2P33A

Synthesis and sar of aminopyrimidines as novel c-jun n-terminal kinase (jnk) inhibitors
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
356
structure length
332
Chain Sequence
DNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLASFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYREHTIEEWKELIYKEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords c-Jun N-terminal kinase 3
publication title Synthesis and SAR of aminopyrimidines as novel c-Jun N-terminal kinase (JNK) inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 332
sequence length 356
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2p33A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2p33A01
5CASA 3FMDA 3HP5A 4IWOA 1IEPA 3MH3A 3N4UA 1WCCA 3RAIA 4QP9A 4L67A 4QMQA 4I93A 2LAVA 4EH9A 4BI2A 4EH5A 1JSTA 3G6GA 3E8DA 3O8UA 5J1VA 2WTKC 3KREA 4CZYB 2CSNA 5B7VA 4YJNA 3EMGA 2HZNA 4Z7HA 4ALUA 4XOZA 2OO8X 3UO4A 3DJ7A 5HLPA 2ZMDA 2ZYBA 3D2IA 4JL9A 4AOIA 4IX3A 2WIPA 1H01A 4ASXA 2UZVA 5GZ9A 5JQ5A 5LCJA 1OGUA 5EKNA 5IQDA 4QTBA 3A60A 4EK6A 1Q97A 4ZS0A 4BGHA 5CF4A 2OKRA 1JKSA 1GZOA 2WU7A 3QLFA 4L9IA 1JAMA 2BZIB 3F5XA 4EH7A 4DFLA 2QOHA 4BBMA 4RX8A 4TZRA 2BFXA 3RJCA 5B2MA 2PVRA 4QPMA 3UG1A 3UOHA 2BR1A 1H24A 2BRNA 4YJSA 1NW1A 3LQ3A 1MRYA 3A7JA 3E3BX 4FE2A 3NNWA 4UX9A 4WA9A 3GU4A 1BYGA 2WMAA 1UKIA 3BLQA 3JYAA 4I5CA 4UYAA 2ONLA 1P2AA 3QUPA 3F6XA 4XH6A 4EC8A 3DK6A 3JVSA 2QOIA 5AP1A 4ACMA 3MA6A 2GS2A 4RVTA 3UZRA 4OTPA 5D41A 4TNBA 3F2NA 4WG3A 2I40A 4ERWA 5IEVA 3OG7A 3WBLA 1OMWA 2HZ4A 3CPCA 5ACBC 4E4MA 2WTWA 3IGGA 2OW3A 3HECA 3HNGA 3ERKA 3KRLA 5KBRA 4EOSA 3AXWA 2JD5A 3ZFXA 4IX6A 4EKLA 3ODZX 4YC3A 5AR4A 4A4LA 3BHYA 4GL9A 2XK9A 4J71A 2Z8CA 4EYJA 5IUIA 4FTKA 2XK3A 2OH0E 4YJPA 1XR1A 4MVFA 4D0WA 5J7BA 4BCPA 2W99B 3FXZA 4MK0A 4EORA 3NCGA 1OPKA 2JKQA 2VD5A 5EKOA 3A7IA 4BDJA 3HMOA 1KE8A 3CXWA 3Q6WA 4RC3A 3DNEA 3POOA 4S33A 4BCNA 4UMQA 4YLKA 3RZBA 3FZTA 4M7IA 4L8MA 2YLFA 3FY0A 3C4WA 3LMIA 5B0XA 1KOBA 2I0YA 4GYIA 5FBOA 4ZZMA 3LIJA 4DN5A 4FTIA 5A9UA 4YNOA 2BKKA 3HAMA 3COIA 2QVSE 2C5NA 2Z7QA 4U6RA 4BCHA 3ORPA 5AP4A 3TNHA 3DQWA 5KUPA 3E63A 3A8WA 5EHYA 5AFVA 4I92A 2IN6A 5ACKA 2X1NA 2QONA 2BHHA 3MYGA 5HE3A 3V01A 3ORXA 1YQJA 4NCTA 4YP8A 4BYJA 3ZXZA 2XCKA 2R0IA 4KRDA 4JOAA 1VZOA 1UWHA 4ZTNA 5HG7A 2BKZA 4FV9A 1PXLA 4U8ZA 4CT2A 3DTWA 4D4VA 1YOMA 4WG4A 1WAKA 3ZBXA 5LOHA 4AT4A 2O8YA 5AADA 1ZRZA 4BF2A 5I3OA 4C59A 4DT8A 1L8TA 4PDOA 2OWBA 4KABA 1LP4A 4ASEA 5G6VA 3TIYA 3PFQA 5FM2A 4Z9LA 1H00A 5IUHA 3CIKA 3IONA 4LUDA 1H0VA 3AC3A 1XBCA 1OKZA 2C0IA 4PTGA 5CVHA 2VTQA 5AV1A 2B9IA 2GHLA 2J0KA 4FKJA 5TO8A 2GQGA 5AV4A 3CQEA 2UVYA 2J0LA 3OUKA 4HGLA 4IZAA 4AGUA 3CTQA 3OFMA 4R7IA 4F6UA 5AR5A 5C8KA 3RALA 3U87A 4M97A 4QMYA 4BFMA 3AT4A 3BGQA 4D9TA 4CG8A 1BMKA 4B4LA 1ZOHA 3C9WA 2ETMA 3H4JA 3COHA 2UW8A 3QZGA 2JGZA 4RT7A 2XA4A 2BZHB 2QKWB 3UYTA 4H1JA 4PNIA 4QO9A 4YZBA 3JUHA 3ZO1A 5IH6A 3OD6X 2X8EA 4B7TA 3SG9A 3NUSA 4DBNA 3EFKA 4CMOA 2VWVA 3Q9XA 4RWKA 2Q83A 4L45A 2J0MB 2XNOA 3AMAA 4GK3A 3MWUA 5ANOA 5IQHA 3IK3A 3UBDA 4Q9ZA 4BDIA 4C4EA 4FTJA 2GFSA 4FG8A 4FKOA 1DAYA 5HEZA 3R7VA 1B38A 2XJ2A 3BYUA 5KBQA 3ID6C 3W2RA 2FYSA 3IOPA 3LE6A 4EZ3A 5BVOA 3IKAA 5HVJA 4I6BA 2OK1A 3R0TA 3SLSA 5IQEA 2ZMCA 3E8EA 3IW7A 1W0XC 2WQOA 2OIBA 3GFWA 5HHWA 3RPYA 5AUXA 1OECA 1HOWA 4CLJA 1WBSA 3VS1A 4BCFA 1UU7A 3N4VA 3K2LA 3WIGA 4U45A 4ZXTA 2XNMA 3MV5A 5BYZA 4AX8A 2BAQA 4IHPA 3L9PA 3BWFA 1VEBA 4IX4A 3WF6A 1U4DA 2V62A 4JBVA 4RJ6A 2WOUA 4DYMA 1SNXA 4QTEA 4GYGA 4J53A 2BCJA 2E2BA 4C4IA 4I5HA 3P08A 1RW8A 1JWHA 1P5EA 5E9EA 5H8GA 4WNKA 3UJGA 5LWMA 2C6DA 4OAVB 3AC1A 3VJNA 4C02A 5C4KA 4EKKA 4BKJA 2C30A 3GU6A 3MN3A 2C3LA 3C4FA 3EH9A 4IVAA 5LARA 4B6LA 4W8DA 4ZSEA 2YM4A 3OS3A 5FEQA 3Q32A 3ZH8A 2JAMA 2YABA 4LOOA 3HX4A 5I9ZA 2DYLA 4O7LA 2QR7A 1XO2B 2RGPA 3N4TA 4QMLA 4BCMA 3VS5A 2YFXA 1UNHA 5LVMA 3IDPA 2UZOA 4NSTA 4CYJA 1E9HA 1FVRA 2R3RA 3IQ7A 3GCUA 5CAOA 4MF0A 3RK5A 2QI8A 5DMZA 1A48A 4W4WA 4HGEA 4NH1A 4R7HA 1SVHA 4XYFA 4LL5A 4EH8A 4FKLA 3TKUA 4FODA 1NA7A 3EHAA 4IB1A 3UNKA 2F9GA 4K33A 4XCUA 2YM3A 3TWJA 5J9LA 2IJMA 2H34A 3UGCA 3P79A 1AGWA 2EVAA 4DGNA 5E8WA 5FXQA 4PF4A 4WD5A 2QURA 1CM8A 5HG8A 3DJ6A 2CGWA 3GFEA 5FTQA 4TWNA 1V0BA 3K5UA 4RQKA 4NM0A 4TYIA 4D28A 4IZYA 3VBWA 3KMMA 4BRXA 1H08A 3IO7A 2RSVA 4Y85A 3NNXA 3OCSA 3R1SA 3PY0A 1CDKA 2VTHA 4APPA 2OFUA 3MH0A 4ZLZA 3Q3BA 1JLUE 2IO6A 4IB5A 2UW0A 1CKJA 1CSNA 1Q3WA 1FMKA 3EN9A 3H30A 3OC1A 4FOCA 4QP6A 5J1WA 3R9NA 4AGWA 3GENA 4TYHA 2W5AA 3TG1A 5EM6A 4JRNA 5CSVA 2I0HA 5JT2A 5J9ZA 3RWQA 1Q8TA 4AAAA 4OAUC 4F7LA 4QP4A 5F95A 1OKVA 4J1RA 3ZLSA 4ENYA 2PSQA 4JX7A 3V6SA 3EN5A 3OY3A 4UMUA 3DKCA 3VS0A 1KE9A 4CFMA 3T3UA 1YDSE 3FMJA 3PWDA 3UYSA 1G8AA 3EKNA 4YPDA 2C3KA 3VBTA 4E1ZA 3ZMMA 2XIRA 3SOCA 1BUHA 5EW3A 3KGAA 3EZRA 4EZ5A 4GSBA 3AT2A 4FKGA 1XH9A 2EWAA 4D2TA 4FT5A 2PYWA 1ZLTA 3KXZA 4QMZA 4DH3A 3BEGA 5L2QA 4EHVA 3AOXA 1ERKA 5M53A 2A4LA 3ORTA 1REKA 1YHVA 4FSYA 2UUEA 4JR7A 4L43A 2XS0A 4PTCA 2X4ZA 3MFUA 4O7VA 2OJGA 2XNGA 5LWNA 3TZ8A 2XYUA 3ULZA 4IH8A 1XH8A 1VYWA 3MPAA 1UNGA 3CS9A 2YN8A 2FSOX 3FMKA 4Q9SA 2C6IA 3MFRA 4D4SA 4KINA 3EIDA 5DOSA 5AAGA 4FTLA 3DXQA 4MH7A 2JLDA 3W2PA 5DIAA 4O0RA 3ANQA 5E8UA 4RZWA 4F64A 4TWPA 3OXZA 1WFCA 3C5UA 3QC4A 4FIIA 5EG3A 5AX3A 1Z5MA 5H8EA 5CU3A 4AT5A 3ATSA 2CKPA 3I1AA 2QG5A 2DQ7X 5DR6A 4CFXA 5CX9A 2Z2WA 3NW7A 4BIBA 2VTLA 4I21A 4FC0A 4NM5A 3V5TA 4AZTA 5IG1A 4BCQA 2F2CB 3AD6A 1Q99A 2VTJA 3GOPA 3OMVA 4EH2A 3SVVA 3JR1A 3PY3A 2QOOA 5HBJA 4YZDA 3PE1A 2CKQA 4EZ7A 5AIRA 3UPZA 2I7QA 4O86A 2BRBA 4EJ7A 4I6FA 1M7NA 2OFVA 3Q9WA 1YDTE 5C4LA 5BUJA 3F61A 5JEBA 4Y5HA 2Y4PA 1YOLA 2C6TA 1IRKA 1H28A 5K0XA 4IM2A 3VUGA 4QQ5A 5IQGA 2W4KA 3QRKA 3S2PA 4H05A 3ZRKA 1O6LA 1Y8GA 3SC1A 3FE3A 4YBJA 2ZDTA 3BPRA 4NIFB 4FTTA 2HYYA 2ERKA 4IJ9A 5CXHA 4PL4A 4RPVA 3F3ZA 4C61A 1FGKA 4M8TA 5L8JA 4IE9A 3CC6A 3NUPA 3NYNA 1Y8YA 5FXSA 1UVRA 2Y0AA 3ZYAA 5C8NA 1GIHA 2QKRA 2ITZA 3NYOA 4QMMA 4Y5QA 4DH5A 2XRWA 2JDOA 5K3YA 4BGGA 3SOAA 4WNOA 1R0EA 3POZA 3QQGA 3LFSA 4K6ZA 2XMYA 3QZFA 2CHLA 4UXQA 1GJOA 4F08A 2WMSA 5JFVA 4R78A 3BGZA 2WD1A 3MH1A 3SW7A 2XJ1A 4YLLA 5HE2A 3S00A 4J95A 3PVGA 4EOJA 3H9OA 2W1FA 5K9IA 4EEVA 3G0EA 2GNHA 2B53A 3LQ8A 4RMZA 3QFVA 5H3QA 1JSUA 3DGKA 5B2KA 5IEYA 4EHGA 4GMYA 4YHFA 3SW4A 2VV9A 3OCGA 5CT0A 5HBHA 4CD0A 3UIUA 3H10A 4BBEA 4NJDA 4BI1A 2QHMA 4FL3A 4JQEA 4ZSGA 5FDXA 3RGFA 1IA8A 4OT5A 3SHEA 4BGQA 3RK7A 3QTSA 3NVMB 4RVKA 4XG7A 2IVUA 3TEIA 3R8ZA 3FL4A 1MRUA 3QLGA 3ZEPA 1W98A 4PMMA 4F70A 5KMOA 1WZYA 2VO7A 5CTPA 2WEVA 3LW0A 3DZOA 3ZUTA 2VX0A 4WSYA 3VUHA 3PSDA 3PVBA 5EYDA 5CALA 2PY3A 2W1DA 2OF4A 4FUXA 3SGCA 4G2FA 4YZMA 1J7LA 4DFZE 1FOTA 3DFAA 4PL3A 1YI3A 2QU6A 5KKRC 4JT3A 5EM5A 3UP2A 3EFLA 3I5NA 2CPKE 2XBAA 5HG5A 4W8EA 3L8XA 1Q41A 3MW1A 3P7BA 4HZRA 3WOWA 4ZK5A 2OZOA 2QO2A 5HLWA 1DS5A 3JY0A 3LHJA 5E90A 3D83A 3L1SA 3Q5IA 5EOLA 1JKLA 4JAIA 5J79A 1JKKA 5CS6A 1MQBA 5EHLA 4KB8A 3QZIA 4N57A 1GNGA 5M07A 4JR3A 2VWUA 2VX3A 3QQHA 1GOLA 1YRPA 1XQZA 4DFNA 5J95A 3FYKX 5HESA 2QOBA 3WF9A 4BYIA 5AUUA 3TL8A 4QMNA 5FUTA 1O6YA 2VWYA 3FQSA 3M1SA 1OPJA 2VN9A 4TKSA 5M56A 4U40A 4B0GA 5D7VA 3W2OA 5CAPA 2PHKA 4F4PA 5AP7A 3OUNB 2XEYA 3ZFYA 1Y57A 3ORKA 4JI9A 3EYHA 4PRJA 3A7HA 5DFPA 4F7JA 2XIKA 3AGLA 4FT0A 3EL7A 5HO8A 4FTNA 3S95A 3TZ9A 2HIWA 3SG8A 1FINA 4R8QA 2R3PA 4OT6A 4M0YA 3TNIA 1SVEA 4XHKB 4Y46A 3UOKA 3LOKA 3TN8A 4AXAA 3VW8A 4ANMA 2WTVA 1OL6A 1H25A 2IZTA 2ITQA 4IFGA 3W2QA 2V7AA 1H4LA 4FZDB 5DGZA 1FQ1B 4RVLA 2YM5A 2IVSA 4X3JA 4XP0A 4YZCA 4V0GA 3LFQA 4U44A 3GCPA 5F20A 3HGKA 4DFUA 5KHXA 2PE1A 4O7SA 4M15A 4OBPA 4DCEA 5IDNA 3NW6A 4MXZA 4YJTA 2W1IA 3PIZA 5TR6A 5AUWA 4FV7A 4BZNA 3O71A 4ZJVA 4O82A 2P2HA 1SYKA 4EQCA 1OL7A 1YXTA 3QALE 3DLZA 1H27A 4IW0A 4O91A 1BI7A 1BL7A 4ZY4A 4LOQA 3VBYA 3BCEA 3VS7A 4I4EA 4PPAA 3EQPA 4H58A 2YIRA 2XNNA 5IQAA 5DI1A 3H0ZA 4O2ZA 3UQGA 5I9WA 3D14A 2DS1A 4U41A 2RL5A 4WNPA 3NR9A 3Q04A 4YURA 2JDVA 3PDTA 3U51A 4CT1A 3G15A 3NX8A 4D2WA 3LCKA 2WELA 4K77A 3RM7A 2PMNX 4ZTQA 4G3EA 2HAKA 3R00A 5D11A 3TNQB 2PPQA 3MVJA 4HJOA 5JFWA 3ALOA 5JFXA 5DWRA 4XEYA 4JG6A 1Q62A 4EBWA 1UU8A 3VO3A 5HE1A 2B52A 4YJRA 5EI6A 1XH6A 5AM6A 4CRLA 4L7FA 5TT7A 4I3ZA 1YOJA 4UEUA 3P5KA 4IAFA 3RNYA 5GZAA 4LRKA 2ZV8A 5CEMA 4JBPA 4ZSJA 2PULA 2ITUA 4IMYA 4FEUA 2UZNA 3LFNA 3SX9A 4ZIMA 1ZZ2A 4M69B 4LYNA 1SZMA 4NTSA 4QTAA 1XHAA 4BHNA 4D2SA 3RPOA 3MH2A 1GZKA 5EDQA 4FTQA 1JNKA 3RCJA 3NUYA 4GW8A 5CEKA 4G5PA 3ZTXA 1B39A 5T3QA 3QWKA 4QP7A 5I0BA 4LG4A 4CNHA 3H9FA 5CENA 2HCKA 2R9SA 4OTHA 4MF1A 3S3IA 4IC7A 4C62A 4ID7A 4R3PA 4DFXE 3LLAA 1PYXA 1MRVA 3KXMA 3QAME 5T68A 5IA0A 2VTMA 4G5JA 3ZOSA 3GU8A 4YC6A 4PP9A 3WE8A 4EOMA 4TXCA 5HTIA 3GVUA 1G5SA 3BEAA 4MQ1A 3MTFA 3G6HA 2GU8A 4QNAA 4NJ3A 3R9HA 2XBJA 3I5ZA 1LPUA 3BBTB 1OUKA 4BHZA 3ORMA 4FV0A 4RA4A 3HV7A 5LVNA 2C1AA 5HNGA 4CQGA 4XS2A 3CJFA 4G6LA 2C6MA 5HCXA 5KZ0A 4L7SA 2P0CA 4NT4A 3QD3A 4ZMEA 3LQ5A 2WMTA 3GC0A 3PUPA 3RAWA 3FMMA 4YJVA 3ZDUA 3HMNA 4O7RA 1H07A 2YIWA 3I60A 1GZ8A 1ZMUA 3C4CA 4UY9A 2FVDA 3OOGA 3KXNA 5D1JA 5IPJA 1KOAA 3F5UA 3ENMA 2FO0A 2XRUA 3EYGA 4E6QA 2C6EA 2IVVA 3D9VA 1KE6A 3ORLA 4MBJA 4RIOA 5E1EA 4R7BA 1Q61A 4EK8A 3HRFA 5CY3A 1IAHA 4N70A 2ETKA 3NAYA 1PKGA 3WI6A 3C0HA 5EW8A 4XJ0A 4D5HA 1XJDA 4IC8A 2ACXA 2G2FA 3RWPA 5JZJA 3DDPA 3Q53A 4KA3A 3QTRA 3OVVA 3QCQA 3B2WA 4OTDA 3BU6A 1P4FA 5HIBA 1IR3A 5KMIA 3E3PA 4QPAA 4ALWA 4C2WA 2PVLA 3FMEA 3O7LD 3ACKA 4RQVA 5CF8A 3II5A 3U4WA 3CQWA 4KD1A 3SRVA 2JDTA 2UZWE 4RZVA 4RX7A 3FWQA 3PJ1A 3NZ0A 1L3RE 3R1NA 3NS9A 2VWXA 1B6CB 3BV3A 1SNUA 3H9RA 2PZ5A 4FT9A 2RKUA 4XV2A 4F7NA 3U6IA 5GIPE 4OR5A 2PMOX 4ZSAA 4ZLOA 5HVKA 3F7ZA 3GCQA 5B2LA 1OVEA 5DR2A 5AJQA 4FOBA 4I5PA 4BZOA 4PL5A 5DT3A 5J87A 2WIHA 1A06A 1OL1A 4BI0A 4XV9A 2YZAA 4ZSLA 4DGGA 5LMKC 1PXMA 2F57A 2JIIA 3JS2A 5BPYA 4UZHA 1M52A 5CEIA 3DQXA 2AYPA 3W55A 4JJRA 3KF4A 3R7EA 2VGPA 3CTHA 4TWCA 1REJA 3NGAA 2G2HA 4EH3A 5FXRA 1GIIA 1ATPE 4C4JA 3ZEWA 2A2AA 3RPVA 5AP0A 1J91A 5HE0A 3I79A 2WU6A 3MTLA 3E7OA 5EYCA 3EL8A 2PVMA 5DT0A 2P33A 4J7BA 3FMHA 4TRLA 3KFAA 4PWNA 1ZAOA 3OZ6A 2QOKA 4YJOA 4HYUA 3P4KA 3UVPA 4BCKA 3MESA 3PG3A 3A2CA 4ANSA 1W8CA 4GG7A 3VUMA 4PNKA 4FK3A 1YVJA 3F66A 4RIYB 4QP2A 4IVDA 1UU3A 4S34A 1MP8A 2GTMA 3AD4A 3Q9ZA 2Z60A 5LJJA 3LXPA 2FGIA 5M57A 4H3BA 3FPQA 2R3HA 4IEBA 1OL2A 2REIA 3IW8A 3QQFA 4RRVA 3OWLA 4PP7A 4K11A 1TKIA 5AP2A 3WZDA 4D4YA 3NUXA 4FZFB 2YM8A 3TV4A 4HW7A 4BCJA 2OZAB 4O0XA 2XNPA 2CDZA 1ZYDA 3KK9A 2GNIA 3PXZA 4AOTA 3N51A 4LUEA 3CD3A 3QGYA 3NUUA 3W16A 4USFA 3NNUA 3RAHA 3FPMA 4CXAA 4HVDA 1YI6A 3G5DA 3OROA 4IXPA 4BDKA 2UW5A 4YR8A 1BKXA 3W10A 5E8XA 5FLFA 1G3NA 5GJFA 3NRMA 3LXNA 4FNYA 4MCVA 4OUCA 4Z3VA 5ANIA 3PIYA 1BX6A 4ZS4A 3IOKA 1VJYA 3PZHA 3MY1A 4FIEA 1J7IA 4WIHA 4CFVA 2QOLA 3QXPA 3ACJA 1F5QA 3CQUA 3QD4A 3RAKA 2JKMA 4QPSA 3FKOA 4XLIA 2RIOA 3ZO2A 3VF9A 3ROCA 1KWPA 4C57A 2E9PA 5CSWA 3KL8A 4XG4A 2RFEA 2IW6A 4E20A 4P2KA 4X2GA 1H8FA 3I6UA 3REPA 3CE3A 2IWIA 4DG2E 3CLYA 2V7OA 4PDPA 1R39A 4UALA 5E8TA 4DG0E 3VUTA 4HCTA 1PMNA 5DBXA 1BI8A 3WZUA 2EU9A 1FVVA 4H36A 3QC9A 5EOBA 5LVLA 2GFCA 3UNJA 4NFNA 3W33A 5J5TA 4MAOA 5A6NA 4ZMFA 4H3PA 3PRFA 1E1VA 4XRJA 4BDGA 4YHTA 3C0GA 2QOCA 5E8SA 5M44A 3L8SA 3KCKA 4HCVA 3DB8A 1IASA 3ZZEA 4C0TA 3C4XA 5CU2A 4O7TA 4D1ZA 1Q8UA 1O6KA 4UMTA 4Y72A 4I20A 4KUJA 1K3AA 4X0MA 3FSKA 4LRMA 4XX9A 2HY81 5CEOA 4X6QC 1KUTA 3R8LA 2WAJA 3EQGA 1WMKA 3LJ1A 3NUAA 2VTRA 3VHEA 2F7XE 2C0OA 2YERA 3DCVA 3NYXA 4MYGA 4TY1A 4NM3A 4DGOA 3EQHA 3EN4A 3MIAA 4JDKA 4GUEA 4FL1A 1KV2A 4X3FA 3LCDA 2YISA 1PHKA 2X81A 4ANNA 4BBFA 4CCBA 1QPCA 2W05A 3O17A 4FTMA 3KXHA 5HICA 4CKJA 3PP0A 2QCSA 3RINA 2WMRA 4ZZOA 2GHMA 1KE7A 1FBNA 1PRYA 2WQEA 3FQHA 5A4CA 4DEHA 5EHOA 2W0JA 4EK4A 4FVRA 3WYXA 3R6XA 4UMRA 2UZLA 1UWJA 3KULB 4WUAA 4S30A 4IAYA 4UV0A 3QTUA 4E4XA 3OT8A 3OBJA 3HEGA 5DEYA 5C01A 1FGIA 2VTIA 3JVRA 3TJDA 3UVRA 1ZWSA 5HU3A 5KHWA 3QUDA 1U59A 3KC3A 1OIQA 4YPSA 5AX9A 3KRRA 3B8RA 3GB2A 3PE2A 2OH4A 4KIKA 4E6CA 3R2YA 4XBUA 4AA0A 4O0TA 3HLLA 3MVHA 4I0RA 2SRCA 3VBVA 2CLQA 2YJSA 4FX3A 3FBVA 3TIZA 4F6SA 5IU2A 4ITHA 5CLPA 3QKMA 5EK7A 1DI9A 3ROYA 3CSVA 3IS5A 3DBQA 1R78A 3R7OA 4F09A 4F9AA 4DT9A 3F3UA 2YAAA 4BDDA 4GJ2A 1XKKA 4TYHB 4QYFA 4E5BA 3LKMA 3DBCA 3UOJA 5AUVA 3JXWA 2FSTX 2PE0A 5EW9A 2YIXA 4YSMA 4BDHA 3SDJA 4FK6A 4E7WA 4HOKA 4DLJA 2CCHA 3LAUA 4TTHB 5E7RA 3BBWA 3O8PA 5CQUA 4IAZA 4FNXA 3VRYA 2R3IA 5IA4A 2YDKA 2ERZE 2YCSA 3EWHA 3N9XA 4MD9E 3I6WA 4UMPA 2ZJWA 4HYIA 4BR3A 4FKRA 1QPJA 4FMQA 3AT3A 4U97A 3S4QA 4G3DA 2WTIA 2I0VA 1WVYA 2R3OA 4JVGA 1NVSA 3KMWA 4AUAA 3KRWA 4F9BA 5IQCA 3VUDA 3OW4A 4K1BA 5AA8A 1ZY5A 5IDPA 4I24A 4W9XA 3MS9A 4V05A 3G9NA 4OBQA 3DK3A 5HOAA 1JSVA 2RG6A 3CR0A 3CGFA 3HRCA 3QQKA 2B4SB 4BCGA 3KMUA 2J7TA 3MB7A 2PUNA 4NW6A 4NZWB 5E8VA 2OIDA 2UZTA 1W82A 3F9NA 5A4QA 5KMKA 4RFYA 2J4ZA 1PXIA 3B2TA 2PK9A 4QYYA 3UODA 5JMSA 3LMHA 3D15A 3UDBA 3KVXA 4DAWA 5BVDA 2R5TA 4U80A 3V6RA 3W2SA 2C3JA 2VTNA 3FI3A 4IQ6A 5DE2A 4FG7A 5HTCA 3C7QA 4XP3A 5HLNA 4MNEA 1H0WA 4NUSA 4FYOA 4JDHA 1LR4A 2OI4X 4IAAA 3BELA 4RG0A 2JIUA 4XBRA 4WSQA 4AU8A 2WXVA 3P0MA 5HVYA 3ZM4A 4NKSA 2WEIA 2X6DA 2Y6OA 3IW6A 3QTIA 2VUWA 3GC8A 5IA3A 4HVIA 4TYGA 3ZU7A 4CFUA 4K2RA 5A14A 3MVLA 4HNIA 4L42A 5BUEA 3R63A 3FLSA 2OBJA 4PV0A 2I0EA 3A7GA 5HO7A 3D4QA 3HUBA 5HKMA 3UZPA 3V51A 3RVGA 2F4JA 4GK2A 4Y73A 2VAGA 2W9ZB 3DKGA 3W2CA 3RMFA 5GIOE 2LGCA 3O8TA 3PLSA 1YXUA 3MI9A 1ZXEA 3KXGA 4R1YA 4FTAA 5KO1A 2JEDA 4GIIA 3RZFA 4KSPA 4LOPA 4C3RA 5I5ZA 4FTUA 4MXYA 1XWSA 2VWIA 2W1EA 4JNWA 2UZEA 1PXPA 4QMTA 1JPAA 4J98A 4KIOA 5F1ZA 2PUPA 3VBQA 2BILB 3W8QA 1WBVA 4NWMA 4D4RA 4FSRA 2X9FA 2FB8A 3FI8A 3TDVA 5DH3A 3RPSA 4FNWA 4E5AX 1H26A 5C1QB 1SMHA 4QQJA 4FKSA 3F69A 3ITZA 4I41A 4JRVA 4ANOA 4CFNA 5L6OA 5AR3A 2A27A 3KXXA 2GNGA 4FZ7A 2CKOA 2YAKA 3I0QA 3U9NA 3QQUA 4E73A 3PLAE 2FA2A 4YJQA 2WTDA 5HTBA 1XBAA 2H96A 3I0OA 3BHVA 3AC4A 2QG7A 4R5YA 4BKZA 4AZWA 5CVFA 3HV6A 1EH4A 3UQFA 5JN2A 3MB6A 4C34A 4ZZNA 3C51A 2R3GA 3DBEA 4IACA 2PUIA 3GT8A 4MQ2A 3U8WA 2WFYA 2VO6A 4U3YA 2HENA 2PVHA 5AP5A 3FI2A 5AM7A 3MY0A 4E4LA 5L2WA 3FLNC 3AC8A 3KN6A 2CLXA 3PJ3A 2NO3A 3LFFA 1ZY4A 3PY1A 4FSMA 4PMSA 3D5XA 1Y91A 4AE6A 4BN1A 3R8MA 3DBDA 5TF9A 3HMPA 3ZONA 2WKMA 3KU2A 3PXKA 4PUZA 4S2ZA 3TUDA 2Z7LA 3BLHA 5GNKA 3DOGA 5M09A 5ANDA 5L4QA 4P7EA 1PF8A 4FI1A 2CGUA 3IDCA 2ESMA 3FMLA 3OOMA 4M84A 5HBEA 3U6JA 4MEDA 2VWZA 1PMVA 5IA1A 4MD7E 2Y8OA 2C5YA 4DEAA 3CP9A 4QD6A 3QYZA 5KNJA 4C7TA 5FP5A 2WQBA 4IIRA 4APCA 4HVSA 2WMVA 4ACCA 4EOPA 1YKRA 3RPRA 4DEIA 3DTCA 4JBQA 1J1CA 5FGKA 3L8VA 4I5MA 5AEPA 2V5QA 4TYJA 3D7TA 1NVQA 4JIKA 2XH5A 4IJPA 3TZ7A 2C6OA 3Q5ZA 5JFSA 1APME 2B0QA 3LVPA 3FXXA 2PWLA 2YLEA 1OUYA 2AUHA 3GC9A 3TACA 4KS8A 3OT3A 3DKFA 4IBMA 2UW9A 1PXOA 4Q5HA 3LPBA 5D9HA 4QTCA 4DGMA 2J5EA 2O5KA 4OW8A 4PDYA 5L2IA 2J2IB 2JFMA 4D58A 4EH6A 5CSPA 5IZFA 4FIGA 1W7HA 4GKHA 4CYIA 5H8BA 4FSQA 2BPMA 3PXFA 1SM2A 4XUFA 1P14A 4IB0A 4QRCA 2UW7A 1Q4LA 2PZIA 5BVKA 4CVAA 1V0PA 1ZZLA 4F1TA 4FVQA 4X2JA 4AP7A 3R7UA 3WARA 3EQRA 3R9DA 2YEXA 3NPCA 2BAJA 4KBAA 3DAJA 3ODYX 4TYEA 3UIMA 1YWVA 5EI2A 4DF3A 1LEZA 4IVBA 5CSXA 5BYYA 4O6EA 3T9IA 4IX5A 2UVXA 5HQ0A 3UMXA 4YC8A 4GUBA 1I09A 3OBGA 2ONLC 5CU6A 4L3LA 3BZ3A 3TDWA 4LV8A 4AW0A 4DFYA 4RIWA 2XB7A 5AIKA 4P4CA 3BHHA 4B8LA 4F65A 3ZM9A 4L3PA 5EYKA 3EJ1A 5FDPA 2HXLA 2H9VA 4AG8A 2WNTA 3EN7A 5F9EA 4YO6A 3OWJA 5CT7A 5HORA 2BRHA 1RDQE 1ZYJA 3AMBA 3G51A 5AA9A 3M42A 4J99A 2YITA 1ZYLA 4FYNA 3PG1A 4U81A 3HV4A 4IB3A 3JY9A 4D2VA 4CZTA 4UWBA 4QQCA 4F63A 3V8WA 2ITTA 3GNIB 3LFEA 3QQLA 2J50A 4CLIA 2X6EA 2KULA 2ITWA 2PVFA 1YDRE 3ELJA 3HRBA 4EWHA 2XNEA 3DK7A 3QRJA 4J96A 2YACA 2XKFA 4JDIA 3AC5A 1YXSA 3E87A 3FZRA 4PPCA 3RI1A 3AG9A 3SQQA 3ZSIA 3MBLA 4GFOA 4QYEA 1ZMVA 4FZAB 3PXYA 5CANA 2B7AA 3C13A 4X21A 2GHGA 3QTWA 3F3TA 4AFJA 4FKWA 3HMIA 5ANGA 2X39A 4AGDA 4IAIA 1Y6BA 4EUTA 3AQVA 4EC9A 4DA5A 3DAKA 3IGOA 4PTEA 5TE0A 4NYEA 3OP5A 3D5UA 3TI1A 4CG9A 3O51A 4HYHA 1MUOA 3D94A 4IANA 4JS8A 3WE4A 2PZRA 2WTJA 4OLIA 4JIAA 3UIXA 3TTIA 4YUQA 3QRTA 5L2TA 1WVXA 2XVDA 1A9UA 4NCTC 3G33A 2OU7A 5C26A 3LCOA 3RM6A 3FUPA 1VYZA 5FP6A 2W06A 5ETFA 4YTIA 4RIXA 3OXIA 2QR8A 4E93A 4YBKA 2IZUA 2YCFA 3ORZA 5A54A 3DBFA 3WIKA 3BV2A 4U79A 4AACA 5KMNA 4IADA 2VGOA 2W96B 2PVJA 5L8KA 3FLQA 4RGJA 1ZMWA 5DR9A 5HX8A 2CNVA 4FR4A 2O2UA 4G1WA 3V5PA 2CN8A 4BDEA 3TTJA 2X9EA 2DWBA 3EFWA 3PXRA 3QKLA 1YXXA 2PL0A 4XG2A 4AE9A 4MXCA 3NIZA 5K5NA 1OIUA 3E7VA 4EBVA 3LJ2A 3R02A 4QTDA 3TKIA 5IF1A 4TL0A 1URCA 3QWJA 5ETAA 4DLIA 4X6RA 4LQMA 4AZVA 2BZJA 3DFCB 4AT3A 2JITA 2NNWB 3JPVA 1BL6A 2BDFA 2W7XA 4RBLA 5KMLA 3KK8A 4ASDA 4J8MA 1H1PA 2OXXA 2VTPA 4B8MA 5C8MA 2HXQA 4ANBA 3IECA 3BHTA 4EOLA 4LMUA 5CZHA 3TJCA 5BX0A 1WBPA 2E9UA 2BALA 4CSVA 4U7ZA 3ALNA 4PDSA 1MQ4A 4KBCA 4I4FA 2W9FB 4BTFA 5IMEA 1URWA 2WPAA 4FTCA 1X8BA 4RFZA 3W18A 5HZNA 2A0CX 2BDJA 4UWYA 4AFEA 3MJ1A 4KIPA 1KV1A 3NSZA 4TPTA 4U3ZA 2BZKB 3NW5A 4LI5A 5CYIA 2PVYA 2P4IA 3SXSA 4BDCA 3CGOA 3PZEA 3OWPA 5KCVA 3VULA 4E5WA 2NRUA 4FG9A 3R9RA 3FAAA 2ETRA 3FKNA 3IDBA 5CZIA 4A9RA 1WBTA 5AP3A 4WNMA 3A4OX 3OF0A 3E92A 4O1PA 3O50A 4X7QA 5CI6A 4RX5A 3UQCA 2ITNA 4FNZA 2CJMA 2VU3A 2HY0A 1ZOEA 2PU8A 5DEWA 5EQPA 3MPMA 3G9LX 4FSWA 5LMAA 3QZHA 5CU0A 3QX4A 1J3HA 1K2PA 2YHVA 4TW9A 3RTPA 3NCZA 3CD8A 3LM5A 3CEKA 4QP1A 2X2LA 3LCTA 3OCTA 2B1PA 2BIYA 4XG9A 4JBOA 4FTOA 4OTRA 3VBXA 4EH4A 5CF6A 5IISA 2ITOA 2PMLX 5DG5A 2Q0NA 4D9UA 5I9YA 5DT4A 4EHEA 1W83A 2CCIA 4M0ZA 5CXZA 2QOFA 2C6LA 3F3VA 4KWPA 4WT6A 4GEOA 4RWLA 3MVMA 3DZQA 3ZUVA 4J8NA 5EDPA 3BRBA 3P23A 3R01A 4F0IA 2XK6A 1YWRA 2C47A 3R2BA 5KX8A 3LMGA 4FF8A 1P4OA 4JG8A 2J90A 2WMBA 3ETAA 3CY3A 4R5SA 5H9BA 3LZBA 2XUUA 1YHSA 1U54A 2C5OA 5KE0A 2B9HA 1WBWA 5CSHA 1YWNA 4EYMA 4I94A 4V04A 2JDSA 5LQFA 4MD8E 2XIZA 4GV1A 4J52A 2R3QA 2GMXA 2EXMA 5HO6A 2FSMX 2O64A 2P3GX 3A7FA 3MFSA 4ITIA 2RFDA 3ANRA 5EYMA 5TKDA 5T6KA 5I9VA 4FEWA 3HA6A 5JH6A 1XBBA 4M69A 3QU0A 5JSMA 1OPLA 4G31A 4X2FA 1FVTA 2XJ0A 4N4SA 4UWCA 5CAUA 4AS0A 4KSQA 3TT0A 3V8TA 4G3FA 5GJGA 3QUEA 5IQBA 4R1VA 1I44A 2OGVA 2R3NA 1RE8A 2C1BA 4ASZA 4DINA 4W4XA 5CAVA 5M08A 2EXEA 3PJ2A 5CI7A 3WZEA 4YO4A 5LVOA 5BYLA 3UTOA 4NEUA 3M2WA 5K5XA 3OHTA 4AZFA 2JAVA 5FEEA 4ARKA 1PMUA 2ZAZA 4IM0A 2F7ZE 4KRCA 1PYEA 3A8XA 3OEFX 5HX6A 2P2IA 1OIRA 5L6PA 5H2UA 2BTSA 3EQIA 4UBAA 4BWXA 2HWPA 3PA4A 3VQUA 3Q52A 4C8BA 1PY5A 4II5A 3QBNA 5EM7A 2YJRA 1JKTA 2QLQA 1PXJA 3E88A 2RFSA 4LRJA 3TV7A 5E8ZA 2WMWA 4ANQA 1NY3A 3KCFA 4RSSA 3UMWA 2J9MA 3FSFA 3GCSA 2PZPA 2R64A 4D1XA 3R8UA 1UV5A 2ITYA 4OTGA 3W1FA 1UA2A 3FC1X 4ZOGA 4CQEA 4RC2A 1Q24A 3CJGA 3IW5A 3UC3A 3MSSA 2FUMA 2OJFE 5K0KA 3NNVA 2Y9QA 3UG2A 1M2PA 4DE4A 3GQIA 5EFQA 4C33A 4UYNA 1SVGA 1PMEA 2QO7A 4MHAA 4RLLA 2XKCA 4ZTHA 3TUBA 5CVGA 3Q2JA 2V0DA 3FZPA 3I7CA 3V5QA 3VIDA 3V3VA 1YI4A 4WRGA 2GPHA 4JAJA 4A4XA 2JC6A 4CMUA 4WKQA 4USEA 5HD4A 5E4HA 3DPKA 2OSCA 5AUTA 1JVPP 4ZY6A 2OJIA 3HL7A 2PVKA 5FM3A 2W5HA 2ZV9A 5BMSA 5CAQA 4F99A 4UB7A 4YTFA 1KE5A 2VO3A 1F0QA 5EM8A 2YCQA 5AUZA 4FKIA 5FEDA 4YU2A 3UOLA 4S32A 4D2RA 4BVUA 3MPTA 2KTYA 4RX9A 3BIZA 4P5ZA 3EB0A 4CEGA 4A06A 3BYMA 2OJ9A 4MWIA 4IVCA 2WMQA 5AR8A 4EK5A 4TN6A 3BI6A 4WRSA 3TUCA 4L01A 2WTCA 3UIBA 2VWWA 5DVRA 5J7HA 1KSWA 4PY1A 3V5LA 4FIHA 3ATTA 4XOYA 4C3PA 3PPKA 1WBOA 4FEVA 4L3JA 4R77A 2B9JA 3R71A 4MX9A 3GI3A 1U46A 3BU5A 2QNJA 4C2VA 4GG5A 2F2UA 1STCE 2PTKA 3B8QA 4EL9A 1PXNA 4GFMA 3DY7A 2E9NA 4RJ3A 3GEQA 3F5PA 4A9UA 4FV2A 4E6AA 5FQDC 3BQCA 1M2RA 5IA5A 2QODA 3S0OA 1PW2A 2G1TA 1HCLA 4IWDA 3FI4A 4AN2A 4ENXA 3FLZA 3AGMA 3VS4A 2EUFB 3QRIA 4TNDA 3VC4A 4OTWA 4HCUA 4MXXA 2FSLX 3DJ5A 3R7YA 1J7UA 5BVEA 2R3KA 2WGJA 4C4GA 5BVWA 4EK3A 5AV2A 3PWYA 2ZM4A 3DLSA 4NU1A 1T46A 3SXRA 5AV3A 4EJNA 5L8LA 2XEZA 4MTAA 3NVKI 2YM6A 4ITJA 4G3CA 3GC7A 4KKGA 3QKKA 4FV3A 3PVUA 4KKHA 3QCXA 5A4EA 4O2PA 5DRDA 4ALVA 3KN5A 3R7IA 4WHZA 5JQ8A 3DB6A 2QD9A 4O21A 2HW7A 2WQMA 4RIYA 1Q8ZA 4WBOA 1RJBA 4P5QA 5F4NA 4X3FB 4O0VA 1CKPA 4EOKA 1IG1A 1QPEA 5C03A 3DU8A 3R9OA 4JQ8A 4AA4A 4C58A 3LXLA 4RWIA 5IQIA 5GINE 3E8NA 3FLWA 3GUBA 4UN0C 5FG8A 2C5VA 3DA6A 3FV8A 4IDTA 1YW2A 3G90X 3OXTA 2OZAA 2BRMA 1OI9A 3LLTA 3RHKA 3SXFA 4HGSA 4A4OA 2QLUA 2I1MA 3I81A 4LV5A 2Z7RA 2WZJA 1O9UA 3KQ7A 2VX1A 4DCAA 3UVQA 1XH5A 2X8IA 4K8AA 4KNBA 5AAEA 2X2KA 3H3CA 3ZSGA 2PUUA 4CCUA 4DITA 2BVAA 3Q6UA 4GFGA 5IEXA 4HZSA 4F1MA 1NVRA 3FC2A 2ITVA 3QYWA 4FA2A 4HPUE 4CMTA 4JXFA 2R2PA 4ZP5A 5AAFA 1LUFA 3PXQA 3WZJA 3FYJX 3W8LA 4M13A 5E91A 4J97A 3BYVA 4KIKB 2Y7JA 4KBKA 4YMJA 3PRIA 2W4JA 1Q3DA 3KRJA 4TWOA 4ZAUA 5JGAA 4MBIA 3THBA 4KS7A 1JQHA 3OEZA 4YSJA 3PJ8A 3Q9YA 3R83A 4AOJA 4ZY5A 3MDYA 3VAPA 4P90A 3EOCA 4ZTLA 2XM9A 5KMJA 3EFJA 4H1MA 4XV1A 4FZ6A 4ACHA 2OIQA 3MA3A 4F7SA 4XLVA 3SKCA 4CZUA 5IH4A 3U6HA 4DTKA 3O96A 4U5JA 1PXKA 3BLRA 4F6WA 3NUNA 4QOXA 4FKTA 4GK4A 4IFCA 1E1XA 4ORKA 2J51A 2R7IA 4LL0A 4O38A 4ONAA 5ITAA 2H6DA 3Q4ZA 1NT2A 5ICPA 3NYVA 4X2NA 1K9AA 2W5BA 5FD2A 3UE4A 4FV8A 4DHFA 4S31A 3R8VA 3Q60A 4EONA 3NWWA 1M14A 3BU3A 3EKKA 3EZVA 2W1HA 2YDIA 4BWPA 4D5KA 3VHKA 3Q96A 4CTCA 5M4CA 3KY2A 4AW5A 1ZARA 2Z7SA 4WO5A 3C4ZA 4G3GA 1OITA 4IM3A 4QYGA 3RP9A 1OBDA 3E64A 2J6MA 3P1AA 4ERKA 3ZC5A 1H1RA 4GU6A 4FKUA 3MJ2A 3QTXA 2XYNA 3QD0A 4GVAA 4BDFA 4BIDA 2YZLA 3GGFA 3L9LA 4FSNA 3MY5A 4H39A 4QYHA 4IWQA 4FV1A 4AZEA 1ZYSA 2BHEA 4FBXA 1M2QA 4PQNA 4ZJJA 5A4LA 5BQ0A 2OXYA 3IW4A 5HCYA 3F5GA 2UW6A 2Y4IB 3Q2MA 4ZEGA 3LM0A 2G9XA 4DGLC 3HKOA 4FGBA 5AWMA 2O0UA 2IW8A 4QMVA 3QL8A 2GTNA 2BROA 2C4GA 2XP2A 3DKOA 4O0YA 5E92A 3RHXA 4M12A 3SD0A 4CGAA 4I23A 2YIQA 3NEWA 3OTVA 3P9JA 4L52A 2BMCA 2X7FA 2XIYA 4M14A 5IA2A 4FSUA 3P7AA 5BNJA 1QCFA 3E62A 2WTKB 2B9FA 4MNEB 4RFMA 1CKIA 4EOIA 5CF5A 5JGDA 2W1ZA 3DXNA 3UPXA 4BKYA 4CKRA 3PA5A 4NL0A 1TQIA 3WYYA 3R22A 5I9XA 2C5XA 4IZ5A 1JOWB 5ANJA 3QXOA 3RNIA 2HZIA 4BY9E 4BCOA 3VRZA 3KKVA 3R1QA 2BAKA 1VR2A 1WBNA 4F1OA 2OF2A 2BFYA 4O7NA 2E9VA 4FTRA 3KULA 4BTMA 4BICA 3PYYA 2UW3A 3UNZA 3FLYA 4R3RA 2X8DA 4BTKA 2PVNA 4QMOA 3R7GA 4DEEA 3ZHPC 1DM2A 2AC5A 2EB3A 2OICA 3FZ1A 2VTOA 1M17A 4I0TA 3WF5A 3GOKA 3ZBFA 2IG7A 1W84A 3U55A 2W1CA 3KA0A 2CNQA 1IA9A 3ENHA 2W1GA 3VS3A 4BC6A 1G8SA 5A6OA 2NPQA 3A62A 3NLBA 2R3FA 2GS7A 4A9TA 3G2FA 4U43A 4ZTRA 1OB3A 2NRYA 5DHJA 5JZNA 3ULIA 3QX2A 5J9YA 3SA0A 3T8OA 3FQEA 4BWKA 4K9YA 4YZ9A 3U4UA 3ZRLA 3QGWA 4C35A 3L9NA 3P86A 3O0GA 4L00A 2UV2A 2GQSA 3R73A 4O84A 3OY1A 3DAEA 2X2MA 4F9YA 3HAVA 2ZDUA 2VWBA 3CPBA 3P78A 4Y8DA 4G6OA 1XH4A 4ACGA 2OXDA 4C3FA 4N6ZA 3KRXA 3VW6A 1R1WA 1UKHA 4G16A 3SAYA 4CTBA 5M51A 2UZDA 1JBPE 2YDJA 4L44A 4QP8A 5A4TA 5JKGA 5LMKA 5HNIX 4XV3A 5LMBA 2YCRA 3F82A 3QHWA 3ZO4A 3L8PA 3COMA 3C1XA 3OWKA 5ETCA 3I4BA 2EXCX 4FGRA 3QRUA 2JIVA 3K3JA 4FEQA 3CTJA 2JFLA 3HYHA 4G34A 3GBZA 4BB4A 5HG9A 4KAOA 3V5JA 4YZNA 4TT7A 5HD7A 4CKIA 1OBGA 4I6QA 5HIEA 2XKDA 4O1OA 3ZO3A 4PX6A 4RJ8A 2EB2A 3ZUUA 3HMMA 2R3LA 3VQHA 2HZ0A 4UXLA 2OLCA 1Z9XA 3Q4TA 3R1YA 5DLSA 4O6LA 1UU9A 2NP8A 2QC6A 3BE9A 3BGPA 5D12A 2YM7A 4QP3A 1Q8WA 5FWKK 4C4FA 5CWZA 3QF9A 3COKA 5AR2A 2XCHA 4AN3A 2JDRA 3D5VA 4EUUA 4XP2A 5C9CA 4EHZA 5HU9A 4U9AA 5CNNA 4A07A 4CFWA 4RLKA 1YXVA 2XK7A 4EQUA 3D7TB 1R0PA 4G9CA 3C5IA 2QOQA 1ZOGA 2VTTA 1TVOA 1DAWA 5F94A 4CV9A 3DV3A 4I6HA 4OTQA 3UZTA 3IPHA 3H0YA 2CKEA 3LFDA 4PPBA 5AR7A 3O7LB 3HDMA 3OTUA 4GT3A 4C4HA 3O2MA 4MKCA 4ZTMA 3CKXA 4YNEA 3VS6A 4CFFA 3PJCA 4YJUA 4E26A 4FV4A 4H3QA 4O0WA 5D10A 3RK9A 1ZYCA 2C68A 3FMNA 4FIJA 2ZM1A 4G17A 3PTGA 3UO6A 2GCDA 5L6WL 1YHWA 2VTSA 3BQRA 4O81A 2CN5A 5HNBA 3D5WA 3DXPA 4FKQA 5BUIA 4HVGA 4GH2A 4NK9A 1Z57A 5FBNC 3TNPC 5J5SA 4FVPA 2E9OA 3NDMA 3BYOA 2IZRA 4NFMA 2J5FA 4USDA 2QQ7A 4RVMA 5CQWA 4N0SA 4Z55A 4W9WA 2YWPA 2BTRA 4B9DA 4DBXA 2XF0A 3LFAA 5EQEA 2FH9A 4HVHA 4E6DA 4XRLA 4FICA 3BHUA 5I4NA 5LCKA 3ZRMA 3FY2A 3BE2A 5JRQA 5A3XA 2IPXA 4RIWB 5GJDA 4O27B 3S1HA 2DUVA 4CRSA 2XKEA 5M06A 2G2IA 3E5AA 3NAXA 4K18A 5EI8A 5EH0A 4OGRA 3HV3A 3FZSA 3VWAA 4LMNA 4QT1A 4CV8A 5M55A 2VZ6A 2ZVAA 4O7YA 5CNOA 2ITPA 4BTJA 3C0IA 2B54A 3VUKA 4JLCA 4DH1A 3V8SA 3UP7A 2ZB1A 3WILA 2JBPA 3KB7A 5M4FA 5EQYA 2R0UA 3QA8A 4Q5EA 3GQLA 4Y95A 3TCPA 5JRSA 4IZ7A 3F3WA 5LVPA 2PE2A 2UW4A 3D7ZA 3LXKA 3HDNA 4E4NA 1R3CA 4DFBA 3ZXTA 5JGBA 4LGDA 3ZLXA 4AF3A 2ITXA 5ETIA 1GIJA 5M4IA 2QU5A 3HV5A 4G6NA 2VNYA 3LFBA 3FHRA 4NIFA 4DTAA 2C6KA 2HW6A 3EN6A 3OW3A 3WZKA 3TZMA 3I7BA 5KZIA 2X7GA 3AMYA 4IDVA 5E8YA 3UO5A 1WVWA 5IUGA 3F2RA 3E93A 1V1KA 3FXWA 4GT5A 4DEBA 4NTTA 3VS2A 4E3CA 3ZDIA 4D55A 4NM7A 2WMXA 3G0FA 3PIXA 4D0XA 5FTOA 2R3MA 1RQQA 2BDWA 5IKWA 5DNRA 4G9RA 4KIQA 4GU9A 1Q5KA 3D0EA 4WBBB 4A7CA 1OKYA 3A4PA 2ZB0A 3GU7A 3ZZWA 2XNBA 2ZOQA 3PP1A 4JQ7A 3GXLA 1GZNA 5ANKA 3V5WA 2AC3A 4O0SA 2GQRA 4V0GB 3QCYA 4LGGA 4RIXB 4FSZA 3RBWA 4YHJA 2VRXA 4L53A 1OIYA 4JX3A 4IAKA 3VUIA 1LEWA 4RA5A 5AMNA 4GT4A 4AN9A 2JBOA 2HELA 2ZM3A 4GRBA 3F2AA 5CEPA 1BLXA 4NW5A 4FT7A 4Q2AA 2CMWA 3TNWA 2BIKB 2W4OA 4BL1A 4X2KA 4Z16A 2CNUA 5HGIA 3LFCA 5E1SA 4AWIA 2BUJA 5I9UA 3TKHA 5AP6A 4C38A 3NIEA 4R6VA 1S9IA 1NXKA 2GDOA 3Q4UA 3R04A 5DRBA 4EWQA 4DTBA 5DA3A 4EI4A 2O65A 2ZV7A 2F7EE 5BVNA 2VTAA 2XZSA 3BX5A 3DS6A 4LFIA 4BCIA 4QMUA 3BYSA 3UC4A 1CMKE 3PSBA 4U0IA 3EQDA 4ZTSA 1TQPA 4FT3A 2YA9A 1OM1A 4XNEA 2B55A 4YTCA 2WO6A 3BKBA 4O7WA 3PPJA 2A19B 4AA5A 3PA3A 3TM0A 3K54A 2HK5A 1V0OA 4HPTE 4M68A 1IAJA 3QA0A 1OKWA 4MWHA 3R30A 5GHVA 3T3VA 2J0JA 3E8CA 4O96A 2UVZA 2R3JA 2GSFA 2O3PA 2W17A 3AC2A 4FV5A 3HVCA 2C3IB 2WQNA 3L9MA 2A1AB 4GVJA 5C27A 1PJKA 3ZSHA 4O83A 4DH8A 4MNFA 4RJ7A 2BRGA 3KEXA 3CY2A 5L2SA 4M3QA 1U5QA 3QTQA 3LJ0A 5AUYA 5LXMA 5ANEA 1M7QA 3ORNA 1CTPE 2RFNA 3FEGA 5A46A 3HP2A 4NKAA 3Q4CA 3U9CA 5KMMA 2IW9A 5DYJA 2QO9A 2RF9A 1QPDA 1UNLA 2WOTA 3QHRA 3FZOA 1Y6AA 2JKOA 2PMIA 2C0TA 4EOQA 3LCSA 2YWVA 3QCSA 4I0SA 1GAGA 1OL5A 1S9JA 3CKWA 4L6QA 4Y83A 4U42A 4A9SA 4F0FA 3K5VA 4O0UA 5GZ8A 5IQFA 4DEGA 4AW2A 5DPVA 3WF8A 3KVWA 3IG7A 3BWJA 4HNFA 3VN9A 3F7WA 3VNTA 3WF7A 4EOOA 3ZS5A 1PKDA 2JKKA 3A99A 1ND4A 4HGTA 3MIYA 4M66A 5L3AA 2HWOA 2CGXA 3FL5A 3QD2B 4WG5A 2CGVA 4M67A 2OG8A 3RCDA 3PPZA 4GIHA 4MXOA 5FRIA 2XK4A 2GS6A 4GKIA 4C37A 5HIDA 4RJ4A 4X3FC 1F3MC 2X4FA 2GNJA 2R4BA 2UZUE 4YTHA 5D7AA 4DH7A 5JK3A 4B99A 2WMUA 4ANLA 2V22A 1U54B 4FV6A 4JG7A 4E8AA 5CU4A 4XG3A 2XM8A 4K0YA 2F49A 4XG8A 5BMMA 3VJOA 3ZFMA 3U54A 3QTZA 2C69A 4FSTA 4RJ5A 4XG6A 4O7ZA 4MXAA 5EDRA 2Z02A 3SV0A 4DEDA 4QMXA 3A61A 5CEQA 3HA8A 3TXOA 3ZLWA 4FIFA 2WHBA 4MBLA 3CBLA 4AGCA 2ZV2A 4BDBA 3AD5A 3FDNA 4QQTA 2IVTA 1H1SA 4HYSA 4LGHA 4WUNA 1QMZA 4C36A 3VF8A 2Y6MA 2I6LA 1H1WA 4FKPA 3CCNA 4D1SA 5I3RA 1HCKA 3ET7A 3ZCLA 4DC2A 4YLJA 2X7OA 2HOGA 4BIEA 5IMXA 3GU5A 4O22A 1AQ1A 4QMPA 2G15A 2QHNA 5K4JA 2RG5A 2GNLA 5G1XA 5HCZA 5DN3A 1H1QA 2X0GA 5AV0A 3SRVB 5M4UA 3O23A 4WOVA 4AW1A 4JDJA 4PMPA 4ZJIA 3C50A 3ORIA 3PVWA 4R3CA 4Z7GA 2Q0BA 2O63A 4OTFA 3ZC6A 4F9CA 3DT1A 5K4IA 4QMSA 3PSCA 2V55A 5BVFA 5HI2A 4FKVA 3C4EA 1T45A 4FUYA 3MGYA 2VNWA 4OBOA 4F9WA 5FTGA 5IH5A 3HUCA 3GP0A 2J0IA 4V01A 1FPUA 3EQFA 4PMTA 5J8IA 4EQMA 4QNYA 4W4YA 2YIYA 4A9YA 4L46A 4UZDA 2UZBA 3T9TA 3V04A 3VVHA 2P55A 2H8HA 4L68A 3QQJA 2XIXA 3DDQA 3FHIA 3FJQE 4FL2A 3DNDA 2VO0A 4KKEA 4IWPA 4LM5A 3K3IA 4BDAA 1Q8YA 4I1ZA 2GNFA 3FKLA 1J1BA 4I22A 4GCJA 3W32A 3F88A 1OZ1A 4QMWA 4YGAA 4D2PA 2OJJA 1XH7A 4AQCA 4DG3E 4AZSA 1FMOE 2XK8A 4FEXA 2PZYA 3HZTA 4N6YA 4RWJA 4ACDA 3D2KA 3GCVA 3P7CA 4ZLYA 4GJ3A 3RKBA 1TQMA 2Y4IC 3EQBA 3OCBA 3TV6A 5TOZA 4W4VA 3R8PA 3R21A 2G01A 2IZSA 1U5RA 4RC4A 2WB8A 1AD5A 3ZLYA 3KF7A 3NMUF 1GY3A 3EQCA 1DI8A 4OTIA 3MFTA 4XMOA 3R28A 4GS6A 1QL6A 3M11A 4BZDA 2R7BA 4F0GA 5KKRB
chains in the Genus database with same CATH superfamily
5CASA 3FMDA 3HP5A 4IWOA 1IEPA 3MH3A 3N4UA 1WCCA 3RAIA 4QP9A 4L67A 4QMQA 4I93A 2LAVA 4EH9A 4BI2A 4EH5A 1JSTA 3G6GA 3E8DA 3O8UA 5J1VA 2WTKC 3KREA 4CZYB 2CSNA 5B7VA 4YJNA 3EMGA 2HZNA 4Z7HA 4ALUA 4XOZA 2OO8X 3UO4A 3DJ7A 5HLPA 3W0QA 2ZMDA 2ZYBA 3D2IA 4JL9A 4AOIA 4IX3A 2WIPA 1H01A 4ASXA 2UZVA 5GZ9A 5JQ5A 5LCJA 1OGUA 5EKNA 5IQDA 4QTBA 3A60A 4EK6A 1Q97A 4ZS0A 4BGHA 5CF4A 2OKRA 1JKSA 1GZOA 2WU7A 3QLFA 4FEWA 4L9IA 1JAMA 2BZIB 3F5XA 4EH7A 4DFLA 2QOHA 4BBMA 4RX8A 4TZRA 2BFXA 3RJCA 5B2MA 2PVRA 4QPMA 3UG1A 3UOHA 2BR1A 2ZFYA 1H24A 2BRNA 4YJSA 1NW1A 3LQ3A 1MRYA 3A7JA 3E3BX 4FE2A 3NNWA 4UX9A 4WA9A 3AKJA 3GU4A 1BYGA 2WMAA 1UKIA 3BLQA 3JYAA 4I5CA 4UYAA 2ONLA 1P2AA 3QUPA 3F6XA 4XH6A 4EC8A 3DK6A 3JVSA 2QOIA 5AP1A 4ACMA 3MA6A 2GS2A 4RVTA 3UZRA 4OTPA 5D41A 4TNBA 3F2NA 1OGYA 4WG3A 2I40A 4ERWA 5IEVA 3OG7A 3WBLA 1OMWA 2HZ4A 3CPCA 5ACBC 4E4MA 2WTWA 3IGGA 2OW3A 3HECA 3HNGA 3ERKA 3KRLA 5KBRA 4EOSA 3AXWA 2JD5A 3ZFXA 4IX6A 4EKLA 3ODZX 4YC3A 5AR4A 4A4LA 3BHYA 4GL9A 2XK9A 4J71A 2Z8CA 4EYJA 5IUIA 4FTKA 2XK3A 2OH0E 4YJPA 1XR1A 4MVFA 4D0WA 5J7BA 4BCPA 2W99B 3FXZA 4MK0A 4EORA 3NCGA 1OPKA 2JKQA 2VD5A 5EKOA 3A7IA 4BDJA 3HMOA 1KE8A 3CXWA 3Q6WA 4O4DA 3DNEA 3POOA 4RC3A 4S33A 4BCNA 4UMQA 4YLKA 3RZBA 3FZTA 4M7IA 4L8MA 2YLFA 3FY0A 3C4WA 3LMIA 5B0XA 1KOBA 2I0YA 4GYIA 5FBOA 4ZZMA 3LIJA 4DN5A 4FTIA 5A9UA 4YNOA 2BKKA 3HAMA 3COIA 2QVSE 2C5NA 2Z7QA 4U6RA 4BCHA 3ORPA 5AP4A 3TNHA 3DQWA 5KUPA 3E63A 3A8WA 5EHYA 5AFVA 4I92A 2IN6A 5ACKA 2X1NA 2QONA 2BHHA 3MYGA 5HE3A 3V01A 3ORXA 1YQJA 4NCTA 4YP8A 4BYJA 3ZXZA 2XCKA 2R0IA 4KRDA 4JOAA 1VZOA 1UWHA 4ZTNA 5HG7A 2BKZA 4FV9A 1PXLA 4U8ZA 4CT2A 3DTWA 4D4VA 1YOMA 4WG4A 1WAKA 3ZBXA 5LOHA 4AT4A 2O8YA 5AADA 1ZRZA 4BF2A 5I3OA 4C59A 4DT8A 1L8TA 4PDOA 2OWBA 4KABA 1LP4A 4ASEA 5G6VA 2X0PA 3TIYA 3PFQA 5FM2A 4Z9LA 1H00A 5IUHA 3CIKA 3IONA 4LUDA 1H0VA 3AC3A 1XBCA 1OKZA 2C0IA 4PTGA 5CVHA 2VTQA 5AV1A 2B9IA 2GHLA 2J0KA 4FKJA 5TO8A 2GQGA 5AV4A 3CQEA 2UVYA 2J0LA 3OUKA 4HGLA 4IZAA 4AGUA 3CTQA 3OFMA 4R7IA 4F6UA 5AR5A 5C8KA 3RALA 3U87A 4M97A 4QMYA 4BFMA 3AT4A 3BGQA 4D9TA 4CG8A 1BMKA 4B4LA 1ZOHA 3C9WA 2ETMA 3H4JA 3COHA 2UW8A 3QZGA 2JGZA 4RT7A 2XA4A 2BZHB 2QKWB 3UYTA 4H1JA 4PNIA 4QO9A 4YZBA 2XANA 3JUHA 3ZO1A 5IH6A 3OD6X 2X8EA 4B7TA 3SG9A 3NUSA 4DBNA 3EFKA 4CMOA 2VWVA 3Q9XA 4RWKA 2Q83A 4L45A 2J0MB 2XNOA 3AMAA 4GK3A 3MWUA 5ANOA 5IQHA 4BJJA 3IK3A 3UBDA 4Q9ZA 4BDIA 4C4EA 4FTJA 2GFSA 4FG8A 4FKOA 1DAYA 5HEZA 3R7VA 1B38A 2XJ2A 3BYUA 5KBQA 3ID6C 3W2RA 2FYSA 3IOPA 3LE6A 4EZ3A 5BVOA 3IKAA 5HVJA 4I6BA 2OK1A 3R0TA 3SLSA 5IQEA 2ZMCA 3E8EA 3IW7A 1W0XC 2WQOA 2OIBA 3GFWA 5HHWA 3RPYA 5AUXA 1OECA 1HOWA 4CLJA 1WBSA 3VS1A 4BCFA 1UU7A 3N4VA 3K2LA 3WIGA 4U45A 4ZXTA 2XNMA 3MV5A 5BYZA 4AX8A 2BAQA 4IHPA 3L9PA 3BWFA 1VEBA 4IX4A 3WF6A 1U4DA 2V62A 4JBVA 4RJ6A 2WOUA 4DYMA 1SNXA 4QTEA 4GYGA 4J53A 2BCJA 2E2BA 4C4IA 4I5HA 3P08A 1RW8A 1JWHA 1P5EA 5E9EA 5H8GA 4WNKA 3UJGA 5LWMA 2C6DA 4OAVB 3AC1A 3VJNA 4C02A 5C4KA 4EKKA 4BKJA 2C30A 3GU6A 3MN3A 1G8JA 2C3LA 3C4FA 3EH9A 4IVAA 5LARA 4B6LA 4W8DA 4ZSEA 2YM4A 3OS3A 5FEQA 3Q32A 3ZH8A 2JAMA 2YABA 4LOOA 3HX4A 5I9ZA 2DYLA 4O7LA 4MUQA 2QR7A 1XO2B 2RGPA 3N4TA 4QMLA 4BCMA 3VS5A 2YFXA 1UNHA 5LVMA 3IDPA 2UZOA 4NSTA 4CYJA 1E9HA 1FVRA 2R3RA 3IQ7A 3GCUA 5CAOA 3VONA 4MF0A 3RK5A 2QI8A 5DMZA 1A48A 4W4WA 4HGEA 4NH1A 4R7HA 1SVHA 4XYFA 4LL5A 4EH8A 4FKLA 3TKUA 4FODA 1NA7A 3EHAA 4IB1A 3UNKA 2F9GA 4K33A 4XCUA 2YM3A 3TWJA 5J9LA 2IJMA 2H34A 3UGCA 3P79A 1AGWA 2EVAA 4DGNA 5E8WA 5FXQA 4PF4A 4WD5A 2QURA 1CM8A 5HG8A 3DJ6A 2CGWA 3GFEA 5FTQA 4TWNA 1V0BA 3K5UA 4RQKA 4NM0A 4TYIA 4D28A 4IZYA 3VBWA 3KMMA 4BRXA 1H08A 3IO7A 2RSVA 4Y85A 3NNXA 3OCSA 3R1SA 3PY0A 1CDKA 2VTHA 2AEGA 4APPA 2OFUA 3MH0A 4ZLZA 3Q3BA 1JLUE 2IO6A 4IB5A 2UW0A 1CKJA 1CSNA 1Q3WA 1FMKA 3EN9A 3H30A 3OC1A 4FOCA 4QP6A 5J1WA 3R9NA 4AGWA 3GENA 4TYHA 2W5AA 3TG1A 5EM6A 4JRNA 5CSVA 2I0HA 5JT2A 5J9ZA 3RWQA 1Q8TA 4AAAA 3W0PA 4OAUC 4F7LA 4QP4A 5F95A 1OKVA 4J1RA 3ZLSA 4ENYA 2PSQA 4JX7A 3V6SA 3EN5A 3OY3A 4UMUA 3DKCA 3VS0A 1KE9A 4CFMA 3T3UA 1YDSE 3AKLA 3FMJA 3PWDA 3UYSA 1G8AA 3EKNA 4YPDA 2C3KA 3VBTA 4E1ZA 3ZMMA 2XIRA 3SOCA 1BUHA 5EW3A 3KGAA 3EZRA 4EZ5A 4GSBA 3AT2A 4FKGA 3UDZA 1XH9A 2EWAA 4D2TA 4FT5A 2PYWA 1ZLTA 3KXZA 4QMZA 4DH3A 3BEGA 5L2QA 4EHVA 3AOXA 1ERKA 5M53A 2A4LA 3ORTA 1REKA 1YHVA 4FSYA 2UUEA 4JR7A 4L43A 2XS0A 4PTCA 2X4ZA 3MFUA 4O7VA 2OJGA 2XNGA 5LWNA 3TZ8A 2XYUA 3ULZA 4IH8A 1XH8A 1VYWA 3MPAA 1UNGA 3CS9A 2YN8A 2FSOX 3FMKA 4Q9SA 1ST0A 2C6IA 3MFRA 4D4SA 4KINA 3EIDA 5DOSA 5AAGA 4FTLA 3DXQA 4MH7A 2JLDA 3W2PA 5DIAA 4O0RA 3ANQA 5E8UA 4RZWA 4F64A 4TWPA 3OXZA 1WFCA 3C5UA 3QC4A 4FIIA 5EG3A 5AX3A 1Z5MA 5H8EA 5CU3A 4AT5A 3ATSA 2CKPA 3I1AA 2QG5A 2DQ7X 5DR6A 4CFXA 5CX9A 2Z2WA 3NW7A 4BIBA 2VTLA 4I21A 4FC0A 4NM5A 3V5TA 4AZTA 5IG1A 4BCQA 2F2CB 3AD6A 1Q99A 2VTJA 3GOPA 3OMVA 4EH2A 3SVVA 3JR1A 3PY3A 2QOOA 5HBJA 4YZDA 3PE1A 2CKQA 4EZ7A 5AIRA 3UPZA 2I7QA 4O86A 2BRBA 4EJ7A 4I6FA 1M7NA 2OFVA 3Q9WA 1YDTE 5C4LA 5BUJA 3F61A 5JEBA 4Y5HA 2Y4PA 1YOLA 2C6TA 1IRKA 1H28A 5K0XA 4IM2A 3VUGA 4QQ5A 5IQGA 2W4KA 3QRKA 3S2PA 4H05A 3ZRKA 1O6LA 1Y8GA 3SC1A 3FE3A 4YBJA 2ZDTA 3BPRA 4NIFB 4FTTA 2HYYA 2ERKA 4IJ9A 5CXHA 4PL4A 4RPVA 3F3ZA 4C61A 1FGKA 4M8TA 5L8JA 4IE9A 3CC6A 3NUPA 3NYNA 1Y8YA 5FXSA 1UVRA 2Y0AA 3ZYAA 5C8NA 1GIHA 2QKRA 2ITZA 3NYOA 4QMMA 4Y5QA 4DH5A 2XRWA 2JDOA 5K3YA 4BGGA 3SOAA 4WNOA 1R0EA 3POZA 3QQGA 3LFSA 4K6ZA 2XMYA 3QZFA 2CHLA 4UXQA 1GJOA 4F08A 2WMSA 5JFVA 4R78A 3BGZA 2WD1A 3MH1A 3SW7A 2XJ1A 4YLLA 5HE2A 3S00A 4J95A 3PVGA 4EOJA 3H9OA 2W1FA 5K9IA 4EEVA 3G0EA 2GNHA 2B53A 3LQ8A 4RMZA 3QFVA 5H3QA 1JSUA 3DGKA 5B2KA 5IEYA 4EHGA 4GMYA 4YHFA 3SW4A 4FRFA 2VV9A 3OCGA 5CT0A 5HBHA 3W0RA 4CD0A 3UIUA 3H10A 4BBEA 4NJDA 4BI1A 2QHMA 4FL3A 4JQEA 4ZSGA 5FDXA 3RGFA 1IA8A 4OT5A 3SHEA 4BGQA 3RK7A 3QTSA 3NVMB 4RVKA 4XG7A 2IVUA 3TEIA 3R8ZA 3FL4A 1MRUA 3QLGA 3ZEPA 1W98A 4PMMA 4F70A 5KMOA 1WZYA 2VO7A 5CTPA 2WEVA 3LW0A 3DZOA 3ZUTA 2VX0A 4WSYA 3VUHA 3PSDA 3PVBA 5EYDA 5CALA 2PY3A 2W1DA 2OF4A 4FUXA 1XMLA 3SGCA 4G2FA 4YZMA 1J7LA 4DFZE 1FOTA 3DFAA 4PL3A 1YI3A 2QU6A 5KKRC 4JT3A 5EM5A 3UP2A 3EFLA 3I5NA 2CPKE 4DDGA 2XBAA 4AXDA 5HG5A 4W8EA 3L8XA 1Q41A 3MW1A 3BL7A 3P7BA 4HZRA 3WOWA 4ZK5A 2OZOA 2QO2A 5HLWA 1DS5A 3JY0A 3LHJA 5E90A 3D83A 3L1SA 3Q5IA 5EOLA 1JKLA 4JAIA 5J79A 1JKKA 5CS6A 1MQBA 5EHLA 4KB8A 3QZIA 4N57A 1GNGA 5M07A 4JR3A 2VWUA 2VX3A 3QQHA 1GOLA 1YRPA 1XQZA 4DFNA 5J95A 3FYKX 5HESA 2QOBA 3WF9A 4BYIA 5AUUA 3TL8A 4QMNA 5FUTA 1O6YA 2VWYA 3FQSA 3M1SA 1OPJA 2VN9A 4TKSA 5M56A 4U40A 4B0GA 5D7VA 3W2OA 5CAPA 2PHKA 4F4PA 5AP7A 3OUNB 2XEYA 3ZFYA 1Y57A 3ORKA 4JI9A 3EYHA 4PRJA 3A7HA 5DFPA 4F7JA 2XIKA 3AGLA 4FT0A 3EL7A 5HO8A 4FTNA 3S95A 3TZ9A 2HIWA 3SG8A 1FINA 4R8QA 2R3PA 4OT6A 4M0YA 3TNIA 1SVEA 4XHKB 4Y46A 3UOKA 3LOKA 3TN8A 4AXAA 3VW8A 4ANMA 2WTVA 1OL6A 1H25A 2IZTA 2ITQA 4IFGA 3W2QA 2V7AA 1H4LA 4FZDB 5DGZA 1FQ1B 4RVLA 2YM5A 2IVSA 4X3JA 4XP0A 4YZCA 4V0GA 3LFQA 4U44A 3GCPA 5F20A 3HGKA 4DFUA 5KHXA 2PE1A 4O7SA 4M15A 4OBPA 4DCEA 5IDNA 3NW6A 4MXZA 4YJTA 2W1IA 3PIZA 5TR6A 5AUWA 4FV7A 4BZNA 3O71A 4ZJVA 4O82A 2P2HA 1SYKA 4EQCA 1OL7A 1YXTA 3QALE 3DLZA 1H27A 4IW0A 4O91A 1BI7A 1BL7A 4ZY4A 4LOQA 3VBYA 3BCEA 3VS7A 4I4EA 4PPAA 3EQPA 4H58A 2YIRA 2XNNA 5IQAA 5DI1A 3H0ZA 4O2ZA 3UQGA 5I9WA 3D14A 2DS1A 4U41A 2RL5A 4WNPA 3NR9A 3Q04A 4YURA 2JDVA 3PDTA 3U51A 4CT1A 3G15A 3NX8A 4D2WA 3LCKA 2WELA 4K77A 3RM7A 2PMNX 4ZTQA 4G3EA 2HAKA 3R00A 5D11A 3TNQB 2PPQA 3MVJA 4HJOA 5JFWA 3O5AA 3ALOA 5JFXA 5DWRA 4XEYA 4JG6A 1Q62A 4EBWA 4LV7A 1UU8A 3VO3A 5HE1A 2B52A 4YJRA 5EI6A 1XH6A 5AM6A 4CRLA 4L7FA 5TT7A 4I3ZA 1YOJA 4UEUA 3P5KA 4IAFA 3RNYA 5GZAA 4LRKA 2ZV8A 5CEMA 4JBPA 4ZSJA 2PULA 2ITUA 4IMYA 4FEUA 2UZNA 3LFNA 3SX9A 4ZIMA 1ZZ2A 4M69B 4LYNA 1SZMA 4NTSA 4QTAA 1XHAA 4BHNA 4D2SA 3RPOA 3MH2A 1GZKA 5EDQA 4FTQA 1JNKA 3RCJA 3NUYA 4GW8A 5CEKA 4G5PA 3ZTXA 1B39A 5T3QA 3QWKA 4QP7A 5I0BA 4AQKA 4LG4A 4CNHA 3H9FA 5CENA 2HCKA 2R9SA 4OTHA 4MF1A 3S3IA 4IC7A 4C62A 4ID7A 4R3PA 4DFXE 3LLAA 1PYXA 1MRVA 3KXMA 3QAME 5T68A 5IA0A 2VTMA 4G5JA 3ZOSA 3GU8A 4YC6A 4PP9A 3WE8A 4EOMA 4TXCA 5HTIA 3GVUA 1G5SA 3BEAA 4MQ1A 3MTFA 3G6HA 2GU8A 4QNAA 4NJ3A 3R9HA 2XBJA 3I5ZA 1LPUA 3BBTB 1OUKA 4BHZA 3ORMA 4FV0A 4RA4A 3HV7A 5LVNA 2C1AA 5HNGA 4CQGA 4XS2A 3CJFA 4G6LA 2C6MA 5HCXA 4O4BB 5KZ0A 4L7SA 2P0CA 4NT4A 3QD3A 4ZMEA 3LQ5A 5BV3A 2WMTA 3GC0A 3PUPA 3RAWA 3FMMA 4YJVA 3ZDUA 4AXCA 3HMNA 4O7RA 1H07A 2YIWA 3I60A 1GZ8A 1ZMUA 3C4CA 4UY9A 2FVDA 3W0OA 3OOGA 3KXNA 5D1JA 5IPJA 1KOAA 3F5UA 3ENMA 2FO0A 2XRUA 3EYGA 4E6QA 2C6EA 2IVVA 3D9VA 1KE6A 3ORLA 4MBJA 4RIOA 5E1EA 4R7BA 1Q61A 4EK8A 3HRFA 5CY3A 1IAHA 1XMMA 4N70A 2ETKA 3NAYA 1PKGA 3WI6A 3C0HA 5EW8A 4XJ0A 4D5HA 1XJDA 4IC8A 2ACXA 2G2FA 3RWPA 5JZJA 3DDPA 3Q53A 4KA3A 3QTRA 3OVVA 3QCQA 3B2WA 4OTDA 3BU6A 1P4FA 5HIBA 1IR3A 5KMIA 3E3PA 4QPAA 4ALWA 4C2WA 2PVLA 3FMEA 3O7LD 3ACKA 4RQVA 5CF8A 3II5A 3U4WA 3CQWA 4KD1A 3SRVA 2JDTA 2UZWE 4RZVA 4RX7A 3FWQA 3PJ1A 3NZ0A 1L3RE 3R1NA 3NS9A 2VWXA 1B6CB 3BV3A 1SNUA 3H9RA 2PZ5A 4FT9A 2RKUA 4XV2A 4F7NA 3U6IA 5GIPE 4OR5A 2PMOX 4ZSAA 4ZLOA 5HVKA 3F7ZA 3GCQA 5B2LA 1OVEA 5DR2A 5AJQA 4FOBA 4I5PA 4BZOA 4PL5A 5DT3A 5J87A 2WIHA 1A06A 1OL1A 4BI0A 4XV9A 2YZAA 4ZSLA 4DGGA 5LMKC 1PXMA 2F57A 2JIIA 3JS2A 5BPYA 4UZHA 1M52A 5CEIA 3DQXA 2AYPA 3W55A 4JJRA 3KF4A 3R7EA 2VGPA 3CTHA 4TWCA 1REJA 3NGAA 2G2HA 4EH3A 5FXRA 1GIIA 1ATPE 4C4JA 3ZEWA 2A2AA 3RPVA 5AP0A 1J91A 5HE0A 3I79A 2WU6A 3MTLA 3E7OA 5EYCA 3EL8A 2PVMA 5DT0A 2P33A 4J7BA 3FMHA 4TRLA 3KFAA 4PWNA 1ZAOA 3OZ6A 2QOKA 4YJOA 4HYUA 3P4KA 3UVPA 4BCKA 3MESA 3PG3A 3A2CA 4ANSA 1W8CA 4GG7A 3VUMA 4PNKA 4FK3A 1YVJA 3F66A 4RIYB 4QP2A 4IVDA 1UU3A 4S34A 1MP8A 2GTMA 3AD4A 3Q9ZA 2Z60A 5LJJA 3LXPA 2FGIA 5M57A 4H3BA 3FPQA 2R3HA 4IEBA 1OL2A 2REIA 3IW8A 3QQFA 4RRVA 3OWLA 4PP7A 4K11A 1TKIA 5AP2A 3WZDA 4D4YA 3NUXA 4FZFB 2YM8A 3TV4A 4HW7A 4BCJA 2OZAB 4O0XA 2XNPA 2CDZA 1ZYDA 3KK9A 2GNIA 3PXZA 4AOTA 3N51A 4LUEA 3CD3A 3QGYA 3NUUA 3W16A 4USFA 3NNUA 3RAHA 3FPMA 4CXAA 4HVDA 1YI6A 3G5DA 3OROA 4IXPA 4BDKA 2UW5A 4YR8A 1BKXA 3W10A 5E8XA 5FLFA 1G3NA 5GJFA 3NRMA 3LXNA 4FNYA 4MCVA 4OUCA 4Z3VA 5ANIA 3PIYA 1BX6A 4ZS4A 3IOKA 1VJYA 3PZHA 3MY1A 4FIEA 1J7IA 4WIHA 4CFVA 2QOLA 3QXPA 3ACJA 1F5QA 3CQUA 3QD4A 3RAKA 2JKMA 4QPSA 3FKOA 4XLIA 2RIOA 3ZO2A 3VF9A 3ROCA 1KWPA 4C57A 3BL9A 2E9PA 5CSWA 2NYAA 3KL8A 4XG4A 2RFEA 2IW6A 4E20A 4P2KA 4X2GA 1H8FA 3I6UA 3REPA 3CE3A 2IWIA 4DG2E 4BJJB 3CLYA 2V7OA 4PDPA 1R39A 4UALA 5E8TA 4DG0E 3VUTA 4HCTA 1PMNA 5DBXA 1BI8A 3WZUA 2EU9A 1FVVA 4H36A 3QC9A 5EOBA 5LVLA 2GFCA 3UNJA 4NFNA 3W33A 5J5TA 4MAOA 5A6NA 4ZMFA 4H3PA 3PRFA 1E1VA 4XRJA 4BDGA 4YHTA 3C0GA 2QOCA 5E8SA 5M44A 3L8SA 3KCKA 4HCVA 3DB8A 1IASA 3ZZEA 4C0TA 3C4XA 5CU2A 4O7TA 4D1ZA 1Q8UA 1O6KA 4UMTA 4Y72A 4I20A 4KUJA 1K3AA 4X0MA 3FSKA 4LRMA 4XX9A 2HY81 5CEOA 4X6QC 1KUTA 3R8LA 2WAJA 3EQGA 1WMKA 3LJ1A 3NUAA 2VTRA 3VHEA 2F7XE 2C0OA 2YERA 3DCVA 3NYXA 4MYGA 4TY1A 4NM3A 4DGOA 1G8KA 3EQHA 3EN4A 4DHZA 3MIAA 4JDKA 4GUEA 4FL1A 1KV2A 4X3FA 3LCDA 2YISA 1PHKA 2X81A 4ANNA 4BBFA 4CCBA 1QPCA 2W05A 3O17A 4FTMA 3TMOA 3KXHA 5HICA 4CKJA 3PP0A 2QCSA 3RINA 4AXFA 2WMRA 4ZZOA 2GHMA 1KE7A 1FBNA 1PRYA 2WQEA 3FQHA 2XALA 5A4CA 4DEHA 5EHOA 2W0JA 4EK4A 4FVRA 3WYXA 3R6XA 4UMRA 2UZLA 1UWJA 3KULB 4WUAA 4S30A 4IAYA 4UV0A 3QTUA 4E4XA 3OT8A 3OBJA 3HEGA 5DEYA 5C01A 1FGIA 2VTIA 3JVRA 3TJDA 3UVRA 1ZWSA 5HU3A 5KHWA 3QUDA 1U59A 3KC3A 1OIQA 4YPSA 5AX9A 3KRRA 3B8RA 3GB2A 3PE2A 2OH4A 4KIKA 4E6CA 3R2YA 4XBUA 4AA0A 4O0TA 3HLLA 3MVHA 4I0RA 2SRCA 3VBVA 2CLQA 2YJSA 4FX3A 3FBVA 3TIZA 4F6SA 5IU2A 4ITHA 5CLPA 3QKMA 5EK7A 1DI9A 3ROYA 3CSVA 3IS5A 3DBQA 1R78A 3R7OA 4F09A 4F9AA 4DT9A 3F3UA 2YAAA 4BDDA 4GJ2A 1XKKA 4TYHB 4QYFA 4E5BA 3LKMA 3DBCA 3UOJA 5AUVA 3JXWA 2FSTX 2PE0A 5EW9A 2YIXA 4YSMA 4BDHA 3SDJA 4FK6A 4E7WA 4HOKA 4DLJA 2CCHA 3LAUA 4TTHB 5E7RA 3BBWA 3O8PA 5CQUA 3UDSA 4AXEA 4IAZA 4FNXA 3VRYA 2R3IA 5IA4A 2YDKA 2ERZE 2YCSA 3EWHA 3N9XA 4MD9E 3I6WA 4UMPA 2ZJWA 4HYIA 4BR3A 4FKRA 1QPJA 4FMQA 3AT3A 4U97A 3S4QA 4G3DA 2WTIA 2I0VA 1WVYA 2R3OA 4JVGA 1NVSA 3KMWA 4AUAA 3KRWA 4F9BA 5IQCA 3VUDA 3OW4A 4K1BA 5AA8A 1ZY5A 5IDPA 4I24A 4W9XA 3MS9A 4V05A 3G9NA 4OBQA 3DK3A 5HOAA 1JSVA 2RG6A 4O4CA 3CR0A 3CGFA 3HRCA 3QQKA 2B4SB 4BCGA 3AKKA 3KMUA 2J7TA 3MB7A 2PUNA 4NW6A 4NZWB 5E8VA 2OIDA 2UZTA 1W82A 3F9NA 5A4QA 5KMKA 4RFYA 2J4ZA 1PXIA 3B2TA 2PK9A 4QYYA 3UODA 5JMSA 3LMHA 3D15A 3UDBA 3KVXA 4DAWA 5BVDA 2R5TA 4U80A 3V6RA 3W2SA 2C3JA 2VTNA 3FI3A 4IQ6A 5DE2A 4FG7A 5HTCA 3C7QA 4XP3A 5HLNA 4MNEA 1H0WA 4NUSA 4FYOA 4JDHA 1LR4A 2OI4X 4IAAA 3BELA 4RG0A 2JIUA 4XBRA 4WSQA 4AU8A 2WXVA 3P0MA 5HVYA 3ZM4A 4NKSA 2WEIA 2X6DA 2Y6OA 3IW6A 3QTIA 2VUWA 3GC8A 5IA3A 4HVIA 4TYGA 3ZU7A 4CFUA 4K2RA 5A14A 3MVLA 4HNIA 4L42A 5BUEA 3R63A 3FLSA 2OBJA 4PV0A 2I0EA 3A7GA 5HO7A 3D4QA 3HUBA 5HKMA 3UZPA 3V51A 3RVGA 2F4JA 4GK2A 4Y73A 2VAGA 2W9ZB 3DKGA 3W2CA 3RMFA 5GIOE 2LGCA 3O8TA 3PLSA 1YXUA 3MI9A 1ZXEA 3KXGA 4R1YA 4FTAA 5KO1A 2JEDA 4GIIA 3RZFA 4KSPA 4LOPA 4C3RA 5I5ZA 4FTUA 4MXYA 1XWSA 2VWIA 2W1EA 4JNWA 2UZEA 1PXPA 4QMTA 1JPAA 4J98A 4KIOA 5F1ZA 2PUPA 3VBQA 2BILB 3W8QA 1WBVA 4NWMA 4D4RA 4FSRA 2X9FA 2FB8A 3FI8A 3TDVA 5DH3A 3RPSA 4FNWA 4E5AX 1H26A 5C1QB 1SMHA 4QQJA 4FKSA 3F69A 3ITZA 4I41A 4JRVA 4ANOA 4CFNA 5L6OA 5AR3A 2A27A 3KXXA 2GNGA 4FZ7A 2CKOA 2YAKA 3I0QA 3U9NA 3QQUA 4E73A 3PLAE 2FA2A 4YJQA 2WTDA 5HTBA 1XBAA 2H96A 3I0OA 3BHVA 3AC4A 2QG7A 4R5YA 4BKZA 4AZWA 5CVFA 3HV6A 1EH4A 3UQFA 5JN2A 3MB6A 4C34A 4ZZNA 3C51A 2R3GA 3DBEA 4IACA 2PUIA 3GT8A 4MQ2A 3U8WA 2WFYA 2VO6A 4U3YA 2HENA 2PVHA 5AP5A 3FI2A 5AM7A 3MY0A 4E4LA 5L2WA 3FLNC 3AC8A 3KN6A 2CLXA 3PJ3A 2NO3A 3LFFA 1ZY4A 3PY1A 4FSMA 4PMSA 3D5XA 1Y91A 4AE6A 4BN1A 3R8MA 3DBDA 5TF9A 3HMPA 3ZONA 2WKMA 3KU2A 3PXKA 4PUZA 4S2ZA 3TUDA 2Z7LA 3BLHA 5GNKA 3DOGA 5M09A 5ANDA 5L4QA 4P7EA 1PF8A 4FI1A 2CGUA 3IDCA 2ESMA 3FMLA