4BKJA

Crystal structure of the human ddr1 kinase domain in complex with imatinib
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
314
structure length
295
Chain Sequence
MPRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Structural Mechanisms Determining Inhibition of the Collagen Receptor Ddr1 by Selective and Multi-Targeted Type II Kinase Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 295
sequence length 314
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bkjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bkjA01
2B9HA 2R3OA 2W4KA 2C0TA 4E7WA 3AT4A 4P7EA 4FA2A 3HMPA 2OFUA 4XG6A 1DS5A 5GIOE 3TIZA 3DNEA 2QOFA 4BCHA 4KKEA 4QYFA 5J9ZA 1U4DA 3JYAA 3RKBA 1W0XC 3PRIA 4IB3A 2HAKA 3OCGA 4GFOA 2G9XA 2FO0A 1R1WA 1UU3A 3GI3A 4JG7A 3OD6X 5LWMA 2R4BA 3DZOA 3HDMA 3OW3A 4JBQA 3R73A 4OT5A 2C3LA 3R7UA 3WZUA 5AUUA 5EQYA 3OY3A 3RWQA 3MBLA 2X4ZA 3NWWA 3FZ1A 3QZHA 3P7AA 2OXYA 3WIKA 4HPTE 4K1BA 3UJGA 2VTIA 3D4QA 3D5UA 3GENA 2BRNA 3BGQA 1IASA 4GH2A 5CWZA 4BB4A 4F7JA 4HVSA 3UQFA 2V5QA 3MB7A 3ZC6A 3CP9A 5HG9A 3ZS5A 3I7BA 3BIZA 5AR3A 3VS7A 1BLXA 4CZTA 3D9VA 2F57A 4YJTA 3QGYA 2HELA 3F3VA 4LMUA 3LM0A 4ZSAA 4WD5A 2BVAA 3E93A 5HLPA 4AU8A 2W99B 3V6RA 2NPQA 4I5MA 1CKPA 5LOHA 2GU8A 3ZMMA 3BYSA 4KKHA 1OGUA 3LFQA 4G1WA 4XLVA 3G51A 4FV5A 1YI3A 4Y5HA 3PXYA 2Z8CA 4HYUA 1SVEA 3FQSA 4DT8A 4W9WA 2IW9A 4RJ3A 4IANA 4F6UA 3AC1A 4EKKA 2XRUA 3PSDA 2E9UA 2W1FA 3QA0A 3QQJA 4NCTC 1K9AA 4TWPA 1WBTA 4AZTA 5JKGA 1SYKA 4FK3A 4FNWA 5CNOA 4Y72A 3R04A 3IECA 3DCVA 4II5A 5KUPA 4C4GA 5IKWA 2VU3A 4UMQA 5L2IA 3EQFA 1M2QA 2XK4A 5E8UA 3RCJA 2QO2A 3ZO4A 1K2PA 4ACMA 4DGMA 4FTOA 4RG0A 2JKKA 1Q24A 4N4SA 3UOJA 5EYDA 1HCLA 4E5WA 4F63A 2OZOA 3D5WA 4EUTA 2H8HA 3IG7A 3UG1A 3A4PA 4ACCA 2R0UA 5KX8A 2H6DA 2IZUA 5L4QA 4AT4A 4DH1A 4L7FA 2WQMA 1YXTA 2B4SB 3R7EA 4FL3A 1A06A 2ESMA 2HYYA 3A7HA 3HV7A 4JBPA 4ANNA 4MKCA 5A6OA 2C6TA 2R0IA 4MXYA 2PHKA 4KIOA 4RQKA 5FXQA 1V0OA 5KBRA 3Q9ZA 3FKOA 4IWOA 3UNZA 2VTMA 5TE0A 3VF8A 4OAVB 4S2ZA 4JX7A 3UVRA 1OM1A 1Q8ZA 2R2PA 2QOLA 3EL7A 4P2KA 3LFEA 2BTRA 2GDOA 4ZJJA 4FZAB 3PE2A 4BVUA 3FI2A 5L6OA 4FMQA 1GIIA 2Z2WA 4ZSEA 3UNJA 3R1NA 1YKRA 3IDCA 3QWJA 3MPMA 3OMVA 4C8BA 2BILB 3VJNA 1Q3WA 2B9FA 3V5QA 1AGWA 4V04A 5BPYA 1WZYA 4KABA 3W1FA 1S9IA 4FV3A 4KAOA 1R0EA 5A4EA 2UZTA 4EOJA 4C33A 2JD5A 1ZYLA 2BDWA 1OIQA 4RIOA 5LCJA 3W8QA 4GKIA 5DT3A 3JR1A 1PHKA 3P7CA 1JQHA 1ZMUA 2CKPA 4G2FA 4ENYA 3OWKA 2PVRA 2ZB0A 4FTKA 5KBQA 3QCQA 2C3JA 3KULA 2C6EA 4D5HA 5J7HA 5LVOA 3Q6WA 3NUYA 4RBLA 4QP7A 4IWQA 1QPDA 5GZ8A 1URCA 4DEGA 2XRWA 2WQOA 2PMNX 3CY2A 2CGUA 4R6VA 5HD4A 4BY9E 4WG3A 4AWIA 2YJSA 2J2IB 1OL1A 2PVHA 3DKCA 2YDJA 3BHYA 3P9JA 2XIKA 2V0DA 5CQUA 2RFDA 4OTFA 5KKRB 3RHXA 2ZVAA 4ZIMA 2F2UA 4JR7A 5FRIA 3SLSA 4HVDA 1YWNA 3F3UA 4CYJA 3E8EA 4L43A 2QOOA 3D7ZA 4L01A 2UW5A 3UE4A 5CF5A 4QTAA 1PMVA 2X9EA 3COIA 2DWBA 4JXFA 2Z7LA 4X7QA 1YOMA 4BIEA 1KE6A 3C5IA 3RWPA 3U87A 4BYJA 3EFWA 1E1VA 4RIXB 3EN9A 4D4RA 5EG3A 3AD4A 2OKRA 3WOWA 4DGGA 5FUTA 4HJOA 5CU0A 5HX6A 3F5PA 2OJGA 2JIIA 5B2LA 3KXNA 3DKFA 3PWDA 3C7QA 1YDTE 2P0CA 5F1ZA 2C3IB 1H24A 2XS0A 3I0QA 3K2LA 1OVEA 3ZM4A 3PLSA 2HY0A 3NSZA 3R7GA 2WFYA 3NPCA 4F1MA 1L3RE 3LKMA 3BYMA 3ID6C 3EQGA 3HVCA 4O0VA 4BDCA 2RL5A 4EOQA 4U45A 3IO7A 2YFXA 3BX5A 4JDKA 3NIEA 2BPMA 5I3OA 4G16A 4UYAA 3RK7A 4PTCA 2EU9A 2VTRA 4GS6A 1IAHA 4H05A 3BQCA 4AGUA 2A1AB 4RC4A 4RVKA 3DQXA 2C69A 4ERKA 3NUNA 5BMMA 4BZDA 1UU9A 3D7TA 3Q4UA 3R1QA 4FEUA 4FKOA 3ZUVA 3GP0A 3G90X 1BKXA 3VRZA 3RHKA 2J51A 4RX8A 5DYJA 4DH5A 3FPQA 4XV9A 2PZPA 3MSSA 4H58A 5FQDC 1WBNA 3GXLA 2AUHA 3KXGA 2HWOA 3EQIA 5D9HA 2HOGA 5E8TA 5IMXA 4JAJA 3EFKA 4TYHB 1OIRA 3Q5ZA 4FICA 5FG8A 3BI6A 5BQ0A 3TZ9A 2C5NA 3FHIA 4U0IA 4YTHA 5IDPA 4F6SA 1F3MC 4PL4A 4FKJA 4I5HA 4UXQA 5AP3A 4C4FA 4RFYA 1PKGA 5BYYA 3LJ0A 3PZHA 1JWHA 1QCFA 4XNEA 4O27B 4CCBA 4WIHA 1J7UA 4FL2A 4LV5A 2X7OA 3KVXA 3EHAA 3TNQB 1DM2A 5AUYA 5ITAA 4RIWB 4F0GA 5FTGA 4IMYA 5KMOA 1OI9A 3WE4A 1E9HA 3EOCA 4A7CA 5LWNA 2Z7RA 1K3AA 5AUXA 4LYNA 3DQWA 1KUTA 2XZSA 2ITZA 3AMAA 3V5WA 3VW8A 3HRCA 4TPTA 3JVRA 5CXHA 4FSTA 3MW1A 1LR4A 4MD8E 3EMGA 2Y4IB 1SVHA 1H27A 4PPAA 4YJOA 2YLEA 4O38A 3JUHA 4MD9E 3NMUF 3VS4A 2JITA 3UOLA 3VQHA 3DNDA 5C8MA 4WNOA 2C4GA 4MVFA 1YXXA 1PXNA 4HW7A 5M09A 5LMBA 2G2FA 3ACKA 3LE6A 2Z7QA 4OLIA 2X6EA 3F7ZA 4QOXA 3NR9A 3Q4ZA 3ORXA 1VZOA 2IO6A 2JAMA 4N6YA 4XEYA 2B1PA 3FI4A 1YXUA 3SXRA 4ITIA 2HY81 4UYNA 3L9MA 2YM5A 4FG8A 2ZMDA 2ITUA 4O7LA 4F6WA 4E20A 4IX3A 1JVPP 4TL0A 2X2LA 3IS5A 3KXZA 1JNKA 1H1WA 2YLFA 4PMSA 4ZLYA 3TTIA 2OZAA 3WZDA 2OF2A 3R22A 2JEDA 3O71A 3DJ7A 4E5AX 3E5AA 4YZDA 2G15A 2BRGA 4F7LA 5E8SA 4PMPA 4DEBA 1MUOA 3PP0A 1Z5MA 3DY7A 3O23A 2IZRA 2UW6A 3BU6A 3DDPA 3Q52A 3H0YA 4GT3A 2C6OA 5CVGA 2HZIA 3ZRKA 2IVTA 1Q61A 1Q5KA 3DFCB 4EOLA 3VS3A 4LFIA 3PIYA 2VTOA 3PG3A 5DBXA 1R3CA 3LFCA 3LFAA 3EKNA 3V5LA 3FYJX 4UWCA 4CXAA 2RFSA 3ZYAA 4AXAA 4ACHA 4KB8A 4NW5A 4XS2A 2F49A 4G3DA 4M0YA 2XK8A 2W17A 4KBCA 1OBGA 4GJ3A 4YU2A 2HK5A 5DT4A 3ZUTA 4G3EA 5EHOA 4QP9A 2QKWB 1Z9XA 5FWKK 3PA4A 4BCOA 3PPZA 4M14A 3WF8A 4AG8A 4EH5A 1GIJA 4C36A 1GAGA 1UKHA 3C51A 4FVPA 2W5AA 1PXOA 4IIRA 4UWYA 3VHKA 4N57A 2C5XA 5JFSA 5J79A 1Y6BA 5DMZA 4FTIA 1NA7A 3R8ZA 3THBA 5GZAA 1YQJA 2C1BA 5AV3A 3ZSIA 1KV1A 4CRSA 3FMDA 5E8YA 5IUIA 4FSWA 4ZMEA 3W10A 4FOBA 2PL0A 2O5KA 4EQUA 4F7SA 2RFNA 4GFGA 4DFYA 1NVRA 3KF4A 5DEWA 4X6RA 1PJKA 1H1SA 2WOTA 4FR4A 5HORA 2CMWA 4BDEA 1UWJA 2J0KA 5EQEA 3WBLA 4GU9A 5ETCA 2AYPA 3TG1A 4BDJA 2BFYA 5L6WL 2RG5A 5C9CA 2PVNA 4GVJA 2OW3A 3DA6A 4XV3A 4YO4A 3I81A 4O7NA 4QPAA 5IISA 3KY2A 4G3FA 4N6ZA 1YDRE 4YPSA 3RAHA 3ORIA 1JBPE 3IGOA 1YDSE 4E4NA 4J52A 4NL0A 4IE9A 4GCJA 3RP9A 2QLQA 2Y6OA 2CLXA 2GMXA 3E87A 2J4ZA 5F4NA 2PULA 3P08A 3COKA 3LJ2A 3QZGA 5M57A 4FTUA 3FWQA 3EQBA 1KV2A 5CNNA 3WYYA 3UO6A 4I4FA 1OL5A 2R3HA 1KE5A 4IAKA 4NZWB 3BV3A 2IZSA 4AA5A 5LMKA 1Q8TA 1JPAA 4G31A 4DINA 5GJFA 4UZHA 3ZLSA 5DR6A 3ZBFA 4O86A 3PJ8A 5CENA 3S2PA 1XH6A 3W33A 2A4LA 5C03A 4L52A 3ZLYA 3TKUA 4PPBA 3R8LA 3R28A 4QMWA 4PTGA 2GPHA 2JDRA 2PMLX 1CTPE 3GU7A 4QQJA 4L3LA 1LP4A 4I0SA 5E7RA 5EOBA 4IW0A 1M52A 3ZOSA 2PPQA 1WVWA 2XK6A 5F94A 4AT3A 4JL9A 5LVLA 4MNFA 1HOWA 1YHVA 3R6XA 2GS2A 1ZOEA 5TT7A 2WO6A 3G33A 3ZLXA 5JEBA 5A54A 3CTQA 4LV8A 5HU9A 3HV3A 4K9YA 3C0GA 5JRSA 2I0EA 5L8KA 2ITTA 4ZTHA 2R3FA 3EQPA 2OJIA 4CLJA 3BKBA 3UIBA 5AUVA 2CKEA 1YOJA 4GRBA 4FTTA 3V04A 5JSMA 3D5VA 3QQLA 5JZJA 4O91A 3QC9A 5KKRC 3BPRA 4W9XA 4JDJA 4G6LA 2B9IA 3F3ZA 1WCCA 3OEFX 1FBNA 2BZJA 1M7QA 4EI4A 2X9FA 4CG9A 2XM8A 5FEEA 2WMVA 4BCJA 4RX5A 2YJRA 3ERKA 4Z9LA 4FEVA 1TQPA 4YZCA 4IDTA 4JI9A 2O63A 4GYIA 4OTGA 3RPRA 4AA4A 1ZOHA 3DBDA 4L53A 3DAEA 3DTCA 3CTJA 4Q2AA 3REPA 3FLZA 3K3JA 4P4CA 1Q62A 3MTFA 2CPKE 1IA8A 4XCUA 5CTPA 4F70A 2ERKA 1FVTA 2FA2A 3DJ6A 4C3FA 4R5SA 5IQAA 3SW7A 3NYXA 3P5KA 1ZWSA 4D28A 4GG5A 4ACGA 5ANIA 4E6QA 3FLNC 5FBNC 4DBXA 3NAXA 2J7TA 2O65A 3EN4A 2XIRA 4NW6A 4NK9A 4D9UA 3G6HA 3WYXA 3S3IA 5D10A 4CLIA 3DB8A 3NNVA 4K77A 4IB1A 5AADA 3NYVA 3QTQA 2VTQA 2BKZA 4QQCA 3LVPA 5EW9A 4O0UA 2P4IA 5LMAA 4C3RA 3H0ZA 2ZB1A 4FT0A 5HTCA 2NNWB 2IW6A 4PDYA 1REJA 2ZDTA 5CZIA 3KU2A 2B53A 4NJDA 3IGGA 3CLYA 3P1AA 4FL1A 4QMXA 4WUNA 4YSMA 4CQGA 4BIDA 2BCJA 3QBNA 1P14A 3NW5A 5HICA 4U43A 3QCXA 5M4CA 5ANDA 1OMWA 3ZTXA 4FSQA 1PXLA 4D2WA 4ZTMA 2WMAA 2WU6A 3FXXA 4ID7A 3QCYA 5CAVA 2CGXA 3JY0A 4JX3A 2A27A 2VO7A 2XB7A 4TYJA 3A7JA 3BEAA 4C4JA 4TW9A 2UZNA 1E1XA 2QO9A 1U54A 3FC2A 5ANOA 4XLIA 2J50A 2FSOX 5DNRA 4O7YA 3F5UA 3PVUA 2JAVA 4JIKA 5FXRA 4EONA 5J95A 5HCYA 4IWDA 4J99A 3W2QA 5M56A 4U7ZA 2Y0AA 4FV6A 3BLQA 4FSZA 1OKZA 3SX9A 2QQ7A 4UALA 1BUHA 4JG8A 4R77A 4LMNA 3VUHA 4C37A 3BRBA 1UA2A 4ZS4A 2XH5A 4I6QA 3RPYA 4FTMA 5DT0A 4ZJIA 4BWPA 2F9GA 3RM6A 4KSPA 4M12A 3RPOA 5L2TA 4NFMA 3LFNA 3OEZA 1JKKA 1R78A 3LIJA 3PYYA 3C4EA 4XRJA 5CU2A 2W1DA 4YHJA 5HG8A 3U54A 3CS9A 2HENA 2JDOA 2PE0A 5JK3A 1GOLA 5HE0A 3NLBA 4FTNA 2Y4IC 2XJ0A 3E8DA 2FUMA 2QOBA 4QYHA 4U3ZA 4XRLA 4PP7A 3QD2B 1FVVA 4HVGA 1OIYA 4FSUA 2WMUA 3FSKA 4ALUA 3PA3A 4BTKA 4FVRA 3AD5A 3A8WA 4NM3A 2VGOA 2GCDA 4EQMA 3A61A 4TWNA 5CT7A 2QO7A 5GNKA 3MGYA 4KWPA 3IOKA 3SKCA 4EJNA 3R01A 4AGCA 2FVDA 2YITA 3LW0A 3OVVA 4OTPA 5DFPA 4BR3A 4R1VA 1H4LA 4D0XA 1W8CA 3AT3A 1ZYJA 5TOZA 3W32A 2PZ5A 5CAOA 4GSBA 3FMNA 1MQBA 1JSUA 4I6HA 5K4IA 2WTKB 2R3KA 5AIRA 1OB3A 2GHLA 2UZDA 4D55A 5DOSA 2BZKB 5BYZA 5FD2A 4BI2A 3CD8A 3FBVA 5AR2A 3R9DA 4CNHA 4X2NA 3Q3BA 1KOAA 5EHYA 3IQ7A 5J5SA 3HV6A 3BHHA 3E3BX 4YO6A 5ETAA 1YVJA 3ULZA 4MXZA 2WNTA 3FE3A 3MPTA 4GMYA 4YZBA 5HKMA 3TJDA 2HXLA 3FLSA 2WIHA 5IPJA 3K3IA 3Q9WA 5K4JA 3AOXA 2VNWA 4AT5A 2J90A 3JPVA 5M07A 3RI1A 4L44A 5EI8A 5HIDA 2VX0A 4J96A 3SD0A 1U5QA 3RGFA 4Y8DA 4IDVA 4Q5HA 2VGPA 3WI6A 5BVFA 2I0YA 4EHEA 2Q83A 1RW8A 2QNJA 2QOCA 4MBLA 4QMVA 1B39A 4LGGA 4APPA 3NCGA 1QL6A 5DLSA 2DYLA 4ANQA 3UMXA 2JBOA 5BUIA 2QG5A 5E92A 3TV6A 2PUUA 4M69A 3ZC5A 4WG4A 4EL9A 4L6QA 2GSFA 2PVMA 2WMXA 3PG1A 3PXQA 3PA5A 2R3MA 3VRYA 4TWOA 4U80A 3ZLWA 4QTEA 3LXKA 2OIBA 3BGPA 3LJ1A 5AP1A 1G5SA 3UPXA 3SQQA 1JOWB 4LUDA 4EEVA 5HVJA 4S33A 3LPBA 4J1RA 4FV1A 2XNEA 3KK9A 5I9VA 4WBOA 3UTOA 3TZ8A 2XK3A 3HV5A 3NS9A 2VX3A 3PXFA 5CF4A 3F61A 2ERZE 4GG7A 1YI6A 4TYGA 5EI2A 4CZUA 5A4LA 4BDIA 1H07A 3FY2A 4EWQA 4R3PA 1W98A 2UVXA 5EYCA 2WGJA 3KULB 5HBHA 3UC4A 4EH3A 3TDWA 3AC4A 3C4FA 3CTHA 3DK7A 1SNXA 3A7GA 4M84A 4NU1A 3G0EA 3GB2A 4DN5A 5IA5A 2W7XA 4IAYA 4DEDA 2CGWA 4X0MA 2IZTA 4J97A 3BBTB 2LGCA 2FSMX 4V0GA 2GTMA 3V8WA 3VUDA 4A4LA 3VBYA 3QLFA 3ZXZA 4EK3A 4YLLA 1UKIA 1ZYCA 3BEGA 1H0VA 4NCTA 4RJ4A 5LVNA 2W1IA 2CDZA 1YXSA 3EQHA 4FKQA 4ZY6A 4FTQA 3MB6A 3OXIA 3GC9A 5CVHA 1M14A 1NT2A 3AC5A 5J9LA 1FGKA 4RPVA 3R02A 3A60A 3UBDA 1KE8A 1Q4LA 3MVLA 5ETIA 5AFVA 3FMMA 3F2AA 4D4YA 3MWUA 4QMUA 5CU3A 2QU5A 3DK3A 3R1SA 3FZTA 3HP2A 4NM0A 4D2RA 3B8RA 4DH3A 5FLFA 4EHZA 3R00A 3GCUA 3O7LB 4L9IA 4Z7HA 2FSLX 5IQEA 4HPUE 5GHVA 2E9OA 5CEKA 4QMQA 2RFEA 3BE9A 4HOKA 3UOKA 4FNXA 4F9BA 4C34A 4WBBB 4J7BA 3MIAA 1JKTA 2PE1A 2YM8A 4C4HA 3V01A 2FB8A 4MAOA 4O2PA 4UXLA 3WF6A 4YURA 4IACA 2F2CB 4BCFA 3TNIA 3QF9A 4CVAA 5AUTA 4FKUA 5EI6A 3CY3A 4FBXA 3O8PA 4NTSA 3FV8A 2PZYA 4D4SA 1SVGA 1YXVA 3MDYA 4ASXA 3H30A 3B2TA 4MBIA 4YP8A 2CNQA 3NVKI 3VBQA 1FMOE 3D0EA 5FGKA 3D7TB 4Y5QA 4ZXTA 2ACXA 2WIPA 5CVFA 4IFGA 4KS7A 3HZTA 2QG7A 4GKHA 2Y7JA 2WB8A 3RJCA 1WMKA 1PKDA 2R5TA 4O7WA 4XMOA 1AQ1A 3EZVA 2Y8OA 2OICA 2ZAZA 4FYOA 5AP0A 4PL5A 3BHTA 4A9SA 4MF0A 1I09A 3FLQA 4ZS0A 1YHSA 4JQ7A 1ZYDA 3DU8A 4RX7A 1MRUA 5A3XA 2X7GA 2WTWA 4H3PA 4WUAA 3FUPA 3T3VA 3SHEA 2H34A 2NRYA 3GCVA 4FZDB 2VNYA 5FTOA 4EYJA 3C4XA 2YIXA 4FTRA 2C30A 3C0HA 3OROA 4JNWA 2FH9A 1W83A 5FBOA 2RSVA 3UODA 4YTFA 5EOLA 5K9IA 4D4VA 3LFFA 2X7FA 4O1PA 4J8MA 3FPMA 4ZEGA 4FTLA 1O6YA 3TI1A 4HCVA 2BRBA 3I5NA 3UIXA 2QR8A 4BHZA 4DEEA 3ZO1A 4FODA 4GK4A 2ZV8A 4E4LA 3QQUA 2GQRA 5HBEA 4I6FA 2WTCA 5BMSA 2CNVA 5ANKA 2OXXA 3QZIA 2GNFA 2I0HA 3IW7A 4X3FA 4D5KA 3NRMA 4WSYA 2V62A 4EOSA 4M8TA 4IAFA 4M7IA 4S31A 5H8EA 4AP7A 4XBRA 4FV7A 3HMNA 3QXPA 4K11A 2UUEA 2B55A 1A9UA 3R9HA 4AW2A 2OJ9A 2W05A 3LCDA 2IW8A 3W2PA 4DG3E 4OAUC 1YW2A 5HCZA 4Q5EA 4XUFA 2GFCA 2NRUA 3ZH8A 3FHRA 5CI7A 3QD0A 2J6MA 4JT3A 3KRJA 1OUYA 3LHJA 4RIYA 4AW0A 4B9DA 4BHNA 4O82A 2JGZA 4ZY5A 2IJMA 3MH3A 3ZM9A 4MWHA 5CAPA 2UW4A 2C6MA 4TN6A 5CQWA 3QLGA 1XH8A 3NYOA 4EOPA 2UW0A 3BU3A 2GFSA 2R3LA 2YERA 4YJQA 4F0IA 2YZLA 4DTBA 2CN5A 4RLLA 3V5JA 4X6QC 4RJ5A 2WKMA 4GUEA 5AP6A 1FMKA 2OZAB 3CCNA 2VWYA 4CCUA 4XOZA 4TNDA 3ORMA 5DR9A 4DEHA 3F5GA 5HVKA 4MXXA 3VNTA 5AAFA 3Q60A 3TL8A 5JZNA 4QP3A 4DG0E 4DE4A 2UV2A 4EKLA 2YABA 4I94A 4FV0A 3VS6A 3BWJA 5IEVA 3RAWA 4HZRA 2WTVA 5A4QA 3OBJA 3SG8A 4BBFA 5KMIA 2BAKA 4KIKA 3FXWA 4E73A 3GU5A 4N0SA 4BDDA 2ZM1A 3IDPA 3I5ZA 5CEQA 2ZM4A 3ZDUA 2X2MA 1CM8A 3OBGA 1AD5A 4I4EA 3G2FA 4PY1A 4U9AA 4DTKA 4O96A 4BZOA 1VYZA 1W82A 3A7FA 4H36A 1LPUA 3DT1A 4IQ6A 4IEBA 2BMCA 2WD1A 3VQUA 2Y6MA 3DLSA 4EOIA 3Q2MA 4FEWA 5DIAA 3VO3A 2CCIA 4WRGA 2WU7A 4QTDA 4AQCA 4Q9ZA 2X6DA 3L9PA 4RC2A 4RVMA 2VWUA 5H9BA 5IQCA 3B8QA 1KWPA 4FSYA 1UU7A 1GNGA 4CQEA 1H25A 3KQ7A 3ZUUA 5I9XA 4F99A 4M0ZA 4RFMA 4NM7A 3HV4A 2BHEA 3A99A 2QHMA 4MXAA 4QPSA 1ZAOA 5GJGA 4D2TA 4F65A 5A46A 3L8PA 1VYWA 3ZRMA 5AAEA 2IVVA 4TYIA 2PWLA 4Y95A 4BDBA 2GS6A 1XQZA 3MPAA 4IJPA 3FZPA 4O0TA 2P2IA 5DPVA 3PVGA 3E8NA 1V1KA 3E3PA 3EL8A 3IDBA 4IM3A 3S95A 3AMYA 2W5HA 3E88A 4AW1A 5K0KA 3PSCA 5KZ0A 3OXTA 4O7SA 5IEYA 4MNEA 3KEXA 3O0GA 2P33A 2OF4A 1XWSA 2ONLA 2Q0BA 1PMEA 2GNJA 2OI4X 3OHTA 3QC4A 2UW9A 4BTFA 4AZSA 2WTKC 1F0QA 5EYKA 1ZOGA 5C26A 3AC8A 2YM6A 4LL5A 3RAKA 2BAJA 3LCSA 3PY3A 3U6IA 3DBQA 4CV8A 2OJFE 1LUFA 4M97A 3I7CA 3R8UA 3ZZEA 5AP7A 5LJJA 4JIAA 2GS7A 4NUSA 3ORTA 4LGDA 4DITA 5M4UA 3GFWA 1JKLA 1QMZA 3GBZA 4QNYA 3ZRLA 2WPAA 3EB0A 3RNYA 5AA8A 5GIPE 5CF6A 4PTEA 3FQEA 4EZ5A 4CKRA 3LFBA 3DKGA 3OZ6A 3PIZA 4EOMA 3OCTA 2XYNA 4Z3VA 3HUBA 3E7OA 4J71A 3C50A 3LFSA 4K33A 3U9CA 4BL1A 5KMKA 3O7LD 3MFSA 1OL7A 4NIFA 2R7BA 4M66A 4RRVA 4QD6A 1H0WA 3BCEA 4XG3A 5AAGA 2YIQA 5HLWA 5IQGA 4J53A 4UN0C 3CKWA 4WA9A 5AEPA 4RJ8A 1U59A 2EXEA 3MIYA 4F08A 5H2UA 2QD9A 4A9UA 1RQQA 4F9CA 5M44A 4BBMA 3FMEA 2R7IA 1UNGA 1J7IA 4O0SA 1WBVA 3MY5A 2NO3A 3R8VA 5BVKA 4DGLC 3L8XA 4YC3A 1JSTA 2UZUE 5CI6A 1PYEA 4JDIA 5DHJA 4USEA 4ZZOA 4PUZA 1YHWA 4MK0A 3N4VA 1J3HA 3SG9A 3RVGA 3U9NA 3BQRA 4QMSA 5DR2A 3F7WA 3LLTA 5IQFA 3TWJA 2BRHA 5HZNA 4GVAA 3VS5A 3TKIA 3V8TA 4O22A 1PY5A 4GEOA 3QL8A 2VWVA 4C4EA 2G2HA 4L3JA 4PX6A 3OFMA 3L8VA 4AZWA 4EHVA 3DOGA 3S4QA 3B2WA 2QOKA 4XP3A 3FI3A 5FP6A 2OG8A 3GOKA 4JBOA 4M68A 3UZTA 2GNGA 1KOBA 3FAAA 3MFRA 3D94A 2C6DA 2EXCX 5E8WA 4FC0A 4CD0A 4C4IA 4DEAA 4E26A 2VWZA 2YM3A 3C4ZA 4FUXA 2PU8A 3VN9A 1APME 4IX4A 4ZTLA 3V5PA 4JQ8A 3VIDA 5KHWA 4HGTA 1G3NA 3DXNA 4GW8A 5DWRA 3F66A 2QVSE 2I40A 4I23A 2JBPA 2QURA 4ITHA 3Q9YA 4FSMA 4FIJA 1YI4A 3NYNA 4E4MA 4OTIA 5AR4A 2UW8A 4FSNA 2ZJWA 4PPCA 5CSHA 4FTAA 3JXWA 5IEXA 2XBAA 3ODZX 5E90A 3MH2A 3QALE 4O1OA 1LEWA 5CZHA 4IJ9A 2XKFA 4O0RA 4DFXE 3UZPA 3DK6A 3O8UA 2PYWA 4RMZA 3A7IA 4GL9A 1V0PA 3BHVA 3HL7A 4J98A 3QHWA 1UU8A 1Q41A 4QMPA 5H8GA 3ZDIA 4A06A 4PQNA 4BKYA 2A0CX 2W1CA 3PP1A 3I0OA 4ZP5A 1STCE 2C0IA 4L8MA 3HX4A 4I24A 4TT7A 3ZFMA 2CN8A 1B6CB 3LLAA 4E8AA 4UMTA 4AZFA 3M42A 3F9NA 3ZEWA 1SMHA 2XCHA 4KUJA 4NWMA 5CEIA 3VUKA 2P55A 3WIGA 3TNHA 2XBJA 3OCSA 3CR0A 3EZRA 4BKJA 3MY0A 1FQ1B 2BKKA 1KE9A 5CXZA 2CKQA 4YJPA 2J0IA 5C27A 3V8SA 2EWAA 2VZ6A 3OUNB 2JDSA 5G1XA 4FNZA 3EKKA 1DI9A 5IG1A 3ZO3A 4D58A 4GK3A 4QMOA 4FGRA 2OO8X 1W7HA 3GU6A 4AW5A 4PRJA 5CF8A 3F6XA 3W55A 2WMQA 1IAJA 4ALVA 3AXWA 3DTWA 4BCKA 3H9OA 4ORKA 2HWPA 3UDBA 3QAME 3DGKA 3P23A 4G6OA 4AOJA 2EVAA 2CCHA 4QO9A 3SC1A 3VWAA 2WAJA 3QU0A 3L9LA 2PE2A 5HD7A 4TNBA 2WHBA 2GQGA 3D2KA 3BHUA 3QGWA 2BR1A 4W4XA 4NKSA 4YLKA 2QKRA 3SV0A 3W2RA 5IA0A 4BYIA 4YJUA 3HA6A 4BN1A 5LCKA 2XJ2A 4YJNA 3RZBA 2R3IA 3MESA 3U55A 4RT7A 2JKOA 2PUNA 2YDIA 4B6LA 1YWRA 2HW7A 3KN5A 4RJ6A 3KMUA 4QP2A 2W1GA 4CFVA 4DF3A 5T68A 3P86A 4UY9A 3RINA 4IVAA 2VV9A 5KO1A 5D1JA 5JFVA 4CT1A 3AGMA 4O0XA 5A9UA 5AM7A 4GT4A 4PV0A 3RMFA 5CANA 3CXWA 1QPJA 3L1SA 3Q9XA 2F7ZE 4RVTA 4FG7A 5J7BA 3ALNA 2R3GA 5JGDA 4ZTNA 1ZZ2A 3MFUA 1WBWA 5ANEA 5K5XA 4NYEA 4LM5A 4G5PA 1H1RA 3GU8A 2YA9A 4CFXA 3FKNA 3SOCA 2BHHA 3AG9A 4ACDA 3TUCA 2W0JA 4OR5A 3SRVB 4EH4A 3W2SA 2Y9QA 4NEUA 3R8MA 2CSNA 2BZHB 2O0UA 3MVHA 4AF3A 2JLDA 2WTDA 2O2UA 4RVLA 5HBJA 3H4JA 1MRVA 4KRDA 2PTKA 4PNKA 2X4FA 3R7IA 4BTJA 2PVYA 4CFUA 4WHZA 3TUBA 2CGVA 4NFNA 2ZOQA 1BI7A 2Z02A 3NUSA 5IQDA 2QCSA 5KCVA 5EDRA 5EFQA 3HRFA 4F9WA 4RWKA 2V22A 3OP5A 4ZLZA 3I79A 4F9AA 3I1AA 1XJDA 3BYOA 4QTBA 3SGCA 3I4BA 2KULA 3OOMA 2QU6A 3C9WA 3FSFA 4ONAA 4A07A 4BBEA 5I3RA 1L8TA 4M69B 2X8EA 1EH4A 4PNIA 3HNGA 3TT0A 5M51A 4YLJA 2IN6A 4L00A 4I0RA 3CKXA 5HG5A 4EC9A 5AV4A 3KGAA 2IG7A 1RE8A 3E63A 4EH6A 3GQLA 3FI8A 3TZMA 4WSQA 4EWHA 2B54A 2W96B 3HMIA 3HA8A 3OWJA 4JRNA 5B0XA 4I6BA 2W4OA 3POZA 1VR2A 2JDTA 2CHLA 3PXKA 2QLUA 4MD7E 3I6UA 3HUCA 4D1ZA 3LAUA 3RZFA 3DV3A 1TQIA 4BCNA 5IA4A 3P79A 4YMJA 3I60A 1WVXA 1S9JA 3D15A 3II5A 4E6DA 3LZBA 3WZJA 3V6SA 4BI1A 4FKLA 3PVWA 1DAWA 3DAKA 2QI8A 4YBJA 2RKUA 4IVDA 4AGDA 5BVWA 1WAKA 4DCEA 5G6VA 4ERWA 2PVFA 3VHEA 3QX2A 4FIFA 5HOAA 3CE3A 2WTJA 4EK6A 4FV9A 3FZRA 3GVUA 5KMJA 3PJCA 2ETMA 5FM3A 4ANOA 4B8LA 3GT8A 2VWBA 5M55A 3KA0A 5BUJA 2PMOX 5D41A 5IUGA 2R3PA 2VTPA 3QKLA 2ETRA 4A9YA 3COMA 4LL0A 5AR5A 3OTUA 1XH7A 3PJ3A 4KSQA 4YGAA 1QPEA 3E64A 3QYZA 4PWNA 3ATSA 3HEGA 5BUEA 5L8LA 2BIYA 5LXMA 4L45A 2VWWA 5IH5A 4UMUA 2OXDA 5LMKC 4ZTQA 4R5YA 4UEUA 2UZLA 3ZU7A 3HKOA 4G5JA 4FKRA 5DEYA 3UYSA 4ZJVA 2XIXA 3QUDA 3ROCA 4CRLA 3G6GA 4O7VA 3AD6A 3QRTA 4OBQA 4F09A 1OBDA 1URWA 4TY1A 3DKOA 4YC6A 3UQCA 4F64A 2J0JA 5A14A 4E1ZA 2J0MB 3ITZA 5TO8A 3VUMA 4JBVA 3HGKA 1PW2A 2UW3A 4XG4A 4DEIA 2HIWA 4YPDA 2EXMA 3FL5A 1IRKA 4HZSA 3CIKA 4BDAA 4O7ZA 4R3CA 1Q8UA 3RNIA 2O64A 5JQ8A 5AWMA 3FLYA 3V5TA 3QZFA 3SXSA 4D1XA 5K0XA 4FV2A 1NVQA 5AV2A 3VBXA 4AUAA 1FINA 2P3GX 1OL6A 3F3WA 3VUIA 2VWIA 5JH6A 2R64A 2YAAA 3ORKA 1BL7A 3F82A 3Q04A 4FX3A 5E1SA 4BCPA 4L68A 4MWIA 4X2GA 3ZFYA 3BGZA 4Y46A 3KREA 1LEZA 4RA5A 4IZYA 1P5EA 2GNHA 3M2WA 5CU6A 2UVZA 3BWFA 4UB7A 2QOQA 1V0BA 2W1HA 4QPMA 5EM7A 4EOKA 5EM8A 2VO6A 2WMBA 4DFNA 4XG2A 4NT4A 1M7NA 3PY0A 5J5TA 3PTGA 4Z55A 5GJDA 1IA9A 5IQBA 3VBWA 3OT8A 3ZONA 2IVUA 3U6JA 3BU5A 1G8AA 3ODYX 3CGOA 3DZQA 3R8PA 4EBWA 4QP4A 3NVMB 2ZDUA 1ZY5A 2OIQA 2VAGA 4O21A 1PRYA 3ET7A 2VD5A 5H3QA 2XKCA 1ZZLA 4JJRA 5HX8A 2ITOA 2XYUA 4PL3A 4RZVA 1CSNA 5J8IA 2XNMA 4GK2A 3TJCA 4C38A 1XBAA 3LFDA 4L67A 4X3FB 2PVLA 4UBAA 3MVMA 2OGVA 4AN2A 5M4FA 4FIGA 2QODA 5CYIA 1PXIA 2Z60A 3VAPA 3KXXA 3NNXA 3EJ1A 4H3QA 5CEOA 4E3CA 4G34A 1CKIA 4FZ6A 3A2CA 4ALWA 3PXRA 4BRXA 2GQSA 3UG2A 2ZV7A 3NW6A 4ZSJA 2C6LA 4D2SA 1UWHA 4ZSLA 4LI5A 2WELA 4QMLA 2UVYA 4BTMA 4FZ7A 3KC3A 3QTRA 3WZKA 4O7TA 3TNWA 4YC8A 4DHFA 1OKYA 4IB5A 4LOPA 4OTDA 5I9WA 1IR3A 4XOYA 4IHPA 4FKGA 2EUFB 3SDJA 3G0FA 4WKQA 4CMUA 2YM4A 3U8WA 3MYGA 2WQNA 5AP4A 4DA5A 4EH7A 1H08A 5C1QB 5DRBA 4C7TA 4MQ2A 4DFBA 3QCSA 2W1ZA 3KB7A 4CFMA 4AAAA 3Q53A 3GNIB 2YM7A 4MTAA 4R1YA 2VTJA 2JDVA 1R39A 2VTAA 3TXOA 1J1BA 1Y6AA 4FZFB 4U41A 3KRRA 2WMTA 4K8AA 5CU4A 4C3PA 1DI8A 4O6LA 1ZRZA 3ELJA 3QHRA 4O0WA 4DFUA 2QHNA 5KHXA 1H26A 3H10A 2PZIA 5L2WA 4FF8A 5FXSA 2XIZA 3KCKA 3QQKA 5J1WA 4G9CA 3UGCA 5TKDA 3ROYA 4OBOA 4ANSA 4K6ZA 4Q9SA 3L9NA 4G3GA 4X2JA 3R9NA 3IW6A 4GUBA 5HO6A 4HVHA 4YUQA 4S32A 3BZ3A 4W8EA 4C0TA 4C62A 3EYGA 3GOPA 2HZ0A 5CSXA 3DAJA 4MH7A 4AGWA 4BGGA 1GZOA 3GU4A 3UYTA 4YTCA 4IVBA 5BVDA 5HHWA 5E8ZA 2ZV2A 1TKIA 1XBBA 1PXKA 4JAIA 4PF4A 3ETAA 4PMTA 5KMNA 4FT5A 3QKMA 3U51A 3R21A 5AM6A 4EJ7A 3MI9A 4IX6A 4HGEA 2JFMA 4RWJA 3TTJA 3W18A 1ZLTA 4HVIA 5HTBA 3BLRA 3T8OA 5KZIA 3UVQA 3PJ1A 4X21A 2V55A 5IA2A 4ZMFA 4MNEB 4YHFA 1OIUA 3QUPA 1OKVA 2X0GA 3RBWA 5T6KA 1Q8WA 4U44A 3WF9A 3DXPA 4HYIA 1Q8YA 1PMUA 3RPVA 4M67A 4EQCA 2ITYA 5FEQA 3QD4A 2CNUA 4HYSA 3PSBA 4P5ZA 4BDFA 3Q5IA 2QC6A 4IFCA 3TV7A 2BTSA 4RWIA 3ORNA 4Y85A 4CTCA 2OU7A 1IEPA 4F9YA 3LMIA 1SZMA 3E92A 4L7SA 2C47A 5HEZA 4MF1A 3EN5A 3FMJA 3LM5A 3OW4A 4IC8A 5D11A 3GEQA 3PWYA 4IM2A 4CFFA 3BLHA 3QTIA 4H39A 2YACA 1P4OA 2C3KA 4EZ7A 3G15A 2P2HA 5L2QA 2OLCA 3JY9A 4NIFB 4FKSA 2HW6A 2YISA 2OWBA 2JC6A 3FYKX 4IB0A 1QPCA 5JT2A 4NSTA 3R7OA 5JMSA 4FT7A 1WBSA 4TKSA 3VULA 3RK9A 4O7RA 2XEZA 5CLPA 2C5VA 3KXMA 5EDQA 5I0BA 3VC4A 5A4CA 2J5FA 4XP2A 3U4WA 4R7BA 1BL6A 4WNKA 4LRKA 2I7QA 3QRUA 4QP8A 5EYMA 2ETKA 5DA3A 5EM6A 3KRLA 2RG6A 1UNHA 4AN3A 2PMIA 3IKAA 3O17A 4OW8A 3LCKA 1OPLA 1UVRA 1PYXA 2HCKA 3Q4CA 4D0WA 2R9SA 4TYEA 5GINE 2ITVA 3CD3A 3RK5A 1H1PA 5ACKA 4YHTA 4XJ0A 4KA3A 4OGRA 1RDQE 3L8SA 3UMWA 4CKIA 5BYLA 2IPXA 5LVPA 3TN8A 2F7EE 3NDMA 5F9EA 1U5RA 2B0QA 2UZOA 5AIKA 4FOCA 2PVJA 1OITA 4CTBA 4XX9A 4DH7A 5HNIX 5LQFA 5CALA 5AMNA 3CC6A 2R3QA 4MQ1A 3KF7A 3IW4A 3EWHA 3GCSA 2XA4A 4I0TA 4B0GA 4W8DA 3IOPA 5BX0A 2C5YA 3T9TA 3H9FA 3P78A 4CFNA 4U81A 3GFEA 3UC3A 3UP2A 2RGPA 4HGSA 4JR3A 3ZXTA 3POOA 4CMOA 2X1NA 1PXMA 4FI1A 1PMNA 4HGLA 4EOOA 3I6WA 2VTSA 4IAIA 4PMMA 5L2SA 5BNJA 3NGAA 4Z16A 1XBCA 5E4HA 4I20A 4FT3A 4QYYA 5CSWA 4YNOA 4EK8A 5HNBA 1BX6A 5L6PA 3LQ5A 2VTLA 4YZ9A 3FQHA 3NUXA 3QYWA 4U40A 3WZEA 4P5QA 1YWVA 4A9TA 3AGLA 3LMGA 3UOHA 2VWXA 3VBTA 4CYIA 3GGFA 4E93A 1J91A 4JQEA 4QMYA 4L46A 3NZ0A 2OBJA 2SRCA 3EN6A 3FY0A 5CSVA 4BKZA 4IC7A 4BCMA 3GC7A 4BZNA 2FSTX 2HZ4A 4CT2A 4S30A 4XHKB 2YHVA 5C8NA 2X2KA 4A9RA 2F4JA 4WRSA 1Y57A 2R3RA 2FYSA 4CMTA 3WE8A 4DFZE 2I1MA 4EBVA 1OKWA 4IH8A 3MH0A 4BCQA 3LCOA 4BFMA 1ZYSA 2G2IA 3D5XA 5C4LA 4HCUA 3FZSA 5HVYA 4OTWA 3G5DA 3N51A 3P7BA 3PPKA 4G17A 4BF2A 4YTIA 2NP8A 3FDNA 1MRYA 1OECA 2OJJA 3PY1A 4G9RA 4S34A 3RALA 3Q96A 4O83A 3M11A 2BDFA 3S1HA 5AX3A 3TACA 2OSCA 4X2KA 3UPZA 2W06A 2XNOA 4MX9A 4CV9A 3QXOA 3MVJA 3QTSA 5KMMA 1ZMVA 3R7YA 1G8SA 2QONA 2PK9A 1GIHA 4C57A 2PUPA 4EK4A 3FEGA 4Y73A 5DG5A 2Q0NA 4RA4A 4EHGA 5HIEA 3N4TA 3ANQA 4XG9A 3KN6A 3MN3A 4R3RA 4G6NA 4NJ3A 3R9OA 2ZM3A 5I4NA 2WEIA 3FC1X 2JKMA 3HECA 4BCGA 4WOVA 5AP5A 2BDJA 3K5UA 5JGAA 4AN9A 1B38A 2PSQA 4QQ5A 2IWIA 4U79A 3T3UA 4DGNA 4X3FC 3QRKA 3DDQA 3HAVA 4OTHA 4X2FA 2UZVA 2J9MA 4J8NA 5TR6A 5M4IA 2WTIA 3BE2A 3HMMA 2W1EA 1GZNA 5D7AA 3DLZA 4MHAA 4IAAA 2JIVA 5EDPA 3W2OA 4XYFA 2VTNA 3C0IA 4I92A 4MXCA 4B4LA 3C4CA 2YIRA 3FLWA 4ARKA 3LXNA 3U4UA 2JIUA 5TF9A 4NTTA 5FM2A 1XKKA 4CGAA 5CT0A 5HG7A 3VVHA 4H1JA 3QX4A 3HYHA 1H28A 3CQWA 4JG6A 4YBKA 4DLJA 4HCTA 3IONA 1ND4A 5AUZA 4PP9A 5H8BA 4AFJA 3PDTA 5CEPA 5C8KA 2YIYA 5A4TA 3UNKA 3QQGA 3SAYA 2I0VA 4I3ZA 4MBJA 2EB3A 5DGZA 4R78A 3QTUA 3OWPA 4MYGA 1FGIA 3CJGA 4IZ5A 3PUPA 2W5BA 2GNIA 4FGBA 4FKVA 3MJ1A 4KBKA 4CEGA 1R0PA 3QD3A 2C6KA 3VS2A 3NX8A 4AX8A 2JFLA 4GYGA 5KE0A 4RLKA 1TVOA 2XP2A 4BDHA 1BYGA 5K3YA 4F1OA 3ANRA 3QTZA 2VUWA 3LXPA 4CFWA 2V7OA 2YWPA 3FMHA 3QRIA 4JRVA 5AJQA 1Z57A 2G01A 3IW5A 2QOHA 4FIIA 4IAZA 4I5PA 2C68A 4V05A 3WILA 3D14A 4BIBA 4D1SA 5CASA 2XNGA 3DS6A 5HTIA 3OT3A 2EB2A 4C02A 3ENMA 3PXZA 3PRFA 3R7VA 1XR1A 5EW8A 3KRXA 3DFAA 3V51A 3W8LA 3QTWA 4F4PA 3GUBA 3CPBA 1PF8A 3PZEA 3HAMA 1JLUE 1WBPA 3COHA 4FIHA 4R7HA 4RFZA 4D9TA 3EFJA 4NH1A 4DAWA 5M06A 2XKEA 3FMKA 1TQMA 4LRMA 1MP8A 3VS0A 3MTLA 2BZIB 2FGIA 4H3BA 3QA8A 4KRCA 1XH9A 3ZEPA 3EN7A 1OZ1A 4FG9A 3H9RA 4CZYB 3KMMA 1GZ8A 3LQ8A 2OK1A 3IPHA 4QP6A 3UQGA 4JOAA 5C4KA 4B99A 3CEKA 1ZARA 3IK3A 3NNUA 4N70A 3QUEA 3MFTA 2XM9A 2ONLC 3RTPA 1GY3A 2VX1A 1IG1A 2WEVA 2WMSA 4FT9A 4USDA 1XH5A 3VUGA 3DXQA 3QQHA 5DI1A 1FVRA 5B2KA 4IX5A 3OTVA 5B7VA 3KVWA 1VJYA 1H8FA 3H3CA 5JFWA 3CBLA 4YJSA 3C4WA 2ITWA 4XH6A 2PUIA 2GHGA 5I9UA 3HRBA 2IVSA 4MEDA 3VW6A 4WNPA 3MY1A 5IF1A 2XNBA 4MXOA 5JN2A 5KNJA 5HE2A 4ASDA 2AC5A 3NUPA 4RWLA 3UO5A 1PXJA 3D2IA 4NKAA 4WNMA 3RCDA 5EKNA 4I1ZA 3P0MA 4PDPA 4DFLA 4ZY4A 3OXZA 3CSVA 3QQFA 4IXPA 5D7VA 5ANJA 2X8IA 3SW4A 4M3QA 2WXVA 4WT6A 2XMYA 4O84A 4B8MA 2ZMCA 3ATTA 1FPUA 4A4XA 4LOQA 2B9JA 3KXHA 4BDGA 2AC3A 5E8XA 4AZVA 4IVCA 4C2WA 1U54B 4I5CA 3JVSA 5HO7A 5IQIA 4JLCA 3UZRA 1NW1A 2BIKB 2GHMA 3R83A 4YJRA 5HCXA 4C59A 4YR8A 4FEQA 1OPKA 2HXQA 3DJ5A 3TEIA 3QWKA 2ZYBA 4DCAA 1O6KA 1O9UA 2UZBA 4G3CA 5E91A 4YZNA 3ENHA 3TV4A 4JS8A 4FK6A 3DB6A 4TTHB 4AOIA 3MA3A 2O8YA 2C0OA 3PVBA 4QRCA 3E8CA 3E7VA 5EQPA 3EH9A 4RQVA 5L3AA 5IDNA 5CAUA 5T3QA 3QKKA 3TDVA 3K5VA 4YNEA 4I41A 2B7AA 2XEYA 3CQUA 3ORLA 3OUKA 3FL4A 4X3JA 4Z7GA 3PE1A 3RAIA 5JRQA 5JGBA 5KMLA 4GIIA 3S0OA 4AS0A 4ITJA 5HE3A 3QFVA 1Q3DA 5BVEA 5IH4A 4KS8A 3NCZA 4RIXA 2QOIA 3AMBA 1WFCA 1I44A 2J0LA 3W16A 4ZTSA 3FXZA 5GZ9A 4IZ7A 3OF0A 3KRWA 4YZMA 4KBAA 2KTYA 2C6IA 3JS2A 3HDNA 4K18A 5CEMA 3SA0A 2V7AA 3NUUA 5JFXA 1ZY4A 2XVDA 4TZRA 4FE2A 3OG7A 5AP2A 1CMKE 1UV5A 3NIZA 4WO5A 2BFXA 4XP0A 2X8DA 5AV1A 4JVGA 5AR7A 2UW7A 4WG5A 5HIBA 3UVPA 5HLNA 2YDKA 4P90A 2OIDA 3D83A 1T45A 4JDHA 4E4XA 5IZFA 4BI0A 1NXKA 3VF9A 4CG8A 3V3VA 3AT2A 3EYHA 2XKDA 3DBFA 3F5XA 1M2RA 3WF5A 3ZSGA 4GIHA 4UMRA 3EQRA 2YCRA 5HGIA 4R7IA 3ZFXA 1RJBA 3OS3A 3F2RA 5ANGA 3DBCA 3O51A 3GC8A 3W2CA 3S00A 4DH8A 4IWPA 1XH4A 3ZHPC 3EFLA 3MV5A 4F7NA 4I93A 4USFA 3AC3A 2YCFA 3VUTA 4LUEA 5CS6A 2WMWA 3UP7A 4I21A 2OFVA 4TYHA 2CJMA 4QYEA 2DS1A 3T9IA 2LAVA 3GCQA 4QMTA 3UIMA 4O0YA 1JSVA 2F7XE 1SNUA 3CJFA 4FKIA 4EUUA 4M15A 4ZAUA 3EQDA 5AUWA 3OWLA 4PDSA 3LCTA 4ZZNA 5IA1A 3TKHA 2GTNA 4TXCA 1Y91A 4FEXA 4GFMA 5ETFA 3GC0A 4ANLA 4NM5A 3OY1A 3WF7A 2Z7SA 4U6RA 1P2AA 5EK7A 3LMHA 4RIWA 3P4KA 2REIA 3M1SA 3OCBA 5E9EA 3NEWA 4UV0A 3R63A 4OUCA 1NY3A 1Y8GA 4R8QA 3BV2A 4Y83A 4PDOA 2W9ZB 2BRMA 3KK8A 4L42A 4ZZMA 2JKQA 4APCA 4QP1A 2BALA 2C1AA 4AOTA 4D2PA 3ZZWA 4UZDA 3CPCA 3LXLA 2WZJA 4V0GB 4A4OA 4AA0A 5BVNA 4RGJA 3PJ2A 1U46A 4U97A 2OH0E 4OTRA 1H01A 4HYHA 1WBOA 3N9XA 3F69A 4DTAA 5FDXA 5LVMA 3NAYA 3ZSHA 3BBWA 5BVOA 3R71A 2DUVA 4GJ2A 4QT1A 2BUJA 4U42A 3IW8A 5F95A 4QMNA 4ANBA 3TM0A 4LQMA 3CGFA 4ZTRA 3TNPC 4HNIA 4BC6A 5IA3A 4IM0A 3NW7A 3R9RA 1SM2A 5FP5A 4EH9A 4UX9A 1REKA 1KSWA 1YOLA 4H1MA 4KKGA 1CDKA 5HNGA 3ULIA 2H96A 2YN8A 4EK5A 2E9VA 2OH4A 2UZEA 5DVRA 4KIPA 4LOOA 4RC3A 5I9YA 4FKWA 2PY3A 3ALOA 1M2PA 3ORPA 4U5JA 4ZSGA 2G1TA 3GCPA 5I9ZA 3A8XA 3DPKA 4UWBA 5HO8A 3MS9A 3F3TA 3R0TA 4FYNA 5HQ0A 4FIEA 4AFEA 3WARA 4FKTA 5EM5A 1CKJA 3C1XA 3RM7A 2W4JA 2YAKA 1GZKA 5D12A 2ITXA 4E6AA 1H1QA 3Q32A 1BMKA 4EORA 3ZO2A 5A6NA 4L3PA 2W9FB 2XK9A 5HESA 2YEXA 4CKJA 3O8TA 4DC2A 1J1CA 2ITQA 1GJOA 3KKVA 2XJ1A 3DBEA 1J7LA 4BDKA 3C13A 4QTCA 3HMOA 3PPJA 4BICA 3VS1A 5FEDA 3ACJA 3R2YA 4M13A 4O2ZA 3ZBXA 4IADA 4I22A 3ZCLA 2C5OA 2VN9A 3EQCA 3VBVA 4FNYA 5E8VA 3RPSA 5L8JA 2WQEA 3LOKA 3FMLA 3Q6UA 3R30A 3O50A 3QTXA 1PXPA 3Q4TA 2R3JA 4J95A 4LG4A 2VO0A 3N4UA 4XBUA 4BWXA 2H9VA 1M17A 2UZWE 3FJQE 3PFQA 3OC1A 4O6EA 4K0YA 4LGHA 2ITPA 2RF9A 1W84A 1KE7A 5AV0A 1A48A 4RSSA 4GU6A 5DRDA 2VTHA 4ANMA 4KD1A 4EC8A 4ZLOA 5HU3A 5CY3A 3EIDA 4W4VA 2E9PA 1DAYA 3FKLA 3VJOA 2X39A 4U8ZA 3UIUA 4DGOA 4QMMA 4EH8A 5IQHA 4EH2A 4DBNA 3G9NA 4FV4A 5I5ZA 4C2VA 3SXFA 2A2AA 4QNAA 2ITNA 4XG8A 5J1VA 3BELA 4RJ7A 2I6LA 1BI8A 2YZAA 4BGHA 5EKOA 5M53A 4FVQA 4QQTA 5K5NA 4OBPA 4OTQA 5CAQA 4ASZA 4KINA 4D2VA 1ERKA 1X8BA 3TZ7A 5IMEA 3UO4A 1OPJA 4AE6A 1XO2B 3AC2A 4RIYB 4DT9A 4B7TA 4K2RA 1F5QA 1Q99A 4AACA 3NUAA 5C01A 4W4WA 4RZWA 4DLIA 2E9NA 5DN3A 1ZXEA 3SRVA 4AZEA 1JKSA 4C58A 2YWVA 3HP5A 4IBMA 1FOTA 3C5UA 1O6LA 3A62A 2E2BA 1T46A 3KL8A 3PIXA 3F88A 4GT5A 5LARA 5B2MA 3TUDA 1YRPA 4XG7A 2YCQA 4C35A 2CLQA 5AX9A 3TIYA 3FZOA 4FSRA 3TCPA 4ASEA 4HNFA 3GQIA 1WVYA 4RX9A 4C61A 3G9LX 5J9YA 4YSJA 2RIOA 4XV2A 2VTTA 4BCIA 2VO3A 3CQEA 2XNPA 3R2BA 4W4YA 5IUHA 2R3NA 2DQ7X 4U3YA 5CX9A 3KMWA 3OOGA 4KIKB 2VRXA 3BYVA 2XUUA 1ATPE 3ORZA 3R1YA 2Y4PA 5DH3A 4BGQA 3U6HA 1VEBA 2BROA 4LRJA 4CSVA 5F20A 3NNWA 1Q97A 4O81A 2WQBA 2XIYA 1Y8YA 5CSPA 4ENXA 2ZV9A 3MJ2A 4XV1A 4QYGA 5AA9A 3QRJA 4ZK5A 1P4FA 2YIWA 3K54A 2XK7A 5HI2A 3A4OX 4QMZA 1OL2A 5EW3A 4UMPA 2XF0A 4MCVA 5EHLA 1JAMA 3F2NA 2CKOA 4FUYA 2QR7A 4EZ3A 3PLAE 1H00A 5J87A 1NVSA 4V01A 4OT6A 5E1EA 4KIQA 3E62A 2XCKA 2HZNA 1OUKA 4TWCA 5FTQA 1MQ4A 4F1TA 4FKPA 4FV8A 4TRLA 2PZRA 5M08A 4FTCA 3Q2JA 2PVKA 5ICPA 1HCKA 4E5BA 5EH0A 4IZAA 5IH6A 2J5EA 1ZMWA 1XHAA 2A19B 3O2MA 2WMRA 4AE9A 4EYMA 3MA6A 2XNNA 5HE1A 2O3PA 3O96A 3BYUA 2YCSA 3MH1A 4FTJA 4KNBA 4GV1A 5FDPA 5IU2A 4F0FA 4DG2E 2X81A 3HLLA 3SVVA 2B52A 2GNLA 4ZOGA 2WOUA 1UNLA 5ACBC 3SOAA 2BAQA 3LQ3A 4E6CA 4BWKA 5DE2A 5JQ5A 4DYMA 3KFAA 4YJVA 3AQVA 3KCFA 5AR8A
chains in the Genus database with same CATH superfamily
2B9HA 2R3OA 2W4KA 2C0TA 4E7WA 3AT4A 4P7EA 4FA2A 3HMPA 2OFUA 4XG6A 1DS5A 5GIOE 4FRFA 3TIZA 3DNEA 2QOFA 4BCHA 4KKEA 4QYFA 5J9ZA 1U4DA 3JYAA 3RKBA 1W0XC 3PRIA 4IB3A 2HAKA 3OCGA 4GFOA 2G9XA 2FO0A 1R1WA 3UDZA 1UU3A 3GI3A 4JG7A 3OD6X 5LWMA 2R4BA 3DZOA 3HDMA 3OW3A 4JBQA 3R73A 4OT5A 2C3LA 3R7UA 3WZUA 5AUUA 5EQYA 3OY3A 3RWQA 3MBLA 4O4CA 2X4ZA 3NWWA 3FZ1A 3QZHA 3P7AA 2OXYA 4BJJA 3WIKA 4HPTE 4K1BA 3UJGA 2VTIA 3D4QA 3D5UA 3GENA 2BRNA 3BGQA 1IASA 4GH2A 5CWZA 4BB4A 4F7JA 4HVSA 3UQFA 2V5QA 3MB7A 3ZC6A 3CP9A 5HG9A 3ZS5A 3I7BA 3BIZA 5AR3A 3VS7A 1BLXA 4CZTA 3D9VA 2F57A 4YJTA 3QGYA 2HELA 3F3VA 4LMUA 3LM0A 4ZSAA 4WD5A 2BVAA 3E93A 5HLPA 4AU8A 2W99B 3V6RA 2NPQA 4I5MA 1CKPA 5LOHA 2GU8A 3ZMMA 3BYSA 4KKHA 1OGUA 3LFQA 4G1WA 4XLVA 3G51A 4FV5A 1YI3A 4Y5HA 2AQXA 2Z8CA 3PXYA 1SVEA 3FQSA 4HYUA 4DT8A 4W9WA 2IW9A 4RJ3A 4IANA 4F6UA 3AC1A 4EKKA 2XRUA 3PSDA 2E9UA 2W1FA 3QA0A 3QQJA 4NCTC 1K9AA 4TWPA 1WBTA 4AZTA 5JKGA 1SYKA 4FK3A 4FNWA 5CNOA 4Y72A 3R04A 3IECA 3DCVA 4II5A 5KUPA 4C4GA 5IKWA 2VU3A 4UMQA 5L2IA 3EQFA 1M2QA 4AAYA 2XK4A 5E8UA 3RCJA 2QO2A 3ZO4A 1K2PA 4ACMA 4DGMA 4FTOA 4RG0A 2JKKA 1Q24A 4N4SA 3UOJA 5EYDA 1HCLA 4E5WA 4LV7A 4F63A 2OZOA 3D5WA 4EUTA 2H8HA 3IG7A 3UG1A 3A4PA 4ACCA 2R0UA 5KX8A 2H6DA 2IZUA 5L4QA 4AT4A 4DH1A 4L7FA 2WQMA 1YXTA 2B4SB 3R7EA 4FL3A 1A06A 2ESMA 2HYYA 3A7HA 3HV7A 4JBPA 4ANNA 4MKCA 5A6OA 2C6TA 2R0IA 4MXYA 2PHKA 4KIOA 4RQKA 5FXQA 1V0OA 5KBRA 3Q9ZA 4AQKA 3FKOA 4IWOA 3UNZA 2VTMA 5TE0A 3VF8A 4OAVB 4S2ZA 4JX7A 3UVRA 1OM1A 1Q8ZA 3P5JC 2R2PA 2QOLA 3EL7A 4P2KA 3LFEA 2BTRA 2GDOA 4ZJJA 4FZAB 3PE2A 4BVUA 3FI2A 5L6OA 4FMQA 1GIIA 2Z2WA 4ZSEA 3W0OA 3UNJA 3R1NA 1YKRA 3IDCA 3QWJA 3MPMA 3OMVA 4C8BA 2BILB 3VJNA 1Q3WA 4I6LA 2B9FA 3V5QA 1AGWA 4V04A 5BPYA 1WZYA 4KABA 3W1FA 1S9IA 4FV3A 4KAOA 1R0EA 5A4EA 2UZTA 4EOJA 4C33A 2JD5A 1ZYLA 2BDWA 1OIQA 4RIOA 5LCJA 3W8QA 4GKIA 5DT3A 3JR1A 1PHKA 3P7CA 1JQHA 1ZMUA 2CKPA 4G2FA 4ENYA 3OWKA 2PVRA 2ZB0A 4FTKA 5KBQA 3QCQA 2C3JA 3KULA 2C6EA 4D5HA 5J7HA 5LVOA 3Q6WA 3NUYA 4RBLA 4QP7A 4IWQA 1QPDA 3TMOA 3W0QA 5GZ8A 1URCA 4DEGA 2XRWA 2WQOA 2PMNX 3CY2A 2CGUA 4R6VA 5HD4A 4BY9E 4WG3A 4AWIA 2YJSA 2J2IB 1OL1A 2PVHA 3DKCA 2YDJA 3BHYA 3P9JA 2XIKA 2V0DA 5CQUA 2RFDA 4OTFA 5KKRB 3RHXA 2ZVAA 4ZIMA 2F2UA 5BV3A 4JR7A 5FRIA 3SLSA 4HVDA 1YWNA 3AKKA 1G8JA 3F3UA 4CYJA 3E8EA 4L43A 2QOOA 3D7ZA 4L01A 2UW5A 3UE4A 5CF5A 4QTAA 1PMVA 2X9EA 3COIA 2DWBA 4JXFA 2Z7LA 4X7QA 1YOMA 4BIEA 1KE6A 3C5IA 3RWPA 3U87A 4BYJA 3EFWA 1E1VA 4RIXB 3EN9A 4D4RA 5EG3A 3AD4A 2OKRA 3WOWA 4DGGA 5FUTA 4HJOA 5CU0A 5HX6A 3F5PA 2OJGA 2JIIA 5B2LA 3KXNA 3DKFA 3PWDA 3C7QA 1YDTE 2P0CA 5F1ZA 2C3IB 1H24A 2XS0A 3I0QA 3K2LA 1OVEA 3ZM4A 3PLSA 2HY0A 3NSZA 3R7GA 2WFYA 3NPCA 4F1MA 1L3RE 3LKMA 3BYMA 3ID6C 3EQGA 3HVCA 4O0VA 4BDCA 2RL5A 4EOQA 4U45A 3IO7A 2YFXA 3BX5A 4JDKA 3NIEA 2BPMA 5I3OA 4G16A 4UYAA 3RK7A 4PTCA 2EU9A 2VTRA 4GS6A 1IAHA 3W0RA 4H05A 3BQCA 4AGUA 2A1AB 3W0PA 4RC4A 4RVKA 3DQXA 2C69A 4ERKA 3NUNA 5BMMA 4BZDA 1UU9A 3D7TA 3Q4UA 3R1QA 4FEUA 3UDTA 4FKOA 3ZUVA 3GP0A 3G90X 1BKXA 3VRZA 3RHKA 2J51A 4RX8A 5DYJA 4DH5A 3FPQA 4XV9A 2PZPA 3MSSA 4H58A 5FQDC 1WBNA 3GXLA 2AUHA 3KXGA 2HWOA 3EQIA 5D9HA 2HOGA 5E8TA 5IMXA 4JAJA 3EFKA 4TYHB 1OIRA 3Q5ZA 4FICA 5FG8A 3BI6A 5BQ0A 3TZ9A 2C5NA 3FHIA 4U0IA 4YTHA 5IDPA 4F6SA 1F3MC 4PL4A 4FKJA 4I5HA 4UXQA 5AP3A 4C4FA 4RFYA 1PKGA 5BYYA 3LJ0A 3PZHA 1JWHA 1QCFA 4XNEA 4O27B 4CCBA 4WIHA 1J7UA 4FL2A 4LV5A 3BL7A 2X7OA 3KVXA 3EHAA 3TNQB 1DM2A 5AUYA 5ITAA 4RIWB 4F0GA 5FTGA 4IMYA 5KMOA 1OI9A 3WE4A 1E9HA 3EOCA 4A7CA 5LWNA 2Z7RA 1K3AA 5AUXA 4LYNA 3DQWA 1KUTA 2XZSA 2ITZA 3AMAA 3V5WA 3VW8A 3HRCA 4TPTA 3JVRA 5CXHA 4FSTA 3MW1A 1LR4A 4MD8E 3EMGA 2Y4IB 1SVHA 1H27A 4PPAA 4YJOA 2YLEA 4O38A 3JUHA 4MD9E 3NMUF 3VS4A 2JITA 3UOLA 3VQHA 3DNDA 5C8MA 4WNOA 2C4GA 4MVFA 1YXXA 1PXNA 4HW7A 5M09A 5LMBA 2G2FA 3ACKA 3LE6A 2Z7QA 4OLIA 2X6EA 3F7ZA 4QOXA 3NR9A 3Q4ZA 3ORXA 1VZOA 2IO6A 2JAMA 4N6YA 4XEYA 2B1PA 3FI4A 1YXUA 3SXRA 4ITIA 2HY81 4UYNA 3L9MA 2YM5A 4FG8A 2ZMDA 2ITUA 4O7LA 4F6WA 4E20A 4IX3A 1JVPP 4TL0A 2X2LA 3IS5A 3KXZA 1JNKA 1H1WA 2YLFA 4PMSA 4ZLYA 3TTIA 2OZAA 3WZDA 2OF2A 3R22A 2JEDA 3O71A 3DJ7A 4E5AX 3E5AA 4YZDA 2G15A 2BRGA 4F7LA 5E8SA 4PMPA 4DEBA 1MUOA 3PP0A 1Z5MA 3DY7A 3O23A 2IZRA 2UW6A 3BU6A 3DDPA 3Q52A 3H0YA 4GT3A 2C6OA 5CVGA 2HZIA 3ZRKA 3AKJA 2IVTA 1Q61A 1Q5KA 3DFCB 4EOLA 3VS3A 4LFIA 3PIYA 2VTOA 3PG3A 5DBXA 1R3CA 3LFCA 3LFAA 3EKNA 3V5LA 3FYJX 4UWCA 4CXAA 2RFSA 3ZYAA 4AXAA 4ACHA 4KB8A 4NW5A 4XS2A 3PUFC 2F49A 4G3DA 4M0YA 2XK8A 2W17A 4KBCA 1OBGA 4GJ3A 4YU2A 2HK5A 5DT4A 3ZUTA 4G3EA 5EHOA 4QP9A 2QKWB 1Z9XA 5FWKK 3PA4A 4BCOA 3PPZA 4M14A 3WF8A 4AG8A 4EH5A 1GIJA 4C36A 1GAGA 1UKHA 3C51A 4FVPA 2W5AA 1PXOA 4IIRA 4UWYA 3VHKA 4N57A 2C5XA 4QEBA 5JFSA 5J79A 1Y6BA 5DMZA 4FTIA 1NA7A 3R8ZA 3THBA 5GZAA 1YQJA 2C1BA 5AV3A 3ZSIA 1KV1A 4CRSA 3FMDA 5E8YA 5IUIA 4FSWA 4ZMEA 3W10A 4FOBA 2PL0A 2O5KA 4EQUA 4F7SA 2RFNA 4GFGA 4DFYA 1NVRA 3KF4A 5DEWA 4X6RA 1PJKA 1H1SA 2WOTA 4FR4A 5HORA 2CMWA 4BDEA 1UWJA 2J0KA 3W0SA 5EQEA 3WBLA 4GU9A 5ETCA 2AYPA 3TG1A 4BDJA 2BFYA 5L6WL 2RG5A 5C9CA 2PVNA 4GVJA 2OW3A 3DA6A 4XV3A 4YO4A 3I81A 1XMMA 4O7NA 4QPAA 5IISA 3KY2A 4G3FA 4N6ZA 1YDRE 4YPSA 3RAHA 3ORIA 1JBPE 3IGOA 1YDSE 4E4NA 4J52A 4NL0A 4IE9A 4GCJA 3RP9A 2QLQA 2Y6OA 2CLXA 2GMXA 3E87A 2J4ZA 5F4NA 2PULA 3P08A 3COKA 3LJ2A 3QZGA 5M57A 4FTUA 3FWQA 3EQBA 1KV2A 5CNNA 3WYYA 3UO6A 3PFYA 4I4FA 1OL5A 2R3HA 1KE5A 4IAKA 4NZWB 3BV3A 2IZSA 4AA5A 5LMKA 1Q8TA 1JPAA 4G31A 4DINA 5GJFA 4UZHA 3ZLSA 5DR6A 3ZBFA 4O86A 3PJ8A 5CENA 3S2PA 1XH6A 3W33A 2A4LA 5C03A 4L52A 3TYKA 3ZLYA 3TKUA 4PPBA 3R8LA 3R28A 4QMWA 4PTGA 2GPHA 2JDRA 2PMLX 1CTPE 3GU7A 4QQJA 4L3LA 1LP4A 4I0SA 5E7RA 5EOBA 4IW0A 1M52A 3ZOSA 2PPQA 1WVWA 2XK6A 5F94A 4AT3A 4JL9A 5LVLA 4MNFA 1HOWA 1YHVA 3R6XA 2GS2A 1ZOEA 5TT7A 2WO6A 3G33A 3ZLXA 5JEBA 4AXEA 5A54A 3CTQA 4LV8A 5HU9A 3HV3A 4DHIB 4K9YA 3C0GA 5JRSA 2I0EA 5L8KA 2ITTA 4ZTHA 2R3FA 3EQPA 2OJIA 4CLJA 3BKBA 3UIBA 1W2CA 5AUVA 2CKEA 1YOJA 4GRBA 4FTTA 3V04A 5JSMA 3D5VA 3QQLA 5JZJA 4O91A 3QC9A 5KKRC 3BPRA 4W9XA 4JDJA 3KIOC 4G6LA 2B9IA 3F3ZA 1WCCA 3OEFX 1FBNA 4AXFA 2BZJA 1M7QA 4EI4A 2X9FA 4CG9A 2XM8A 5FEEA 2WMVA 4BCJA 4RX5A 2YJRA 3ERKA 4Z9LA 4FEVA 1TQPA 4YZCA 4IDTA 4JI9A 2O63A 4GYIA 4OTGA 3RPRA 4AA4A 1ZOHA 3DBDA 4L53A 3DAEA 3DTCA 3CTJA 4Q2AA 3REPA 3FLZA 3K3JA 4P4CA 1Q62A 3MTFA 4DHJA 2CPKE 1IA8A 4XCUA 5CTPA 4F70A 2ERKA 1FVTA 2FA2A 3DJ6A 4C3FA 4R5SA 5IQAA 3SW7A 3NYXA 3P5KA 1ZWSA 4D28A 4GG5A 4ACGA 5ANIA 4E6QA 3FLNC 5FBNC 4DBXA 3NAXA 2J7TA 2O65A 3EN4A 2XIRA 4NW6A 4NK9A 4D9UA 3G6HA 3WYXA 3S3IA 5D10A 4CLIA 3DB8A 3NNVA 4K77A 4IB1A 5AADA 3NYVA 3QTQA 2VTQA 2BKZA 4QQCA 3LVPA 5EW9A 4O0UA 2P4IA 5LMAA 4C3RA 3H0ZA 2ZB1A 4FT0A 5HTCA 2NNWB 2IW6A 4PDYA 1REJA 2ZDTA 5CZIA 3KU2A 2B53A 4NJDA 3IGGA 3CLYA 3P1AA 4FL1A 4QMXA 4WUNA 4YSMA 4CQGA 4BIDA 2BCJA 3QBNA 1P14A 3NW5A 5HICA 4U43A 3QCXA 5M4CA 5ANDA 1OMWA 3ZTXA 4FSQA 1PXLA 4D2WA 4ZTMA 2WMAA 2WU6A 3FXXA 4ID7A 3QCYA 5CAVA 2CGXA 3JY0A 4JX3A 2A27A 2VO7A 2XB7A 4TYJA 3A7JA 3BEAA 4C4JA 4TW9A 2UZNA 1E1XA 2QO9A 1U54A 3FC2A 5ANOA 4XLIA 2J50A 4BJJB 2FSOX 5DNRA 4O7YA 3F5UA 3PVUA 2JAVA 4JIKA 5FXRA 4EONA 3NFFB 5J95A 5HCYA 4IWDA 4J99A 3W2QA 5M56A 4U7ZA 2Y0AA 4FV6A 3BLQA 4FSZA 1OKZA 3SX9A 2QQ7A 4UALA 1BUHA 4JG8A 4R77A 4LMNA 3VUHA 4C37A 3BRBA 1UA2A 4ZS4A 2XH5A 4I6QA 3RPYA 4FTMA 5DT0A 4ZJIA 4BWPA 2F9GA 3RM6A 4KSPA 4M12A 3RPOA 5L2TA 4NFMA 4QDVA 3LFNA 3OEZA 1JKKA 1R78A 3LIJA 3PYYA 3C4EA 4XRJA 5CU2A 2W1DA 4YHJA 5HG8A 3U54A 3CS9A 2HENA 2JDOA 2PE0A 5JK3A 1GOLA 5HE0A 3NLBA 4FTNA 2Y4IC 2XJ0A 3E8DA 2FUMA 2QOBA 4QYHA 4U3ZA 4XRLA 4PP7A 1ST0A 3QD2B 1FVVA 4HVGA 1OIYA 4FSUA 2WMUA 3FSKA 4ALUA 3PA3A 4BTKA 4FVRA 3AD5A 3A8WA 4NM3A 2VGOA 2GCDA 4EQMA 3A61A 4TWNA 5CT7A 2QO7A 5GNKA 3MGYA 4KWPA 3IOKA 3SKCA 4EJNA 3R01A 4AGCA 2FVDA 2YITA 3LW0A 3OVVA 4OTPA 5DFPA 4BR3A 4R1VA 1H4LA 4D0XA 1W8CA 3AT3A 1ZYJA 5TOZA 3W32A 2PZ5A 5CAOA 4GSBA 3FMNA 1ST4A 1MQBA 1JSUA 4I6HA 5K4IA 2WTKB 2R3KA 5AIRA 1OB3A 2GHLA 2UZDA 4D55A 5DOSA 2BZKB 5BYZA 5FD2A 4BI2A 3CD8A 3FBVA 5AR2A 3R9DA 4CNHA 4X2NA 3Q3BA 1KOAA 5EHYA 2XANA 3IQ7A 5J5SA 3HV6A 3BHHA 3E3BX 4YO6A 5ETAA 1YVJA 3ULZA 4MXZA 2WNTA 3FE3A 3MPTA 4GMYA 4YZBA 5HKMA 3TJDA 2HXLA 3FLSA 2WIHA 5IPJA 3K3IA 3Q9WA 5K4JA 3AOXA 2VNWA 4AT5A 2J90A 3JPVA 5M07A 3RI1A 4L44A 5EI8A 5HIDA 2VX0A 4J96A 3SD0A 1U5QA 3RGFA 4Y8DA 4IDVA 4Q5HA 2VGPA 3WI6A 5BVFA 2I0YA 4EHEA 2Q83A 1RW8A 2QNJA 2QOCA 4MBLA 4QMVA 1B39A 4LGGA 4APPA 3NCGA 1QL6A 5DLSA 2DYLA 4ANQA 3UMXA 2JBOA 5BUIA 2QG5A 5E92A 3TV6A 2PUUA 4M69A 3ZC5A 4WG4A 4EL9A 4L6QA 2GSFA 2PVMA 2WMXA 3PG1A 3PXQA 3PA5A 2R3MA 3VRYA 4TWOA 4U80A 3ZLWA 4QTEA 3LXKA 2OIBA 3BGPA 3LJ1A 5AP1A 1G5SA 3UPXA 4DDGA 3SQQA 1JOWB 4LUDA 4EEVA 5HVJA 4S33A 3LPBA 4J1RA 4FV1A 2XNEA 3KK9A 5I9VA 4WBOA 3UTOA 3TZ8A 2XK3A 3HV5A 3NS9A 2VX3A 3PXFA 5CF4A 3F61A 2ERZE 4GG7A 1YI6A 4TYGA 5EI2A 4CZUA 5A4LA 4BDIA 1H07A 3FY2A 4EWQA 4R3PA 1W98A 2UVXA 5EYCA 2WGJA 3KULB 5HBHA 3UC4A 4EH3A 3TDWA 3AC4A 3C4FA 3CTHA 3DK7A 1SNXA 3A7GA 4M84A 4NU1A 3G0EA 3GB2A 4DN5A 5IA5A 2W7XA 4IAYA 4DEDA 4F78A 2CGWA 4X0MA 2IZTA 4J97A 3BBTB 2LGCA 2FSMX 4V0GA 2GTMA 3V8WA 3VUDA 4A4LA 3VBYA 3QLFA 3ZXZA 4EK3A 4YLLA 1UKIA 1ZYCA 3BEGA 1H0VA 4NCTA 4RJ4A 5LVNA 2W1IA 2CDZA 1YXSA 3EQHA 4FKQA 4ZY6A 4FTQA 3MB6A 3OXIA 3GC9A 5CVHA 1M14A 1NT2A 3AC5A 5J9LA 1FGKA 4RPVA 3R02A 3A60A 3UBDA 1KE8A 1Q4LA 3MVLA 5ETIA 5AFVA 3FMMA 3F2AA 4D4YA 3MWUA 4QMUA 5CU3A 2QU5A 3DK3A 3R1SA 3FZTA 3HP2A 4NM0A 4D2RA 3B8RA 4DH3A 5FLFA 4EHZA 3R00A 3GCUA 3O7LB 4L9IA 4Z7HA 2FSLX 5IQEA 4HPUE 5GHVA 2E9OA 5CEKA 4QMQA 2RFEA 3BE9A 4HOKA 3UOKA 4FNXA 4F9BA 4C34A 4WBBB 1OGYA 4J7BA 3MIAA 1JKTA 2PE1A 2YM8A 4C4HA 3V01A 2FB8A 4MAOA 4O2PA 4UXLA 3WF6A 4YURA 4IACA 2F2CB 4BCFA 3TNIA 3QF9A 4CVAA 5AUTA 4FKUA 5EI6A 3CY3A 4FBXA 3O8PA 4NTSA 3FV8A 2PZYA 4D4SA 1SVGA 1YXVA 3MDYA 4ASXA 3H30A 3B2TA 4MBIA 4YP8A 2CNQA 3NVKI 3VBQA 1FMOE 3D0EA 5FGKA 3D7TB 4Y5QA 4ZXTA 2ACXA 2WIPA 5CVFA 4IFGA 4KS7A 3HZTA 2QG7A 4GKHA 2Y7JA 2WB8A 3RJCA 1WMKA 1PKDA 2R5TA 4O7WA 4XMOA 1AQ1A 3EZVA 2Y8OA 2OICA 2ZAZA 4FYOA 5AP0A 4PL5A 3BHTA 4A9SA 4MF0A 1I09A 3FLQA 4ZS0A 1YHSA 4JQ7A 1ZYDA 3DU8A 4RX7A 1MRUA 5A3XA 2X7GA 2WTWA 4H3PA 4WUAA 3FUPA 3T3VA 3SHEA 2H34A 2NRYA 3GCVA 4FZDB 2VNYA 5FTOA 4EYJA 3C4XA 2YIXA 1VLRA 4FTRA 2C30A 3C0HA 3OROA 4JNWA 2FH9A 1W83A 5FBOA 2RSVA 3UODA 4YTFA 5EOLA 5K9IA 4D4VA 3LFFA 2X7FA 4O1PA 4J8MA 3FPMA 4ZEGA 4FTLA 1O6YA 3TI1A 4HCVA 2BRBA 3I5NA 3UIXA 2QR8A 4BHZA 4DEEA 3ZO1A 4FODA 4GK4A 2ZV8A 4E4LA 3QQUA 2GQRA 5HBEA 4I6FA 2WTCA 5BMSA 2CNVA 5ANKA 2OXXA 3QZIA 2GNFA 2I0HA 3IW7A 4X3FA 4D5KA 3NRMA 4WSYA 2V62A 2X0OA 4M8TA 4EOSA 4IAFA 4M7IA 4S31A 5H8EA 4AP7A 4XBRA 4FV7A 3HMNA 3QXPA 4K11A 2UUEA 2B55A 1A9UA 3R9HA 4AW2A 2OJ9A 2W05A 3LCDA 2IW8A 3W2PA 4DG3E 4OAUC 1YW2A 5HCZA 4Q5EA 4XUFA 2GFCA 2NRUA 3ZH8A 3FHRA 5CI7A 3QD0A 2J6MA 4JT3A 3KRJA 1OUYA 3LHJA 4RIYA 4AW0A 4B9DA 4BHNA 4O82A 2JGZA 4ZY5A 2IJMA 3MH3A 3ZM9A 4MWHA 5CAPA 2UW4A 2C6MA 4TN6A 5CQWA 3QLGA 1XH8A 3NYOA 4EOPA 2UW0A 3BU3A 2GFSA 2R3LA 2YERA 4YJQA 4F0IA 2YZLA 4DTBA 2CN5A 4RLLA 3V5JA 4X6QC 4RJ5A 2WKMA 4GUEA 5AP6A 1FMKA 2OZAB 3CCNA 2VWYA 4CCUA 4XOZA 4TNDA 3ORMA 5DR9A 4DEHA 3F5GA 5HVKA 4MXXA 3VNTA 5AAFA 3Q60A 3TL8A 5JZNA 4QP3A 4DG0E 4DE4A 2UV2A 4EKLA 4LDTA 2YABA 4I94A 4FV0A 3VS6A 3BWJA 5IEVA 3RAWA 4HZRA 2WTVA 5A4QA 3OBJA 3SG8A 4BBFA 5KMIA 2BAKA 4KIKA 3FXWA 4E73A 3GU5A 4N0SA 4BDDA 2ZM1A 3IDPA 3I5ZA 5CEQA 2ZM4A 3ZDUA 2X2MA 1CM8A 3OBGA 1AD5A 4I4EA 3G2FA 4PY1A 4U9AA 4DTKA 4O96A 4BZOA 1VYZA 1W82A 3A7FA 4H36A 1LPUA 3DT1A 4IQ6A 4IEBA 2BMCA 2WD1A 3VQUA 2Y6MA 3DLSA 4EOIA 3Q2MA 4FEWA 5DIAA 3VO3A 2CCIA 4WRGA 2WU7A 4QTDA 4AQCA 4Q9ZA 2X6DA 3L9PA 4RC2A 4RVMA 2VWUA 5H9BA 5IQCA 3B8QA 1KWPA 4FSYA 1UU7A 1GNGA 4CQEA 1H25A 3KQ7A 1XMLA 3ZUUA 5I9XA 4F99A 4M0ZA 4RFMA 2ZFYA 4NM7A 3HV4A 2BHEA 3A99A 2QHMA 4MXAA 4QPSA 1ZAOA 5GJGA 4D2TA 4F65A 5A46A 3L8PA 1VYWA 3ZRMA 5AAEA 2IVVA 4TYIA 2PWLA 4Y95A 4BDBA 2GS6A 1XQZA 3MPAA 4IJPA 3FZPA 4O0TA 2P2IA 5DPVA 3PVGA 3E8NA 1V1KA 3E3PA 3EL8A 3IDBA 4IM3A 3S95A 3AMYA 2W5HA 3E88A 4AW1A 5K0KA 3PSCA 5KZ0A 3OXTA 4O7SA 5IEYA 4MNEA 3KEXA 3O0GA 2P33A 2OF4A 1XWSA 2ONLA 2Q0BA 1PMEA 2GNJA 2OI4X 3OHTA 3QC4A 2UW9A 4BTFA 4AZSA 2WTKC 1F0QA 5EYKA 1ZOGA 5C26A 3AC8A 2YM6A 4LL5A 3RAKA 2BAJA 3LCSA 3PY3A 3U6IA 3DBQA 4CV8A 2OJFE 1LUFA 4M97A 3I7CA 3R8UA 3ZZEA 5AP7A 5LJJA 4JIAA 2GS7A 4NUSA 3ORTA 4LGDA 4DITA 5M4UA 3GFWA 1JKLA 1QMZA 3GBZA 4QNYA 3ZRLA 2WPAA 3EB0A 3RNYA 5AA8A 5GIPE 5CF6A 4PTEA 3FQEA 4EZ5A 4CKRA 3LFBA 3DKGA 3OZ6A 3PIZA 4EOMA 3OCTA 2XYNA 4Z3VA 3HUBA 3E7OA 4J71A 3C50A 3LFSA 4K33A 3U9CA 4BL1A 1TFFA 5KMKA 3O7LD 3MFSA 1OL7A 4NIFA 2R7BA 4M66A 4RRVA 4QD6A 1H0WA 3BCEA 4XG3A 5AAGA 2YIQA 5HLWA 5IQGA 4J53A 4UN0C 3CKWA 4WA9A 5AEPA 2XALA 4RJ8A 1U59A 2EXEA 3MIYA 4F08A 5H2UA 2QD9A 4A9UA 1RQQA 4F9CA 5M44A 4BBMA 3O5AA 3FMEA 2R7IA 1UNGA 1J7IA 4O0SA 1WBVA 3MY5A 2NO3A 3R8VA 5BVKA 4DGLC 3L8XA 4YC3A 1JSTA 2UZUE 5CI6A 1PYEA 4JDIA 5DHJA 4USEA 4ZZOA 4PUZA 1YHWA 4MK0A 3N4VA 1J3HA 3SG9A 3RVGA 3U9NA 3BQRA 4QMSA 5DR2A 3F7WA 3LLTA 5IQFA 3TWJA 2BRHA 5HZNA 4GVAA 3VS5A 3TKIA 3V8TA 4O22A 1PY5A 4GEOA 3QL8A 2VWVA 4C4EA 2G2HA 4L3JA 4PX6A 3OFMA 3L8VA 4AZWA 4EHVA 3DOGA 3S4QA 3B2WA 2QOKA 4XP3A 3FI3A 5FP6A 2OG8A 3GOKA 4JBOA 4M68A 3UZTA 2GNGA 1KOBA 3FAAA 3MFRA 3D94A 2C6DA 2EXCX 5E8WA 4FC0A 4CD0A 4C4IA 4DEAA 4E26A 2VWZA 2YM3A 3C4ZA 4FUXA 2PU8A 3VN9A 1APME 4IX4A 4ZTLA 3V5PA 4JQ8A 3VIDA 5KHWA 4HGTA 1G3NA 3DXNA 4GW8A 5DWRA 3F66A 2QVSE 2I40A 4I23A 2JBPA 2QURA 4ITHA 3Q9YA 4FSMA 4FIJA 1YI4A 3NYNA 4E4MA 4OTIA 5AR4A 2UW8A 4FSNA 2ZJWA 4PPCA 5CSHA 4FTAA 3JXWA 5IEXA 2XBAA 3ODZX 5E90A 3MH2A 3QALE 4O1OA 1LEWA 5CZHA 4IJ9A 2XKFA 4O0RA 4DFXE 3UZPA 3DK6A 3O8UA 2PYWA 4RMZA 3A7IA 4GL9A 1V0PA 3BHVA 3HL7A 4J98A 3QHWA 1UU8A 1Q41A 4QMPA 5H8GA 3ZDIA 4A06A 4PQNA 4BKYA 2A0CX 2W1CA 3PP1A 3I0OA 4ZP5A 1STCE 2C0IA 4L8MA 3HX4A 4I24A 4TT7A 3ZFMA 2CN8A 1B6CB