 5EQYA 4BWKA 4FSQA 4CV9A 4XHKB 3E8NA 4OTQA 4G9RA 1UU3A 3MH0A 4I6QA 2QKRA 4S2ZA 4IACA 1R0PA 4XUFA 1OUKA 3PA4A 3OW3A 4PWNA 4GV1A 2FO0A 4CRSA 4D4RA 5HU3A 2HZIA 5L2SA 4XP2A 3BGQA 3FLQA 5CEOA 2WZJA 2W1CA 4X2JA 4EH9A 4FYOA 2NRYA 4RIXA 1WBVA 1AQ1A 2EXCX 3LXNA 4Y95A 3RHXA 4BY9E 5D11A 4MXXA 1NVRA 4GU9A 4OTPA 3JY0A 3ORNA 1XQZA 1YDTE 2C6TA 3MJ2A 3EFKA 3OEFX 5HKMA 4L00A 3C0GA 2ETKA 3G6GA 4RBLA 4BCKA 3QCYA 2GNLA 3NS9A 4YJTA 2ZAZA 1O6YA 2AC5A 2YACA 3ZRLA 3P23A 4J7BA 3WOWA 3BHUA 3HV5A 5DVRA 4C7TA 1XH5A 1IG1A 4GIIA 3SXSA 2BROA 4BHZA 2F7ZE 4IC8A 3ZLSA 1OPJA 2UW0A 2GNIA 3KK8A 4FV8A 4WRGA 4FKQA 3FQEA 4BDEA 2HZ4A 4LG4A 3H3CA 4GSBA 4ZTMA 4CG8A 4O22A 4QO9A 4C4JA 3CQUA 3ZXTA 2A19B 4AE6A 3H4JA 4DCAA 2BR1A 2QKWB 3ETAA 3IECA 4DITA 2A1AB 2CNQA 4ZK5A 2W05A 3FQHA 3VS1A 4PMPA 2B9JA 4FV5A 3R8LA 5EI6A 1GIJA 3CKXA 5E8UA 4IM3A 2B7AA 4I5PA 4FICA 5KHWA 3ZZEA 4EOQA 2JIIA 4WA9A 5AR7A 2X7GA 4MXAA 4S30A 3JVRA 5E91A 3UE4A 4GG7A 4XBRA 5GJDA 4DFXE 4Y5QA 3BGPA 1UWJA 3ZLWA 1OITA 3F3ZA 1YHWA 2G2IA 2VD5A 2C68A 4GU6A 4MAOA 4H36A 4XG2A 3VVHA 5BMSA 1UNLA 4FTNA 5IA2A 3GUBA 4HPUE 3TNIA 4JQEA 4NKAA 3LFEA 2YIQA 5TO8A 4FUXA 2B9FA 4XRLA 5AA9A 3QCSA 1H1SA 3BU3A 3QRKA 4L7SA 4R8QA 3EL7A 4YHFA 2W1FA 4R3RA 2IW9A 5EDPA 4A4LA 5HTCA 3PLAE 4AN3A 2E9UA 3RM6A 1NW1A 3AMAA 4ALVA 3IW4A 1LEWA 1FMOE 4YC8A 3IK3A 3W16A 4IAIA 4GRBA 4QMSA 4EJNA 1PXLA 4U8ZA 2UZNA 3BX5A 3FKLA 2OZAA 1XR1A 5CXHA 1VYZA 5D7VA 3DFCB 5AP2A 2YWVA 1XKKA 5IH4A 4M8TA 2X0GA 2C1BA 2OF4A 3BYVA 4GIHA 3QAME 3K2LA 2BHEA 5FXRA 4M69A 4L68A 2DQ7X 4YZMA 2UVXA 3N9XA 3UPXA 2XJ1A 4FTAA 4EHVA 1Q8ZA 5B2LA 4O7SA 3V04A 3UP2A 3UVQA 3OXZA 2F7EE 3LW0A 4TYEA 4XOYA 1DI9A 1ZMWA 2QG7A 3W33A 2YLFA 3C5IA 3QYZA 2CGVA 4NU1A 3VULA 2R2PA 4M15A 2CPKE 3PP0A 5K4IA 1OL2A 4F7SA 4JJRA 4RA5A 1ZMVA 2HYYA 3M11A 4GVAA 5I5ZA 4OTDA 2JDRA 3W2CA 4C4HA 3BHYA 4FL3A 2VTHA 2PMOX 2W4JA 5LARA 4BZOA 5H2UA 3KULA 4RVKA 1JSVA 4ZAUA 3CXWA 3R1QA 4C4EA 2BAJA 3RBWA 3P7AA 1E9HA 5IEXA 1Q99A 5AR2A 4CZUA 3D83A 4C58A 3BI6A 1W8CA 4O0WA 5TOZA 2QO7A 4JT3A 4U41A 4NZWB 4U5JA 1QMZA 2RKUA 5AP0A 4AN2A 3AC2A 4C2VA 3UNKA 4HZSA 1KV2A 3QQLA 1UNGA 2FVDA 2ITZA 5H8EA 3ZMMA 4HVGA 2WQNA 4J8MA 1PXOA 4NW5A 4PV0A 3IW8A 4YC3A 4QQ5A 3MPAA 3VBVA 5CANA 4FTUA 4QTCA 3ZFYA 2OBJA 3NSZA 4U40A 3V5PA 5DRBA 1IR3A 2ZB0A 1PKGA 3F5GA 4NTTA 1PW2A 3QYWA 1OI9A 4QMXA 5AP6A 3FEGA 3B8RA 2FSOX 1OPKA 2ITVA 2IN6A 2W1EA 3C9WA 4RZVA 3VS5A 4BI0A 4EC9A 5M09A 4AS0A 2GS6A 4I4FA 1V1KA 3A7JA 4JR3A 4K18A 2UW8A 2EB2A 3ACJA 3FLWA 2PZYA 5CX9A 5HNGA 5E92A 3CPBA 3FI3A 5CQUA 4B8LA 4BCJA 3DOGA 4LRKA 3MDYA 2O5KA 2W9ZB 4AGWA 1JPAA 3FY0A 3FPMA 3QGWA 2HOGA 4FTCA 3EB0A 4DH1A 3QA0A 1REJA 3NYNA 3G5DA 4CFVA 3ATTA 4IFGA 4DG0E 4BL1A 4MBLA 1X8BA 3II5A 5AAFA 4FZ6A 3FZPA 1YDRE 2WXVA 2PUIA 4IZ7A 3MTLA 3FXZA 3OWPA 4D1SA 3GI3A 2XM9A 4HVDA 3FLYA 1BMKA 2CKEA 2XM8A 3TZ7A 4EK4A 1A48A 4XP0A 2BKKA 5H8BA 3VS4A 1L3RE 3WZJA 3P79A 4MWIA 4MHAA 4HYIA 2PPQA 2EWAA 4QMOA 1TQMA 3CD8A 4FKOA 4IXPA 4FTKA 3FKOA 4ZJJA 1W84A 2ITTA 2PTKA 4JL9A 1PRYA 3BYOA 1OMWA 2OK1A 3FJQE 3G33A 4I94A 3FHRA 4KBKA 3ATSA 3CD3A 4O0TA 4P5QA 4WOVA 2B54A 4ONAA 3SRVA 3ZS5A 4UB7A 2O0UA 4EOOA 5FM3A 1U4DA 5BYZA 2R64A 4WG5A 2R5TA 2C47A 1WVYA 3NX8A 4IC7A 3SKCA 1ZOEA 3GQLA 3R22A 4FT7A 4K8AA 3TDVA 3DJ6A 4A9YA 4BCQA 4HVSA 2UW9A 4GFOA 4RJ3A 4YC6A 2BRGA 3FMNA 3WZUA 1QPDA 3D9VA 2R7BA 5HD4A 3PUPA 3F61A 5HTIA 2IPXA 1QPEA 3POOA 4FTQA 3H30A 4E6DA 3KC3A 5T6KA 3V51A 4FODA 4GJ3A 2C0OA 3ZUTA 4FIHA 2J0JA 5GIPE 3FC2A 4QD6A 5FTOA 5DRDA 1ZY4A 2VTNA 4F9YA 3FZOA 5KMKA 4CFXA 3H10A 3IONA 2P33A 5CAVA 1B6CB 5JKGA 2IVTA 2E2BA 4EBVA 5F9EA 4Z7GA 4WSYA 4CFUA 3MWUA 4WNMA 4BKJA 3KRRA 4RIWB 4UWBA 2O8YA 1Q8WA 5CLPA 3QTXA 1LR4A 4C37A 5K9IA 4JBVA 3ZC6A 4AT3A 2A0CX 5CALA 2HZNA 3S0OA 2HELA 3PTGA 4QQTA 2X2LA 3SVVA 5ANEA 4GK2A 4MX9A 4CFMA 2CCHA 3P1AA 4YSMA 4QTAA 3OOGA 3R01A 4FGBA 3Q4TA 4TT7A 3ERKA 3MV5A 2BDFA 5KMNA 1OKZA 3E92A 4FYNA 2WU7A 3IW6A 2V0DA 4RQVA 5AUYA 4ZZOA 4LI5A 3KXXA 5CAQA 4RLLA 3LJ1A 1J91A 1U5QA 4FV3A 4NJDA 4RT7A 1RDQE 3R9NA 1BLXA 2OG8A 3VN9A 5IUIA 5A4TA 2OW3A 1G3NA 1GZKA 5L6WL 3V6SA 4BBEA 5L2TA 3EQRA 3QLFA 1M14A 3EOCA 4IIRA 2YAKA 3Q6UA 4QPSA 4F64A 3CQEA 5DOSA 3W8LA 2Q83A 5EKNA 4MVFA 3V5WA 4AAAA 2XRUA 4FNWA 4QMLA 4I93A 3GCQA 2IW6A 1W82A 4HNFA 5J7BA 2PZRA 5CU4A 5J1VA 4O27B 3G90X 1V0BA 3WF5A 4U44A 5KX8A 3WYYA 3E5AA 5IZFA 2OWBA 3EN6A 4E5WA 3ENMA 4YJUA 4GH2A 4L67A 2OI4X 4R7IA 2W0JA 3R9DA 5GHVA 3R8ZA 3PVUA 3NNUA
chains in the Genus database with same CATH superfamily
4EYMA 4L42A 2ITXA 3EKKA 4ENXA 4K33A 4CSVA 2VTMA 1YRPA 3D94A 4EEVA 4LYNA 2W1HA 2XNOA 3UQFA 2B9HA 4OBOA 5FP6A 4ZS4A 3LQ8A 3C4XA 2XNGA 2RSVA 4PNIA 4YTFA 5FRIA 3O8UA 4UXLA 4LGHA 2OZOA 4LOOA 5E8TA 4J98A 3SQQA 3EN7A 5L8KA 4IDTA 1ZYCA 1UV5A 4I3ZA 2C1AA 2REIA 3R04A 2OXXA 2HW6A 4AQCA 3MYGA 4EQMA 1LEZA 3LFQA 2VTQA 3ZSHA 2OJGA 1R1WA 4O84A 4JQ8A 2RFEA 1JSUA 4DGNA 4FNYA 2YWPA 4NUSA 3ZEPA 4GKHA 3Q52A 1UU7A 2Z02A 3CGFA 3B2WA 4ANMA 2C0TA 1YDSE 4L52A 4NH1A 4G3GA 3TZ8A 5JT2A 1ZYSA 3LAUA 2JKMA 1FVRA 4IX4A 3MPMA 4HGSA 2HK5A 4FZ7A 4J96A 5IPJA 3ODYX 4BRXA 5KUPA 3BQRA 3O51A 4Z3VA 1WVWA 3QTZA 1LUFA 4ITHA 3OCSA 3QU0A 1H27A 1OKYA 4KS7A 2E9NA 1H0VA 4FIFA 3HA6A 4XG6A 3Q6WA 4FGRA 3Q60A 4O0XA 2HWOA 5BVDA 4QTEA 3IW7A 4WT6A 5KKRB 4RX5A 3I7CA 3PJCA 5EW3A 2VTTA 2C6KA 4JIKA 2R3FA 4WBOA 3VAPA 3FSKA 3H9RA 3U6JA 4IWDA 2JKQA 3EQFA 4AZFA 3FZTA 4QQCA 5E90A 1IA9A 1UKHA 2PVKA 3E8DA 2XIRA 5LOHA 2AYPA 1DAYA 3FL5A 3G6HA 4GW8A 2YIYA 4M12A 4N0SA 4RX9A 4G5JA 2Z8CA 3PG1A 4N6ZA 4OTFA 2WGJA 5DFPA 1PYEA 4QMNA 4LMNA 3VC4A 4PMSA 2EUFB 2OFVA 3FKNA 3F5XA 5A46A 2CGWA 1Y6AA 2ESMA 3SW4A 3BYUA 4RQKA 1PMNA 3F5PA 1RW8A 2VGOA 4XV9A 5BV3A 2IVUA 5AV3A 5T68A 3RKBA 1CKJA 4DA5A 2PVRA 3D5XA 3I60A 4LFIA 5I3OA 5HG9A 2AC3A 1W83A 2WU6A 2VO0A 5F1ZA 3UQGA 3DCVA 2C6LA 4BDFA 2QLQA 4WHZA 4A9RA 2BPMA 5CU2A 2YJSA 4YJSA 4BR3A 1BUHA 3DLSA 4RJ6A 4QYYA 4O1PA 2KTYA 3PIXA 2W1ZA 4OR5A 4L9IA 4X6RA 3CLYA 4QNYA 2VGPA 2X8IA 3BBWA 3LZBA 5IEVA 5KHXA 3RPOA 3W0MA 1JLUE 2YLEA 3Q2JA 5EH0A 4MD8E 5CEPA 4DG3E 2UV2A 4FEXA 4JBQA 2QURA 4DTAA 3C1XA 3UIXA 3C4WA 5KMMA 3POZA 2EVAA 1TFFA 3QC4A 5DI1A 2F2CB 3UVRA 4BJJB 4IH8A 2H8HA 3QTUA 5LWMA 2R3QA 4X7QA 3MS9A 2GTNA 3MIYA 1XH9A 1P2AA 1WAKA 2HW7A 1SNXA 1YI6A 4FKWA 3ZM9A 1HCLA 4JI9A 1V0PA 3ZONA 3I79A 3W18A 4KIKB 1Y8YA 4F9CA 4DDGA 5IQHA 5CF6A 3MTFA 2WAJA 3GCUA 2I6LA 4YZDA 3BL9A 4RIWA 5LVNA 5LWNA 2YFXA 4JS8A 3D15A 4DGLC 3VS3A 3CEKA 2O65A 2GS2A 3GENA 2Y4PA 4DCEA 4GCJA 3MH3A 3IDCA 4O21A 4ARKA 3VUDA 4KABA 2HCKA 2BRBA 5FDPA 3IQ7A 3L8PA 2B4SB 3QWKA 1FVVA 4IWOA 4WG3A 2WOTA 4KSPA 3QTQA 3W2SA 4MCVA 2B55A 2UZUE 2VTAA 2E9VA 3EL8A 4KBAA 5AV1A 4QMVA 4RFZA 3TNWA 4BTKA 4M68A 3DK7A 4LDTA 3CKWA 1MQ4A 5HG7A 3R8UA 4F63A 1U5RA 2ITWA 3GFEA 4QMPA 5L2WA 1URCA 4RX8A 4FEVA 4DHZA 4F78A 1RE8A 3FQSA 3KRLA 3UOJA 2J0KA 3EMGA 2RF9A 1WBTA 1A06A 4BIEA 4Y46A 2ERKA 4YO6A 2GFSA 3TV4A 2XK8A 3DQWA 4BZNA 4UZHA 1TKIA 3NPCA 3MH1A 5AUZA 2QOOA 4ACDA 1KE8A 2WD1A 3RAHA 3T8OA 4WSQA 3LPBA 3C13A 5FTQA 4AWIA 2WMVA 3HKOA 2RL5A 4TRLA 4ERKA 3NW5A 5J5TA 4BYJA 4FT5A 3LMHA 4OTGA 2ONLA 5IG1A 3PFYA 4BKZA 2OGVA 3FE3A 4GUEA 3TUBA 3GVUA 2WNTA 4HYSA 2PUNA 1NY3A 2Z7QA 5HE3A 3R2YA 4ASDA 4F6UA 4TL0A 3TTIA 3BWJA 4FBXA 2OLCA 2VWIA 1OIYA 2XK6A 3QC9A 2UVZA 3R0TA 2C6MA 4MKCA 3WF6A 4BIBA 2J0LA 3TV6A 5D41A 3A7IA 5BVNA 4IB5A 3UO4A 4Y73A 5EM8A 5LQFA 3DXNA 2VWXA 2YIWA 3EQPA 2VTJA 4DHIB 4QNAA 3NYVA 4ANBA 3UQCA 3SG9A 4FKJA 2XK9A 3AT3A 3R73A 4QMWA 5EKOA 1WCCA 3FLSA 5E1EA 2YCFA 3HZTA 4X6QC 4MH7A 4FV1A 2IEWA 3HRBA 4E5AX 3VNTA 2GDOA 4P7EA 3JPVA 5KE0A 5KZIA 4FVQA 3EWHA 4OTRA 3W32A 1V0OA 3DKCA 3F3TA 5HLPA 4E4MA 4EH4A 3AOXA 1GAGA 3EQGA 4FV6A 1JVPP 3FDNA 3C7QA 4GEOA 3PIYA 4IWPA 2F4JA 2B9IA 4BB4A 5HBHA 1H07A 4ITJA 1GY3A 3P9JA 3W2PA 4C0TA 1M2PA 4FKUA 5AUUA 5HLWA 2R4BA 2VUWA 2XNEA 1FMKA 3Q96A 4G3CA 4ID7A 5DT4A 4MF0A 1YWNA 4HYUA 5HIDA 2OIBA 1H1WA 3AD6A 4AT5A 5DA3A 1G8KA 3UODA 2P2HA 3ALOA 5LCKA 4DEBA 2VTOA 2Y4IB 4CT1A 4DH5A 3CQWA 2Z60A 1O6KA 4BBMA 3PSDA 5LMKC 2GQGA 4DLJA 3DK6A 4FIIA 5T3QA 5IQBA 3UDZA 4KB8A 5IMXA 3HNGA 4RX7A 4R7BA 3GBZA 5ETIA 4ACCA 2IG7A 2RG5A 2RIOA 3K54A 4FK3A 2G2FA 3IOPA 3LCDA 4I1ZA 3FMJA 4OW8A 5CZHA 2HY81 4NM3A 4BDDA 4EOMA 5IEYA 4K2RA 4A9SA 5IUHA 5CXZA 1IASA 2PZIA 3EN4A 4TNDA 4XP3A 4BCGA 5AA8A 3TACA 4C02A 3QZIA 3HP5A 4NJ3A 3UIMA 4GT3A 2GQRA 2R0UA 5FP5A 3LCKA 4N70A 4ASZA 5IUGA 5IQAA 5CEMA 1U54B 4FSYA 1XMMA 4X3FC 3GFWA 1KE7A 5AADA 1Q3DA 5FXQA 4FOBA 2YA9A 3Q53A 5KMJA 3EJ1A 1FGKA 3MY1A 3LCSA 4RJ4A 2X4ZA 3H9OA 5CF4A 2PMNX 3TZMA 3OFMA 2PVNA 1SM2A 3D7ZA 3FBVA 1IA8A 3OF0A 4DTKA 2Z2WA 3D14A 3F66A 4F6SA 2XAOA 3OROA 4AX8A 4K11A 2ERZE 3W10A 2WIHA 3NEWA 2VO7A 4AXFA 5CSXA 5JZNA 4DAWA 2BTSA 4QP8A 2BAQA 4LRMA 5ANKA 3ELJA 3QRUA 4O0SA 4FVRA 4UV0A 3RGFA 3DAKA 1CSNA 4PUZA 3QX4A 4CG9A 1Q4LA 4D0WA 2YHVA 3N4TA 4BKYA 2W1GA 2F57A 3HMIA 4G34A 3MA6A 4WNOA 3TG1A 3KK9A 5CTPA 3V01A 1M2QA 1PXIA 4L53A 4Y72A 3VQHA 4EH6A 5FUTA 5DBXA 2V62A 3EFWA 3PXQA 5G1XA 1K3AA 3ZO3A 4DGGA 2PZ5A 3PSCA 3MW1A 1LPUA 5BX0A 4XJ0A 3LKMA 2XK4A 1KOAA 4IAYA 3NW6A 4F9AA 2RG6A 3OWJA 4MTAA 4BTMA 4MQ1A 2QONA 4IJPA 5CAPA 5E1SA 4CYJA 4FZFB 4L3LA 5H3QA 3R28A 5K0KA 4PTCA 2G9XA 3RHKA 4BJJA 2XALA 4EK3A 3OT8A 4HGLA 4I4EA 3HAMA 4BHNA 5J5SA 4ZSLA 1BL6A 4TYGA 4PX6A 3TI1A 5HX6A 4I6FA 4RPVA 5HVJA 4AW0A 4PRJA 5FBNC 4HVIA 1M7NA 4G3EA 4KIKA 1XH6A 2CSNA 4PTGA 3FMLA 4D9UA 3WF7A 2WTJA 2RGPA 3LQ5A 5BVEA 5E8WA 4EWQA 5IISA 4I6LA 3FHIA 4FSZA 1YWRA 3HEGA 4F0GA 4AFEA 2X6DA 2YISA 3OWLA 4ZIMA 5A4QA 4E5BA 2YEXA 5EOLA 3VS7A 1MQBA 4O7ZA 1JKKA 3Q9ZA 5B2MA 4WD5A 2XIKA 4D0XA 2QO2A 3WZEA 4X21A 4R3PA 4EORA 5CY3A 3TYKA 2R3OA 3PPJA 4YNOA 3I6WA 4NFNA 2R3PA 2QVSE 2XNMA 4ZS0A 2OH4A 2WO6A 4CV8A 4D55A 4ERWA 2CGXA 4XG4A 5DR2A 4QMUA 4FT9A 3CR0A 5GNKA 3ZSGA 3LCOA 1ZARA 4UWCA 3HVCA 4EBWA 2P0CA 4D4VA 2Y6MA 3O7LD 4RC4A 2GHMA 4AGUA 4DFBA 3L9PA 4A4XA 2OH0E 3VW8A 2WQBA 3M42A 5LXMA 4CCBA 5M4IA 3ULZA 3FV8A 1FOTA 1ZAOA 2BDJA 1QL6A 3OBGA 3QHRA 3MVLA 4O4EA 3PSBA 5EYCA 2CNVA 3ANQA 4FV0A 4A9UA 4FKLA 3QKKA 4XRJA 4NSTA 5IA0A 2O3PA 3EH9A 4XG7A 3V8SA 3C4EA 4UZDA 4O6LA 3A7FA 4FSRA 4D5KA 2E9PA 3BHHA 3CSVA 3W2QA 2WPAA 2B0QA 3OXTA 3ZO2A 4BDGA 4DEHA 4W4VA 1J1CA 3FMDA 5C01A 4CZYB 1W98A 3WARA 4FTRA 1J3HA 3PG3A 4HCVA 2R3RA 4L6QA 3UGCA 1H26A 4J71A 5E8VA 3DNDA 3F6XA 3TM0A 3WE4A 2J50A 3COIA 3PYYA 3BV2A 4HYHA 3BIZA 1F0QA 3MIAA 4IHPA 5BUIA 3GC7A 2YERA 4OAVB 2F9GA 5FXSA 3R7EA 4C57A 4OTHA 4QRCA 3EFJA 2WIPA 4H3BA 4I24A 5M08A 4U3ZA 4ZTRA 2UW4A 5A4CA 1WBOA 3DBFA 3LIJA 3KKVA 3GEQA 3NNWA 2XNPA 3QX2A 2C6IA 2JAMA 2WEIA 4IWQA 4KINA 5DT3A 3P7BA 3E63A 4LV7A 3GCVA 5ETCA 3VUIA 4PDSA 3VUKA 3OWKA 1YI4A 2C3KA 5H9BA 3DTWA 2YN8A 2X81A 3A61A 5CYIA 5AR3A 2IZTA 4QPMA 5FGKA 3RK9A 4RC3A 3OD6X 3DS6A 3L9NA 4MQ2A 4AZEA 4HCTA 1P14A 1Q97A 3BCEA 2F7XE 3BKBA 4FTIA 4PDOA 4IAAA 5IH5A 3AC5A 3TN8A 3HDNA 4F9WA 1JKSA 4FSTA 4JIAA 3R7GA 5TKDA 5JEBA 2HXQA 3VQUA 4AZSA 3KIOC 5JN2A 1XJDA 4FT3A 4ZZNA 3FI2A 4UWYA 1H00A 3RI1A 5L8LA 3NLBA 3VHKA 4D9TA 3U4UA 3QRTA 4UMTA 5KMLA 3R1YA 3RK7A 5E4HA 4G3DA 5JFSA 5AM6A 1XO2B 4TYIA 4R5YA 2VX0A 4F1OA 2VWYA 3KXGA 4I92A 2GNFA 1ZWSA 1CKPA 3DGKA 4AOJA 4FL2A 3FXWA 2EB3A 4JBPA 2QHNA 1Q8TA 4ALUA 3F82A 2X0QA 4QTBA 4U0IA 4FNZA 4MD7E 2XB7A 1SVHA 5CI7A 5KBQA 3R9RA 3NUYA 3TJDA 4F1TA 4O0UA 5J1WA 3CS9A 3R9HA 5FEQA 5J9YA 3EHAA 1YOJA 1R39A 3ZYAA 4G5PA 1U54A 3MVJA 2WQOA 4IVAA 4FV9A 1WFCA 2PY3A 2VWBA 5HO8A 3H9FA 4NM7A 5D10A 3ZC5A 2A27A 2WMUA 3D7TB 5CEIA 3PP1A 3QTRA 3N4UA 2OJJA 3ORTA 3BGZA 1RJBA 2YCQA 2WTWA 4FIGA 5HE2A 3ROYA 5AX3A 4YPDA 5EM7A 3PY1A 4EYJA 4I0RA 4FMQA 3FPQA 3LJ0A 3HV3A 2YDKA 3QQUA 5I9ZA 2QI8A 1H28A 3W8QA 5JGAA 3SA0A 2PHKA 3DLZA 5HIEA 2UW6A 4L8MA 4ZEGA 4FV4A 3A2CA 2WTCA 1OBDA 5KZ0A 2Q0BA 3QQKA 4JQ7A 3M1SA 3RMFA 4ZLZA 2YM5A 2V55A 3PXFA 5DR6A 3ZLYA 4QP4A 4G6OA 3QHWA 4Y5HA 1PXNA 2BUJA 3L9MA 4PMMA 4ZY5A 4YJPA 2XZSA 4L01A 4AU8A 2B1PA 4NCTC 3A4OX 4MYGA 4P4CA 1GZ8A 2EU9A 4UXQA 1TQIA 4ZY6A 5A3XA 4F99A 3VS6A 4EC8A 4YR8A 2QOFA 3CPCA 3RALA 3R7UA 4GYIA 3MPTA 2X8EA 5JFWA 4CNHA 4ASXA 3I0OA 4R3CA 5JH6A 2QU6A 4LUEA 3QZGA 3TXOA 4C62A 4IB0A 4KIOA 5K4JA 5BUJA 4YMJA 1H0WA 4E6AA 1ZY5A 2PSQA 3LQ3A 5LJJA 2W4OA 3C4CA 3FZ1A 3P4KA 5BVWA 3UMWA 5M07A 5AFVA 3UZRA 4O2ZA 4G9CA 3LFSA 2DS1A 4UYNA 3QQGA 4EH3A 3ZOSA 3TIZA 2YZLA 5EHOA 2I0HA 1ZXEA 2FB8A 5CI6A 3O23A 4XLVA 2UW7A 5EYDA 5JRSA 3I4BA 4QMQA 2XEZA 2VV9A 4R1YA 3DB8A 4EWHA 4ANNA 1GOLA 4BWXA 3LXKA 4YJQA 3EN5A 3RVGA 1CDKA 4B9DA 3HP2A 3OCTA 5A6NA 5EQPA 3W0PA 3TWJA 3DBEA 2UZVA 3RCJA 2YM8A 5C9CA 2WTKC 3SHEA 1W2DA 1HCKA 4P90A 2GQSA 3ZLXA 5EI8A 3L9LA 4I6HA 3TKIA 3CC6A 2VWWA 3LCTA 3ZM4A 5GZAA 4AGCA 2J7TA 4BF2A 3NVMB 4EUTA 3AQVA 1H25A 4C3RA 5IQGA 3QALE 4Q5EA 4KD1A 4P2KA 4UY9A 5C8MA 3R83A 4WUNA 1XBCA 4V04A 4KIPA 5DHJA 5EK7A 3HMNA 5EYKA 5HNIX 5ANJA 2NPQA 2VWVA 1OKWA 2J51A 4TNBA 4B0GA 4R1VA 4CEGA 4O1OA 2X2KA 3SAYA 4PF4A 4G6LA 5B7VA 2XJ2A 2ACXA 4MXYA 3TIYA 3PVWA 1I44A 3EKNA 2HXLA 3HGKA 4NK9A 3G2FA 4YBJA 5K5NA 4PL3A 5LCJA 4R77A 3QF9A 5I9UA 5HICA 3COKA 1OL7A 4F4PA 4GS6A 4O0RA 3I7BA 4HZRA 2JITA 3WIKA 5FBOA 4CLJA 4Y83A 3COMA 2VWUA 4Y85A 3Q9XA 4IM0A 5KBRA 5LVMA 1S9IA 2BDWA 2QNJA 4JG8A 3OP5A 3OY1A 4QP9A 2QG5A 4G3FA 5L2QA 2ONLC 4MXOA 2GS7A 2P55A 4ZJIA 4TN6A 3R2BA 3C51A 3B8QA 4CRLA 5J79A 5L6OA 3HA8A 5JRQA 2WMAA 3CTJA 2YIRA 3KF4A 4MXZA 3RAWA 3F7ZA 4CVAA 3O0GA 3BLHA 5M56A 4FTJA 4BCHA 4F08A 2PVYA 2QD9A 2R9SA 4YURA 4ZP5A 2QR8A 4C2WA 3K5VA 5IQCA 4LQMA 4FEQA 2P4IA 1B38A 3NR9A 3IGGA 4GG5A 5HESA 1SMHA 3LFAA 2UZOA 5BVFA 2J9MA 4IQ6A 3G0EA 3T9TA 1VZOA 4Z16A 4USEA 5IDNA 3IGOA 5EYMA 4I22A 4C4FA 4DHJA 4QMZA 5HEZA 3EN9A 3UDSA 3Q4UA 3E7VA 4APCA 2WB8A 1OL5A 1W2FA 4TKSA 4WG4A 1OL6A 3WIGA 2Y9QA 1IAJA 3QUPA 3QLGA 2HIWA 4FR4A 4DC2A 4JX3A 3IW5A 5J9LA 3AC4A 2QOLA 3KFAA 1TVOA 4OBQA 5H8GA 4DH7A 5IMEA 5CU6A 5CS6A 1PF8A 3P08A 4KKEA 3DA6A 3O8PA 4JRNA 2QOHA 3RNIA 3RPYA 3WZDA 2JIVA 4AG8A 2SRCA 1VYWA 2IJMA 2VX1A 3HX4A 3OC1A 4M7IA 1YI3A 3DKOA 3NUPA 4J1RA 3CIKA 4A7CA 3RPRA 3PRIA 3FWQA 1WBPA 2C5VA 3T3VA 4JMQA 1J1BA 2VN9A 3TKHA 4BFMA 2OF2A 2O64A 4IB3A 2R3GA 1OPLA 2VO6A 4H05A 1H1QA 1PMVA 4JDHA 3HYHA 5HCZA 3HDMA 2X6EA 1FVTA 4R5SA 3FZRA 4I0TA 2C6OA 2ETMA 3KQ7A 4IX5A 3NZ0A 2ZB1A 3QCXA 3Q9WA 3BEGA 3D7TA 3DTCA 4IB1A 4AFJA 5AAGA 3UO6A 1WBSA 3WE8A 4RJ5A 4MNEB 4AA0A 4O7RA 2UZBA 1BKXA 4IX6A 3E3BX 5AWMA 5C1QB 3JR1A 2I0VA 4G31A 2NRUA 5A14A 3SD0A 1ZYLA 1VEBA 1I09A 2NO3A 3UC4A 3ZSIA 3VBYA 4O7LA 4O96A 4BDHA 2VRXA 2WMSA 5CSWA 2B52A 5I9WA 2JAVA 3QWJA 2PVHA 4NYEA 4FKRA 1KE6A 4C4GA 4EZ3A 5KCVA 5EFQA 5DYJA 3PLSA 4RFYA 4C61A 4NT4A 2CGUA 2QOKA 1K2PA 5FEEA 2XF0A 2R3IA 4QYEA 5E9EA 5DE2A 1GZNA 1BX6A 3V5LA 1DI8A 3KN5A 3KRJA 3LVPA 4CKIA 3TUDA 2XYUA 3QKLA 3VBTA 1KSWA 4UEUA 2WEVA 4R7HA 4W4XA 3QTSA 2XS0A 5AP1A 4C35A 1TQPA 4JDKA 4AZWA 3V5QA 2DUVA 4TWOA 2XANA 3OT3A 5AV2A 1JNKA 1KOBA 1QCFA 5KNJA 1Y6BA 1U46A 2C69A 2FA2A 2VTSA 2ZV2A 4JAJA 4S33A 5EM6A 3EQDA 3W2OA 5A54A 4NM5A 2UZEA 4L43A 4OT5A 2VTRA 2V7OA 2R3KA 3KCKA 4I23A 4D2VA 4CFNA 1OM1A 2WELA 3VHEA 4DG2E 5M4FA 3DV3A 4EJ7A 2BCJA 4XOZA 2YM3A 3AD5A 2GNGA 1OL1A 4IDVA 1Z9XA 4EQCA 3PY3A 2BRMA 4OBPA 4L46A 4GUBA 5I9YA 2ZOQA 1J7UA 5CZIA 4GT5A 2OJFE 4BDJA 3NNXA 4AN9A 4JVGA 3L8SA 4I6BA 4D1XA 4Z55A 2PYWA 2R3NA 3HV4A 1ZYDA 3QCQA 2ITPA 1PJKA 1PMUA 1SVGA 2VTIA 4F0IA 4M14A 3PFQA 2IO6A 4O0YA 3N4VA 5GZ8A 3DFAA 4JAIA 3BLRA 4FTMA 1G8AA 4IVCA 4TW9A 3F2NA 4X2KA 2JBOA 2JDOA 4F7JA 1MP8A 4BCIA 5M51A 4XV1A 2GNJA 3UOKA 1YOMA 4FKTA 1CKIA 3V5JA 4J97A 2YITA 3Q4ZA 4LOQA 4I5HA 4E20A 2XRWA 4D4SA 4FG8A 3UP7A 4DGMA 5L6PA 1ZYJA 3HMPA 2NNWB 4E1ZA 2X1NA 4FV7A 4GT4A 3ENHA 2YIXA 3E64A 4FF8A 3AKKA 4XX9A 5ANDA 4E7WA 2FSLX 3ZO4A 1P4OA 3OXIA 1Q24A 2W5HA 4ANQA 3E8CA 4PL4A 2H6DA 5HGIA 1Q62A 3VJOA 3NFGB 4BI2A 2X9FA 1MUOA 3ZHPC 1F3MC 4UALA 4C59A 3TV7A 4DHFA 4YU2A 2IVSA 3UPZA 4IMYA 1A9UA 2GFCA 4EOPA 3DU8A 3R21A 2XIYA 4IAKA 4CMOA 3PUFC 4RRVA 4HCUA 4TPTA 3ZRKA 3AC8A 4KRDA 3SG8A 1QPJA 4NM0A 4BCPA 3LXLA 4S32A 2QO9A 1OGYA 2ZVAA 3VBWA 4BGGA 5I9XA 4ZSAA 2RFDA 2Z7LA 5HBJA 3UTOA 3FY2A 3PJ8A 5AV0A 3RTPA 2FYSA 2VX3A 3D5UA 1WVXA 4FIEA 5J95A 3ZH8A 4A4OA 4WBBB 4CKRA 5M4CA 5LVLA 3NRMA 3U8WA 5EOBA 1JQHA 3E88A 4DH3A 4XLIA 3GXLA 5JSMA 2F49A 1UA2A 3K5UA 3MVHA 2PE1A 2X7OA 4BTFA 2BZKB 1KUTA 1H4LA 4FRFA 4M3QA 3I5ZA 4L45A 4M0YA 1Q5KA 3RPSA 2V22A 5K5XA 4ZTQA 5D7AA 3SC1A 4ZLOA 4W8DA 4I0SA 2RFNA 2VTLA 4K9YA 5C03A 4K0YA 1M52A 4KKGA 2PU8A 1G8JA 4WRSA 4EK8A 2VTPA 1ERKA 3K3IA 2R7IA 4LV8A 4AE9A 5B2KA 5HX8A 3KMUA 1KE5A 5HIBA 2XH5A 4NEUA 3NAXA 3DXQA 1EH4A 2OJ9A 5M06A 3IDBA 3RJCA 4Z7HA 2EXMA 5IA3A 3BYMA 3ZBFA 2PE2A 4P5ZA 3TDWA 2QR7A 1DAWA 4YUQA 4KBCA 4C3PA 3SDJA 3O96A 3HLLA 2J5FA 4YPSA 2XYNA 5GINE 3Q32A 2BVAA 2JDVA 3P78A 4N4SA 4KIQA 1STCE 4O91A 2QOCA 4AA4A 4CLIA 3EYHA 2GPHA 3GNIB 2W1IA 4B4LA 4BZDA 2BZHB 2ITOA 2ITYA 5I9VA 2C4GA 3BZ3A 4K1BA 3TJCA 2R3JA 2ZV8A 3KRXA 3FC1X 3G0FA 2I40A 3BQCA 3IPHA 2FH9A 4BBFA 2LAVA 2C3LA 2Z7RA 4PQNA 1NVQA 4O4DA 4U81A 5HOAA 4D2PA 3ZUVA 5A4EA 5AIKA 3OUNB 3UYSA 3ZO1A 5F4NA 1OUYA 2W17A 1OIQA 3CP9A 4M13A 4ZZMA 4E8AA 4PDYA 1YXXA 4IZ5A 4YJRA 4MNEA 2GNHA 4UMUA 4XNEA 2W9FB 3R30A 3KXZA 1ATPE 3V6RA 3KVXA 2X8DA 4EH7A 3W0NA 2CLQA 3E8EA 5E7RA 2BAKA 5JQ8A 2IZSA 1QPCA 5BYYA 2XCHA 4D2WA 4H3PA 2IZUA 2JC6A 4KA3A 4HVHA 4FA2A 1P5EA 3TT0A 5GJGA 1BI7A 3VUHA 4EK5A 4YTIA 3VJNA 4RG0A 4XEYA 3SXRA 3V8TA 4AACA 1XMLA 3MN3A 4YO4A 4XCUA 4X3FB 5DG5A 2CKPA 4WIHA 3NYXA 5AMNA 2JEDA 2Y6OA 4D58A 2R3LA 3DT1A 3QUEA 4KNBA 4AW5A 4O86A 4ZMEA 5AUVA 1R78A 1VR2A 3ORIA 1XBAA 4FIJA 4HNIA 5AR4A 5IQIA 4LMUA 3VW6A 2QODA 4DYMA 3NW7A 2OIQA 4XBUA 5JMSA 4QMTA 3RAIA 2UW5A 3O71A 4PP7A 3UJGA 1UWHA 3PZEA 1KV1A 1JAMA 4KKHA 4O0VA 3F69A 1M7QA 4FVPA 1WBNA 2PZPA 5J8IA 4RA4A 4Q9ZA 1NT2A 3U9CA 2OJIA 5DEYA 3IG7A 2YAAA 5A9UA 5BVOA 4FSMA 4BC6A 3EQHA 4IE9A 4FZDB 4AOTA 2XAMA 5LVPA 3Q04A 4JDJA 4DT8A 1KWPA 4U97A 5DPVA 4EQUA 4NIFB 5CAUA 3F3WA 4AZVA 4DT9A 3CJGA 5ETAA 4W4YA 2UZWE 3VRYA 4B6LA 3E93A 1PKDA 2C5XA 5I4NA 4BVUA 3VIDA 5HU9A 5CASA 1PMEA 3W55A 4FX3A 2IZRA 5AUWA 5HHWA 4U3YA 3DXPA 3F7WA 5DN3A 2WMXA 3UZPA 5JK3A 4IVBA 3MB6A 4WNKA 2XIZA 1XH7A 3NUXA 1H01A 3UO5A 3R63A 4X0MA 4ANSA 5J87A 1H8FA 3DNEA 3FI8A 3UOHA 3E62A 3NWWA 3AD4A 3LFDA 4J99A 2QOQA 3A8WA 4FTTA 4CFWA 4U42A 2JDTA 4B99A 4M84A 2BMCA 3R6XA 5IA1A 4G6NA 3PPZA 5BPYA 3AT2A 3R1NA 4CQEA 2JFLA 1KE9A 2XP2A 3A7GA 2IW8A 4DINA 3S3IA 3F2AA 1CTPE 3QL8A 2XK7A 4JG7A 2OXYA 5CEKA 4HW7A 1W7HA