4BKJA

Crystal structure of the human ddr1 kinase domain in complex with imatinib
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
314
structure length
295
Chain Sequence
MPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Structural Mechanisms Determining Inhibition of the Collagen Receptor Ddr1 by Selective and Multi-Targeted Type II Kinase Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 295
sequence length 314
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bkjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bkjA01
3TV6A 5CEMA 3FZPA 4ANQA 1Q4LA 4C61A 3F2RA 4LGHA 5EH0A 4J53A 4PPBA 3CY2A 3LLAA 3R28A 4LV5A 4OW8A 3ZC5A 1T46A 4APPA 4E93A 5FXRA 4D2RA 1PXOA 3FXWA 3DLSA 4FKUA 2VO6A 2GS2A 3KCFA 4M69B 4QNYA 3GCQA 4AW0A 3HAVA 2B4SB 3BGZA 4YNOA 3W8LA 2PUPA 1QPDA 5D7VA 1SZMA 4L7FA 3CD3A 1UNGA 3DQWA 2O5KA 2XNBA 3DJ7A 3ORZA 5EW9A 3CEKA 3GCSA 4XG6A 4WNKA 4YJSA 5IMXA 2BRMA 4E7WA 4F99A 4BCGA 4GKHA 4QPMA 4N0SA 2W17A 2V7AA 2ITZA 4EH5A 1ND4A 4C7TA 3T9TA 3KMMA 3A7FA 3ZC6A 1OIUA 3AC8A 3PXQA 3PPJA 3PZHA 2X81A 4ZJIA 4G16A 4C4HA 2OJGA 3KFAA 5HG9A 5A4EA 4JVGA 4QQJA 3KF7A 3MVHA 4EQCA 3SAYA 3KCKA 4ZSGA 5CASA 3E8EA 2HY0A 5ANGA 1W82A 3BEAA 3VS2A 2X9FA 4APCA 3UNZA 4BTJA 4CQEA 3P7AA 4RLKA 3EZRA 4DGMA 3LVPA 1U4DA 1PMNA 5AR7A 5HESA 4D1SA 4E6AA 4ZTRA 4EEVA 3RPVA 5CQUA 5BNJA 5GJFA 4N6YA 5F94A 2JFLA 2CJMA 2YCRA 3IW5A 1JKSA 4QTEA 5IDNA 4D1ZA 4L44A 3KL8A 4FZAB 3RI1A 4NM7A 4O7SA 2VWXA 3SOAA 2C6OA 2XCKA 1S9JA 4B7TA 2GTNA 1BKXA 4PUZA 3ACJA 4GT4A 5KHXA 2GS6A 4PPCA 5LARA 4EK8A 2CLXA 4GJ2A 3OG7A 4J8MA 4BGGA 3TM0A 3QKLA 3PVUA 4IE9A 3DQXA 5IQBA 1U59A 1OMWA 2OGVA 3BRBA 5L3AA 1BL7A 4FZDB 4BZOA 4CQGA 4EH2A 4FTUA 1OKWA 2ZDUA 4XP2A 3U55A 5IH4A 4CFFA 3LHJA 4DT8A 1E1XA 2BCJA 3D5XA 4HVDA 4FEXA 3CBLA 3R30A 2HELA 2W4OA 4E3CA 3GU7A 4X3FC 2R0IA 3FLSA 4BDHA 2IG7A 4IQ6A 2RF9A 3P23A 4NW6A 5DE2A 3VUHA 3TDVA 4JT3A 2ACXA 5C03A 2QO7A 4ANMA 3I7CA 3PIZA 2W06A 4QYEA 2ETMA 4EOKA 2BTRA 3QZHA 2HW7A 3GXLA 5HLNA 4GSBA 2OFVA 1STCE 3R1QA 3FLNC 4AX8A 4FBXA 4AZVA 2C5NA 3LCOA 4GRBA 3RCDA 2XUUA 3PIYA 5AUXA 1YOJA 4GVJA 3TNIA 1UKHA 4MYGA 3U4UA 2ZB1A 5IH5A 4Q9ZA 2OXDA 1J91A 4YC6A 2OXYA 2XIZA 3D9VA 4O82A 4O6EA 5GNKA 1PXNA 4DAWA 4E6CA 4W4WA 1ZYJA 2C6TA 2Y6OA 3LFEA 3G9LX 3Q53A 3WZKA 3MV5A 5IISA 4FVRA 3O8UA 5FBNC 4PDOA 2FSMX 5DRDA 2I40A 4O0UA 3TCPA 4EK3A 5LOHA 2WAJA 4FV9A 3VHEA 4BDBA 1MQBA 5CNNA 3W55A 4HPUE 3QUDA 3R71A 5CSHA 3TZMA 2V5QA 1PMVA 2J6MA 1R3CA 4I5CA 4X3FB 3FZTA 4Y46A 3EQGA 3FZRA 4G2FA 1VJYA 4A9SA 2HK5A 4JX3A 4BCJA 2BTSA 3M42A 1GIJA 4TTHB 4AA5A 5C4KA 4EORA 5IQCA 1M2RA 2XK3A 3VS1A 5D41A 3O23A 2PMLX 3R63A 1MUOA 3GUBA 5DT3A 5AUZA 2YWPA 3E7VA 2WTDA 2V62A 2R7IA 1Z9XA 1YKRA 3EH9A 4U41A 3I81A 4DEHA 3LXNA 3NNUA 4MXYA 3W32A 5CLPA 4AGCA 4F09A 2XYUA 3DK7A 5EYMA 3HDNA 3NAXA 2ZJWA 2YIRA 4C4IA 2WFYA 4O0RA 5LVPA 3U6HA 4A9RA 4LOPA 3FI2A 3HV7A 4QMNA 3R8MA 4PPAA 3PXYA 4FKVA 4GIHA 4Y83A 2QHNA 3E8NA 3WZEA 3QQGA 3JVSA 4RFYA 4GW8A 3T9IA 3WE4A 4FYNA 3UPXA 4MEDA 3FKNA 2E9OA 3MA3A 2QOOA 2BKZA 3LKMA 4FV2A 3TNHA 2WMWA 3BE9A 3BLQA 2W96B 3KRWA 4RVLA 3IS5A 4DG3E 4YJUA 4FE2A 4DFUA 5LMKA 1UKIA 5HNBA 3E87A 3HMPA 5HNIX 3C7QA 4BCHA 4I93A 2QQ7A 3BEGA 3EQHA 4FIFA 4O0SA 4YP8A 3A7GA 1PMEA 3FQSA 3IDBA 3D0EA 4JR3A 3ZUTA 4BI0A 1IG1A 4EQUA 3H0ZA 1WBTA 4QO9A 5AP5A 3MW1A 2WKMA 2C0OA 5AR4A 3WF5A 4BCFA 1H1QA 4USFA 3LFAA 4EK6A 1JSVA 3K54A 3R1SA 1P4FA 3POZA 4JAJA 3I1AA 3OWJA 4HZSA 4M69A 3UZRA 4DTAA 5K0XA 2WMBA 2B7AA 3OT8A 5HU3A 4JS8A 4BTKA 4GJ3A 3KK8A 5FTOA 5HO6A 3R9RA 3UIUA 2EU9A 3WI6A 4W4YA 5CF5A 5IUGA 4EUTA 2J0MB 4JBOA 5HE1A 1OL5A 5CF4A 2QU6A 1XKKA 1YRPA 4FOBA 2W1CA 3QLGA 4JG6A 4KS7A 4V01A 5L2SA 4QQTA 3F9NA 5HI2A 2R3RA 1CDKA 4ALWA 2VWWA 4PDPA 2PE1A 3KRRA 5JGAA 3VUKA 1AGWA 3R6XA 3R22A 3BYSA 2YJSA 4V05A 3RP9A 1H00A 1SVHA 2XVDA 5CI6A 4XRLA 4XX9A 3GU5A 1YWNA 2IW6A 1Q8YA 4NSTA 4QT1A 4EJ7A 2NPQA 4D4YA 3QFVA 4IANA 2UVYA 4RVKA 5D10A 2JBOA 3SHEA 4BB4A 1LUFA 4G9RA 4YHJA 1PF8A 3HEGA 5J79A 4QMLA 4YJPA 3UO5A 2O2UA 4FL2A 4HGSA 5CS6A 3ZBFA 1OUKA 5LWMA 3U54A 4QYGA 4QQCA 3OCSA 3UOJA 4WSYA 4PP7A 2JIVA 3F69A 4QNAA 4F9YA 3SG8A 5IQHA 2ZM1A 3EKKA 2R3LA 5LCJA 3VULA 3DA6A 1IASA 2VTMA 2W1HA 3UOKA 1GZOA 1ZYCA 3BE2A 3AOXA 2E2BA 3NIEA 4FSWA 2HW6A 4I6HA 1Q5KA 1HCLA 3FY0A 3PJ8A 4IB0A 4L6QA 4Q2AA 3VBWA 5ITAA 2XIXA 4IAZA 3R7YA 3VW8A 2XM8A 3ACKA 3WZDA 1BL6A 5M07A 2BILB 2OH0E 5IQDA 2R3PA 3NAYA 4A9UA 3OTVA 3IECA 2JKMA 5H8BA 1UWHA 3LCKA 4FIJA 2CDZA 3AT3A 3R0TA 1J7IA 4RJ3A 3VIDA 3G0FA 2JDVA 5L2QA 3OW4A 4ZTLA 3DY7A 4I24A 3ZBXA 3RZBA 5L8JA 3QD4A 2W99B 2R3IA 4ENYA 3HECA 3MFSA 4BICA 1W98A 4OR5A 4YJNA 4DH5A 4ANLA 1M2QA 3MVMA 2YIQA 1ZMVA 2DQ7X 3R73A 3VF8A 4D9TA 3MPMA 4X2GA 5HX6A 2GHMA 3L9NA 3PIXA 4RVMA 4DN5A 2WO6A 4ANOA 4GFGA 2VWYA 2UUEA 3FI8A 4FI1A 3WOWA 4C02A 4O7TA 4R77A 1SNUA 4ANBA 3PLAE 3REPA 3V51A 3ZFMA 1XBAA 4NKAA 4NJ3A 3OZ6A 3RCJA 4I3ZA 4FT9A 4RIYB 3WBLA 4JG7A 4B4LA 3COIA 5I9VA 4BL1A 4Y5HA 4B9DA 2Y7JA 2YDIA 3ROYA 5JEBA 3QLFA 4FVPA 2XKEA 1P5EA 1WBWA 2C30A 3IDCA 4FKSA 4KUJA 4NM3A 4C8BA 3TIYA 2J9MA 5HTBA 3IW4A 2PVKA 2UZBA 4W8EA 2PZPA 2XIYA 5CU6A 3W2PA 4AQCA 3JXWA 3DOGA 2ITYA 2R3NA 3VS7A 3W2SA 4HW7A 3KXMA 5L6WL 5M44A 3LM0A 4C58A 5DA3A 5GJGA 4ERKA 4X3FA 5HTCA 4JBQA 5KMIA 4D2TA 4O7RA 3A4OX 3VF9A 3SXFA 1KE9A 2P3GX 4J98A 5A54A 1NA7A 3EQFA 4ZTMA 2ITXA 3GI3A 3W33A 3F5UA 4TN6A 4IX6A 1UU8A 2HZNA 1GNGA 3MVLA 4O22A 4MNFA 1Y8GA 2HZIA 5AAGA 2VZ6A 4IMYA 4AZFA 4KNBA 5IQAA 4R1VA 4FX3A 3WF8A 3R7VA 1TKIA 3EB0A 4R3PA 1PYXA 3QQHA 3IKAA 4LGGA 2NRUA 2RIOA 2BRHA 4TYJA 2GSFA 4P7EA 1KE6A 2XCHA 3D5UA 3FI4A 2UZNA 4MWHA 4A06A 3ZRLA 4DH8A 3RHXA 5BVEA 5HE0A 3E8CA 2SRCA 5KMOA 3CGFA 2ZV9A 4D55A 4KKEA 4QMUA 4KBKA 3F7ZA 4YHFA 1UVRA 3HGKA 3NR9A 4QMMA 3PJ2A 3EMGA 3L1SA 3Q9XA 3ORXA 3ZLYA 4RJ7A 4BDKA 3QL8A 1R1WA 2Z2WA 4I92A 4I20A 2X7GA 4UY9A 3KVXA 2R5TA 3GU6A 3BGPA 4LOQA 5K3YA 2YLEA 2OIDA 1M17A 5A4QA 2C0IA 3IGGA 1P14A 2F7XE 2PHKA 1J7UA 3RPOA 2XK7A 4BYJA 3KEXA 4O7NA 3RAKA 3ERKA 3UG1A 5AV0A 4C2VA 3R8LA 4GEOA 4K1BA 4DLIA 4ZLYA 2A4LA 3OXZA 4H05A 1QCFA 2OZAB 2VTQA 4MWIA 2PU8A 3WIGA 5FTQA 2XK6A 4IFGA 3Q6UA 3RM7A 4C4EA 1RW8A 4L01A 1VZOA 3DBQA 4O0YA 4BZDA 4FT0A 2GHLA 3NW6A 4YZNA 5EM5A 4PTGA 3P9JA 4RC2A 5HTIA 3V8TA 4EWQA 1GY3A 3EN6A 3PTGA 2OZOA 1RDQE 5EK7A 3LM5A 3IG7A 2HIWA 4HCTA 5HG7A 3PYYA 4A9YA 2B53A 1H1SA 2PVYA 1NVRA 3C0HA 3GC9A 1ZOGA 2R3JA 3NUPA 4IC8A 4XG8A 4F6SA 4LL5A 4ORKA 2FGIA 2JAMA 4X7QA 4AGDA 2YM7A 1LEZA 1QPCA 3Q5ZA 2C4GA 3DNEA 4JDJA 4K0YA 2F49A 2RG6A 2ZMDA 1FQ1B 4LI5A 2CKPA 4CNHA 4ZTHA 5H2UA 4FKQA 4FZ6A 3RPSA 5FXQA 4AA4A 3I5ZA 3OEFX 3CKXA 4AS0A 4GFMA 3O17A 3F82A 3FL4A 4WNOA 5C8MA 3H30A 3AXWA 4B0GA 4EH9A 1BI8A 4U97A 4EOOA 2VX3A 1B38A 1ZZ2A 1XWSA 2H9VA 1WFCA 3TTJA 4O27B 4RX5A 2X2KA 4C3RA 3R1NA 2VAGA 4KWPA 4F0IA 4XH6A 4ZZMA 1KV1A 2BIYA 4QQ5A 5ETFA 3FC1X 3G9NA 4M66A 3ULIA 1YXSA 3E88A 4S2ZA 3OCGA 3RKBA 1IAHA 2EB3A 1YDTE 2QLQA 5HLWA 2WEIA 3TNPC 3THBA 5DBXA 4DE4A 2PVFA 4IJ9A 2VRXA 4ZMEA 3A61A 3DJ5A 5BUEA 4MNEB 2VU3A 4F9AA 2C6LA 3OWPA 4O1PA 4U79A 1BI7A 1JAMA 5FWKK 4FTKA 3HP2A 5KE0A 1OPJA 4NIFB 4RPVA 4RWLA 4DFLA 4KD1A 4WSQA 5AV3A 4O7YA 5J7HA 1UV5A 3IW8A 3TKUA 4EHGA 3QALE 1Z57A 2Y6MA 5BVKA 3ORKA 3KVWA 4HJOA 2LAVA 3FMJA 2P4IA 2WGJA 5E1SA 3MS9A 4G3DA 2JDTA 1WVXA 3G6GA 4FGBA 2VNWA 3NUNA 4E6QA 5EKNA 2WD1A 1KE7A 1EH4A 4K6ZA 4RIYA 5EYDA 5KMNA 5KUPA 4CCUA 4JL9A 1G3NA 4LGDA 1JLUE 2CMWA 4MX9A 3E93A 5DVRA 3SOCA 4BCOA 3F3TA 4FEWA 1M7QA 3D2IA 2UW8A 4HVHA 2F7ZE 4IHPA 4EWHA 3FL5A 1OUYA 4BBMA 4EOLA 4BGHA 3QTZA 3NVKI 3PVGA 3LFBA 3PWDA 4FV3A 4PP9A 4FV5A 2P0CA 1T45A 4IJPA 2O8YA 2XMYA 2B9FA 2JAVA 2FSOX 4U44A 3H9RA 3A99A 2GNHA 2R3GA 3F5XA 3PE2A 5HO8A 4PV0A 3W2CA 3GCUA 5EQEA 2X39A 3HKOA 2GMXA 4ALUA 2UW0A 3EQPA 4TKSA 3FV8A 3EL7A 2UZEA 3MH1A 3WZJA 3ZFXA 4IAIA 2AC3A 2B52A 3ZRKA 4AN3A 3QYZA 3ENMA 3RINA 1WBVA 4ACHA 3KC3A 5HVYA 1LR4A 5IA3A 1BMKA 4F65A 1AQ1A 4DG0E 2B1PA 2C6EA 4QP2A 4YR8A 4EOJA 4BBEA 2GFCA 4FR4A 2ERKA 5IA2A 3RK7A 4BTMA 4DFBA 4L52A 4F9CA 4LOOA 2EVAA 5D9HA 5ETIA 5CENA 2RGPA 4DC2A 2VTJA 4GT3A 4JLCA 2RG5A 3HL7A 3ZSHA 2C5XA 4CMTA 4GU6A 2YZLA 3EFLA 4EK4A 2RSVA 1K3AA 2XJ2A 4LG4A 3Q4UA 1JPAA 5CF8A 3IPHA 5E91A 4JDHA 3SG9A 3FZOA 5B2KA 3I7BA 1OI9A 1Q62A 4QTDA 3LQ8A 3BHYA 5FDPA 4OTWA 4YTCA 1E9HA 4AACA 3AMBA 2JFMA 4YC8A 3MH2A 2UW3A 3L8PA 3CGOA 4BCKA 4DFXE 3HV3A 4F08A 2YCQA 2IZTA 3QTSA 2F57A 3F3UA 3QZIA 2X2MA 4BF2A 3NUXA 2Q0NA 2YABA 3QTXA 3DKCA 2Z7SA 3RPRA 4IVAA 3GCPA 1J1CA 4EHEA 4MK0A 1OGUA 3CTQA 5ANDA 5CALA 2CGVA 2OKRA 3QD2B 3W16A 2OZAA 5EM7A 4EH7A 1CM8A 4GH2A 2UZTA 3MB7A 5CVHA 1E1VA 3RJCA 4DLJA 4C3FA 5I4NA 4ZJVA 1YW2A 3Q9ZA 3C4CA 4OTQA 4BDGA 2C6KA 4Z7HA 4FICA 3MPTA 4G5JA 2WEVA 3BI6A 4DH7A 3EQRA 4IX4A 3LXLA 4JG8A 3O2MA 4WRGA 2XNNA 3BV2A 2RL5A 3TUBA 4AOJA 4FKGA 2CN5A 3PSBA 4I1ZA 5J8IA 4ZP5A 3NIZA 4BBFA 5DHJA 5IKWA 2PWLA 1JSUA 4WUAA 3DK3A 4JBPA 5F4NA 4FUYA 2J50A 3UYTA 5IQFA 1JBPE 4ACCA 1M14A 4C2WA 5IA1A 5J7BA 3OXTA 5FM3A 1R0PA 3DBDA 2BUJA 4J97A 4JQ7A 3G90X 3FMKA 4K2RA 5ANEA 3IONA 2YM6A 4FSMA 3VHKA 1PHKA 4NTTA 5CEPA 4M14A 3I60A 5FP5A 1NXKA 4UN0C 3HA6A 2GQSA 4L3JA 4CZYB 3Q6WA 3HX4A 5AP7A 1XH5A 5FUTA 1O9UA 3EFKA 2ITOA 4I6FA 4BKYA 4R78A 1JNKA 4IZYA 4BVUA 5HE3A 4P5ZA 4I21A 3FKLA 3PPKA 4L53A 2HOGA 4MCVA 4OLIA 4BC6A 4FGRA 4ID7A 2R3QA 3P5KA 4AUAA 4EHVA 2HWOA 4M8TA 2WMXA 3GENA 1K9AA 1OM1A 3QTQA 4NTSA 5A6NA 1UNLA 2BZKB 3R9OA 4DGNA 4K11A 5BYZA 2IWIA 1QPEA 4QP6A 3V8SA 1O6YA 4IWDA 4RJ4A 4AFJA 4TNBA 3V01A 4BCIA 4BZNA 4DEDA 4YSJA 4O83A 2HXLA 5DYJA 4CLJA 1WAKA 2XIRA 2FH9A 4MNEA 4XLIA 3UTOA 3UQCA 3AD6A 3HV6A 4QMYA 4U0IA 4ANNA 3PXRA 4YZCA 3OWLA 3I0QA 5ANOA 1IRKA 4YPSA 4FKRA 1DAWA 5E8TA 3W2QA 4NIFA 4EOIA 4JOAA 5HEZA 3ZO4A 1CTPE 4FT5A 1DS5A 2A27A 5DPVA 3BWFA 1H01A 5A9UA 4KKGA 4O96A 4G3CA 3LJ0A 3TV4A 3TXOA 4FSTA 3SA0A 4BCQA 1Q99A 2O63A 3DV3A 3RAHA 2WTVA 4BYIA 2C3KA 3DKGA 4RJ5A 3SRVB 3UPZA 3L9MA 3MVJA 3CTJA 4ZIMA 2A2AA 3T3VA 4MF0A 4FF8A 4C3PA 2WMRA 3NCZA 2YM4A 3BYMA 1FMOE 5AIKA 4C59A 1U46A 1UNHA 3DAEA 4CRLA 3H10A 3FPQA 4O7WA 3F3VA 5EHLA 2IVVA 1IAJA 4FKTA 4R7IA 1GZKA 4USDA 3RNYA 2VTAA 1ZYDA 3VRZA 4ZZOA 5IQEA 3CP9A 3ET7A 4K8AA 4XG4A 3BBWA 2GS7A 3EOCA 3PY0A 4J8NA 2XJ1A 2A0CX 4G3FA 4GL9A 3H9FA 4F9BA 3ID6C 5HICA 3B2TA 4U3ZA 1CKIA 1M7NA 3LIJA 4FEVA 4X6QC 4WG5A 2R3MA 3V6SA 3NCGA 4L7SA 4BY9E 3NYVA 5I9UA 4QMTA 4J95A 4DTBA 4E4LA 2PY3A 1XR1A 3BU5A 4GS6A 3G2FA 3ANQA 4RVTA 4Y72A 4UMQA 2UZWE 3C4EA 3ZLXA 3UC3A 4L68A 3FLQA 5AUYA 1WMKA 5J87A 4D0XA 4Z7GA 5J95A 2OJ9A 4FTIA 5IG1A 4ZJJA 4L45A 3UC4A 2WIPA 4FV7A 4MKCA 5M4CA 5C26A 1A06A 4F1OA 2YJRA 3D5VA 3DFAA 4FTOA 2W9FB 1J1BA 3EJ1A 3Q4ZA 4PL3A 4D2VA 3A60A 4RC3A 3RAWA 3DLZA 4OBPA 5GINE 1QL6A 5KKRC 5IU2A 2PULA 3I5NA 5C8KA 2WQNA 3I6UA 5K4JA 3GNIB 3BCEA 5IF1A 3A4PA 5DT4A 2OW3A 1UU3A 3SD0A 3A8XA 2B9JA 4G3GA 4CV8A 2QD9A 2I0EA 5EM8A 4RGJA 2WNTA 3MY1A 3QTRA 5BPYA 3IGOA 3ZEPA 3PDTA 3NW5A 2FA2A 3F7WA 3LE6A 1VEBA 3UG2A 3H0YA 4JI9A 2P2IA 4ZZNA 3C4WA 2QG5A 5IUHA 5KNJA 3TNQB 4Z3VA 5AR8A 1XQZA 2WOTA 1ZY5A 2C1AA 3V8WA 4FODA 3V3VA 2DUVA 3HMMA 3MWUA 3OBGA 4IEBA 5ANJA 4ZY6A 3TL8A 5J5TA 4IBMA 4O2PA 5EW8A 4G1WA 3KK9A 2YWVA 2VGOA 2J90A 2VWUA 3QZGA 4O2ZA 5J5SA 3BQCA 1JKKA 4OTHA 3BV3A 5AUTA 2P55A 4IM2A 4EYJA 3W2OA 4IFCA 2YHVA 3QWKA 5AR2A 3BU3A 4E26A 4BI1A 3DPKA 5KHWA 5HKMA 4FSZA 4FV8A 5KKRB 1J7LA 2UW4A 1IR3A 4P4CA 1KOBA 1R78A 3UQGA 5I9WA 1YWRA 2B9HA 2BALA 5EDRA 3IO7A 5EI2A 1IA9A 3OY3A 2QOQA 5BMSA 2YN8A 1XO2B 3MTFA 4LUEA 1SVEA 4OUCA 4DTKA 5I3RA 1G8AA 5TO8A 1TQPA 3COKA 3I0OA 5IA0A 3NUAA 3H3CA 5E8YA 4FTCA 4H3PA 2ZDTA 1W83A 3CKWA 3OHTA 5DT0A 5F1ZA 4XBRA 2UZDA 3QCQA 2KULA 4BKZA 4TPTA 2WTIA 3R7GA 3O8TA 4WO5A 5LVLA 4XOYA 1FGKA 3FZSA 2XZSA 3V5LA 3KN6A 4RRVA 4PTCA 2PSQA 5EOBA 3VAPA 4OT5A 5B2LA 5HHWA 2G01A 4ZTQA 1OZ1A 3TI1A 1YI6A 3RMFA 5BX0A 1JOWB 2W1EA 4EQMA 4ZOGA 3GQIA 2VTLA 5I5ZA 1F0QA 4QMOA 4BHZA 3HRCA 4ITIA 4XV2A 4GT5A 2W5HA 3EN7A 3R83A 2UZOA 5HORA 5JQ8A 1U5QA 4RMZA 4W9XA 3ZU7A 4I5HA 4EOMA 5EHOA 3BKBA 4E4MA 4WBBB 2EXEA 3BELA 5I9YA 3UDBA 5AAFA 1KV2A 2BZJA 2VWZA 3KU2A 5TE0A 2WTWA 1BYGA 4KSPA 4WG3A 3QQKA 4UEUA 1ZYLA 3VW6A 5LMAA 2REIA 3TDWA 4JIAA 4KBAA 3SXRA 4D9UA 1LPUA 4RA5A 3ZTXA 4H3BA 3IOKA 4YZDA 3QC4A 2PYWA 3A7HA 4EC9A 2VTHA 4XV3A 1QMZA 3FZ1A 1RQQA 2XF0A 3PXFA 4L8MA 3D83A 2YIYA 4ASEA 2UW7A 2HY81 5AP0A 2RFEA 3G0EA 3SKCA 4AW1A 3ZDUA 5JFSA 2JGZA 4JX7A 4XMOA 5DG5A 2R3KA 4MD8E 4UXQA 4WIHA 4QMPA 5DNRA 3ZONA 4AA0A 4F64A 2CPKE 2JC6A 4LRJA 4HPTE 4PL4A 3TKIA 3NUUA 3U9CA 4HVGA 2B0QA 3LLTA 2W5AA 4EJNA 1VR2A 3AGLA 3ODYX 4AZTA 2C1BA 2G15A 4IADA 3Q4TA 4CKJA 5HZNA 4UV0A 4Q5EA 3ORPA 3E8DA 3RK9A 3SRVA 3JYAA 3OY1A 4RX8A 4BIBA 4FTLA 4O81A 1YVJA 3FAAA 3LXKA 4C33A 3Q9YA 5CEOA 4ZSEA 4CFXA 3NDMA 3ETAA 3LW0A 4MD7E 3ZLSA 3FQEA 1UU9A 2R9SA 4DCAA 4WOVA 2H6DA 4RQVA 2UVZA 4AOIA 2YLFA 1W84A 4XV9A 5EHYA 3PVBA 4QYHA 4Y95A 1Q8ZA 2VV9A 1URCA 5EM6A 3WF9A 1CKPA 3QTUA 3KB7A 4GUEA 4CRSA 5JQ5A 4UMPA 5AV1A 4WUNA 5FXSA 4IVBA 4GMYA 3MIAA 4I0TA 4GK2A 3HNGA 4IZ7A 1ZYSA 4U40A 1Q3DA 2AC5A 3D7ZA 4KBCA 4C57A 3CIKA 3VUMA 1A9UA 4RLLA 1Y6AA 5BUIA 1O6LA 3ZO2A 4DGOA 3U6IA 4MXZA 3FEGA 4QD6A 2JKQA 5EI8A 1P4OA 5AM6A 4ERWA 4FKOA 2WZJA 4QMSA 5HCYA 5E8VA 3ZZWA 3FJQE 4D4VA 3GU8A 2BDFA 4W4VA 2EWAA 1OL1A 2A19B 4M13A 5BUJA 4MBLA 3Q2MA 5E1EA 4F7NA 2UZUE 2ITWA 2BZIB 1Y8YA 4DEAA 2CCIA 5DH3A 2BZHB 4JRVA 4RG0A 2XH5A 2ZMCA 5EQPA 4F4PA 4IB1A 5AP1A 3U8WA 3VBTA 1PXIA 3IW7A 1NVSA 4EH4A 1OL6A 2WMQA 5AP3A 5G6VA 3SLSA 3Q04A 4MXCA 4UWYA 5J9YA 2PVNA 2XS0A 5CEQA 4FKWA 3HYHA 1IEPA 1RJBA 2R7BA 3JR1A 1ZMUA 4V0GB 4D2SA 2R2PA 4G3EA 3KXXA 5AUVA 5BQ0A 4DYMA 3ZSIA 4TXCA 1WVYA 1SNXA 3C1XA 3COMA 3CCNA 2C69A 3MTLA 2XA4A 3DB6A 2GQGA 2BR1A 3PJ1A 2YACA 5M4IA 5T68A 3VQUA 4BDEA 2HZ4A 4F70A 3NMUF 1JVPP 3MSSA 4GV1A 3UMWA 2VN9A 3FQHA 4LV8A 2XP2A 3D15A 4J52A 3U87A 4JR7A 3PXKA 3DXPA 4CYIA 3QCXA 4J96A 4PMSA 5EDPA 1REJA 3F6XA 3QX4A 4JBVA 4M0YA 3HV5A 3OTUA 2BRNA 3MB6A 5KZ0A 4PF4A 2WMAA 1OIRA 3KRXA 5AIRA 1K2PA 1BUHA 4DEBA 2VX1A 4UB7A 1PYEA 5JGBA 1H28A 3OUKA 5EOLA 3TUCA 3QQUA 1H4LA 3B8QA 4OAVB 4G9CA 1LEWA 5ANIA 3TZ9A 2OJIA 3DTWA 4LMNA 4LQMA 3T3UA 1PRYA 1YWVA 5CAQA 4RFMA 2BIKB 2VTNA 3CQEA 3QRIA 4FKJA 4EZ3A 5CAOA 2ERZE 2XB7A 4W8DA 2C6DA 5ETAA 4BCMA 4FT7A 4D0WA 5KMLA 3ROCA 4A4LA 4U6RA 1O6KA 4ALVA 4X0MA 3V5WA 2ONLC 4GCJA 1ZLTA 1I44A 3G6HA 4JQ8A 1YQJA 4DITA 5IMEA 3NRMA 2X9EA 1ZRZA 2F2CB 4R1YA 1W0XC 4F6UA 3GB2A 4WHZA 5C01A 4CCBA 2WELA 3TACA 4M3QA 5LXMA 3RHKA 2XK9A 1Q8UA 4OAUC 2HWPA 3PXZA 5DEYA 3E7OA 5CZHA 2JIIA 3FLZA 2B55A 2G2HA 3P78A 4GYIA 3EFJA 5CSPA 3K5UA 4B8MA 4FZ7A 4D5HA 1YDRE 4HCUA 4KIQA 5GJDA 2YM5A 4RIWA 3AD5A 3VBYA 4F1MA 4YU2A 4FTNA 4QPAA 2OIQA 4IDVA 3SW7A 5KCVA 4U3YA 3BPRA 2PE2A 2XRUA 3MPAA 5D11A 5JZNA 4C4GA 4ARKA 3C4XA 3WIKA 2F4JA 1MRUA 3BIZA 5HBJA 3KKVA 3N4UA 3BHHA 4I22A 3AG9A 4EYMA 4PMTA 3C4ZA 4UMTA 2GNLA 4KAOA 3CSVA 2Z7QA 3D4QA 3DBEA 3GCVA 1MRVA 5HG8A 4CFWA 5ICPA 2PZ5A 4AT4A 4CFUA 1HCKA 3I79A 3O8PA 3R7EA 4L3PA 2BAQA 4O91A 5AWMA 4BWKA 4NK9A 4AN9A 2NNWB 3DNDA 4FTJA 1URWA 4YBKA 1H0VA 5IA4A 3TKHA 4MBJA 2Z60A 4J71A 4ACMA 2Y4IC 5JT2A 3BGQA 4FA2A 5FD2A 5AUWA 3FSFA 1CSNA 4R5YA 4CTCA 3DBCA 1ZAOA 3BZ3A 5L8LA 3JUHA 3RGFA 1ZY4A 4YURA 2WMUA 4IDTA 1V0PA 5A3XA 3GC7A 5M06A 4L46A 3O7LB 3FUPA 5GZ8A 2EXMA 3L9PA 1PKGA 3Q5IA 1VYZA 2WMVA 5AX9A 4B8LA 5IEVA 4D1XA 2YAAA 3KF4A 2W1DA 4FTAA 4G31A 4E5AX 2XBAA 3OVVA 4NFMA 3EHAA 1YI3A 3DDPA 4EZ5A 3ODZX 5AA9A 2WU7A 2C5OA 3MH3A 4G6NA 3EQBA 3V5JA 3K3IA 4DG2E 3I6WA 1YXVA 2PVHA 5I9XA 3UNKA 4XRJA 3WARA 2ETKA 2PMNX 2GHGA 4CEGA 3O96A 3R9DA 1U54B 2NRYA 2WMSA 5HLPA 1OVEA 2Y4IB 4FIIA 4FG8A 3L8VA 4UZHA 3OBJA 3OOMA 5FBOA 5FM2A 1B39A 3P08A 4RX7A 4QTAA 5IQGA 1WCCA 1GOLA 4O38A 5LVOA 2BPMA 5AADA 2ZM3A 5CSVA 2JDSA 2ITVA 4AOTA 2XK4A 3HUCA 3K3JA 3QYWA 4GK3A 5DRBA 3TNWA 3K2LA 3FYJX 1PXMA 3KRJA 4TY1A 1KE5A 4YJRA 3KXNA 4D5KA 3C13A 2OJFE 2YDKA 1Q61A 4IC7A 4AG8A 3BQRA 4E20A 4C0TA 2QC6A 3NVMB 4ASDA 5CI7A 5TOZA 4HGTA 3R8PA 3JVRA 4AN2A 1PXJA 4FEQA 3DK6A 3F3WA 4IM3A 3MH0A 5HNGA 5HO7A 1FBNA 4BGQA 1G5SA 2JIUA 3KQ7A 3LFCA 4V0GA 5FG8A 5CVGA 4CVAA 1PJKA 1NW1A 4EKLA 4PTEA 3F88A 4X2KA 5CSXA 4ZS0A 1OKYA 3RTPA 4I0SA 5A4LA 4S30A 4CGAA 4HVIA 5JMSA 2VTTA 4IX3A 3WF7A 4S34A 4PNKA 3VBQA 5E8XA 4PX6A 4ANSA 3CQUA 4FSNA 4AP7A 4PMPA 4O1OA 1Y6BA 5HCXA 3KY2A 4FZFB 4CFNA 1H1WA 2FO0A 1MP8A 4AFEA 4CYJA 2YITA 5KMMA 4O86A 5M09A 1CKJA 3ZDIA 4TRLA 3D5WA 3BHUA 3QGWA 3QTWA 3R9NA 3QD0A 4YBJA 1OIQA 3NYNA 2XYNA 1UA2A 5DR6A 4JIKA 4YC3A 4JRNA 4USEA 4RC4A 3UP2A 2J5FA 4RWKA 2WQEA 3QBNA 4M67A 5IA5A 3M1SA 4RX9A 2C47A 3MI9A 4OGRA 4PQNA 5GZAA 3ORMA 2OBJA 4MAOA 3WE8A 4WNPA 4D4SA 3FBVA 5CVFA 5AEPA 5M08A 3NZ0A 4YHTA 2XNPA 2PL0A 3CJFA 4S33A 2GPHA 3W1FA 3CPBA 3PA5A 4AU8A 1H8FA 2VWVA 4BWPA 3BHVA 3OUNB 3NEWA 5FEDA 1BLXA 2UW5A 3FE3A 4KABA 1OBGA 3KMUA 4WNMA 1GIHA 3A62A 3ZO3A 4YMJA 5C1QB 2GNGA 3UVPA 3R21A 4GIIA 5H9BA 4CKRA 2X8DA 4A4XA 5HCZA 2BHEA 3SXSA 2ZV7A 4N70A 1QPJA 3EL8A 4DEIA 4L67A 4IVDA 1J3HA 3WYXA 1OL2A 4CMUA 2GQRA 3RVGA 3UQFA 5EW3A 2FYSA 2BAKA 2XBJA 2ZVAA 2JLDA 3KREA 4RA4A 4UALA 2XIKA 2X8IA 3DGKA 3VJOA 3R2BA 4AT3A 2QO9A 4PRJA 3QRTA 2CNUA 3SV0A 3OD6X 3ANRA 1H07A 5JRSA 1SYKA 1W8CA 3U6JA 3UODA 1YXXA 2X2LA 4GYGA 1AD5A 4FTRA 4O7ZA 3P7CA 3PP0A 3WILA 4XP3A 2BKKA 4EOQA 2VD5A 3IQ7A 4BDJA 4UMRA 1ZMWA 2AYPA 5JSMA 2P33A 2R3FA 4O7VA 4CZUA 3EZVA 4BWXA 2EXCX 2FUMA 5B2MA 4FSYA 5I9ZA 4KB8A 4XP0A 3TT0A 3C4FA 2O3PA 5LWNA 3LPBA 5AP6A 4ITJA 2QOLA 3DZQA 2ONLA 2OWBA 4FTQA 3F5GA 3PA3A 4EHZA 2C3JA 1Q3WA 3BYUA 3P0MA 2QNJA 2J51A 1XJDA 1ZZLA 2F9GA 4FG9A 3A7JA 3FMEA 1Y91A 3TZ7A 3HLLA 5M51A 4RIOA 2C5VA 1FGIA 5BYYA 1FOTA 2CKEA 2BROA 4JXFA 3Q3BA 3E62A 5B0XA 3ALNA 3V5QA 4RWJA 3W18A 3O0GA 2HCKA 2IN6A 4QMZA 4MH7A 2X1NA 3SX9A 5EI6A 4DEGA 4QTBA 4NWMA 4U42A 1ZOHA 4EH6A 3NYXA 3P4KA 2X7FA 3UMXA 5I3OA 1PKDA 4OBOA 5FP6A 4X2JA 3EFWA 3JY0A 1OL7A 4L42A 4R6VA 4BR3A 5CF6A 3E64A 2DS1A 3FWQA 3LFDA 5DI1A 4EL9A 4NH1A 5F95A 4RIXB 5IPJA 2P2HA 5CAUA 4GU9A 2CHLA 4NM0A 5DGZA 4UZDA 5IH6A 2VTOA 3C51A 4F0FA 5JKGA 4CD0A 5KMKA 3TUDA 1X8BA 2I0VA 5BVFA 4FK3A 1GZNA 4NFNA 1ZWSA 2O65A 1U54A 2Y9QA 4FL3A 4I4FA 4TL0A 5A4CA 3U9NA 4HYUA 3FYKX 4FV6A 4K77A 5E9EA 3OOGA 4FSUA 3R9HA 5A14A 4L00A 5TR6A 5JFVA 1WBSA 1IA8A 2BRBA 4MXXA 5DMZA 4XCUA 4HYIA 5LVNA 3ZHPC 5KBRA 5DFPA 1KUTA 3DKOA 3KGAA 4HZRA 2J0JA 3IDPA 1M2PA 4HGLA 4IVCA 3UOHA 4WRSA 1TQMA 4ZAUA 1DI9A 3ORLA 3NYOA 3CXWA 5AV2A 3BX5A 5IDPA 4PDSA 3M11A 3WYYA 2QONA 1SM2A 4XNEA 4YLJA 2J0KA 1ATPE 5KO1A 2OI4X 5AV4A 1OIYA 1JKTA 3VQHA 3VS4A 4D28A 4N4SA 4YTFA 2IO6A 3FLWA 4LRKA 4E6DA 5EDQA 2JITA 3L9LA 5JGDA 5EYCA 5HBEA 4FMQA 2DYLA 1NT2A 2OU7A 2E9NA 3CJGA 5E90A 5BVDA 3O50A 3GU4A 5CTPA 3EN4A 4NUSA 3QKMA 3ZYAA 5JN2A 4TYEA 1R39A 4F63A 5FLFA 2W1GA 3DTCA 3HUBA 2X0GA 2YEXA 4EBWA 2Q83A 2R0UA 4GG7A 2ITNA 4ZMFA 5T6KA 1F5QA 2R4BA 3QUEA 4U9AA 3TJDA 3MJ1A 2ITUA 3UIXA 3AC4A 4AGWA 3BYVA 3QQLA 3CD8A 3MIYA 5H3QA 3S4QA 4ITHA 4EONA 2W1ZA 3IOPA 5GIOE 5CU3A 3QZFA 4CFVA 2CGWA 3WZUA 3UIMA 4KIKB 4IIRA 4X2NA 2G2IA 4CXAA 5CEKA 4TWCA 3KRLA 4OTDA 4ONAA 4EKKA 5F9EA 2NP8A 3HMIA 3C9WA 5J1VA 3NW7A 3FHIA 3TJCA 4ZS4A 4YTHA 5JFXA 2G2FA 4IWOA 3DDQA 4CKIA 2OICA 1HOWA 3E63A 3H9OA 3VBXA 4MHAA 3EQCA 4ZEGA 4OBQA 4ZY5A 1W7HA 4F1TA 1NY3A 4OTFA 1G8SA 2C6MA 4FUXA 5D1JA 2EB2A 2QKWB 4YGAA 3TTIA 4RJ6A 3SQQA 4B6LA 1L3RE 1PXKA 3R01A 2E9VA 3ZXZA 4D58A 4EH8A 3OW3A 5BYLA 2J0IA 5IUIA 3HA8A 1XHAA 1PW2A 1FVTA 2CSNA 2PVLA 5IEYA 3QTIA 2EUFB 1GJOA 3GOPA 4HGEA 3II5A 4NJDA 4QYFA 4XS2A 4ACGA 4AZSA 5HX8A 2GU8A 2ZAZA 4MQ1A 4TW9A 3ZUUA 3MA6A 3VUDA 4D2PA 4BHNA 3CS9A 4OTGA 4Z9LA 3HMNA 1YHSA 2OSCA 3PY3A 2X4FA 1TVOA 2ZYBA 4LFIA 4BTFA 4NL0A 1KE8A 4JDKA 5DR9A 2G1TA 4LMUA 5CAVA 4QOXA 2CCHA 3ENHA 4ZY4A 3OCBA 3MDYA 3MBLA 3ZXTA 4IH8A 3DXQA 2PZIA 4EZ7A 2G9XA 2BFXA 3R02A 3TIZA 2R64A 4TWPA 3NSZA 2WXVA 4GUBA 4R5SA 3V5PA 4NYEA 4ZK5A 3PE1A 4Y8DA 5KX8A 4E4XA 2F7EE 4R7BA 1S9IA 3BBTB 4BCPA 4GG5A 3OCTA 4HNIA 4M12A 4FKIA 5HVKA 1CMKE 4JAIA 2WTCA 4FTMA 3O71A 2V55A 3Q60A 4AW5A 4TYGA 4I4EA 1OECA 4XUFA 4DGLC 3C50A 4NW5A 3GQLA 3NWWA 4X21A 3ZS5A 4IW0A 4YTIA 5GHVA 5EYKA 5CT7A 3VWAA 4AXAA 5M56A 4MXOA 2HAKA 4ACDA 3GFWA 4X3JA 3UBDA 4RQKA 4F7LA 2VWIA 5M57A 5AX3A 1V0BA 3MGYA 4H3QA 4L3LA 4MD9E 3ZH8A 5ETCA 5TKDA 3M2WA 5I0BA 5HIBA 3FY2A 4TYIA 5AAEA 4XOZA 1L8TA 3NLBA 3EWHA 4A7CA 4FIEA 1RE8A 4NU1A 2YA9A 4QYYA 5HIEA 4Z55A 2OFUA 3OP5A 1JQHA 4TYHB 5D12A 4HOKA 5BVOA 4E5WA 1Q41A 2ZB0A 3PY1A 4ZLOA 5JZJA 3F5PA 4EI4A 2BFYA 5AP2A 3AC1A 3PRIA 4H1JA 5C8NA 4XG2A 4N57A 4DBNA 4BDIA 4QP9A 4RIXA 2JD5A 3QGYA 3PLSA 3S3IA 2GNIA 2BDWA 3FMHA 3EQDA 3N51A 2RFNA 5J9LA 4UX9A 2I7QA 4IM0A 4BDCA 1F3MC 4U5JA 5FGKA 3GOKA 4O0VA 4EH3A 2OIBA 4LRMA 2HZ0A 2W1IA 3SVVA 4RIWB 5HE2A 4F0GA 3LJ2A 3BHTA 1UU7A 4NEUA 5DWRA 3LCSA 2W4KA 2Z7RA 3PPZA 5BMMA 4TZRA 4YO6A 3RAIA 5CXHA 4G17A 2RFDA 3VVHA 2Q0BA 2VWBA 3H4JA 2W5BA 1V1KA 2FVDA 3BLHA 5LMBA 2B54A 2XNGA 3DAKA 5E8ZA 2PK9A 2PMIA 2VO0A 2ITPA 2ITTA 2OF4A 3HAMA 1MRYA 4QMVA 3ZMMA 4AZEA 2V0DA 4H58A 2IW8A 1YOLA 2IJMA 3SC1A 5HQ0A 3AC2A 5JH6A 4WT6A 3Q2JA 4AF3A 3G51A 3WF6A 2KTYA 4U45A 3PA4A 3DU8A 3FC2A 4YSMA 4ASZA 4JQEA 3AD4A 4MTAA 2PPQA 3IW6A 2YERA 4OTIA 2CGUA 2IW9A 2Z7LA 3FMMA 5CXZA 2C3IB 5JFWA 3UZPA 1REKA 4AW2A 4E8AA 3PRFA 3R8VA 3BU6A 3FSKA 5EG3A 3ORIA 3PSCA 1XH4A 2C5YA 2Z02A 3NUYA 3KXZA 4C37A 2XEYA 5HD4A 1V0OA 1YHWA 2W1FA 4IWPA 4YJQA 3UE4A 2BMCA 3QHWA 4TNDA 3OEZA 4HYHA 4RZVA 4M97A 4DH3A 4GKIA 2XJ0A 2QVSE 5K0KA 4A9TA 3N4VA 5L2WA 3GFEA 3G33A 4J99A 3TG1A 3V04A 2E9UA 4XYFA 1PY5A 4KIKA 5BVWA 3F2AA 1XH7A 2VTSA 4U7ZA 3DZOA 3DFCB 4BKJA 2C68A 3R04A 2YIWA 4CLIA 2FSLX 3ALOA 3IK3A 1JSTA 3ORNA 4L43A 5FEQA 2UW9A 3Q9WA 3VUIA 5L8KA 3RALA 1Q97A 4FIHA 3JY9A 2YCFA 4YJOA 4YJVA 5H8EA 3HP5A 1FVRA 3QC9A 2YM8A 2PUUA 3DS6A 4GK4A 5HBHA 4U81A 5LCKA 3W2RA 5K9IA 2WTKC 4XHKB 3MY5A 2XNOA 3L8SA 3BLRA 4RT7A 2C3LA 1OPLA 3FPMA 3QD3A 3F61A 4DEEA 4E4NA 5L4QA 3ZFYA 2ZV8A 4QMQA 2X4ZA 4RBLA 3P86A 5CYIA 2OXXA 5HIDA 2I6LA 5HVJA 3ZO1A 3AMYA 3L8XA 2IZRA 4FT3A 4PL5A 2LGCA 4ZSLA 4FSRA 5IQIA 2Z8CA 1P2AA 2PE0A 3PVWA 5CU2A 3QWJA 4BDDA 4XV1A 2YZAA 3EN5A 3U51A 2Y8OA 5AM7A 2QLUA 4O0WA 3LMHA 4QPSA 2QURA 3KULB 4IAYA 3SDJA 3G5DA 3ULZA 3D14A 4EBVA 2GNJA 4K33A 2PVJA 3Q32A 2PZYA 4BCNA 3BYOA 4CZTA 1OB3A 3E3BX 3U4WA 2PTKA 3UVQA 3TN8A 3HMOA 4V04A 2C6IA 4UWBA 4H39A 4Y85A 3W8QA 2YIXA 3PJCA 4RWIA 2XNEA 3FDNA 4NM5A 1ZOEA 2WB8A 2I1MA 2WTKB 3C0GA 4E5BA 5A6OA 2JDRA 2X6EA 2JKKA 3BWJA 4KS8A 3RM6A 3AC5A 3P7BA 2FSTX 4QP1A 3R8UA 4FC0A 2BHHA 2X6DA 4ENXA 4LUDA 1BX6A 3OC1A 3UZTA 1H25A 4IACA 1VYWA 2ZM4A 3PWYA 5DOSA 3B8RA 4U8ZA 5CNOA 4C34A 3GP0A 5ACBC 4YJTA 4IB5A 5CSWA 1OKZA 3NNVA 3V6RA 3EN9A 3FMLA 1FMKA 3E92A 1XH8A 4HCVA 2QOHA 2XM9A 4I5PA 4DINA 4Y73A 3RNIA 2XKDA 2GDOA 4FNZA 3RWQA 3W10A 4MF1A 4C35A 4FOCA 3HZTA 4CV9A 1PXLA 5T3QA 5K4IA 4DA5A 3ZCLA 3DT1A 2W4JA 2WIHA 3CPCA 3VUTA 5IZFA 3C5IA 2CGXA 5TT7A 1GIIA 2IZUA 3OF0A 2O0UA 4YNEA 1FPUA 5E8SA 5H8GA 4J7BA 2CN8A 1KSWA 4O0XA 4Q9SA 4DCEA 4QMXA 4DHFA 3QA0A 2CNVA 4BFMA 2OO8X 3GEQA 4PMMA 3S95A 4O0TA 2QOFA 5EFQA 4TYHA 3VN9A 4R3CA 3ZM4A 2WHBA 2PVMA 3LAUA 5E92A 3TWJA 5AA8A 3ZOSA 3MY0A 2VX0A 4XG3A 2VNYA 4C4JA 2YISA 5DIAA 1Y57A 4KSQA 3KA0A 3GC0A 3PZEA 1YHVA 1YOMA 5GZ9A 2GTMA 3DJ6A 5GIPE 2QCSA 5LJJA 3R2YA 2Y0AA 3AT2A 5J9ZA 5E4HA 2ESMA 5BVNA 3V5TA 4ASXA 4MBIA 3UP7A 2XNMA 2YAKA 4F9WA 2CKQA 4FEUA 1WVWA 3JS2A 4E73A 4XG9A 2IVUA 4IAKA 2QODA 2R3HA 3E3PA 3VS6A 1LP4A 1FINA 5FEEA 4D4RA 2QO2A 4UYNA 3Q4CA 3GT8A 3R1YA 2C0TA 4AGUA 4F6WA 3MFRA 3LCDA 3NNXA 2OH4A 4JJRA 3QU0A 5CU4A 4CMOA 1Q8TA 2J0LA 3QAME 4I5MA 3RZFA 3VS0A 3RK5A 4QP3A 5HU9A 5C4LA 5KZIA 4A07A 4HNFA 5CT0A 1JKLA 3UO6A 3PUPA 3DB8A 3T8OA 1M52A 4M15A 3KN5A 3OWKA 4KKHA 3GC8A 4OT6A 3PP1A 4BN1A 3QQFA 4WKQA 2OF2A 5L6OA 2HYYA 2QOCA 3D7TB 5AR3A 4AWIA 3K5VA 1H1RA 2ZV2A 4I94A 2WQOA 3DXNA 4LM5A 3RWPA 5L6PA 4DF3A 2UW6A 2VTIA 3CQWA 3LFQA 2JEDA 5CWZA 5HGIA 3ZLWA 4ZSAA 4Z16A 2A1AB 2VO7A 2OJJA 3AGMA 3CE3A 4FKPA 4RSSA 4HVSA 4NCTC 4TWOA 3QRUA 1WBNA 4P5QA 3PJ3A 5K5NA 4IB3A 4CG8A 3R7OA 5CQWA 5KBQA 2PVRA 3QXOA 4NKSA 4CT2A 4DFZE 2CKOA 3DCVA 2RFSA 5AP4A 3QQJA 4HYSA 3NUSA 4EOPA 5E7RA 3R00A 3ZEWA 2ITQA 3COHA 4NT4A 3O7LD 4BIDA 2WMTA 1YI4A 4CG9A 4CSVA 4PDYA 1GZ8A 3Q96A 4KIPA 4XEYA 4IAFA 4BRXA 2OK1A 1DAYA 4CT1A 2QOIA 4QP8A 3TV7A 3MYGA 3EIDA 2YM3A 3EYGA 3NGAA 3F66A 4G5PA 3UGCA 3OS3A 2UV2A 4X2FA 5M4FA 2QG7A 4YZMA 2V22A 3D2KA 3QF9A 4EK5A 5LVMA 3HVCA 4YUQA 5EQYA 4W4XA 3AQVA 3VNTA 2Y4PA 3FMDA 3UIBA 2FB8A 4OTRA 5FQDC 3R7IA 2H8HA 4FV0A 3OFMA 1B6CB 5L2TA 3DBFA 1MQ4A 1DI8A 4L9IA 3KXHA 3LFFA 4ZTNA 3FMNA 4II5A 3FLYA 2HXQA 4P2KA 3VUGA 4FSQA 1SVGA 2JDOA 4A4OA 2J5EA 4WBOA 3HDMA 4S31A 3F3ZA 2XRWA 3DKFA 4QP7A 4R3RA 3G15A 5DN3A 4I23A 5CAPA 3ZM9A 2RKUA 3QCSA 4WG4A 4C62A 2IPXA 5AJQA 3S1HA 3LMIA 4U80A 3LCTA 3LQ5A 2CNQA 4FK6A 4K18A 5E8WA 2F2UA 3JPVA 3QRJA 3D94A 4K9YA 4ZLZA 3MESA 1TQIA 3VS3A 5HD7A 2XK8A 1PXPA 3CY3A 4KRDA 5FTGA 1H26A 4X6RA 4C36A 2IVTA 3C0IA 3KULA 3ORTA 1FVVA 3LFNA 4UYAA 3AMAA 4M68A 4DBXA 2VTRA 3C5UA 4IZ5A 3QRKA 1Z5MA 2VTPA 4H36A 4IAAA 5DEWA 5D7AA 3PFQA 3LZBA 3LMGA 2JKOA 4IXPA 4MXAA 2WU6A 4KRCA 3NPCA 2ZOQA 4G6LA 3OROA 4IZAA 2X8EA 1OITA 1H27A 2BDJA 2J4ZA 2QR7A 4MVFA 1H0WA 3UO4A 3HV4A 3QA8A 1SMHA 1XH9A 3DAJA 1KOAA 2GFSA 4XLVA 4M0ZA 5J1WA 1YXTA 3ELJA 4C4FA 2PUIA 3HRFA 1H24A 3EKNA 2AUHA 3FI3A 3NS9A 1UWJA 2QI8A 2YCSA 3S2PA 5M4UA 2H34A 3PSDA 1OKVA 4ZSJA 4DT9A 3TZ8A 3HRBA 3CC6A 4O84A 2XEZA 4EC8A 3UVRA 3QXPA 4AE9A 3LXPA 4TWNA 3R7UA 3FKOA 3UYSA 2QOBA 5L2IA 4G6OA 2VGPA 3P79A 4FVQA 4UBAA 3CR0A 3MN3A 4P90A 2WOUA 1YXUA 1WBOA 3CTHA 1I09A 2GNFA 4CTBA 3P1AA 3FXZA 3ZZEA 2X7OA 4AAAA 4DFNA 4LL0A 4I0RA 2UVXA 4IWQA 4QRCA 4KIOA 4MQ2A 4DGGA 4QP4A 3B2WA 2WQBA 4JDIA 5E8UA 3S00A 3QX2A 5B7VA 4J1RA 3OXIA 3GGFA 2I0YA 3QCYA 2ETRA 2O64A 4BI2A 4YZ9A 4YLKA 2HENA 1A48A 3ATSA 3PG3A 3UOLA 5ANKA 5C9CA 4FKLA 3Q52A 3CLYA 1WBPA 3VBVA 1KWPA 2PUNA 4Y5QA 4G34A 4BDAA 2IZSA 2PZRA 4OTPA 2J2IB 3A2CA 3ZSGA 4PNIA 3VJNA 4E1ZA 2B9IA 5LQFA 4FYOA 5M53A 4ZTSA 1ZARA 5CANA 4QTCA 3KMWA 3GVUA 1ZXEA 2V7OA 5ACKA 2W9ZB 5AFVA 3RBWA 3QHRA 4PWNA 4D2WA 4DFYA 2E9PA 4FIGA 5IEXA 2QR8A 2WPAA 2CLQA 3E5AA 2GCDA 3MJ2A 5FRIA 4B99A 4C38A 4UMUA 4WD5A 5AR5A 3UJGA 5KMJA 4M7IA 5HG5A 1XH6A 4ZXTA 5K5XA 2WTJA 3LFSA 4FG7A 4I6BA 3RPYA 5HOAA 5A4TA 2QKRA 5DLSA 5AMNA 4RFZA 5JK3A 5CZIA 4R7HA 4RZWA 4GFOA 4AZWA 4FL1A 5DR2A 2QHMA 3SGCA 1APME 3TEIA 2NO3A 4XBUA 4UWCA 4UXLA 1NVQA 3ZRMA 3PG1A 2J7TA 4WA9A 2W0JA 1H1PA 3MFUA 5G1XA 1JWHA 2YDJA 3GBZA 3D7TA 4EOSA 1WZYA 3EQIA 2W05A 4F7SA 2XKCA 3AC3A 4IX5A 1Q24A 2WQMA 4R8QA 3QKKA 4NZWB 3EYHA 1GAGA 3R8ZA 4F7JA 4N6ZA 2QOKA 5JRQA 4O7LA 2JBPA 3N4TA 5CU0A 3A8WA 3AT4A 3LJ1A 4KINA 5TF9A 4LYNA 3S0OA 3OMVA 4H1MA 2YFXA 4QMWA 3VC4A 4TT7A 5F20A 4S32A 2XKFA 4XJ0A 1XBBA 5LMKC 4FV1A 3A7IA 4FNWA 2BRGA 4O21A 4FV4A 3VS5A 4CFMA 2BAJA 3KXGA 4KA3A 3VRYA 5AUUA 2W7XA 5FDXA 4FNXA 1U5RA 2UZVA 2QU5A 4YLLA 3OT3A 5CX9A 4DH1A 3N9XA 1OPKA 4FNYA 4JNWA 3LOKA 3NX8A 2H96A 4AT5A 2OLCA 4PY1A 2BVAA 4BIEA 4I41A 3ATTA 3POOA 4YO4A 1Q8WA 3I4BA 3ZUVA 1H08A 3NNWA 4GVAA 4AE6A 2OG8A 3FXXA 4M84A 3ITZA 1DM2A 2VO3A 3F2NA 4FTTA 2DWBA 5M55A 3FHRA 4YPDA 4O6LA 3O51A 3QUPA 4XG7A 5C27A 5CY3A 3SW4A 4I6QA 4RJ8A 4YZBA 2UZLA 5EKOA 2VUWA 4EUUA 4NCTA 1XBCA 1YDSE 2IVSA 4Q5HA 4U43A 1ERKA 1R0EA 3LQ3A 2PMOX 3VO3A 3UNJA 2I0HA 5A46A 1PMUA 4W9WA 3MFTA 4BDFA 5CEIA 2R3OA 1OBDA
chains in the Genus database with same CATH superfamily
3TV6A 5CEMA 3FZPA 4ANQA 3AKLA 1Q4LA 4C61A 3F2RA 4LGHA 5EH0A 4J53A 4PPBA 3CY2A 3LLAA 3R28A 4LV5A 4OW8A 3ZC5A 1T46A 4APPA 4E93A 5FXRA 4D2RA 1PXOA 3FXWA 3DLSA 4FKUA 2VO6A 2GS2A 3KCFA 4M69B 4QNYA 3GCQA 4AW0A 3HAVA 2B4SB 3BGZA 4YNOA 3W8LA 2PUPA 1QPDA 5D7VA 1SZMA 4L7FA 3CD3A 1UNGA 3DQWA 2O5KA 2XNBA 3DJ7A 3ORZA 5EW9A 3CEKA 3GCSA 4XG6A 4WNKA 4YJSA 5IMXA 2BRMA 4E7WA 4F99A 4BCGA 4GKHA 4QPMA 4N0SA 2W17A 2V7AA 2ITZA 4EH5A 1ND4A 4C7TA 3T9TA 3KMMA 3A7FA 3ZC6A 1OIUA 3AC8A 3PXQA 3PPJA 3PZHA 2X81A 4ZJIA 4G16A 4C4HA 2OJGA 3KFAA 5HG9A 5A4EA 4JVGA 4QQJA 3KF7A 3MVHA 4EQCA 3SAYA 3KCKA 4ZSGA 5CASA 3E8EA 2HY0A 5ANGA 1W82A 3BEAA 3VS2A 2X9FA 4APCA 3UNZA 4BTJA 4CQEA 3P7AA 4RLKA 3EZRA 4DGMA 3LVPA 1U4DA 1PMNA 3BL7A 5AR7A 5HESA 4D1SA 4E6AA 4ZTRA 4EEVA 3RPVA 5CQUA 5BNJA 5GJFA 4N6YA 5F94A 2JFLA 2CJMA 2YCRA 3IW5A 1JKSA 4QTEA 5IDNA 4D1ZA 4L44A 3KL8A 4FZAB 3RI1A 4NM7A 4O7SA 2VWXA 3TYKA 3SOAA 2C6OA 2XCKA 1S9JA 4B7TA 2GTNA 1BKXA 4PUZA 3ACJA 4GT4A 5KHXA 2GS6A 4PPCA 5LARA 4EK8A 2CLXA 4GJ2A 3OG7A 4J8MA 4BGGA 3TM0A 3QKLA 3PVUA 4IE9A 3DQXA 5IQBA 1U59A 1OMWA 1TZDA 2OGVA 3BRBA 5L3AA 1BL7A 4FZDB 4BZOA 4CQGA 4EH2A 4FTUA 1OKWA 2ZDUA 4XP2A 3U55A 5IH4A 4CFFA 3LHJA 4DT8A 1E1XA 2BCJA 3D5XA 4HVDA 4FEXA 3CBLA 3R30A 2HELA 2W4OA 4E3CA 3GU7A 4X3FC 2R0IA 3FLSA 4BDHA 2IG7A 4IQ6A 2RF9A 3P23A 4NW6A 5DE2A 3VUHA 3TDVA 4JT3A 2ACXA 5C03A 2QO7A 4ANMA 3I7CA 3PIZA 2W06A 4QYEA 2ETMA 4EOKA 2BTRA 3QZHA 2HW7A 3GXLA 5HLNA 4GSBA 2OFVA 1STCE 3R1QA 3FLNC 4AX8A 4FBXA 4AZVA 2C5NA 3LCOA 4GRBA 3RCDA 2XUUA 3PIYA 5AUXA 1YOJA 4GVJA 3TNIA 1UKHA 4MYGA 3U4UA 2ZB1A 5IH5A 4Q9ZA 2OXDA 1J91A 4YC6A 2OXYA 2XIZA 3D9VA 4O82A 4O6EA 5GNKA 1PXNA 4DAWA 4E6CA 4W4WA 1ZYJA 2C6TA 2Y6OA 3LFEA 3G9LX 3Q53A 3WZKA 3MV5A 5IISA 4FVRA 3O8UA 5FBNC 2XARA 4PDOA 2FSMX 5DRDA 2I40A 4O0UA 3TCPA 4EK3A 5LOHA 2WAJA 4FV9A 3VHEA 4BDBA 1MQBA 5CNNA 3W55A 4HPUE 3QUDA 3R71A 5CSHA 3TZMA 2V5QA 1PMVA 2J6MA 1R3CA 4I5CA 4X3FB 3FZTA 4Y46A 3EQGA 3FZRA 4G2FA 1VJYA 4A9SA 2HK5A 4JX3A 4BCJA 2BTSA 3M42A 1GIJA 4TTHB 4AA5A 5C4KA 4EORA 5IQCA 1M2RA 2XK3A 3VS1A 5D41A 3O23A 2PMLX 3R63A 1MUOA 3GUBA 5DT3A 5AUZA 2YWPA 3E7VA 2WTDA 4FJVA 2V62A 2R7IA 1Z9XA 1YKRA 3EH9A 4U41A 3BL9A 3I81A 4DEHA 3LXNA 3NNUA 4MXYA 3W32A 5CLPA 4AGCA 4F09A 2XYUA 3DK7A 5EYMA 3HDNA 3NAXA 2ZJWA 2YIRA 4C4IA 2WFYA 4O0RA 5LVPA 3U6HA 4A9RA 4LOPA 3FI2A 3HV7A 4QMNA 3R8MA 4PPAA 3PXYA 4FKVA 4GIHA 4Y83A 2QHNA 3E8NA 3WZEA 3QQGA 3JVSA 4RFYA 4GW8A 3T9IA 3WE4A 4FYNA 3UPXA 4MEDA 3FKNA 2E9OA 3MA3A 2QOOA 2BKZA 3LKMA 4FV2A 3TNHA 2WMWA 3BE9A 3BLQA 2W96B 3KRWA 4RVLA 3IS5A 4DG3E 4YJUA 4FE2A 4AXFA 5LMKA 1UKIA 5HNBA 3E87A 3HMPA 5HNIX 3C7QA 4BCHA 4I93A 2QQ7A 3BEGA 3EQHA 4FIFA 4O0SA 4YP8A 3A7GA 1PMEA 3FQSA 3IDBA 3D0EA 4JR3A 3ZUTA 4BI0A 1IG1A 4EQUA 3H0ZA 1WBTA 4QO9A 5AP5A 3MW1A 2WKMA 2C0OA 5AR4A 3WF5A 4BCFA 1H1QA 4USFA 3LFAA 4EK6A 1JSVA 3K54A 3R1SA 1P4FA 3POZA 4JAJA 3I1AA 3OWJA 4HZSA 4M69A 3UZRA 4DTAA 5K0XA 2WMBA 2B7AA 3OT8A 5HU3A 4JS8A 4BTKA 4GJ3A 3KK8A 5FTOA 5HO6A 3R9RA 3UIUA 2EU9A 3WI6A 4W4YA 5CF5A 5IUGA 4EUTA 2J0MB 4JBOA 5HE1A 1OL5A 5CF4A 2QU6A 1XKKA 1YRPA 4FOBA 2W1CA 3QLGA 4JG6A 4KS7A 4V01A 5L2SA 4QQTA 3F9NA 5HI2A 2R3RA 1CDKA 4ALWA 2VWWA 4PDPA 2PE1A 3KRRA 5JGAA 3VUKA 1AGWA 3R6XA 3R22A 3BYSA 2YJSA 4V05A 3RP9A 1H00A 1SVHA 2XVDA 5CI6A 2AEGA 4XRLA 4XX9A 3GU5A 1YWNA 2IW6A 1Q8YA 4NSTA 4QT1A 4EJ7A 2NPQA 4D4YA 3QFVA 4IANA 2UVYA 4RVKA 5D10A 2JBOA 3SHEA 4BB4A 1LUFA 4G9RA 4YHJA 1PF8A 3HEGA 4BJJB 5J79A 4QMLA 4YJPA 3UO5A 2O2UA 4FL2A 4HGSA 5CS6A 3ZBFA 1OUKA 5LWMA 3U54A 4QYGA 4QQCA 3OCSA 3UOJA 4WSYA 4PP7A 2JIVA 3F69A 4QNAA 4F9YA 3SG8A 5IQHA 2ZM1A 3EKKA 2R3LA 5LCJA 3VULA 3DA6A 1IASA 2VTMA 2W1HA 3UOKA 1GZOA 1ZYCA 3BE2A 3AOXA 2E2BA 2X0OA 3NIEA 2HW6A 4FSWA 1Q5KA 1HCLA 3FY0A 3PJ8A 4I6HA 4IB0A 4Q2AA 3VBWA 5ITAA 2XIXA 4IAZA 3R7YA 3VW8A 2XM8A 3ACKA 3WZDA 1BL6A 5M07A 2BILB 2OH0E 5IQDA 2R3PA 3NAYA 4A9UA 3OTVA 3IECA 2JKMA 5H8BA 1UWHA 3LCKA 4FIJA 2CDZA 3AT3A 3R0TA 1J7IA 4RJ3A 3VIDA 3G0FA 2JDVA 5L2QA 3OW4A 4DDGA 4ZTLA 3DY7A 4I24A 3ZBXA 3RZBA 5L8JA 3QD4A 2W99B 2R3IA 4ENYA 3HECA 3MFSA 4BICA 1W98A 4OR5A 4YJNA 4DH5A 4ANLA 1M2QA 3MVMA 2YIQA 1ZMVA 2DQ7X 3R73A 3VF8A 4D9TA 3MPMA 4X2GA 5HX6A 2GHMA 3L9NA 3PIXA 4RVMA 4DN5A 2WO6A 4ANOA 4GFGA 2VWYA 2UUEA 3FI8A 4FI1A 3WOWA 4C02A 4O7TA 4R77A 1SNUA 4ANBA 3PLAE 3REPA 3V51A 3ZFMA 3W0SA 1XBAA 4NKAA 4NJ3A 3OZ6A 3RCJA 4I3ZA 4FT9A 4RIYB 3WBLA 4JG7A 4B4LA 3COIA 5I9VA 4BL1A 4Y5HA 4B9DA 2Y7JA 2YDIA 3ROYA 5JEBA 3QLFA 4FVPA 2XKEA 1P5EA 1WBWA 2C30A 3IDCA 4FKSA 4KUJA 4NM3A 4C8BA 3TIYA 2J9MA 5HTBA 3IW4A 2PVKA 2UZBA 4W8EA 2PZPA 2XIYA 5CU6A 3W2PA 4AQCA 3JXWA 3DOGA 2ITYA 2R3NA 3VS7A 3W2SA 4HW7A 3KXMA 5L6WL 5M44A 3LM0A 4C58A 5DA3A 5GJGA 4ERKA 4X3FA 5HTCA 4JBQA 5KMIA 4D2TA 4O7RA 3A4OX 3VF9A 3SXFA 1KE9A 2P3GX 4J98A 5A54A 1NA7A 3EQFA 4ZTMA 2ITXA 3GI3A 3W33A 3F5UA 4TN6A 4IX6A 1UU8A 2HZNA 1GNGA 3MVLA 4O22A 4MNFA 1Y8GA 4JMQA 2HZIA 5AAGA 2VZ6A 4IMYA 4AZFA 4KNBA 5IQAA 4R1VA 4FX3A 3WF8A 3R7VA 1TKIA 3EB0A 4R3PA 1PYXA 3QQHA 3IKAA 4LGGA 2NRUA 2RIOA 2BRHA 4TYJA 2GSFA 4P7EA 1KE6A 2XCHA 3D5UA 3FI4A 2UZNA 4MWHA 4A06A 3ZRLA 4DH8A 3RHXA 5BVEA 5HE0A 3E8CA 2SRCA 5KMOA 3CGFA 2ZV9A 4D55A 4KKEA 4QMUA 4KBKA 3F7ZA 4YHFA 1UVRA 3HGKA 3NR9A 4QMMA 3PJ2A 3EMGA 3L1SA 3Q9XA 3ORXA 3ZLYA 4RJ7A 4BDKA 3QL8A 1R1WA 2Z2WA 4I92A 4I20A 4DHJA 2X7GA 4UY9A 3KVXA 2R5TA 3GU6A 3BGPA 4LOQA 5K3YA 2YLEA 2OIDA 1M17A 5A4QA 2C0IA 3IGGA 1P14A 2F7XE 2PHKA 1J7UA 3RPOA 2XK7A 4BYJA 3KEXA 4O7NA 3RAKA 3ERKA 3UG1A 5AV0A 4C2VA 3R8LA 4GEOA 4K1BA 4DLIA 4ZLYA 2A4LA 3OXZA 4H05A 2NYAA 1QCFA 2OZAB 2VTQA 4MWIA 2PU8A 3WIGA 5FTQA 2XK6A 4IFGA 3Q6UA 3RM7A 4C4EA 1RW8A 4L01A 1VZOA 3DBQA 4O0YA 4BZDA 4FT0A 2GHLA 3NW6A 4YZNA 5EM5A 4PTGA 3P9JA 4RC2A 5HTIA 3V8TA 4EWQA 1GY3A 3EN6A 3PTGA 2OZOA 1RDQE 1W2FA 5EK7A 3LM5A 3IG7A 2HIWA 4HCTA 5HG7A 3PYYA 4A9YA 2B53A 1H1SA 2PVYA 1NVRA 3C0HA 3GC9A 1ZOGA 2R3JA 3NUPA 4IC8A 4XG8A 4F6SA 4LL5A 4ORKA 2FGIA 2JAMA 4X7QA 4AGDA 2YM7A 1LEZA 1QPCA 3Q5ZA 2C4GA 3DNEA 4JDJA 4K0YA 2F49A 2RG6A 2ZMDA 1FQ1B 4LI5A 2CKPA 4CNHA 4ZTHA 5H2UA 4FKQA 4FZ6A 3RPSA 4BJJA 5FXQA 4AA4A 3I5ZA 3OEFX 3CKXA 4AS0A 4GFMA 3O17A 3F82A 3FL4A 4WNOA 5C8MA 3H30A 3AXWA 4B0GA 4EH9A 1BI8A 4U97A 4EOOA 2VX3A 1B38A 1ZZ2A 1XWSA 2H9VA 1WFCA 3TTJA 4O27B 4RX5A 2X2KA 4C3RA 3R1NA 2VAGA 4KWPA 4F0IA 4XH6A 4ZZMA 4DFUA 1KV1A 2BIYA 4QQ5A 5ETFA 3FC1X 3G9NA 4M66A 3ULIA 2ZFYA 1YXSA 3E88A 4S2ZA 3OCGA 3RKBA 1IAHA 3W0MA 2EB3A 1YDTE 2QLQA 5HLWA 2WEIA 3TNPC 3THBA 5DBXA 4DE4A 2PVFA 4IJ9A 2VRXA 4ZMEA 3A61A 3DJ5A 5BUEA 4MNEB 2VU3A 4F9AA 2C6LA 3OWPA 4O1PA 4U79A 1BI7A 1JAMA 5FWKK 4FTKA 3HP2A 5KE0A 1OPJA 4NIFB 4RPVA 4RWLA 4DFLA 4KD1A 4WSQA 5AV3A 4O7YA 5J7HA 1UV5A 3IW8A 3TKUA 4EHGA 3QALE 3UDSA 1Z57A 2Y6MA 5BVKA 3ORKA 3KVWA 4HJOA 2LAVA 3FMJA 2P4IA 2WGJA 5E1SA 3MS9A 4G3DA 2JDTA 1WVXA 3G6GA 4FGBA 2VNWA 3NUNA 4E6QA 5EKNA 2XAMA 2WD1A 1KE7A 1EH4A 4K6ZA 4RIYA 5EYDA 5KMNA 5KUPA 4CCUA 4JL9A 1G3NA 4LGDA 1JLUE 2CMWA 4MX9A 3E93A 5DVRA 3SOCA 4BCOA 3F3TA 4FEWA 1M7QA 3D2IA 2UW8A 4HVHA 2F7ZE 4IHPA 4EWHA 3FL5A 1OUYA 4BBMA 4EOLA 4BGHA 3QTZA 3NVKI 3PVGA 3LFBA 3PWDA 4FV3A 4PP9A 4FV5A 2P0CA 1T45A 4IJPA 2O8YA 2XMYA 2B9FA 2JAVA 2FSOX 4U44A 3H9RA 2X0PA 2GNHA 2R3GA 3A99A 3F5XA 3PE2A 4PV0A 5HO8A 3W2CA 3GCUA 5EQEA 2X39A 3HKOA 2GMXA 4ALUA 2UW0A 3EQPA 4TKSA 3FV8A 3EL7A 2UZEA 3MH1A 3WZJA 3ZFXA 4IAIA 2AC3A 2B52A 3ZRKA 4AN3A 3QYZA 3ENMA 3RINA 1WBVA 4ACHA 3KC3A 5HVYA 1LR4A 5IA3A 1BMKA 4F65A 1ST4A 1AQ1A 4DG0E 2B1PA 2C6EA 4QP2A 4YR8A 4EOJA 4BBEA 2GFCA 4FR4A 2ERKA 5IA2A 3RK7A 4BTMA 4DFBA 4L52A 4F9CA 4LOOA 2EVAA 2XAOA 5D9HA 5ETIA 5CENA 2RGPA 4DC2A 2VTJA 4GT3A 4JLCA 2RG5A 3HL7A 3ZSHA 2C5XA 4CMTA 4GU6A 2YZLA 3EFLA 4EK4A 2RSVA 2IEWA 1K3AA 2XJ2A 4LG4A 3Q4UA 1JPAA 5CF8A 3IPHA 5E91A 4JDHA 3SG9A 3FZOA 5B2KA 3I7BA 1OI9A 1Q62A 4QTDA 3LQ8A 3BHYA 5FDPA 4OTWA 2IF8A 4YTCA 1E9HA 4AACA 3AMBA 2JFMA 4YC8A 3MH2A 2UW3A 3L8PA 3CGOA 4BCKA 4DFXE 3HV3A 4F08A 2YCQA 2IZTA 3QTSA 2F57A 3F3UA 3QZIA 2X2MA 4BF2A 3NUXA 2Q0NA 2YABA 3QTXA 3DKCA 2Z7SA 3RPRA 4IVAA 3GCPA 1J1CA 4EHEA 4MK0A 1OGUA 3CTQA 5ANDA 5CALA 2CGVA 2OKRA 3QD2B 3W16A 2OZAA 5EM7A 4EH7A 1CM8A 4GH2A 2UZTA 3MB7A 5CVHA 1E1VA 3RJCA 4DLJA 4C3FA 5I4NA 4ZJVA 1YW2A 3Q9ZA 3C4CA 4OTQA 4BDGA 2C6KA 4Z7HA 4FICA 3MPTA 4G5JA 2WEVA 3BI6A 4DH7A 3EQRA 4IX4A 3LXLA 4JG8A 3O2MA 4WRGA 2XNNA 3BV2A 2RL5A 3TUBA 4AOJA 4FKGA 2CN5A 3PSBA 4I1ZA 5J8IA 4ZP5A 3NIZA 4BBFA 5DHJA 5IKWA 2PWLA 1JSUA 4WUAA 3DK3A 4JBPA 5F4NA 3ML1A 4FUYA 2J50A 3UYTA 5IQFA 1JBPE 4ACCA 1M14A 4C2WA 5IA1A 5J7BA 3OXTA 5FM3A 1R0PA 3DBDA 2BUJA 4J97A 4JQ7A 3G90X 3FMKA 4K2RA 5ANEA 3IONA 2YM6A 4FSMA 3VHKA 1PHKA 4NTTA 5CEPA 4M14A 3I60A 5FP5A 1NXKA 4UN0C 3HA6A 1XMLA 4L3JA 4CZYB 3Q6WA 3HX4A 5AP7A 2GQSA 1XH5A 5FUTA 1O9UA 3EFKA 2ITOA 4I6FA 4BKYA 4R78A 1JNKA 4IZYA 4BVUA 5HE3A 4P5ZA 4I21A 3FKLA 3PPKA 4L53A 2HOGA 4MCVA 4OLIA 4BC6A 4FGRA 4ID7A 2R3QA 3P5KA 4AUAA 4EHVA 2HWOA 4M8TA 2WMXA 3GENA 1K9AA 1OM1A 3QTQA 4NTSA 5A6NA 1UNLA 2BZKB 3R9OA 4DGNA 4K11A 3P5JC 5BYZA 2IWIA 1QPEA 4QP6A 3V8SA 1O6YA 4IWDA 4RJ4A 4AFJA 4TNBA 3V01A 4BCIA 4BZNA 4DEDA 4YSJA 4O83A 2HXLA 5DYJA 4CLJA 1WAKA 2XIRA 2FH9A 4MNEA 4XLIA 3UTOA 3UQCA 3AD6A 3HV6A 4QMYA 4U0IA 4ANNA 3PXRA 4YZCA 3OWLA 3I0QA 5ANOA 1IRKA 4YPSA 4FKRA 1DAWA 5E8TA 3W2QA 4NIFA 4EOIA 4JOAA 5HEZA 3ZO4A 1CTPE 4FT5A 1DS5A 2A27A 5DPVA 3BWFA 1H01A 5A9UA 4KKGA 4O96A 4G3CA 3LJ0A 3TV4A 3TXOA 4FSTA 3SA0A 4BCQA 1Q99A 2O63A 3DV3A 3RAHA 2WTVA 4BYIA 2C3KA 3DKGA 4RJ5A 3SRVB 3UPZA 4O4BB 3L9MA 3MVJA 3CTJA 4ZIMA 2A2AA 3T3VA 4MF0A 4FF8A 4C3PA 2WMRA 3NCZA 2YM4A 3BYMA 1FMOE 5AIKA 4C59A 1U46A 1UNHA 3DAEA 4CRLA 3H10A 3FPQA 4O7WA 3F3VA 5EHLA 2IVVA 1IAJA 4FKTA 4R7IA 1GZKA 4USDA 3RNYA 2VTAA 1ZYDA 3VRZA 4ZZOA 5IQEA 3CP9A 3ET7A 4K8AA 4XG4A 3BBWA 2GS7A 3EOCA 3PY0A 4J8NA 2XJ1A 2A0CX 4G3FA 4GL9A 3H9FA 4F9BA 3ID6C 5HICA 3B2TA 4U3ZA 1CKIA 1M7NA 3LIJA 4FEVA 4X6QC 4WG5A 2R3MA 3V6SA 3NCGA 4L7SA 4BY9E 3NYVA 5I9UA 4QMTA 4J95A 4DTBA 4E4LA 2PY3A 1XR1A 3BU5A 4GS6A 3G2FA 3ANQA 4RVTA 4Y72A 4UMQA 2UZWE 3C4EA 3ZLXA 3UC3A 4L68A 3FLQA 5AUYA 1WMKA 5J87A 4D0XA 4Z7GA 5J95A 2OJ9A 4FTIA 5IG1A 4ZJJA 4L45A 3UC4A 2WIPA 4FV7A 4MKCA 5M4CA 1W2CA 5C26A 1A06A 4F1OA 2YJRA 3D5VA 3DFAA 4FTOA 2W9FB 1J1BA 3EJ1A 3Q4ZA 4PL3A 3AKKA 4D2VA 3A60A 4RC3A 3RAWA 3DLZA 4OBPA 5GINE 1QL6A 5KKRC 5IU2A 2PULA 3I5NA 5C8KA 2WQNA 3I6UA 5K4JA 3GNIB 3BCEA 5IF1A 3W0QA 3A4PA 5DT4A 2OW3A 1UU3A 3SD0A 3A8XA 2B9JA 4G3GA 4CV8A 2QD9A 2I0EA 5EM8A 4RGJA 2WNTA 3MY1A 3QTRA 5BPYA 3IGOA 3ZEPA 3PDTA 3NW5A 2FA2A 3F7WA 3LE6A 1VEBA 3UG2A 3H0YA 4JI9A 2P2IA 4ZZNA 3C4WA 2QG5A 5IUHA 5KNJA 3TNQB 4Z3VA 3TMOA 5AR8A 1XQZA 2WOTA 1ZY5A 2C1AA 3V8WA 4FODA 3V3VA 2DUVA 3HMMA 3MWUA 3OBGA 4IEBA 5ANJA 4ZY6A 3TL8A 5J5TA 4IBMA 4O2PA 5EW8A 4G1WA 3KK9A 2YWVA 2VGOA 2J90A 2VWUA 3QZGA 4O2ZA 5J5SA 3BQCA 1JKKA 4OTHA 3BV3A 5AUTA 2P55A 4IM2A 4EYJA 3W2OA 4IFCA 2YHVA 3QWKA 5AR2A 3BU3A 4E26A 4BI1A 3DPKA 5KHWA 5HKMA 4FSZA 4FV8A 5KKRB 1J7LA 2UW4A 1IR3A 4P4CA 1KOBA 1R78A 3UQGA 5I9WA 3W0PA 1YWRA 2B9HA 2BALA 5EDRA 3IO7A 5EI2A 1IA9A 3OY3A 2QOQA 5BMSA 2YN8A 1XO2B 3MTFA 4LUEA 1SVEA 4OUCA 4DTKA 5I3RA 1G8AA 5TO8A 1TQPA 3COKA 3I0OA 5IA0A 3NUAA 3H3CA 5E8YA 4FTCA 4H3PA 2ZDTA 1W83A 3CKWA 3OHTA 5DT0A 5F1ZA 4XBRA 2UZDA 3QCQA 2KULA 4BKZA 4TPTA 2WTIA 3R7GA 3O8TA 4WO5A 5LVLA 4XOYA 1FGKA 3FZSA 2XZSA 3V5LA 3KN6A 4RRVA 4PTCA 2PSQA 5EOBA 3VAPA 4OT5A 5B2LA 5HHWA 2G01A 4ZTQA 1OZ1A 3TI1A 1YI6A 3RMFA 5BX0A 1JOWB 2W1EA 4EQMA 4ZOGA 3GQIA 2VTLA 5I5ZA 1F0QA 4QMOA 4BHZA 3HRCA 4ITIA 4XV2A 4GT5A 2W5HA 3EN7A 3R83A 2UZOA 5HORA 5JQ8A 1U5QA 4RMZA 4W9XA 3ZU7A 4I5HA 4EOMA 5EHOA 3BKBA 4E4MA 4WBBB 2EXEA 3BELA 5I9YA 3UDBA 5AAFA 1KV2A 2BZJA 2VWZA 3KU2A 5TE0A 2WTWA 1BYGA 1VLRA 4KSPA 4WG3A 4I6LA 3QQKA 4UEUA 1ZYLA 3VW6A 5LMAA 2REIA 3TDWA 4JIAA 4KBAA 3SXRA 4D9UA 1LPUA 4RA5A 3ZTXA 4H3BA 3IOKA 4YZDA 3QC4A 2PYWA 3A7HA 4EC9A 2VTHA 4XV3A 1QMZA 3FZ1A 1RQQA 2XF0A 3PXFA 4L8MA 3D83A 2YIYA 4ASEA 2UW7A 2HY81 5AP0A 2RFEA 3G0EA 3SKCA 4AW1A 3ZDUA 5JFSA 2JGZA 4JX7A 4XMOA 5DG5A 5BV3A 2R3KA 4MD8E 4UXQA 4WIHA 4QMPA 5DNRA 3ZONA 4AA0A 4F64A 2CPKE 2JC6A 4LRJA 4HPTE 4PL4A 3TKIA 3NUUA 3U9CA 4HVGA 2B0QA 3LLTA 2W5AA 4EJNA 1VR2A 3AGLA 3ODYX 4AZTA 2C1BA 2G15A 4IADA 3Q4TA 4CKJA 5HZNA 4UV0A 4Q5EA 3ORPA 3E8DA 3RK9A 3SRVA 3JYAA 3OY1A 4RX8A 4BIBA 4FTLA 4O81A 1YVJA 3FAAA 3LXKA 4C33A 3Q9YA 5CEOA 4ZSEA 4CFXA 3NDMA 3ETAA 3LW0A 4MD7E 3ZLSA 3FQEA 1UU9A 2R9SA 4DCAA 4WOVA 2H6DA 4RQVA 2UVZA 4AOIA 2YLFA 1W84A 4XV9A 5EHYA 3PVBA 4QYHA 4Y95A 1Q8ZA 2VV9A 1URCA 5EM6A 3WF9A 1CKPA 3QTUA 3KB7A 4GUEA 4CRSA 5JQ5A 4UMPA 5AV1A 4WUNA 5FXSA 4IVBA 4GMYA 3MIAA 4I0TA 4GK2A 3HNGA 4IZ7A 1ZYSA 4U40A 1Q3DA 2AC5A 3D7ZA 4KBCA 4AQKA 4C57A 3CIKA 3VUMA 1TFFA 1A9UA 4RLLA 1Y6AA 5BUIA 1O6LA 3ZO2A 4DGOA 3U6IA 4MXZA 3FEGA 4QD6A 2JKQA 5EI8A 4AAYA 1P4OA 4QDEA 5AM6A 4ERWA 4FKOA 2WZJA 4QMSA 5HCYA 5E8VA 3ZZWA 3FJQE 4D4VA 3GU8A 2BDFA 4W4VA 2EWAA 1OL1A 2A19B 4M13A 5BUJA 4MBLA 3Q2MA 5E1EA 4F7NA 2UZUE 2ITWA 2BZIB 1Y8YA 4DEAA 2CCIA 5DH3A 2BZHB 4JRVA 4RG0A 2XH5A 2ZMCA 5EQPA 4F4PA 4IB1A 5AP1A 3U8WA 3VBTA 1PXIA 3IW7A 1NVSA 2X0QA 4EH4A 1OL6A 2WMQA 5AP3A 1W2DA 5G6VA 3SLSA 3Q04A 4MXCA 4UWYA 5J9YA 2PVNA 2XS0A 5CEQA 4FKWA 3HYHA 1IEPA 1RJBA 2R7BA 3JR1A 1ZMUA 4V0GB 4D2SA 2R2PA 4G3EA 3KXXA 5AUVA 5BQ0A 4DYMA 3ZSIA 4TXCA 1WVYA 1SNXA 3C1XA 3COMA 3CCNA 2C69A 3MTLA 2XA4A 3DB6A 2GQGA 2BR1A 3PJ1A 4QEBA 2YACA 5M4IA 5T68A 3VQUA 4BDEA 2HZ4A 4F70A 3NMUF 1JVPP 3MSSA 4GV1A 3UMWA 2VN9A 3FQHA 4LV8A 2XP2A 3D15A 4J52A 3U87A 4JR7A 3PXKA 3DXPA 4CYIA 3QCXA 4J96A 4PMSA 5EDPA 1REJA 3F6XA 3QX4A 4JBVA 4M0YA 3HV5A 4DHZA 3OTUA 2BRNA 3MB6A 5KZ0A 4PF4A 2WMAA 1OIRA 3KRXA 5AIRA 1K2PA 1BUHA 4DEBA 2VX1A 4UB7A 1PYEA 5JGBA 1H28A 3OUKA 5EOLA 3TUCA 3QQUA 1H4LA 3B8QA 4OAVB 4G9CA 1LEWA 5ANIA 3TZ9A 2OJIA 3DTWA 4LMNA 4LQMA 3T3UA 1PRYA 1YWVA 5CAQA 4RFMA 2BIKB 2VTNA 3CQEA 3QRIA 4FKJA 4EZ3A 5CAOA 2ERZE 1ST0A 2XB7A 4W8DA 2C6DA 5ETAA 4BCMA 4FT7A 4D0WA</