3BU6A

Crystal structure of the insulin receptor kinase in complex with irs2 krlb phosphopeptide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
294
Chain Sequence
DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords insulin receptor subunit beta
publication title Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 294
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bu6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bu6A01
4S32A 4O0YA 3F3UA 4CKRA 5T68A 2J4ZA 2WHBA 3S3IA 3W8QA 4ANMA 4O7LA 4MF1A 1W83A 1XWSA 3P0MA 2XIZA 2XRWA 4IX5A 4LGDA 3ZDUA 4I23A 5I9WA 1WBVA 5EW9A 4OBPA 4F1MA 2ONLC 2WB8A 3A2CA 5DPVA 1WBOA 1YRPA 3QQHA 3A7FA 5I4NA 1M2RA 3FMHA 2KTYA 1IR3A 3HL7A 3NSZA 4CFVA 4YBJA 5M06A 5HTCA 3FAAA 3E64A 2WD1A 3CE3A 4LRJA 4HPTE 3T9IA 4BCGA 1YXVA 4HYIA 3JUHA 4L53A 4CZTA 5IMXA 5ICPA 3C9WA 3EQIA 4GW8A 3IDPA 4C61A 4UMUA 4E4NA 4ALUA 1XH4A 2OIQA 2VTQA 4CKIA 3SV0A 3R7GA 3V51A 5CXZA 3BRBA 2VNWA 2JLDA 3QRJA 5CQUA 3NUNA 4OLIA 4ZTSA 4BYIA 4APCA 4DBXA 3ATSA 2W1GA 4FTUA 1PW2A 1UU3A 3IS5A 3OT3A 2HY0A 3D7TB 3HGKA 1FVVA 3IDBA 4QPSA 2XIYA 5HESA 4BDIA 4XG3A 4FEUA 1PRYA 1QPJA 5FP6A 1OI9A 1U59A 2WMXA 3Q9WA 4ARKA 2UZBA 1VJYA 3QGYA 2PE2A 3ZO3A 4FZAB 4FSMA 4AZWA 3RAKA 3EQHA 4R3RA 4O0WA 4U81A 4YHTA 4TL0A 1YXTA 5BVOA 1XKKA 2E9OA 3KGAA 3EOCA 1PYXA 4GT4A 2WZJA 3C0HA 4FTCA 5AR7A 2XYNA 5AR3A 3VS5A 3VQHA 2Z02A 3R63A 2J2IB 3VBVA 4L6QA 3CD3A 4W4YA 4ZP5A 3F5XA 2GNJA 3UODA 4QP2A 3BE9A 4CRLA 1M2QA 4CKJA 3S95A 3LFFA 2OJ9A 4ZZNA 4GT5A 3DPKA 1JWHA 3DCVA 3ZONA 2RF9A 5C8KA 4EOSA 5FG8A 3NIZA 3CSVA 5FTGA 3IGGA 2GMXA 5J9ZA 2WMAA 4QO9A 3OUKA 2PZ5A 3Q04A 3MBLA 1R3CA 2C6MA 2X7FA 4XRJA 4RQVA 2PVKA 5EM7A 1UU8A 4O2ZA 2J0IA 5HCZA 2E9NA 4U43A 4RMZA 3DDQA 1NVRA 5IU2A 3BHUA 3C4EA 3F7ZA 2W05A 4LOPA 5D9HA 4G34A 4MBJA 1BKXA 4JXFA 4BDJA 5K5XA 3LMIA 5JGDA 1B6CB 3FC2A 3ZTXA 3O50A 4PP9A 1IEPA 2PVFA 3KN5A 4DT9A 2JEDA 3D9VA 3FMEA 3OW3A 4FL1A 4R8QA 4EBVA 5I9YA 2AUHA 4F6WA 5J7BA 4R7IA 3RALA 3FL4A 4FKOA 4RX9A 4OGRA 5EM5A 5IF1A 2V7OA 5F94A 4U40A 1F0QA 5GJGA 2IWIA 4XX9A 5FQDC 5AJQA 2C4GA 3N9XA 3TNPC 4A9TA 4XJ0A 4V0GB 3WF9A 4IVBA 4EBWA 5L8LA 1WMKA 2VWYA 4D2VA 4QMMA 5DT3A 3U8WA 1J7LA 3R7IA 5HLNA 2GNFA 4FUYA 4D4SA 3FC1X 4ZSJA 2UZLA 4CCBA 3R1SA 3NGAA 4C3RA 1U54A 3UVQA 1JOWB 3TUBA 3MVHA 1PXJA 5D1JA 5DFPA 3ZRMA 4AA4A 4YZNA 4ANOA 5LQFA 4V05A 3QUEA 2IVTA 3V3VA 4KSQA 3PWYA 2EVAA 3TZ9A 2P4IA 2J0MB 4CFNA 1W82A 2HIWA 3CEKA 1ZYCA 2B52A 2WMUA 4FT5A 4IH8A 1O9UA 1VZOA 2J0KA 2XM8A 4JIKA 1XH5A 3MTLA 2BROA 2CPKE 3QTWA 4ZY5A 3ZRLA 3OEZA 4NWMA 2BILB 4RGJA 5BVEA 4C3PA 2QI8A 4RC2A 5JQ8A 3OFMA 4ITJA 4O0UA 1CMKE 3FXWA 4JR7A 1SMHA 2Z7SA 4JIAA 4BHNA 4DCAA 2H6DA 4LOQA 4QMXA 2XH5A 5CNOA 2GNHA 2OJGA 1HCLA 2EWAA 4FF8A 4WUAA 2XBAA 3HECA 2O5KA 1DS5A 2UZNA 4NW6A 3RVGA 3WZDA 3ZM4A 4EH6A 3MDYA 2B0QA 3TKUA 3GU7A 2XZSA 2VWUA 3LM5A 4J96A 2ITYA 4B8MA 4UX9A 5JRSA 3PJ2A 2NPQA 1B39A 2GU8A 2IW9A 3DGKA 3FXZA 1JKKA 5IG1A 4KIOA 4WO5A 3R8LA 4FV4A 1E9HA 4CD0A 3R9OA 3CTHA 4OTFA 4CRSA 1Z9XA 4X0MA 5DI1A 4XOZA 2G9XA 1YDRE 1E1XA 4EYMA 4DN5A 3ZEPA 3ALOA 3LFAA 1FQ1B 1U46A 3R73A 4KBCA 3QKMA 4A4OA 4X21A 4RVKA 4YC6A 5A3XA 2NO3A 3GCPA 5IH4A 4GT3A 4C36A 3EFJA 4IM3A 4U41A 5HNIX 5TR6A 3VO3A 4B6LA 4A07A 4X2NA 3Q4ZA 3CPCA 4A9UA 4BCHA 2I7QA 4GG7A 2IVSA 3V5PA 3R9RA 3EQFA 2Y7JA 3I0QA 3I1AA 4YC8A 5E8SA 1CTPE 2CCHA 4AF3A 4U5JA 4D2PA 2CGVA 4E8AA 5EQYA 5E8UA 3GEQA 3ZYAA 3NNUA 4QMYA 2X0GA 2HWPA 1Q5KA 2OSCA 4L67A 1PMNA 5CSVA 3TCPA 4EZ7A 2IW8A 4IAFA 4NM3A 4ERKA 3EB0A 3PYYA 4W4WA 3DBQA 5FDPA 3Q32A 4KS7A 4BICA 2QONA 3AT3A 4YZCA 5J87A 4YLJA 2JIIA 3OC1A 4MNFA 4WBOA 4D4VA 3NAXA 3FQHA 4OTIA 5CT7A 4F65A 4AS0A 1OIYA 3G90X 1H01A 3DXQA 3PJ8A 3W2CA 1NW1A 3ZO2A 2XNPA 1TQMA 2OF4A 2CCIA 3MJ2A 2ITPA 3D7TA 1FVRA 4EHVA 2EB3A 3QD4A 2QHMA 4AT3A 4UMTA 3Q6UA 1WBTA 4RWKA 5A14A 2XIXA 4E5BA 3AMYA 2LGCA 3Q9YA 4ASDA 1H1SA 4G6NA 2C6EA 3DT1A 4I5HA 5ANGA 1ZZ2A 4W4XA 3VS3A 3DJ7A 4IZ7A 3IOKA 2XK7A 2VTLA 4FL3A 4NEUA 3R7VA 2ZMCA 1YOJA 4E3CA 1XBBA 3A4OX 2Y0AA 1XR1A 2VUWA 4IFGA 2CHLA 3EMGA 2CJMA 2GTNA 4MBIA 4DHFA 2HYYA 4JG7A 4OUCA 5CYIA 2C0IA 2F49A 3QTRA 4ZLZA 2WTWA 2Q0NA 3ZFYA 2WTDA 3E87A 5AA8A 3FMJA 1PXKA 3CGOA 3RK5A 4FSTA 4XYFA 4G9RA 5IUHA 4L3LA 3JVSA 1W8CA 3KN6A 4GEOA 4C62A 4F0IA 2YWVA 3PZEA 5DRDA 5J8IA 4NJDA 3QQLA 2UVXA 3GCSA 4TXCA 4EORA 2YM7A 5T3QA 4C37A 4QP9A 3RZBA 4BIEA 4DGMA 1KOAA 2W1DA 3GCVA 4AGWA 4BL1A 3QQFA 4IHPA 4O7YA 4C34A 4OAUC 4YJRA 3I79A 3PPZA 3C4FA 4YR8A 3B8QA 4ID7A 2QCSA 3QLFA 1JPAA 3Q2JA 5AR2A 3OXZA 4AU8A 4DTBA 3HZTA 4EWHA 3NW7A 3I5ZA 4WHZA 1U5QA 2BDFA 2X2LA 2BUJA 4H39A 4YTHA 4CFUA 1NY3A 2XNEA 3FZSA 5D12A 3NRMA 2ZM4A 1H8FA 5EW3A 4F6UA 2RL5A 5EK7A 1OKVA 3LE6A 3BWFA 3IW6A 4IQ6A 1GZNA 3CY3A 4NM0A 4U44A 3CBLA 2RG6A 4YJSA 4MH7A 5FXQA 1GIIA 4XG2A 3C51A 1YHWA 3EQGA 3LJ2A 5M4CA 1R78A 3Q60A 3CCNA 4GVJA 4M66A 4EL9A 3QGWA 4QMNA 3UGCA 4BF2A 4FTKA 4CYIA 2FVDA 4JG6A 5HG8A 2GNLA 4AQCA 4V0GA 5HCXA 2PVNA 3P9JA 3OMVA 3R8PA 5CXHA 2WXVA 3K3IA 4E4LA 4H3PA 4E26A 2X7GA 5EQEA 2YDIA 4NFMA 4FV6A 4A9YA 2CGUA 2BZJA 5HE3A 4XEYA 3JPVA 3T8OA 4QMSA 3FMDA 4CEGA 5M4IA 3EN9A 1UU9A 3F3TA 4FTOA 2W4JA 3ERKA 4X6RA 5LCKA 5M44A 3LW0A 5EDQA 2C5NA 2OI4X 4C58A 2CN8A 2JKMA 3G5DA 3RNYA 5CAOA 5M08A 1I09A 4D2WA 4HVHA 4CG8A 5J95A 3NVMB 5C03A 4BIDA 2BRMA 4W9WA 2ZM3A 4LRKA 3RINA 3VIDA 5HORA 4YSMA 2UZDA 1H0VA 4QP3A 4XLVA 3VUKA 3G0FA 4AGDA 1H28A 4G3CA 3ENHA 5AV0A 3DTCA 5AP1A 4O7SA 3NUPA 4RFYA 3HA6A 4DLIA 3OWJA 2W1FA 4O84A 4I6BA 1PXOA 2UW3A 5L2IA 4YJOA 2IPXA 4EJNA 3OEFX 3ZLXA 4O0RA 4EH5A 2IN6A 3Q5IA 3JR1A 4D58A 3IG7A 4JRNA 2ITVA 4CCUA 3V5TA 3LJ1A 2XK4A 3H0YA 3GB2A 3OTVA 4ZY4A 5HU3A 4OBOA 5HG9A 2IVVA 2W0JA 1T46A 3OCSA 2W06A 4JOAA 4K9YA 4M12A 2J9MA 2HCKA 3BYOA 4QYEA 3L8XA 5HLWA 1R0EA 5CQWA 2ZDTA 4UMRA 3VBTA 3PIZA 4HVSA 4IC7A 4F7JA 4QP4A 4PDPA 4U8ZA 2JDTA 4N57A 3G2FA 4PP7A 4P5ZA 4RRVA 5DWRA 4AOIA 2YA9A 3QU0A 3JVRA 3M2WA 4DGGA 3BYSA 2OIDA 3C5UA 3ZXZA 5AP4A 2PE1A 5EI6A 2X6EA 2YHVA 4QNAA 1YWVA 5CLPA 5H3QA 2J90A 3QHWA 4EOJA 3HRCA 3GI3A 4MXZA 4YHFA 4L45A 2I40A 3MIAA 4G5JA 3CGFA 5HCYA 3LFBA 1BLXA 4II5A 3MIYA 2GQGA 3R28A 2CNQA 3IGOA 3ZCLA 5CASA 3DV3A 3KREA 3EJ1A 3ROCA 3HDMA 4RC3A 5CI7A 3V04A 3O8UA 4XBUA 5CY3A 5F20A 2ZM1A 2PZPA 3SLSA 4I4EA 4EOKA 5JGAA 1CM8A 3MI9A 2QOHA 4F1TA 3HNGA 2B9JA 4NFNA 2VTAA 3FPMA 3H9OA 2WNTA 3PG3A 3H9RA 4QMZA 3R7OA 4G3FA 1SZMA 2YLFA 4X6QC 5HIBA 5H8BA 1PMEA 4GYGA 5HNGA 5KBRA 4EI4A 4FT9A 2BTRA 2PVRA 4DEIA 4J99A 4IANA 1YI6A 4FG9A 3MJ1A 2OXDA 4V01A 3ORNA 3ZFXA 1M52A 5B2LA 1P4FA 5H8GA 4XG4A 4PMPA 5JQ5A 5ACKA 4I4FA 4FV8A 2XCHA 5DT4A 5C01A 4FIGA 4K8AA 1R39A 2DS1A 4E4MA 3I0OA 2QG5A 2GCDA 3FI2A 3UIUA 1V0BA 4CV8A 4K11A 3E63A 4DGOA 4I3ZA 4W8DA 2XCKA 3UP7A 5AX3A 5JFXA 4UB7A 3U54A 4FZFB 5EYDA 1J1CA 3NR9A 4YSJA 2O64A 2VTNA 1GOLA 4TRLA 4EC9A 3R71A 3GUBA 3LCTA 4TYEA 4KNBA 1YDSE 4MNEB 3V8SA 2BRNA 2J0LA 4L7SA 4OTPA 3LHJA 3U6HA 3AMBA 3FMNA 4YTFA 4YURA 4OW8A 5KMLA 1KWPA 2CSNA 4XRLA 4ACMA 2H34A 4KSPA 1XH8A 1MQBA 2BHEA 4KKEA 3V5QA 1XQZA 2X8DA 2WAJA 3A4PA 3FXXA 1A48A 4LV8A 3WYYA 1ZYSA 2XNBA 2G2IA 2YM5A 4DFNA 3H9FA 2UW9A 3DJ6A 1J3HA 2XP2A 3HUBA 4ANBA 4ZLOA 2VX3A 3ZM9A 3QYWA 3CJFA 5I3OA 4FT3A 3QCYA 4YBKA 5AP0A 3FWQA 5HX8A 3VWAA 3SGCA 3MY5A 5GIOE 5AR4A 5G1XA 4ZSAA 5IPJA 2F2UA 2J50A 4O83A 2C1BA 3FLQA 4RA4A 5HKMA 4IEBA 2WOTA 4QRCA 4BTKA 4E5WA 5CEKA 2XS0A 4KKHA 3PTGA 4UMQA 1ND4A 4QP7A 1URWA 3P7CA 4DEAA 3D94A 1U5RA 2ETMA 3BCEA 3POOA 3IPHA 4X2JA 4QMQA 2WIPA 1UNLA 3S0OA 2X1NA 5HTIA 5E8WA 4FSUA 4DH8A 3KXHA 4O6LA 1W0XC 3BLHA 4QTBA 5DN3A 2X2KA 4PDSA 3FBVA 4FKUA 4JG8A 4X7QA 4CMTA 4OAVB 4RWIA 2YN8A 3MH0A 4HYHA 4I92A 3R30A 4BVUA 2C5XA 3PWDA 4NTSA 5HNBA 5AA9A 3GNIB 3DK7A 3MS9A 1OUKA 5LARA 3R9DA 1KUTA 3FHRA 3QCSA 3WIKA 3F9NA 3BLQA 4GK3A 4IAIA 4QYHA 3WARA 3VBWA 1IA9A 4MYGA 4FIIA 3R2YA 4BRXA 4CLJA 1WAKA 4I20A 2BVAA 2PMLX 2X9EA 3FYKX 4GG5A 4I6HA 4PL5A 3NNVA 1JQHA 3DKFA 3VBYA 3ZUTA 3PJCA 5BVWA 5AUVA 3UMWA 3UZPA 3VS1A 2F4JA 2HW7A 3DY7A 4ENYA 3H10A 4PNIA 4IM2A 3LOKA 5BYYA 4YZDA 3KMUA 5A46A 3LMGA 1YXUA 3HV5A 5K4JA 3HAMA 4E6AA 4QMWA 5I3RA 3QCQA 2F7ZE 2O8YA 3LQ3A 4BTMA 3TNIA 3P08A 3ZSHA 3QKLA 4YGAA 2OWBA 1SVGA 1YW2A 3B8RA 4A06A 2OJJA 3OOMA 3MH3A 2C6OA 5FWKK 3M1SA 4LL5A 3VUHA 4XV1A 4AN2A 4BCJA 5L6WL 4ZIMA 4H3QA 2R3RA 3LFSA 1PKDA 2FGIA 3UQCA 2W9FB 4PF4A 4O22A 3BEAA 3RPSA 3R1QA 1IA8A 2C6TA 4FKGA 5KHXA 2ERZE 3NVKI 2PL0A 3ORXA 2A0CX 2BFXA 4Y5QA 2OJIA 4S34A 4PMMA 5JFVA 4FKJA 4OT6A 5EQPA 5EYMA 2ZB1A 1AQ1A 3MA3A 4JR3A 1JNKA 2Q0BA 3IW4A 3C1XA 2E9UA 3FY2A 3KB7A 5DGZA 2QG7A 4F7SA 1G5SA 4FOBA 4S33A 3S1HA 5IQIA 3E7OA 3V8TA 5LWNA 3EL8A 3NEWA 4MHAA 4PRJA 1XH6A 3KA0A 4S30A 5GZ9A 4EOQA 3EH9A 5IA4A 3FV8A 4KINA 4X2KA 5L8JA 4NKSA 4EEVA 4FEQA 4G3GA 3HYHA 4Y72A 3ZBFA 3AQVA 3IECA 4IDTA 2DQ7X 4DYMA 4F9CA 4FKTA 4WT6A 1UWHA 2J51A 2BPMA 3GOKA 4MF0A 3SVVA 4FSYA 1YHSA 4TYIA 1YHVA 2JFLA 3F5PA 4MVFA 2R2PA 4YJVA 4EK6A 3NS9A 3QZFA 4PNKA 4AOTA 2RG5A 4L7FA 3ANRA 4JNWA 3D7ZA 2Z60A 3WOWA 3C50A 4QQJA 1R1WA 2R3FA 4H05A 4FA2A 5M57A 4IDVA 3P4KA 2YABA 1BL7A 2Z7QA 3BYUA 1H0WA 4HGSA 5FEEA 3TEIA 4HZRA 4EYJA 4PPCA 1KV2A 5FXSA 3MPAA 1UU7A 3TKHA 3OWKA 1UNHA 4IX3A 5F9EA 3OBJA 2EB2A 4QMLA 4MD8E 5KUPA 3HUCA 5E8YA 5IKWA 3VN9A 3VUMA 4DFZE 4DFXE 3O0GA 4PDOA 4EH8A 2I0YA 1XO2B 3BQRA 3NX8A 4YC3A 5AV4A 3EQPA 4KKGA 3KRXA 3QC9A 3VAPA 4EOMA 4AFEA 4KIQA 1P14A 5CI6A 3UQFA 4IAAA 2W1HA 3RK9A 3EFKA 4C0TA 5CZIA 4Y73A 3NUXA 3FQEA 3UYTA 4KWPA 3LQ5A 4E6CA 5HBJA 3Q3BA 4ZTHA 4BI2A 2VX1A 3BX5A 1YWRA 1A06A 1K3AA 3RHKA 1ZMVA 1B38A 3DU8A 3R2BA 3OTUA 2YIRA 5GZAA 4MWIA 3AT2A 1FINA 3PXRA 3SAYA 4DG3E 3FPQA 4DFLA 5BNJA 2A27A 4DH5A 2RFNA 5CX9A 2JDVA 5TOZA 4MTAA 4BDDA 2X8IA 1XBAA 2J5EA 3S2PA 4YTCA 4U42A 4C02A 3O71A 2JDRA 3E93A 1GZ8A 3JYAA 4MNEA 3VBXA 4F64A 1UV5A 4LMUA 2VGPA 4BDHA 4S2ZA 2BR1A 4R3CA 5IA0A 5AV3A 3COIA 5H2UA 3BGQA 2F7EE 5L2TA 2BKZA 2O0UA 2AYPA 4TWOA 3SC1A 3KVWA 4TY1A 2UZTA 3QC4A 1HCKA 3EKKA 4JJRA 2QO2A 3ORMA 4DG0E 3TNWA 4YJNA 5AP7A 3D5VA 3GXLA 2UZWE 1JKTA 3QZGA 4CVAA 4BCPA 1O6YA 2XB7A 2Y4IC 3BHHA 5IDPA 1UKHA 4IB0A 3PXFA 3C4XA 3Q9XA 3SOAA 5A6NA 4QQTA 5D10A 4AZEA 5EI8A 3OD6X 1LEZA 2C6DA 4RJ6A 4KB8A 4IWQA 5JK3A 5CEQA 2RKUA 4XH6A 2WMVA 5CALA 1GZKA 2XIKA 5CVFA 3PSCA 2WGJA 4P4CA 4R7BA 2JKQA 4O2PA 3UNKA 4TYHB 2XEYA 4MXXA 5AUZA 2ITOA 4AZVA 2QOKA 4CSVA 4CZUA 4ZMFA 3MY1A 2W96B 3BHYA 1BI8A 3ZDIA 4OT5A 2O65A 2IO6A 2YAKA 1F3MC 3Q9ZA 4TYJA 5AP6A 3L9NA 1OBDA 5F95A 3IK3A 3WF7A 4GIHA 2UZVA 3EQCA 3VC4A 3ACJA 2BRHA 3AC3A 3PE2A 3M11A 4KUJA 3AMAA 2W1ZA 4TKSA 2G01A 2YIQA 3F3WA 4FVPA 4GU9A 4IWPA 4RT7A 2QO9A 1FVTA 3VW6A 4TWCA 2HAKA 4F7NA 3AC1A 3GP0A 3MVLA 3MESA 3IDCA 4LM5A 4LUDA 1RW8A 4NCTA 1KE8A 3LMHA 2YM4A 5DHJA 4QTEA 4BZOA 3D5UA 2YCRA 4DA5A 4JQ7A 4BKYA 3COMA 4EK4A 4IWOA 3U9NA 2W1EA 3CTJA 3JY9A 2XK3A 3WYXA 3C4ZA 4C7TA 5EDRA 3PE1A 4GL9A 5I9ZA 4FTLA 3DS6A 5HVKA 3ID6C 3HEGA 2W1CA 4YNEA 4BDEA 5TE0A 2OXXA 4FKPA 3W2PA 5FUTA 1ZOHA 3GQLA 4G6LA 4XP2A 1R0PA 3AC8A 2VGOA 4RJ3A 2QR8A 4GYIA 3BLRA 4P7EA 4J52A 3TV7A 3RPRA 3CS9A 2XKCA 2XIRA 3R01A 2CKQA 1IG1A 4QT1A 4X3FB 2YZLA 2W5HA 4QMOA 2ETKA 1PF8A 4NYEA 4I1ZA 3WE8A 1MP8A 1ZY5A 4U0IA 1YXSA 1ZRZA 2VRXA 1ZAOA 3PZHA 3RKBA 3W1FA 5IQGA 3WF6A 3QUDA 1PKGA 3ULZA 1WFCA 5BVFA 4ORKA 4NJ3A 3QRUA 2PSQA 4CLIA 1CKJA 4O0TA 3I7CA 3KXGA 3PUPA 4D28A 5A4QA 3CQWA 4PMSA 4IW0A 2C68A 3UC4A 5E9EA 1JBPE 5I9UA 1UKIA 2ESMA 3OCTA 3EWHA 2QOCA 3GC0A 3A60A 1FPUA 1V0OA 2UV2A 2OGVA 3QA0A 2AC5A 1GJOA 3JXWA 4HPUE 4IVDA 3LLTA 2QKRA 3ZFMA 3U6IA 2CLXA 4FT0A 3OY1A 4G1WA 2V5QA 3RBWA 3VF9A 5CF6A 4FBXA 2V55A 3D2KA 4IJPA 3POZA 3HDNA 2P0CA 1ZYLA 4FG8A 3V01A 2WFYA 2YIWA 4AW1A 5CF5A 4LQMA 3C0IA 4UWCA 2WTJA 3V6SA 4E6DA 3L9LA 4EOPA 3BBWA 4PTEA 1ATPE 3FHIA 4CTBA 3OP5A 3UBDA 4FVQA 4RZWA 4EQUA 4JX3A 3CXWA 3SDJA 3KXXA 5K0KA 3LCSA 2JGZA 4BGGA 2C3IB 3PP1A 2JDSA 2OZAB 5ANOA 4JBVA 1ZARA 4GUEA 3V5JA 4BTJA 4EOIA 1Y6AA 2X4FA 4YZBA 3LCDA 1XBCA 3F5GA 4XHKB 4A9SA 3OF0A 2I0VA 3QXOA 3Q4CA 4HOKA 2WTVA 2GHLA 5LVLA 4KA3A 4AZFA 1ZOEA 3VS4A 4OTDA 4B7TA 5EM6A 4AG8A 4WG5A 2H96A 3ZXTA 5ANIA 3F3VA 3K3JA 2PY3A 4YJUA 5HEZA 4BI1A 1CKIA 4F1OA 4N70A 2YIXA 4FNYA 3I60A 1OL6A 2YEXA 4AX8A 3LVPA 4UYNA 4L8MA 3QQJA 4LG4A 1S9IA 3KCFA 4O7VA 5J1WA 3HLLA 4LL0A 5G6VA 3UE4A 4NU1A 4RPVA 4I5PA 3Q5ZA 2E9PA 3MV5A 5AUYA 1OKWA 4NCTC 3K5VA 2HXLA 2FSMX 1I44A 3QBNA 2PE0A 4FIEA 4E73A 4F6SA 1O6KA 4K0YA 4M7IA 3GBZA 5JZJA 4BTFA 3BHTA 5DEWA 2PUIA 4HVDA 2V0DA 3OCBA 2C0TA 4JDJA 3RHXA 3DBEA 4QYYA 4P90A 5AAEA 2ZV9A 3AC2A 4JVGA 4YJPA 3VQUA 3QD0A 2EUFB 4C4EA 4L43A 2C5OA 4JDHA 4ZSEA 3E3BX 4D55A 2HZIA 1ZXEA 5IA5A 3ZBXA 3FLSA 4FX3A 4FK3A 5HVYA 5E90A 3ORKA 4KIPA 3E62A 5FRIA 3W16A 3DKOA 4D0XA 5ETIA 5HX6A 3NW6A 2R3PA 3VRYA 1CDKA 2QR7A 2XK6A 2XNMA 3R21A 3QTSA 4GJ2A 4WG3A 1W84A 2GTMA 4AACA 4WNOA 1LP4A 3ELJA 1OL2A 4RWLA 4UEUA 4XNEA 4DEBA 1OL5A 3UTOA 3R8UA 2JKKA 5DH3A 1Y8YA 3MPMA 3N4TA 3E3PA 4TYHA 3F2RA 4FOCA 5AAGA 2QURA 3DZQA 4IZYA 1Q8ZA 3D4QA 2UW7A 4UMPA 3KK9A 3LCKA 5E91A 4WBBB 1WBSA 3UOJA 4FTTA 3VJOA 4WRGA 4LI5A 3MA6A 2PVHA 4RZVA 3K5UA 4DC2A 3AT4A 3LCOA 1VYZA 3O8TA 3HV6A 3DB6A 3QHRA 4JBQA 4GH2A 2B9HA 4GK4A 5AEPA 3OUNB 5DMZA 4JBPA 5F1ZA 3ORIA 3M42A 2YLEA 4XV9A 5GHVA 3NYXA 2VWBA 2X4ZA 4F9WA 3F66A 5JRQA 4QTDA 2ZVAA 3UYSA 2R3HA 4JX7A 4RC4A 5DRBA 5CAUA 3KRJA 2VTOA 3L1SA 3KF7A 3N4UA 2HENA 4LFIA 3P23A 4BZNA 4N4SA 3WBLA 3TNHA 3DTWA 2V7AA 4DH3A 4D2TA 3AD6A 1H00A 4D9TA 1Q4LA 4HCVA 5FGKA 5KE0A 4BDGA 5ITAA 4GKHA 3KVXA 4FICA 3UOHA 3SQQA 4O7RA 4MD9E 5ANKA 4FYNA 3CKWA 4FTJA 4ZAUA 2C3JA 5AP2A 3F7WA 5TO8A 4G9CA 4U45A 1OUYA 4JQ8A 3RJCA 4X3FA 5L8KA 4BGQA 4Z7HA 2PVYA 5AWMA 2PTKA 4MXYA 3CPBA 3FL5A 3KQ7A 3MN3A 3CP9A 3KL8A 4FTRA 2XK8A 4GFMA 4GU6A 4I94A 3UJGA 4AFJA 4BZDA 3EYGA 4FKLA 4EQMA 4B9DA 3QQKA 2WOUA 3MB7A 5KHWA 1M14A 4HVGA 4IJ9A 4WSYA 3RP9A 3SXRA 4MAOA 3R7UA 3HRFA 5L2SA 1BL6A 2UW6A 5CU3A 4Y95A 4CMUA 1S9JA 4IBMA 2WU7A 2PVJA 3ORTA 4DG2E 2YCQA 3QX4A 2BDJA 4L42A 3ENMA 1GAGA 3DJ5A 2C30A 1YI3A 3F88A 3UIXA 3MYGA 1NA7A 3KMMA 4QMTA 2WMTA 2XMYA 5K5NA 1CKPA 5IEXA 4RJ7A 4K18A 5EKNA 2VO7A 4J7BA 4C59A 2VO3A 4KD1A 4TT7A 4YNOA 4E7WA 2DWBA 3R02A 5CENA 3LIJA 4FKIA 2Y4IB 4ZS4A 3TWJA 2FSLX 4ASXA 3REPA 4MQ2A 4G3EA 4RJ8A 4A7CA 4HW7A 5CVGA 1OIUA 5CWZA 2P2HA 3BIZA 4PTGA 3IW5A 2F9GA 4WRSA 4ANQA 4FG7A 1M7NA 3TJDA 4EKLA 3OWLA 5HO7A 1JSUA 4DINA 4XUFA 4C2VA 1SVHA 4CMOA 2OZAA 3I6UA 4DBNA 4WNMA 3R8MA 4W4VA 4OBQA 4ACDA 3NAYA 3Q6WA 4FSNA 2XJ2A 4IM0A 2NRYA 4ENXA 1LEWA 3DBCA 3DQXA 3E8NA 3OW4A 3QKKA 3RPVA 4AXAA 3QFVA 4F7LA 4W8EA 5HE2A 4EOOA 4XG9A 3WZJA 5CEPA 5HBEA 2OICA 3ATTA 4FV1A 3IKAA 4BYJA 4PMTA 3PPKA 2UW5A 5DBXA 2IZSA 5AR8A 2XNGA 3NYNA 4IX4A 1CSNA 5AIRA 3DK6A 3EN7A 4M84A 4HGLA 3FLYA 1P5EA 2JAVA 3QALE 4R5YA 3WIGA 2OFVA 5GJFA 3IO7A 2VV9A 4FTIA 5EOBA 5H8EA 2OG8A 4EH7A 5BPYA 2O2UA 2RSVA 2ZJWA 3FZPA 2HZ4A 5LCJA 4EZ5A 5C27A 3RTPA 4CQGA 1JVPP 3TUDA 3SW4A 1KOBA 1VR2A 2WTIA 3WILA 4XLIA 3NNXA 3EQBA 5GJDA 4D9UA 3LFCA 5KZ0A 3T3VA 2PVLA 4MKCA 2PZIA 3CKXA 4PX6A 2XRUA 1SYKA 2YFXA 1FOTA 2PUUA 3HMOA 4ZEGA 3R9HA 4FNXA 5J5SA 4XBRA 5EM8A 3Q2MA 4ASEA 4ZZOA 3PVUA 4YUQA 4UALA 4CGAA 3CQUA 4AP7A 2PZRA 2ZYBA 3QZHA 2XA4A 4O0XA 4BBEA 4I93A 3CR0A 3F82A 1X8BA 2QU5A 1OIQA 1UWJA 4JS8A 2VO0A 3R7YA 5IH5A 2BZIB 5ETFA 3EYHA 1YI4A 2XK9A 3UPZA 5DOSA 2CKEA 4B8LA 5HU9A 3DLSA 3I7BA 1H1QA 4WUNA 3O7LD 2J0JA 4IVAA 2PWLA 4L46A 3MWUA 4X3FC 4CXAA 5C4LA 5JEBA 1G8AA 4AZSA 3VHEA 4RJ5A 1XH7A 4JBOA 1ZMUA 2QOQA 1H08A 1OGUA 4O0VA 3F5UA 4PTCA 3WE4A 2CGXA 4U79A 2PZYA 3LXPA 2J7TA 4M14A 4BFMA 4PDYA 5AUWA 3MTFA 3AC4A 2R9SA 5IMEA 2PUNA 1W7HA 3GFWA 4FL2A 3DDPA 4IAYA 1U4DA 4S31A 5LJJA 2NP8A 4J95A 4O38A 3GGFA 3SKCA 3DAJA 3PP0A 2R3JA 3U9CA 2ZMDA 4F4PA 2RFEA 4O21A 3LLAA 4BDCA 5JMSA 3TACA 4QQCA 2KULA 3D2IA 2V22A 4FMQA 4HCTA 4E6QA 1DI8A 1Y6BA 2BDWA 2BHHA 3I81A 1KE5A 2OJFE 4O7TA 4O86A 4ACGA 4FEVA 1QMZA 1GY3A 2WQBA 4O0SA 3GU6A 1O6LA 5CF4A 2XF0A 5JN2A 5HO6A 1Q3DA 3UG1A 4IAZA 3OG7A 3ACKA 2G15A 3TI1A 3DXPA 2OLCA 3PG1A 4RQKA 1YKRA 3GC7A 4I6FA 1OL7A 3FLZA 3VUDA 3F61A 4JAJA 2R3NA 4U80A 5FBOA 1UVRA 2BTSA 2BRBA 3DNDA 1FMKA 3MFRA 4K1BA 3NUSA 3HMMA 3OT8A 3TZMA 5FEDA 4EWQA 5I9XA 1OITA 4I5CA 5CAPA 2XNOA 3OXIA 3W2QA 3A7IA 2QLQA 4WNKA 4O81A 2X2MA 1LR4A 2P2IA 2ERKA 3OHTA 2GFSA 3TN8A 5GINE 2C0OA 3UVRA 4CG9A 3UO4A 1OPJA 2HY81 5IZFA 4BY9E 3QUPA 4NK9A 3QX2A 5HLPA 4EH2A 4EQCA 4Q9ZA 4IMYA 5DYJA 3R6XA 4B99A 5K9IA 3SG9A 2Y9QA 2WU6A 5JH6A 3PJ3A 2NNWB 2YDJA 1APME 1QPDA 5GIPE 4QQ5A 2AC3A 3BI6A 2ZDUA 4DH7A 3NNWA 4UWYA 3K2LA 4AAAA 3G9NA 5TF9A 3QF9A 3EZVA 4H1JA 4M15A 3ZZEA 3Q52A 5BYZA 1YQJA 2GFCA 2IVUA 3TG1A 3GCUA 4CT2A 3KC3A 4DGNA 1K9AA 3R83A 4A4LA 4KRCA 3RNIA 5LVMA 2A4LA 2VD5A 3QL8A 2VWIA 2W4OA 3DKGA 4PPAA 4EOLA 3OBGA 5A4LA 3A62A 3C0GA 5HQ0A 4XG8A 3AGLA 4M0ZA 4FUXA 4QTAA 4TPTA 3DBDA 4PQNA 2UW8A 5J9LA 2FSOX 4TN6A 2B7AA 5FBNC 3LXNA 3FLNC 4XV3A 3ZO4A 1Y91A 3TL8A 4BDKA 4RIYB 4RJ4A 3ZSGA 4R5SA 3W2OA 1J7UA 2F57A 3KEXA 1V0PA 1SNUA 2YM3A 2YWPA 3QXPA 2WO6A 3LZBA 5EDPA 4RA5A 3VUTA 3NWWA 3AG9A 3RMFA 5JSMA 4ZTLA 4BDFA 3PY0A 1P2AA 1NT2A 4KBKA 1JKSA 2GSFA 3QTZA 3BELA 4M8TA 4F09A 4O1OA 4FNZA 4PL4A 1IAHA 2V62A 5HO8A 4I0RA 4I21A 5CEMA 3PLSA 5JZNA 3W55A 3GOPA 3BEGA 4OTRA 4G5PA 1IRKA 3RGFA 3W2RA 2QOLA 4EKKA 4KS8A 4YJTA 4KIKB 3TKIA 4Y5HA 4FIJA 3W32A 4HYSA 1QL6A 5CU4A 5DVRA 2EXMA 2OZOA 3E88A 5BVNA 2X39A 3D0EA 4ZY6A 3PPJA 3W2SA 2QC6A 3LPBA 4GUBA 3BWJA 3HP5A 3EKNA 4R77A 1H26A 3P79A 3ZRKA 2GQSA 3A7HA 2ZOQA 4C3FA 1FGIA 1Q62A 3PDTA 4N6ZA 4FV2A 4I0SA 3EL7A 3LJ0A 3CD8A 1VYWA 2ZV8A 3Q96A 4J97A 2WPAA 3SOCA 1YOLA 4MD7E 2R3MA 4M68A 4U3YA 3SHEA 3W10A 5I9VA 3DBFA 3TUCA 1WBWA 2QOFA 4CT1A 4U97A 2HW6A 2ETRA 2XJ1A 2ZAZA 1QPEA 3W8LA 4DAWA 3ZLWA 3SG8A 1K2PA 2UZEA 4YO6A 3L9PA 1NXKA 4E93A 2FH9A 3NUYA 4OTQA 3FZOA 3O96A 4DE4A 2YACA 5LOHA 1FGKA 3BGZA 3Q4TA 3P78A 3FJQE 4RFZA 4DLJA 4FVRA 4I24A 1Y8GA 3LXLA 3QRIA 1OPLA 3OXTA 5DNRA 3VULA 4TW9A 4BBMA 5A4EA 4B0GA 5IQAA 1PXIA 3VS7A 2B55A 3RCDA 2FSTX 2RFSA 2XVDA 4BCIA 3ET7A 2ITTA 4YLKA 2A2AA 4C33A 2YISA 3G33A 3KXNA 2VTTA 2PYWA 3FKLA 4UZHA 4R6VA 4WOVA 5HBHA 3NIEA 3NYOA 5HI2A 1PXNA 5IEVA 3N4VA 3II5A 4ZXTA 4AZTA 2QLUA 2YAAA 3EZRA 2E2BA 1YWNA 4Q5HA 3GC9A 3KKVA 3P1AA 5HHWA 4DGLC 5EYKA 4EZ3A 3E8DA 3SX9A 3UNZA 5B2MA 3QQGA 5L3AA 2HK5A 4Y8DA 3G6GA 3OZ6A 3UQGA 3UZRA 2WELA 4JDKA 4RWJA 2QHNA 2UUEA 5J9YA 3FKNA 5FM2A 1M2PA 3NYVA 2HZNA 2JIUA 1H07A 1WZYA 3Q4UA 4F9YA 3HMNA 1L3RE 3R04A 3MH1A 2Z8CA 4HYUA 4L3JA 5B7VA 3HV4A 3NZ0A 5M09A 3TNQB 4RVMA 2CN5A 2GHGA 4BB4A 2YDKA 4UXLA 4M13A 2R3GA 3ETAA 3GFEA 3DLZA 3QAME 4R7HA 4O7NA 4YLLA 3AGMA 2X6DA 4WD5A 5FLFA 4HNIA 4BWPA 4NUSA 5HE1A 2WQOA 5JKGA 4CFFA 1PXPA 4K33A 3QRTA 4CFWA 2VTHA 2R7BA 4J8NA 4D4RA 4GFOA 2IG7A 2BCJA 2F7XE 4NZWB 3V5WA 3A8XA 5AP5A 1YXXA 4ZLYA 2BRGA 5AUXA 1WBPA 3UPXA 4J53A 4C8BA 3FZTA 4QPMA 5CTPA 5AAFA 5EFQA 1MRYA 4AWIA 3ZUVA 3TXOA 5FXRA 3FMMA 2W5BA 3C4WA 4GS6A 5DR6A 2Y6MA 1FMOE 2RGPA 5BVKA 4DITA 3G6HA 3OY3A 3P5KA 4TWPA 3EIDA 4ZTQA 1GIHA 1RDQE 2JKOA 3F6XA 4ZOGA 3UIBA 4ASZA 3FDNA 5FEQA 4NIFB 2VWWA 5FD2A 5C8MA 3FQSA 4EH3A 3TTJA 2F2CB 4MX9A 2SRCA 2P3GX 5E4HA 4M69B 5CVHA 3W33A 5BYLA 3UO6A 4UY9A 3NMUF 3TZ7A 2ZB0A 4U9AA 5HIDA 3R8ZA 1E1VA 5IUIA 4IE9A 3R22A 3ITZA 3G15A 3FKOA 4H58A 1IAJA 4FE2A 2YJRA 3BU5A 4RX5A 2YITA 5BMSA 3O2MA 3KK8A 4C57A 1Q8UA 3VF8A 1LPUA 5LVNA 2VWVA 4Y85A 3PVGA 3TDVA 3TJCA 4Q2AA 2JD5A 4F08A 4PPBA 3GENA 3HV7A 4FZ7A 3UNJA 4HJOA 1PXLA 3NPCA 3RAIA 4BKZA 3RAWA 2R64A 2YCSA 3EN5A 2HELA 4AE9A 1BX6A 2JFMA 4GJ3A 4FSWA 5IQBA 3PJ1A 5IUGA 4F70A 5LVOA 2X81A 3KULB 4GSBA 4QNYA 2GNGA 4NH1A 3GU8A 4UWBA 4YZMA 1ZOGA 5DE2A 3KY2A 5B2KA 2CKOA 3R1YA 2UVZA 3HMPA 3S4QA 4RIYA 4R3PA 4E1ZA 1F5QA 4IWDA 3NCZA 4YHJA 3FI3A 1OVEA 3FUPA 3VNTA 1VEBA 3KCKA 3B2WA 2GS7A 3CQEA 1KE9A 4YU2A 2XBJA 5HD4A 1PYEA 5ETAA 2C6IA 2OKRA 2XNNA 2BMCA 4FGBA 4C4GA 5J79A 2WKMA 2WTKC 1WVYA 4MXCA 5E8TA 5A4TA 5GZ8A 4BCMA 4GRBA 4KAOA 4C4FA 2ACXA 2QOBA 4F0GA 3RPOA 5JGBA 5L4QA 1WVWA 2BIKB 2OH0E 4ALVA 4RLLA 1XHAA 5LMAA 1ZYJA 4D4YA 4KIKA 4FTAA 3UDBA 4USFA 4JL9A 4MBLA 1PY5A 2OIBA 1KE7A 4ALWA 4P2KA 2JC6A 4G31A 4H36A 5L2QA 4OR5A 5K4IA 3MPTA 3PSDA 4KBAA 1AGWA 4L9IA 1H1RA 2JDOA 1H25A 3LFQA 3QWKA 4R1VA 5I5ZA 4CZYB 4ONAA 4L52A 3D15A 5CF8A 2I0HA 4YPSA 4FNWA 4A4XA 3R7EA 3JS2A 3PFQA 2I0EA 2XJ0A 2CMWA 3U55A 3HP2A 2R5TA 4TZRA 3SXFA 1RE8A 2VTMA 1HOWA 2WIHA 3D5WA 4MCVA 5CSXA 4N0SA 3IW7A 2YZAA 1TVOA 3ODYX 1RJBA 5L6OA 2QO7A 2JBPA 4YMJA 4EK8A 5AIKA 3C4CA 3FYJX 3EHAA 4GIIA 4IB1A 3QQUA 4CFXA 1GIJA 4DCEA 2FA2A 1Y57A 4APPA 5HICA 3OWPA 3PSBA 2W99B 3A7GA 3O23A 4UN0C 2VNYA 3BPRA 3HAVA 5IQDA 2UVYA 3GT8A 3QTIA 2WEIA 3Q53A 3MGYA 5EH0A 4FGRA 3KRWA 1QCFA 5HTBA 4XOYA 4ZTMA 2OXYA 5ANEA 2E9VA 4IZAA 3BGPA 3RWPA 5BUJA 4F0FA 3R1NA 5LMBA 5E7RA 3PRFA 4NM7A 2YJSA 3U6JA 4BCFA 5TT7A 5AMNA 5HD7A 3L8PA 1V1KA 3UMXA 4U6RA 2R3IA 4CQEA 1MRVA 5EI2A 4AA5A 3KXZA 3BE2A 1LUFA 2HOGA 2XKDA 3E8EA 3MVJA 2XEZA 4AW2A 4Z16A 2C1AA 1H4LA 4Z3VA 3QYZA 5D41A 1ZYDA 5KKRC 2BAJA 3QD2B 4IZ5A 1DI9A 2UW4A 5J5TA 1Q99A 2UW0A 3I6WA 3MFSA 4GV1A 4TNBA 4AW0A 1G8SA 1PJKA 4C4HA 4RIOA 2IJMA 2A19B 4PUZA 3IONA 2ITNA 3BQCA 4QYFA 4NKAA 1OIRA 4YZ9A 4ZSLA 4BC6A 4J8MA 3RK7A 5AFVA 5DR2A 5T6KA 2C6KA 5KNJA 4ZK5A 2C5VA 3ORLA 2EU9A 3OS3A 4FTNA 3PVBA 4C4IA 4AOJA 4L01A 2ITUA 3COHA 4PV0A 3PLAE 4QMVA 3O8PA 4RIXB 4BCKA 4IC8A 3DQWA 4CTCA 3UVPA 1OL1A 4YTIA 3BKBA 2R3LA 1OBGA 2EXCX 4WNPA 3DOGA 5BVDA 3K54A 4LRMA 4FK6A 4GK2A 4RVTA 3P7AA 1NVQA 2UZUE 2IW6A 3BBTB 3I4BA 4Q9SA 2YCFA 5KMOA 3UOLA 5KMMA 3AD5A 2GDOA 2XUUA 4I0TA 5E1SA 3SRVB 3V5LA 4F9BA 4Y83A 4NIFA 4ITHA 4DEEA 4FV7A 4FV3A 3VRZA 4NM5A 5C1QB 4R78A 5J7HA 3L8VA 5FP5A 3F2AA 4M0YA 2W1IA 4M69A 5CEOA 5ACBC 4EK3A 2PUPA 3TM0A 2VX0A 3F3ZA 4H1MA 4OTWA 5EG3A 4OTHA 3ZS5A 4FKWA 4DFUA 2GQRA 3ZLSA 1Q8YA 3IOPA 3RAHA 2XKFA 2P55A 3ORPA 2BFYA 1QPCA 2EXEA 4LMNA 4UXQA 4BDAA 3HA8A 3TIYA 5C26A 4ZMEA 4ZJVA 1JLUE 5IA2A 2GHMA 4NW5A 4AGUA 3PA5A 2YM8A 4H3BA 3KU2A 3VVHA 3ZHPC 2LAVA 4CYJA 4UBAA 3FSFA 1RQQA 5F4NA 3ODZX 4DEDA 2VWZA 1G3NA 2C3KA 2R4BA 4RBLA 5AM7A 4EH9A 5A9UA 1ERKA 4Y46A 2CGWA 2OH4A 3HMIA 5JFWA 4L44A 5AADA 5E8VA 1NVSA 2RIOA 3NLBA 4QTCA 3KF4A 4J71A 3RPYA 3DA6A 3H30A 4J1RA 4LGGA 2CDZA 1UA2A 3DAKA 4V04A 3DK3A 3HV3A 3VS6A 1J7IA 3QZIA 4FR4A 2R0IA 3VS2A 3C5IA 4RX8A 1Q97A 2QOIA 3MH2A 4MWHA 4XV2A 5BMMA 5ETCA 4JQEA 3KULA 4W9XA 4NTTA 5BQ0A 3T3UA 2PMIA 3FLWA 3VBQA 2QU6A 2OF2A 5AUUA 5M56A 3CJGA 3MVMA 2WTCA 1MQ4A 2HWOA 4WG4A 2BIYA 1PXMA 3PIYA 3PA4A 1KSWA 3NDMA 1OKZA 3COKA 4FZ6A 2X9FA 4TYGA 4B4LA 4DEGA 3I5NA 5K0XA 2H8HA 4XG7A 3G9LX 3PXYA 3PXQA 2HXQA 3MY0A 5E92A 3KRRA 4C35A 2Y4PA 2WMQA 4D1SA 2WMWA 4DTKA 4O82A 2WMSA 4JT3A 3RZFA 3CLYA 4G16A 3VJNA 4AE6A 4U7ZA 4JI9A 1H24A 2ITXA 1OB3A 2VTSA 2YM6A 4N6YA 5FM3A 2GS6A 4LOOA 5DG5A 5AX9A 2VTRA 5DEYA 3NUUA 4D5HA 1XH9A 4AGCA 4G17A 5GNKA 5ANJA 2GNIA 4Z55A 4XP0A 4D1XA 3R0TA 3FI8A 4YPDA 5L2WA 4EH4A 5LMKA 3D83A 1PHKA 3H4JA 4U3ZA 3A99A 3TZ8A 4TNDA 4ZTNA 5IQCA 2XYUA 2R3OA 5JFSA 2WQMA 3DXNA 4D5KA 3BU6A 4D1ZA 2OW3A 3KFAA 1MUOA 2PMNX 3LFEA 4IAKA 3LKMA 4E5AX 3ZC5A 3FE3A 2ITZA 3TT0A 5KBQA 4FZDB 3MFUA 3HKOA 3OROA 3HRBA 5FDXA 4LYNA 1GZOA 4ANNA 3SW7A 4QPAA 5TKDA 3PRIA 1SNXA 4MXOA 2X8EA 4FC0A 4ACCA 4YP8A 4FT7A 4Z7GA 5LWMA 3BYVA 4R1YA 4L00A 3VUIA 1BMKA 2JAMA 2BZKB 3NUAA 4DFBA 4QP6A 2OFUA 3RI1A 4F9AA 2O3PA 3U4UA 4EHZA 1SVEA 4O91A 3CTQA 3KXMA 4EONA 5L6PA 5M07A 5M51A 2PULA 4IX6A 4ERWA 3MFTA 3MW1A 1H27A 2BZHB 3VUGA 4LV5A 1SM2A 3V6RA 3V8WA 2C6LA 1REJA 2PMOX 3PXZA 4FODA 3U4WA 4ZS0A 1TKIA 2FYSA 2WMBA 1FBNA 3WZUA 4ZSGA 2W17A 3P7BA 2Z7RA 5E8XA 1TQPA 3ZU7A 3FEGA 1J91A 4USDA 3O7LB 3HVCA 4BBFA 3QTQA 4O27B 4M3QA 3UP2A 1UNGA 4CNHA 2QOOA 3KMWA 2QNJA 5DLSA 3WF5A 5CU0A 2JIVA 3ZH8A 4Z9LA 4BWXA 5I0BA 2W5AA 3IQ7A 4FSRA 3PIXA 4MXAA 3ZEWA 3GU5A 2G1TA 5KMNA 2FO0A 5CNNA 4O96A 5E8ZA 4EUTA 1ZWSA 3VW8A 5CANA 5CSWA 3TV4A 2B54A 1ZZLA 4BN1A 1OM1A 5HIEA 5CAQA 2FB8A 3GQIA 1KE6A 1M17A 4JLCA 5EOLA 3QCXA 5JT2A 5CS6A 5H9BA 3ROYA 4IB3A 1PMUA 1WBNA 3L9MA 1BI7A 4ANSA 4BGHA 5IQHA 5AR5A 3EN6A 4GMYA 1P4OA 4RIWB 4PY1A 1EH4A 1OMWA 4L68A 3PY1A 3ZOSA 2VZ6A 2IZRA 5CEIA 4DTAA 1Q61A 3WI6A 1A9UA 1XJDA 4HGEA 4BR3A 5CU6A 4QD6A 2QQ7A 3UG2A 4D2SA 2J5FA 2QODA 2WQEA 5AM6A 4AW5A 1Q24A 1JSTA 2HZ0A 1JKLA 2WEVA 2OBJA 5BX0A 4RIXA 4NT4A 3S00A 3QLGA 4G3DA 4ZJIA 4IB5A 4C4JA 1AD5A 2R7IA 4USEA 4BKJA 5CZHA 4BI0A 4I41A 1KV1A 4GCJA 3N51A 4IIRA 2PU8A 2JBOA 5E1EA 2WTKB 3BHVA 4E4XA 3F69A 4FV0A 4RFMA 5IQFA 4YJQA 2ZV2A 2P33A 3CC6A 4QP1A 2DUVA 4QP8A 4RLKA 3B2TA 5EHOA 3SRVA 5IDNA 5KCVA 2I1MA 3D14A 3OVVA 4EJ7A 3DAEA 5AUTA 2RFDA 4XCUA 3RM6A 1YDTE 1Q3WA 2REIA 4FI1A 4I5MA 4D2RA 2B4SB 4FV5A 2VAGA 4HGTA 4AT5A 1JSVA 3DNEA 1M7QA 4FKQA 1T45A 3EN4A 4HNFA 4JRVA 3CY2A 5DR9A 4EHGA 2DYLA 3PY3A 5BUEA 3O51A 5KO1A 3EFLA 2B9IA 4UV0A 2VN9A 3QD3A 3E7VA 5LMKC 1Q41A 3ZLYA 5KZIA 4K2RA 3ALNA 3SD0A 3L8SA 4HCUA 5AP3A 5IEYA 3R9NA 2C5YA 4BWKA 4EUUA 2GPHA 5CT0A 5IISA 1OECA 2B1PA 2QVSE 3ANQA 4O7ZA 3UO5A 4GVAA 2FUMA 3VS0A 5LVPA 4RSSA 3GVUA 2BAKA 3R00A 4FYOA 4BCNA 4AA0A 4DFYA 5KMKA 3BZ3A 2CLQA 1L8TA 5EHLA 4O7WA 3ULIA 1W98A 2WQNA 1Q8TA 4M97A 2X7OA 3RCJA 1DAYA 4IACA 4EHEA 5IQEA 2NRUA 2G2FA 4HZSA 2W7XA 5FTOA 4J98A 3G51A 4FTMA 3IW8A 4BDBA 5FTQA 2VTPA 4C38A 1H1WA 3JY0A 5IA3A 1J1BA 2JITA 2VTJA 4ACHA 2VWXA 1WVXA 4MEDA 1BUHA 1REKA 3E5AA 3SXSA 2Z7LA 5HVJA 3LXKA 2GS2A 5IH6A 5DT0A 4X2FA 2XM9A 3DFCB 4AN3A 4I6QA 5KKRB 1PMVA 4ZZMA 5M4FA 3TV6A 3WF8A 5EYCA 3EQDA 2VTIA 5C4KA 4XP3A 1OPKA 4RVLA 3AC5A 2ITQA 3W18A 2C47A 4JAIA 4ANLA 3FMLA 3GU4A 4FIFA 4QMUA 4UZDA 4IVCA 4NSTA 1JAMA 1ZY4A 3DFAA 3F2NA 4FSQA 3UOKA 1DAWA 2R0UA 3UZTA 3D5XA 3E8CA 2ZV7A 5CSPA 4LUEA 2PK9A 4QYGA 3BV2A 4BHZA 2ITWA 1OZ1A 4F99A 3HX4A 2PHKA 5DIAA 5D11A 4AUAA 4OTGA 4WIHA 4G2FA 4BCQA 2ONLA 3FSKA 5EKOA 2BAQA 1Z5MA 3ZSIA 2W9ZB 4RX7A 5M53A 3LFNA 2PVMA 5CSHA 3H0ZA 1GNGA 2QKWB 2J6MA 3BYMA 3PVWA 3TTIA 4EK5A 3EQRA 4X2GA 3UC3A 1YVJA 4HVIA 5BUIA 2CNVA 4GKIA 3TDWA 4DH1A 4F63A 2C3LA 2Y8OA 3RWQA 3EFWA 5C8NA 3OOGA 2W4KA 4IXPA 2B53A 3AD4A 3MSSA 3VHKA 5HE0A 3BV3A 5B0XA 3G0EA 3QTUA 5KX8A 4AT4A 4XG6A 5A54A 4D0WA 2H9VA 2QD9A 2Z2WA 4GFGA 4TTHB 3P86A 4XS2A 1IASA 3GC8A 4KRDA 4FEXA 4I22A 4DT8A 4FKSA 3ZC6A 1MRUA 3THBA 2XKEA 5KMJA 5K3YA 5J1VA 4ITIA 4WKQA 4IFCA 4K77A 3GCQA 3LQ8A 4A9RA 4DF3A 3NW5A 3ZUUA 4FKVA 4NL0A 3KRLA 4M67A 5HG7A 4ZTRA 3WZKA 4MQ1A 3ZZWA 4BIBA 4CFMA 3DZOA 5C9CA 4Q5EA 5HGIA 2UZOA 2YERA 3FZ1A 3NCGA 1U54B 1TQIA 5AV1A 1Q8WA 4L3PA 4P5QA 2OO8X 4O1PA 2YIYA 5D7AA 5KMIA 3FI4A 4RG0A 4FV9A 4X3JA 3PXKA 4G6OA 5IA1A 1ZLTA 3E92A 5EW8A 3C7QA 2R3QA 3ORZA 3RM7A 1DM2A 3UIMA 3DB8A 5A4CA 4C2WA 2IZUA 2Q83A 5EHYA 3WZEA 3FMKA 4FSZA 4QOXA 5HZNA 2BALA 2C69A 2IZTA 4RIWA 4FEWA 2O63A 5M55A 4QMPA 1WCCA 4FKRA 2I6LA 1OKYA 3ZMMA 2A1AB 4TWNA 3AXWA 4PL3A 4WA9A 5HG5A 4DEHA 4PWNA 2Y6OA 4JDIA 2B9FA 3FZRA 3QRKA 2OU7A 3QWJA 5HOAA 3OCGA 3QTXA 4YO4A 3R8VA 1H1PA 3U51A 3LAUA 4E20A 4K6ZA 1STCE 4ZJJA 3QA8A 3CIKA 4FIHA 4XMOA 1Z57A 5ANDA 5AV2A 4CV9A 4EC8A 1BYGA 3A7JA 4BCOA 1URCA 5A6OA 1ZMWA 3PA3A 2PPQA 4AN9A 2WMRA 3BU3A 3U87A 4LGHA 3TIZA 3DKCA 2OK1A 5CU2A 5LXMA 3SA0A 4MK0A 3LFDA 4IADA 2R3KA 3MB6A 5D7VA 2CKPA 3H3CA 5CAVA 5M4UA 4FTQA 4WSQA 3O17A 4KABA 3C13A 2VO6A 3T9TA 2G2HA 3FY0A 4O6EA 3A8WA 2CNUA 1YOMA 2VU3A 4UYAA 3ZO1A 3LM0A 3AOXA 5DA3A 2BKKA 3A61A
chains in the Genus database with same CATH superfamily
4S32A 4O0YA 3F3UA 4CKRA 5T68A 2J4ZA 2WHBA 1TZDA 3S3IA 3W8QA 4ANMA 4O7LA 4MF1A 1W83A 1XWSA 3P0MA 2XIZA 2XRWA 4IX5A 4LGDA 3ZDUA 4I23A 5I9WA 1WBVA 5EW9A 4OBPA 4F1MA 2ONLC 2WB8A 3A2CA 5DPVA 1WBOA 1YRPA 3QQHA 3A7FA 5I4NA 1M2RA 3FMHA 2KTYA 1IR3A 3HL7A 3NSZA 4CFVA 4YBJA 5M06A 5HTCA 3FAAA 3E64A 2WD1A 3CE3A 4LRJA 4HPTE 3T9IA 4BCGA 1YXVA 4HYIA 3JUHA 4L53A 4CZTA 5IMXA 5ICPA 3C9WA 3EQIA 4GW8A 3IDPA 4C61A 4UMUA 4E4NA 4ALUA 1XH4A 2OIQA 2VTQA 4CKIA 3SV0A 3R7GA 3V51A 5CXZA 3BRBA 2VNWA 2JLDA 2X0PA 3QRJA 3NUNA 4OLIA 5CQUA 4ZTSA 4BYIA 4APCA 4DBXA 3ATSA 2W1GA 4FTUA 1PW2A 1UU3A 3IS5A 3OT3A 2HY0A 3D7TB 3HGKA 1FVVA 3IDBA 4QPSA 2XIYA 5HESA 4BDIA 4XG3A 4FEUA 1PRYA 1QPJA 5FP6A 1OI9A 1U59A 2WMXA 3Q9WA 4ARKA 2UZBA 1VJYA 3QGYA 2PE2A 3ZO3A 4FZAB 4FSMA 4AZWA 3RAKA 3EQHA 4R3RA 4O0WA 4U81A 4YHTA 4TL0A 1YXTA 5BVOA 1XKKA 2E9OA 3KGAA 3EOCA 1PYXA 4GT4A 2WZJA 3C0HA 4FTCA 5AR7A 2XYNA 5AR3A 3VS5A 3VQHA 2Z02A 3R63A 2J2IB 3VBVA 4L6QA 3CD3A 4W4YA 4ZP5A 3F5XA 2GNJA 3UODA 4QP2A 3BE9A 4CRLA 1M2QA 4CKJA 3S95A 3LFFA 2OJ9A 4ZZNA 4GT5A 3DPKA 1JWHA 3DCVA 3ZONA 2RF9A 5C8KA 4EOSA 5FG8A 3NIZA 3CSVA 5FTGA 3IGGA 2GMXA 5J9ZA 2WMAA 4QO9A 3OUKA 2PZ5A 3Q04A 3MBLA 1R3CA 2C6MA 2X7FA 4XRJA 4RQVA 2PVKA 5EM7A 1UU8A 4O2ZA 2J0IA 5HCZA 2E9NA 3W0NA 4U43A 4RMZA 3DDQA 1NVRA 5IU2A 3BHUA 3C4EA 3F7ZA 2W05A 4LOPA 5D9HA 4G34A 4MBJA 1BKXA 4JXFA 4BDJA 5K5XA 3LMIA 5JGDA 1B6CB 3FC2A 3ZTXA 3O50A 4PP9A 1IEPA 2PVFA 3KN5A 4DT9A 2JEDA 3D9VA 3FMEA 3OW3A 4FL1A 4R8QA 4EBVA 5I9YA 2AUHA 4F6WA 5J7BA 4R7IA 3RALA 3FL4A 4DHZA 4FKOA 4RX9A 4OGRA 5EM5A 5IF1A 2V7OA 5F94A 4U40A 1F0QA 5GJGA 2IWIA 4XX9A 5FQDC 5AJQA 2C4GA 3N9XA 3TNPC 4A9TA 4XJ0A 4V0GB 3WF9A 4IVBA 4EBWA 5L8LA 1WMKA 2VWYA 4D2VA 4QMMA 5DT3A 3U8WA 1J7LA 3R7IA 5HLNA 2GNFA 4FUYA 4D4SA 3FC1X 4ZSJA 2UZLA 4CCBA 3R1SA 3NGAA 4C3RA 1U54A 3UVQA 1JOWB 3TUBA 3MVHA 1PXJA 5D1JA 5DFPA 3ZRMA 4AA4A 4YZNA 4ANOA 5LQFA 4V05A 3QUEA 2IVTA 3V3VA 4KSQA 4QDVA 3PWYA 2EVAA 3TZ9A 2P4IA 2J0MB 4CFNA 1W82A 2HIWA 3CEKA 1ZYCA 2B52A 2WMUA 4FT5A 4IH8A 1O9UA 1VZOA 2J0KA 2XM8A 4JIKA 1XH5A 3MTLA 2BROA 2CPKE 3QTWA 3UDTA 4ZY5A 3ZRLA 3UDZA 3OEZA 4NWMA 2BILB 4RGJA 5BVEA 4C3PA 2QI8A 4RC2A 5JQ8A 3OFMA 4ITJA 4O0UA 1CMKE 3FXWA 4JR7A 1SMHA 2Z7SA 4JIAA 4BHNA 4DCAA 2H6DA 4LOQA 4QMXA 2XH5A 5CNOA 2GNHA 2OJGA 1HCLA 2EWAA 4FF8A 4WUAA 2XBAA 3HECA 2O5KA 1DS5A 2UZNA 4NW6A 3RVGA 3WZDA 3ZM4A 4EH6A 3MDYA 2B0QA 3TKUA 3GU7A 2XZSA 2VWUA 3LM5A 4J96A 2ITYA 4B8MA 4UX9A 5JRSA 3PJ2A 2NPQA 1B39A 2GU8A 2IW9A 3DGKA 3FXZA 1JKKA 5IG1A 4KIOA 4WO5A 3R8LA 4FV4A 1E9HA 4CD0A 3R9OA 3CTHA 4OTFA 4CRSA 1Z9XA 4X0MA 5DI1A 4XOZA 4O4BB 2G9XA 1YDRE 1E1XA 4EYMA 4DN5A 3ZEPA 3ALOA 3LFAA 1FQ1B 1U46A 3R73A 4KBCA 3QKMA 4A4OA 4X21A 4RVKA 4YC6A 5A3XA 2NO3A 3GCPA 5IH4A 4GT3A 4C36A 3EFJA 4IM3A 4U41A 5HNIX 5TR6A 3VO3A 4B6LA 4A07A 1G8JA 4X2NA 3Q4ZA 3CPCA 4A9UA 4BCHA 2I7QA 4GG7A 2IVSA 3V5PA 3R9RA 3EQFA 2Y7JA 3I0QA 3I1AA 4YC8A 5E8SA 1CTPE 2CCHA 4AF3A 4U5JA 4D2PA 2CGVA 4E8AA 5EQYA 5E8UA 3GEQA 3ZYAA 3NNUA 4QMYA 2X0GA 2HWPA 1Q5KA 2OSCA 4L67A 1PMNA 5CSVA 3TCPA 4EZ7A 2IW8A 4IAFA 4NM3A 4ERKA 3EB0A 3PYYA 4W4WA 3DBQA 5FDPA 3Q32A 4KS7A 4BICA 2QONA 3AT3A 4YZCA 5J87A 4DHIB 4YLJA 2JIIA 3OC1A 4MNFA 4WBOA 4D4VA 3NAXA 3FQHA 4OTIA 5CT7A 4F65A 4AS0A 1OIYA 3G90X 1H01A 3DXQA 3PJ8A 3W2CA 1NW1A 3ZO2A 2XNPA 1TQMA 3BL7A 2OF4A 2CCIA 3MJ2A 2ITPA 3D7TA 1FVRA 4EHVA 2EB3A 3QD4A 2QHMA 4AT3A 4UMTA 3Q6UA 1WBTA 4RWKA 5A14A 2XIXA 4E5BA 3AMYA 2LGCA 3Q9YA 4ASDA 1H1SA 4G6NA 2C6EA 3DT1A 4I5HA 5ANGA 1ZZ2A 4W4XA 3VS3A 3DJ7A 4IZ7A 3IOKA 2XK7A 2VTLA 4FL3A 4NEUA 3R7VA 2ZMCA 1YOJA 4E3CA 1XBBA 3A4OX 2Y0AA 1XR1A 2VUWA 4IFGA 2CHLA 3EMGA 2CJMA 2GTNA 4MBIA 4DHFA 2HYYA 4JG7A 4OUCA 5CYIA 2C0IA 2F49A 3QTRA 4ZLZA 2WTWA 2Q0NA 3ZFYA 2WTDA 3E87A 5AA8A 3FMJA 1PXKA 3CGOA 3RK5A 4FSTA 4XYFA 4G9RA 5IUHA 4L3LA 3JVSA 1W8CA 3KN6A 4GEOA 4C62A 4F0IA 2YWVA 3PZEA 5DRDA 5J8IA 4NJDA 3QQLA 2UVXA 3GCSA 4TXCA 4EORA 2YM7A 5T3QA 4C37A 4QP9A 3RZBA 4BIEA 4DGMA 1KOAA 2W1DA 3GCVA 4AGWA 4BL1A 3QQFA 4IHPA 4O7YA 4C34A 4OAUC 4YJRA 3I79A 3PPZA 3C4FA 4YR8A 3B8QA 4ID7A 2QCSA 3QLFA 1JPAA 3Q2JA 5AR2A 3OXZA 4AU8A 3PUFC 4DTBA 3HZTA 4EWHA 3NW7A 3I5ZA 4WHZA 1U5QA 2BDFA 2X2LA 2BUJA 4H39A 4YTHA 4CFUA 1NY3A 2XNEA 3FZSA 5D12A 3NRMA 2ZM4A 1H8FA 5EW3A 4F6UA 2RL5A 5EK7A 1OKVA 3LE6A 3BWFA 3IW6A 4IQ6A 1GZNA 3CY3A 4NM0A 4U44A 3CBLA 2RG6A 4YJSA 4MH7A 5FXQA 1GIIA 4XG2A 3C51A 1YHWA 3EQGA 3LJ2A 5M4CA 1R78A 3Q60A 3CCNA 4GVJA 4M66A 4EL9A 3QGWA 4QMNA 3UGCA 4BF2A 4FTKA 4CYIA 2FVDA 4JG6A 5HG8A 2XAMA 2GNLA 4AQCA 4V0GA 5HCXA 2PVNA 3P9JA 3OMVA 3R8PA 5CXHA 2WXVA 3K3IA 4E4LA 4H3PA 4E26A 2X7GA 5EQEA 2YDIA 4NFMA 4FV6A 4A9YA 2CGUA 2BZJA 5HE3A 2XALA 4XEYA 3JPVA 3T8OA 4QMSA 3FMDA 4CEGA 5M4IA 3EN9A 1UU9A 3F3TA 4FTOA 2W4JA 3ERKA 4X6RA 5LCKA 5M44A 3LW0A 5EDQA 2C5NA 2OI4X 4C58A 2CN8A 2JKMA 3G5DA 3RNYA 5CAOA 4QEBA 5M08A 1I09A 4D2WA 4HVHA 4CG8A 5J95A 3NVMB 5C03A 4BIDA 2BRMA 4W9WA 2ZM3A 4LRKA 3RINA 3VIDA 5HORA 4YSMA 2UZDA 1H0VA 4QP3A 4XLVA 3VUKA 3G0FA 4AGDA 1H28A 4G3CA 3ENHA 5AV0A 3DTCA 5AP1A 4O7SA 3NUPA 4RFYA 3HA6A 4DLIA 3OWJA 2W1FA 4O84A 4I6BA 1PXOA 2UW3A 5L2IA 4YJOA 2IPXA 4EJNA 3OEFX 3ZLXA 4O0RA 4EH5A 2IN6A 3Q5IA 3JR1A 4D58A 3IG7A 4JRNA 2ITVA 4CCUA 3V5TA 3LJ1A 2XK4A 3H0YA 3GB2A 3OTVA 4ZY4A 5HU3A 4OBOA 1TFFA 5HG9A 2IVVA 2W0JA 1T46A 3OCSA 2W06A 4JOAA 4K9YA 4M12A 2J9MA 2HCKA 4AXCA 3BYOA 4QYEA 3L8XA 5HLWA 1R0EA 5CQWA 2ZDTA 4UMRA 3VBTA 3PIZA 4HVSA 4IC7A 4F7JA 4QP4A 3BL9A 4PDPA 4U8ZA 2JDTA 4N57A 3G2FA 4PP7A 4P5ZA 4RRVA 5DWRA 4AOIA 2YA9A 3QU0A 3JVRA 3M2WA 4DGGA 3BYSA 2OIDA 3C5UA 3ZXZA 5AP4A 2PE1A 5EI6A 2X6EA 2YHVA 4QNAA 1YWVA 5CLPA 5H3QA 2J90A 3QHWA 4EOJA 3HRCA 3GI3A 4MXZA 4YHFA 4L45A 2I40A 3MIAA 4G5JA 3CGFA 5HCYA 3LFBA 1BLXA 4II5A 3MIYA 2GQGA 3R28A 2CNQA 3IGOA 3ZCLA 5CASA 3DV3A 3KREA 1W2FA 2A98A 3EJ1A 3HDMA 3ROCA 3NFGB 4RC3A 5CI7A 3V04A 3O8UA 4XBUA 5CY3A 5F20A 2ZM1A 2PZPA 3SLSA 4I4EA 4EOKA 5JGAA 3W0PA 1CM8A 3MI9A 2QOHA 4F1TA 3HNGA 2B9JA 4NFNA 2VTAA 3FPMA 3H9OA 2WNTA 3PG3A 3H9RA 4QMZA 3R7OA 4G3FA 1SZMA 2YLFA 4X6QC 5HIBA 5H8BA 1PMEA 4GYGA 5HNGA 5KBRA 4EI4A 4FT9A 2BTRA 2PVRA 4DEIA 4J99A 4IANA 1YI6A 4FG9A 3MJ1A 2OXDA 4V01A 3ORNA 3ZFXA 1M52A 5B2LA 1P4FA 5H8GA 4XG4A 4PMPA 5JQ5A 5ACKA 4I4FA 4FV8A 2XCHA 5DT4A 5C01A 4FIGA 4K8AA 1R39A 2DS1A 4E4MA 3I0OA 2QG5A 2GCDA 3FI2A 3UIUA 1V0BA 4CV8A 4K11A 3E63A 4DGOA 4I3ZA 4W8DA 2XCKA 3UP7A 5AX3A 5JFXA 4UB7A 3U54A 4FZFB 5EYDA 1J1CA 3NR9A 4YSJA 2O64A 2VTNA 1GOLA 4TRLA 4EC9A 3R71A 3GUBA 3LCTA 4TYEA 4KNBA 1YDSE 4MNEB 3V8SA 2BRNA 2J0LA 4L7SA 4OTPA 3LHJA 3U6HA 3AMBA 3FMNA 4YTFA 4YURA 4OW8A 5KMLA 1KWPA 2CSNA 4XRLA 4ACMA 2H34A 4KSPA 1XH8A 1MQBA 2BHEA 4KKEA 3V5QA 1XQZA 2X8DA 2WAJA 3A4PA 3FXXA 1A48A 4LV8A 3WYYA 1ZYSA 2XNBA 2G2IA 2YM5A 4DFNA 3H9FA 2UW9A 3DJ6A 1J3HA 2XP2A 3HUBA 4ANBA 4ZLOA 2VX3A 3ZM9A 3QYWA 3CJFA 5I3OA 4FT3A 3QCYA 4YBKA 5AP0A 3FWQA 5HX8A 3VWAA 3SGCA 3MY5A 5GIOE 5AR4A 5G1XA 4ZSAA 5IPJA 2F2UA 2J50A 4O83A 2C1BA 3FLQA 4RA4A 5HKMA 4IEBA 2WOTA 4QRCA 4BTKA 4E5WA 5CEKA 2XS0A 4KKHA 3PTGA 4UMQA 1ND4A 4QP7A 1URWA 3P7CA 4DEAA 3D94A 1U5RA 2ETMA 3BCEA 3POOA 3IPHA 4X2JA 4QMQA 2WIPA 1UNLA 3S0OA 2X1NA 5HTIA 5E8WA 4FSUA 4DH8A 3KXHA 4O6LA 1W0XC 3BLHA 4QTBA 5DN3A 2X2KA 4PDSA 3FBVA 4FKUA 4JG8A 4X7QA 4CMTA 4OAVB 4RWIA 2YN8A 3MH0A 4HYHA 4I92A 3R30A 4BVUA 2C5XA 3PWDA 4NTSA 5HNBA 5AA9A 3GNIB 3DK7A 3MS9A 1OUKA 5LARA 3R9DA 1KUTA 3FHRA 3QCSA 3WIKA 3F9NA 3BLQA 4GK3A 4IAIA 3KIOC 4QYHA 3WARA 3VBWA 1IA9A 4MYGA 4FIIA 3R2YA 4BRXA 4CLJA 3W0RA 1WAKA 4I20A 2BVAA 2PMLX 2X9EA 3FYKX 4GG5A 4I6HA 4PL5A 3NNVA 1JQHA 3DKFA 3VBYA 3ZUTA 3PJCA 5BVWA 5AUVA 3UMWA 3UZPA 3VS1A 2F4JA 2HW7A 3DY7A 4ENYA 3H10A 4PNIA 4IM2A 3LOKA 5BYYA 4YZDA 3KMUA 5A46A 3LMGA 1YXUA 4O4DA 3HV5A 5K4JA 3HAMA 4E6AA 4QMWA 2XANA 5I3RA 3QCQA 2F7ZE 2O8YA 3LQ3A 4BTMA 3TNIA 3P08A 3ZSHA 3QKLA 4YGAA 2OWBA 1SVGA 1YW2A 3B8RA 4A06A 2OJJA 3OOMA 3MH3A 2C6OA 5FWKK 3M1SA 4LL5A 3VUHA 4XV1A 4AN2A 4BCJA 5L6WL 4ZIMA 4H3QA 2R3RA 3LFSA 1PKDA 2FGIA 3UQCA 2W9FB 4PF4A 4O22A 3BEAA 3RPSA 3R1QA 1IA8A 2C6TA 4FKGA 5KHXA 2ERZE 3NVKI 2PL0A 3ORXA 2A0CX 2BFXA 4Y5QA 2OJIA 4S34A 4PMMA 5JFVA 4FKJA 4OT6A 5EQPA 5EYMA 2ZB1A 1AQ1A 3MA3A 4JR3A 1JNKA 2Q0BA 3IW4A 3C1XA 2E9UA 3FY2A 3KB7A 5DGZA 2X0QA 2QG7A 4F7SA 1G5SA 4FOBA 4S33A 3S1HA 5IQIA 3E7OA 3V8TA 5LWNA 3EL8A 3NEWA 4MHAA 4PRJA 1XH6A 3KA0A 4S30A 5GZ9A 4EOQA 3EH9A 5IA4A 3FV8A 4KINA 3TMOA 4X2KA 5L8JA 4NKSA 4EEVA 4FEQA 4G3GA 3HYHA 4Y72A 3ZBFA 3AQVA 3IECA 4IDTA 2DQ7X 4DYMA 4F9CA 4FKTA 4WT6A 1UWHA 2J51A 2BPMA 3GOKA 4MF0A 3SVVA 4FSYA 1YHSA 3UDSA 4TYIA 1YHVA 2JFLA 3F5PA 4MVFA 2R2PA 4YJVA 4EK6A 3NS9A 3QZFA 4PNKA 4AOTA 2RG5A 4L7FA 3ANRA 4JNWA 3D7ZA 2Z60A 3WOWA 3C50A 4QQJA 1R1WA 2R3FA 4H05A 4FA2A 5M57A 4IDVA 3P4KA 2YABA 1BL7A 2Z7QA 3BYUA 1H0WA 4HGSA 5FEEA 3TEIA 4HZRA 4EYJA 4PPCA 1KV2A 5FXSA 3MPAA 1UU7A 3TKHA 3OWKA 1UNHA 4IX3A 5F9EA 3OBJA 2EB2A 4QMLA 4MD8E 5KUPA 3HUCA 5E8YA 5IKWA 3VN9A 3VUMA 4DFZE 4DFXE 3O0GA 4PDOA 4EH8A 2I0YA 1XO2B 3BQRA 3NX8A 4YC3A 5AV4A 3EQPA 4KKGA 3KRXA 3QC9A 3VAPA 4EOMA 4AFEA 3W0QA 4KIQA 1P14A 5CI6A 3UQFA 4IAAA 2W1HA 3RK9A 3EFKA 4C0TA 5CZIA 4Y73A 3NUXA 3FQEA 3UYTA 4KWPA 3LQ5A 4E6CA 5HBJA 3Q3BA 4ZTHA 4BI2A 2VX1A 3BX5A 1YWRA 1A06A 1K3AA 3RHKA 1ZMVA 1B38A 3DU8A 3R2BA 3OTUA 2YIRA 5GZAA 4MWIA 3AT2A 1FINA 3PXRA 3SAYA 4DG3E 3FPQA 4DFLA 5BNJA 2A27A 4DH5A 2RFNA 5CX9A 2JDVA 5TOZA 4MTAA 4BDDA 2X8IA 1XBAA 2J5EA 3S2PA 4YTCA 4U42A 4C02A 3O71A 2JDRA 3E93A 1GZ8A 3JYAA 4MNEA 3VBXA 4F64A 5BV3A 1UV5A 4LMUA 2VGPA 4AXDA 4BDHA 4S2ZA 2BR1A 4R3CA 5IA0A 5AV3A 3COIA 5H2UA 3BGQA 2F7EE 5L2TA 2BKZA 2O0UA 2AYPA 4TWOA 3SC1A 3KVWA 4TY1A 2UZTA 3QC4A 1HCKA 3EKKA 4JJRA 2QO2A 3ORMA 4DG0E 3TNWA 4YJNA 5AP7A 3D5VA 3GXLA 2UZWE 1JKTA 3QZGA 4CVAA 4BCPA 1O6YA 2XB7A 2Y4IC 3BHHA 5IDPA 1UKHA 4IB0A 3PXFA 3C4XA 3Q9XA 3SOAA 5A6NA 4QQTA 5D10A 4AZEA 5EI8A 3OD6X 1LEZA 2C6DA 4RJ6A 4KB8A 4IWQA 5JK3A 5CEQA 2RKUA 4XH6A 2WMVA 5CALA 1GZKA 2XIKA 5CVFA 4QDEA 3PSCA 2WGJA 4P4CA 4R7BA 2JKQA 4O2PA 3UNKA 4TYHB 2XEYA 4MXXA 5AUZA 2ITOA 4AZVA 2QOKA 4CSVA 4CZUA 3AKLA 3MY1A 2W96B 4ZMFA 3BHYA 1BI8A 3ZDIA 4OT5A 2O65A 2IO6A 2YAKA 1F3MC 3Q9ZA 4TYJA 1W2CA 3L9NA 4O4EA 5AP6A 5F95A 3IK3A 3WF7A 4GIHA 2UZVA 3EQCA 3VC4A 3ACJA 2BRHA 3AC3A 3PE2A 3M11A 4KUJA 3AMAA 2W1ZA 4TKSA 2G01A 2YIQA 3F3WA 4FVPA 4GU9A 4IWPA 4RT7A 2QO9A 1FVTA 3VW6A 4TWCA 2HAKA 4F7NA 3AC1A 3GP0A 3MVLA 3MESA 3IDCA 4LM5A 4LUDA 1RW8A 4NCTA 1KE8A 3LMHA 2YM4A 5DHJA 4QTEA 4BZOA 3D5UA 2YCRA 4DA5A 4JQ7A 4BKYA 3COMA 4EK4A 4IWOA 3U9NA 2W1EA 3CTJA 3JY9A 2XK3A 3WYXA 3C4ZA 4C7TA 5EDRA 3PE1A 4GL9A 5I9ZA 4FTLA 3DS6A 5HVKA 3AKJA 3ID6C 3HEGA 2W1CA 4YNEA 4BDEA 5TE0A 2OXXA 4FKPA 3W2PA 5FUTA 1ZOHA 3GQLA 4G6LA 4XP2A 1R0PA 3AC8A 2VGOA 4RJ3A 2QR8A 4GYIA 3BLRA 4P7EA 4J52A 3TV7A 3RPRA 3CS9A 2XKCA 2XIRA 3R01A 2CKQA 1IG1A 4QT1A 4X3FB 2YZLA 2W5HA 4QMOA 2ETKA 1PF8A 4NYEA 4I1ZA 3WE8A 1MP8A 1ZY5A 4U0IA 1YXSA 1ZRZA 2VRXA 1ZAOA 3PZHA 3RKBA 3W1FA 3W0MA 3WF6A 3QUDA 5IQGA 1PKGA 3ULZA 1WFCA 5BVFA 4ORKA 4NJ3A 3QRUA 2PSQA 4CLIA 1CKJA 4O0TA 3I7CA 3KXGA 3PUPA 4D28A 5A4QA 3CQWA 4PMSA 4IW0A 2C68A 3UC4A 5E9EA 1JBPE 5I9UA 1UKIA 2ESMA 3OCTA 3EWHA 2QOCA 3GC0A 3A60A 1FPUA 1V0OA 2UV2A 2OGVA 3QA0A 2AC5A 1GJOA 3JXWA 4HPUE 4IVDA 3LLTA 2QKRA 3ZFMA 3U6IA 2CLXA 4FT0A 3OY1A 4G1WA 2V5QA 3RBWA 3VF9A 5CF6A 4FBXA 2V55A 3D2KA 4IJPA 3POZA 3HDNA 2P0CA 1ZYLA 4FG8A 3V01A 2WFYA 2YIWA 4AW1A 5CF5A 4LQMA 3C0IA 4UWCA 2WTJA 3V6SA 4E6DA 3L9LA 4EOPA 3BBWA 4PTEA 1ATPE 3FHIA 4CTBA 3OP5A 3UBDA 4FVQA 4RZWA 4EQUA 4JX3A 3CXWA 3SDJA 3KXXA 5K0KA 3LCSA 2JGZA 4BGGA 2C3IB 3PP1A 2IF8A 2JDSA 2OZAB 5ANOA 4JBVA 1ZARA 4GUEA 3V5JA 4BTJA 4EOIA 1Y6AA 3AKKA 2X4FA 4YZBA 3LCDA 4FJVA 1XBCA 3F5GA 4XHKB 4A9SA 3OF0A 2I0VA 3QXOA 3Q4CA 4HOKA 2WTVA 2GHLA 5LVLA 4KA3A 4AZFA 1ZOEA 3VS4A 4OTDA 4B7TA 5EM6A 4AG8A 4WG5A 2H96A 3ZXTA 5ANIA 3F3VA 3K3JA 2PY3A 4YJUA 5HEZA 4BI1A 1CKIA 4F1OA 4N70A 2YIXA 4FNYA 3I60A 1OL6A 2YEXA 4AX8A 3LVPA 4UYNA 4L8MA 3QQJA 4LG4A 1S9IA 3KCFA 4O7VA 5J1WA 3HLLA 4LL0A 5G6VA 3UE4A 4NU1A 4RPVA 4I5PA 3Q5ZA 2E9PA 3MV5A 5AUYA 1OKWA 4NCTC 3K5VA 2HXLA 2FSMX 1I44A 3QBNA 2PE0A 4FIEA 4E73A 4F6SA 1O6KA 4K0YA 4M7IA 3GBZA 5JZJA 4BTFA 3BHTA 5DEWA 2PUIA 4MUQA 4HVDA 2V0DA 3OCBA 2C0TA 4JDJA 3RHXA 3DBEA 4I6LA 4QYYA 4P90A 5AAEA 2ZV9A 3AC2A 4JVGA 4YJPA 3VQUA 3QD0A 2EUFB 4C4EA 2AQXA 2C5OA 4L43A 4JDHA 2XAOA 4ZSEA 3E3BX 4D55A 2HZIA 1ZXEA 5IA5A 3ZBXA 3FLSA 4FX3A 4FK3A 5HVYA 5E90A 3ORKA 4KIPA 3E62A 5FRIA 3W16A 3DKOA 4D0XA 5ETIA 5HX6A 3NW6A 2R3PA 3VRYA 1CDKA 2QR7A 2XK6A 2XNMA 3R21A 3QTSA 4GJ2A 4WG3A 1W84A 2GTMA 4AACA 4WNOA 1LP4A 3ELJA 1OL2A 4RWLA 4UEUA 4XNEA 4DEBA 1OL5A 3UTOA 3R8UA 2JKKA 5DH3A 1Y8YA 3MPMA 3N4TA 3E3PA 4TYHA 3F2RA 4AXEA 4FOCA 5AAGA 2QURA 3DZQA 4IZYA 1Q8ZA 3D4QA 2UW7A 4UMPA 3KK9A 3LCKA 5E91A 4WBBB 1WBSA 3UOJA 4FTTA 3VJOA 4WRGA 4LI5A 3MA6A 2PVHA 4RZVA 3K5UA 4DC2A 3AT4A 3LCOA 1VYZA 3O8TA 3HV6A 3DB6A 3QHRA 4JBQA 4GH2A 2B9HA 4GK4A 5AEPA 3OUNB 5DMZA 1ST4A 4JBPA 5F1ZA 3ORIA 3M42A 2YLEA 4XV9A 5GHVA 3NYXA 2VWBA 2X4ZA 4F9WA 3F66A 5JRQA 4QTDA 2ZVAA 3UYSA 2R3HA 4JX7A 4RC4A 5DRBA 5CAUA 3KRJA 2VTOA 3L1SA 3KF7A 3N4UA 2HENA 4LFIA 3NFFB 3P23A 4BZNA 4N4SA 3WBLA 3TNHA 3DTWA 2V7AA 4DH3A 4D2TA 3AD6A 1H00A 4D9TA 1Q4LA 4HCVA 5FGKA 5KE0A 4BDGA 5ITAA 4GKHA 3KVXA 4FICA 3UOHA 3SQQA 4O7RA 4MD9E 5ANKA 4FYNA 3CKWA 4FTJA 4ZAUA 2C3JA 5AP2A 3F7WA 5TO8A 4G9CA 4U45A 1OUYA 4JQ8A 3RJCA 4X3FA 5L8KA 4BGQA 4Z7HA 4FRFA 2PVYA 5AWMA 2PTKA 4MXYA 3CPBA 3FL5A 3KQ7A 3MN3A 3CP9A 3KL8A 4FTRA 2XK8A 4GFMA 4GU6A 4I94A 3UJGA 4AFJA 4BZDA 3EYGA 4FKLA 4EQMA 4B9DA 3QQKA 2WOUA 3MB7A 5KHWA 1M14A 4HVGA 4IJ9A 4WSYA 3RP9A 3SXRA 4MAOA 3R7UA 3HRFA 5L2SA 1BL6A 2UW6A 5CU3A 4Y95A 4CMUA 1S9JA 4IBMA 2WU7A 2PVJA 3ORTA 4DG2E 2YCQA 3QX4A 2BDJA 4L42A 3ENMA 1GAGA 3DJ5A 2C30A 4AAYA 1YI3A 3F88A 3UIXA 3MYGA 1NA7A 3KMMA 4QMTA 2WMTA 2XMYA 5K5NA 1CKPA 5IEXA 4RJ7A 4K18A 5EKNA 2VO7A 4J7BA 4C59A 2VO3A 4KD1A 4TT7A 4YNOA 4E7WA 2DWBA 3R02A 5CENA 3LIJA 4FKIA 2Y4IB <