3BU6A

Crystal structure of the insulin receptor kinase in complex with irs2 krlb phosphopeptide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
294
Chain Sequence
DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords insulin receptor subunit beta
publication title Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 294
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bu6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bu6A01
2HZ0A 3ZLWA 3KULA 1ZY5A 3P1AA 4ZJJA 3ZUVA 2YAAA 4LV5A 5KCVA 3IKAA 2XIKA 4GL9A 2BHEA 3RZFA 2PPQA 1GZNA 3T9IA 3QZIA 5LCKA 4U0IA 4C3RA 4QP6A 4ZLYA 4RJ8A 4RPVA 4JLCA 2V7OA 3HLLA 3RPVA 4RIXB 3O8PA 4EWQA 1GOLA 2G9XA 4RJ3A 2A0CX 3MN3A 3RM7A 3V5WA 3UMXA 4QT1A 3VUDA 3JYAA 4I5MA 2G2IA 5M4FA 3PE1A 4P4CA 2WEVA 5EYDA 5DT3A 2Y7JA 4C4GA 1DS5A 3UPZA 2ONLC 5TF9A 3I81A 4ZY4A 3WYYA 4BYIA 1Q62A 5CEPA 4BCGA 4CXAA 2XZSA 4O1PA 2EWAA 4K6ZA 5EFQA 1WVYA 4BCNA 5FUTA 1H08A 1ZZLA 2IN6A 5HNBA 4QMPA 4RX9A 4IWDA 2X39A 5BUEA 3PSDA 4LRMA 3IW6A 2FH9A 3BHHA 3C0IA 5F1ZA 4FBXA 3FYKX 3BELA 4BCHA 5IISA 2OXDA 3TACA 1JPAA 5LMBA 1MQ4A 2UW8A 2OBJA 3BYVA 4WNMA 2JKOA 1O6YA 3GNIB 5ANDA 4ZSGA 3HGKA 4ASEA 4E20A 3RCJA 4EOMA 1PF8A 1HCKA 3ZO2A 5AJQA 3ZXZA 2QO7A 2BRNA 4KIPA 4FGBA 3TT0A 5DA3A 5CI6A 3WZDA 1XH4A 4G31A 2VGPA 3NUPA 4FK6A 4JRNA 4ZEGA 3D9VA 3DNEA 1GNGA 3OUKA 4KIKB 4CD0A 4C35A 1PXIA 3NUXA 3DBFA 4JG8A 4KS7A 2WQOA 3TTIA 4P2KA 2XYNA 3ACKA 1WBWA 4CT2A 4QYHA 4G1WA 5D41A 4JNWA 4MF1A 2E9NA 4D5HA 4KSQA 3SW4A 1YI4A 4K33A 2QLQA 5LVMA 3DBCA 4W8EA 3WF9A 3FLNC 3PY0A 4EOSA 3PPJA 3VJOA 4J98A 3KRWA 4XJ0A 4BGQA 3I7BA 3PLAE 5EW9A 2W4JA 3K5UA 2Y0AA 4F6UA 5IU2A 5M57A 4E4MA 4RFMA 3JR1A 5HO7A 4KBKA 2C68A 3NPCA 3CSVA 3UVPA 2X7OA 4BTKA 5ITAA 5K0KA 2UZLA 1GZKA 3BQCA 3NYXA 4DBXA 4EHZA 5CEKA 4XRLA 2WTKC 4JR7A 2PUNA 3BWJA 5IQBA 3KGAA 5EI6A 2E9UA 3RKBA 4DH7A 3KFAA 4ASXA 3PUPA 3KMMA 2WFYA 3AXWA 2BTSA 4DH3A 2R3FA 5C27A 5JKGA 3NUUA 4ZZMA 4ACMA 3BU3A 4F63A 2HWPA 3KREA 3QRTA 5DG5A 5FBOA 3R8VA 2PE0A 3PJ3A 2HY81 3W16A 3ZLSA 2BROA 3FC1X 4CMOA 5ACKA 1J7UA 1S9JA 2XNNA 2C1BA 2GU8A 4IJ9A 3LHJA 5HESA 5JGAA 3TV7A 2HZIA 4GCJA 2HY0A 3DKFA 4GS6A 4LOQA 4O2ZA 4U81A 3BWFA 4JDKA 4FA2A 4EH8A 4R78A 2HELA 5ANEA 2X81A 4AA4A 5KX8A 3UZTA 3GVUA 5LMKA 3ATTA 3R7UA 2JBPA 4FTRA 4O27B 2WMQA 4U80A 5HLPA 3FI3A 5FEQA 2VV9A 3R7EA 4BCQA 5IUHA 3A7GA 5DR2A 3ZYAA 2BAJA 3C7QA 3R8UA 3P86A 3S95A 4OT6A 1WCCA 2X6EA 5KMJA 5M07A 3G5DA 4DEAA 3FZ1A 2OG8A 2XF0A 4LMNA 4UZHA 4I5PA 4L67A 4HPUE 4FKVA 3IDBA 4BWPA 2F2CB 3TKIA 3UOHA 3ZHPC 3JPVA 2FA2A 5E92A 3L8SA 1H1WA 4O7VA 1Y8GA 4XP3A 1YOLA 5D7AA 4TWNA 3NRMA 4MXAA 5FWKK 5HE3A 4PMPA 4AP7A 2XRWA 1URWA 4LQMA 1Q4LA 5CZIA 5D1JA 2C6LA 4O2PA 2V0DA 4LGGA 4Z7GA 4PP9A 4RC2A 1I44A 4YPSA 4FT0A 4F7NA 4EH2A 2XEYA 3G9NA 4TXCA 5GINE 3KXMA 2PMIA 3PRIA 5C1QB 4GSBA 4EQMA 2CNUA 3PJ1A 4AAAA 3OWPA 5LARA 2P33A 5EOBA 1PXMA 4UWCA 4N6YA 1UVRA 3I7CA 5IUGA 1DI8A 4GYIA 3QQJA 4QNAA 4PMTA 5T68A 3UIUA 3P7BA 2XBJA 5FTOA 5A4LA 3OS3A 1KUTA 4UZDA 1FVVA 1OM1A 2PMNX 4F9YA 3HV5A 2OH4A 3OG7A 5A4QA 4FKWA 2A1AB 5IA1A 2XKFA 2W06A 1VR2A 4XV3A 3M1SA 4EC9A 1CDKA 4I6FA 3RM6A 4FEQA 2BPMA 3D14A 4AN3A 2XVDA 2GQRA 2OFVA 4WNPA 3QCXA 4C02A 3QTSA 4M0YA 4C61A 3ZC6A 2W4KA 4JDHA 5EI2A 3U6JA 2BR1A 3F66A 5GZ8A 3NR9A 5AUUA 5J1VA 3UP7A 3OW4A 1Q8YA 4YHTA 3TNIA 3MS9A 3VULA 4FEUA 2VGOA 5H9BA 5AUZA 3TCPA 4C59A 4IX3A 5IA0A 5M4UA 4O7RA 1K3AA 1O6KA 3IGOA 3MPTA 4G6NA 5A4CA 5FTGA 5AEPA 1LEWA 3R2BA 1O6LA 4E6AA 4D9UA 1JVPP 2O8YA 3FWQA 4O91A 3UG1A 1BLXA 1ZZ2A 5HG5A 2WMTA 3EYHA 5G1XA 3CIKA 4ZSAA 4ID7A 5EHOA 2ZV2A 5F9EA 5L2TA 2BFYA 3NZ0A 3VBYA 2UW5A 4F9BA 3HMIA 1FBNA 5HBEA 5J9LA 2XRUA 5CVGA 2BALA 2QOCA 2YDIA 1OL7A 2C47A 4LGDA 3M11A 2YLFA 2QODA 3GXLA 3V51A 1TQIA 3DOGA 2OIBA 3R8LA 4EK4A 2WB8A 4O84A 2J7TA 3UBDA 4UMRA 4QQCA 3QD2B 4FL2A 3SXRA 2WEIA 2R4BA 1YXUA 4MXYA 5IQEA 4FV3A 5C4LA 2QOLA 3MB7A 3OCGA 4BB4A 3BU5A 2ITYA 2BVAA 4GKHA 4FEWA 4QTBA 4AZSA 4NFNA 4AOTA 1OPLA 2QOIA 5KE0A 4TNDA 5KMKA 3HMOA 2VTIA 3W10A 4BRXA 3PJCA 1JLUE 5A54A 1NXKA 5HG8A 1SM2A 3CGFA 4R7HA 4C3PA 5CU2A 4AE9A 3PPZA 2XIYA 1MP8A 4BHZA 3LFEA 1OI9A 4YBKA 4YMJA 2UZBA 4OTDA 4USEA 2W05A 4YTCA 3OP5A 4E26A 2P4IA 1PXNA 1QCFA 4U43A 4BDGA 2RFDA 3OWKA 4UWYA 3EQIA 3RPSA 4CG9A 3WIGA 5FP6A 4EL9A 3F5GA 4UXQA 4BBMA 4DINA 4HVHA 2VWXA 4U40A 1G8AA 4FKPA 4AN9A 4RJ6A 3ULIA 5HBJA 1GZ8A 2OU7A 4Y95A 5CXZA 4FOBA 4J99A 3FMDA 5M06A 4YTHA 4G3DA 5H2UA 2R3JA 4JQ7A 4QMXA 3I79A 1CKPA 4H05A 4EWHA 3MH0A 2YJRA 4FODA 3FMMA 3E88A 4HZRA 4QPMA 4I21A 4C4HA 2W96B 3OMVA 3F61A 3TG1A 1CKIA 4F6WA 2J51A 5CF8A 5CASA 3BLRA 3QWJA 4AE6A 4FIIA 4YURA 2YIYA 3A2CA 5AP4A 2PE1A 4O0XA 4BCPA 4V04A 5LCJA 4AG8A 5AR3A 1F3MC 2JDVA 3DNDA 4CQGA 5KMOA 2H34A 3Q5ZA 5ANKA 1UA2A 2BDWA 4OTPA 5CU4A 2H8HA 1MRYA 2ITZA 2PVHA 2FB8A 3MY0A 2VWIA 3B8RA 3MA3A 3D4QA 4FSWA 2JDTA 4CCBA 2BZKB 3C50A 3UDBA 1L8TA 1JKTA 1XJDA 2NP8A 3GEQA 4RX8A 4YBJA 3MV5A 5LVLA 3NSZA 4DFUA 4PV0A 2PZPA 4ITIA 2CLXA 3T3VA 1F5QA 3FZRA 5EH0A 3WBLA 3WIKA 4IAKA 3QTXA 3ZSHA 3R1QA 3POOA 2OJJA 1B38A 4AZVA 4IADA 2QI8A 3SOAA 1KWPA 3E7VA 4DFNA 3DXQA 3ENMA 3BRBA 4HVSA 1OUKA 2Y4IC 3QD3A 4DFXE 5E9EA 2VTJA 3PVGA 4WUAA 5M09A 4O7NA 3FKLA 3LCDA 2W1HA 3KK8A 4IFCA 4DG0E 3GQLA 4ANBA 4KIQA 5IA5A 5FRIA 2QG5A 1PW2A 1YHWA 2C5NA 2WXVA 3G6HA 5F20A 4HOKA 4WBBB 4RJ7A 3E64A 4U3YA 5DH3A 1OGUA 5E8ZA 3CR0A 3RK9A 3NYNA 3VF9A 3ZBFA 4DEGA 2W1ZA 3RCDA 4HW7A 3ZUUA 5FDXA 1U59A 4MBIA 2YDJA 1ERKA 2YIQA 3DZOA 2IWIA 3P0MA 4K2RA 4RFYA 4RZVA 3KXGA 3LQ5A 3D2KA 2G01A 4NKAA 5IKWA 3UODA 3WYXA 4JX7A 4EH6A 5J5SA 2LAVA 3N4UA 3ORIA 3CY2A 2R7BA 2VNWA 3Q60A 4G3GA 5DT0A 1UU3A 4MXXA 3U4WA 1OITA 2YM3A 3PY1A 4AF3A 3E8NA 2X8IA 1SVGA 4FSNA 3DU8A 1OECA 3FKNA 4PMMA 4ACCA 5EW3A 2QKRA 4FKRA 3OCBA 4XOZA 2BKZA 1MRVA 4GK4A 4KSPA 3ELJA 4RQVA 4Y83A 1LP4A 4AACA 5H8GA 3R8MA 3MFSA 5A14A 5EK7A 2BAQA 2RIOA 5AX3A 4DEIA 4E93A 4FTKA 4NTTA 4LG4A 1MQBA 5AADA 2EUFB 4RWLA 1Q8ZA 3KRRA 4G3EA 4JBQA 1XO2B 3VS3A 5FG8A 4ACGA 4CZYB 4EEVA 4GV1A 5AV2A 2XCKA 4MD7E 3HX4A 4BYJA 3S2PA 4AGUA 2UZVA 3HKOA 3D15A 2E2BA 3A4OX 2VO3A 1WMKA 3VHEA 4BKZA 3QQFA 1W0XC 4HGTA 4APPA 3R83A 2VWUA 3NUSA 1M52A 4ZXTA 4RZWA 4EH5A 2ITWA 2IVUA 3GQIA 4PRJA 3A99A 1FMOE 5J87A 5HTBA 4B0GA 1V0PA 2GNGA 4L6QA 5JH6A 3BE2A 3Q3BA 3R9HA 1Y6AA 4RFZA 3R04A 3CE3A 3PYYA 5HG9A 5CEQA 2C5OA 5K4IA 4PPCA 1VZOA 3RTPA 5AP1A 4YR8A 4CTBA 4FR4A 3EH9A 3TV4A 4FVRA 3SHEA 1Q8UA 4KS8A 2JDOA 4FGRA 1QPJA 1MUOA 2ZYBA 3NGAA 5E8VA 4GH2A 3TJCA 1XWSA 3VHKA 3E8DA 5CSHA 3UO4A 3AT3A 3CQEA 3UYSA 3ETAA 2IW9A 5BVOA 3CCNA 3SXSA 5KZIA 4C7TA 3VJNA 1R3CA 5GJFA 1JSVA 4K8AA 4RVLA 2VWYA 1WVXA 2GS6A 2ZB0A 1U5QA 4L3JA 3TNPC 3D5XA 4IB0A 4Y85A 1W83A 1DM2A 2FSLX 3Q53A 4M67A 5IQFA 2B7AA 3U9NA 2CCIA 5K5XA 3VO3A 3A7IA 2F4JA 5A6OA 3TZ9A 2XS0A 3DTWA 4XG7A 4AN2A 1UKHA 3QC9A 3EFLA 3D5VA 5DNRA 1VYZA 3H9RA 3L1SA 5HO6A 4J8NA 3F5UA 4E8AA 5K0XA 3ZO1A 3FMEA 2ZV8A 2GHMA 4KRDA 4BTMA 2OKRA 3TDWA 2J0JA 3PXYA 4XYFA 4NM7A 3D2IA 4C36A 3ORMA 2RF9A 3BKBA 4M3QA 5HE1A 2CKPA 1DI9A 4NIFB 5IEVA 3AMBA 3UO5A 3CBLA 1E9HA 5LVNA 3KMWA 4I6QA 4ZLOA 4BY9E 2X8DA 3QHWA 4XH6A 1NA7A 5IG1A 3DV3A 4FIGA 4KRCA 3W33A 4ANOA 5JRQA 3MA6A 3VUIA 4G2FA 4XP0A 4L46A 4IX4A 3LXPA 1KOAA 2XA4A 2E9VA 2HXQA 3GU4A 3ZLXA 3O0GA 4QMLA 3D7TB 3GCVA 4XG8A 4BBFA 2OIQA 3VS2A 3NUNA 3QQLA 2GS2A 3I0OA 1G5SA 3Q9XA 4UMQA 5FM3A 3TM0A 3QTWA 1TQMA 3Q52A 4F70A 4IC7A 5I9WA 2YA9A 1H1SA 3GCQA 1GJOA 4JBOA 2BILB 3QTRA 4LRKA 5D7VA 4YSJA 2C0OA 4ANLA 4BCMA 3HAMA 2R3QA 3GU8A 3QD0A 3MGYA 3QZGA 3BHTA 3GB2A 3GCPA 3VUKA 4X2KA 3R1YA 4GT3A 5L2QA 2WZJA 4XX9A 1M2PA 3QTZA 4FTLA 4FTCA 5A4TA 2BHHA 4WBOA 3HL7A 4BDIA 2FYSA 3IONA 4GK2A 5IMXA 3PA4A 4MD9E 4X6RA 3UE4A 4ZZNA 3N9XA 1W84A 2I7QA 2VX3A 3AC5A 3EFKA 4Y46A 5L6PA 2ITPA 3OW3A 5J7BA 5HKMA 2BIKB 3OUNB 4PL4A 2PE2A 1YDTE 4CV9A 2R3HA 3C5UA 3P4KA 1SMHA 5EQPA 5DOSA 3LCKA 1OKVA 1UWJA 2BZHB 2ZB1A 3G90X 1XBBA 3PE2A 1Z9XA 2GCDA 3HV6A 3RGFA 4QTCA 5CVFA 3TNWA 4NIFA 3IW5A 3S3IA 3LMIA 2WKMA 3BYMA 4HYUA 5DR6A 2PYWA 4LI5A 4V05A 4A9YA 3LM0A 1RDQE 1UWHA 2VWWA 3MB6A 3W55A 3DPKA 4BICA 2WTIA 4JBVA 3LFBA 5D12A 3MVJA 4L68A 3MH1A 5IDNA 4FVPA 4EQCA 3UG2A 1NVQA 2C4GA 3D7TA 3QKLA 4DFZE 3F3ZA 4I22A 4PWNA 3LKMA 3VUMA 4A9UA 2P0CA 4NCTA 2BKKA 3DQWA 1ND4A 2XKDA 2B54A 5IQGA 3LCOA 3WZKA 4FTJA 4TN6A 3DLZA 3C51A 4KB8A 4YC6A 3H0ZA 4EHGA 1PMNA 3OWJA 3EKNA 2ITTA 2ACXA 4ZTRA 4F0FA 1PRYA 2J0IA 3QHRA 3R6XA 4FIFA 4H36A 3B2WA 1Q5KA 3ZO3A 4L7SA 5JSMA 2RG6A 3KXXA 4IXPA 4GT4A 4C4JA 1H1RA 1XR1A 2F7EE 2OGVA 3FLWA 5I9VA 5EM6A 3Q6WA 3SLSA 4NK9A 3G0EA 4I41A 4QP3A 4M97A 4XUFA 4OBOA 3FLSA 3KN6A 4MWIA 4NZWB 4FL1A 3V3VA 3AQVA 2VTLA 4MYGA 4W4YA 1Q99A 4A06A 1Y57A 5IQAA 5HOAA 3VS4A 1YXTA 2YDKA 5CU0A 3QF9A 5M4IA 2P55A 3HP5A 1KE9A 1UU7A 3QKKA 3ZM9A 3V6SA 2X8EA 5HD7A 5BMMA 3GP0A 1OBGA 3NNWA 3U9CA 4RC4A 4J71A 4N0SA 1FGKA 3R1NA 4I92A 2ZM1A 5C9CA 1M17A 2IZRA 3NCZA 1Q3DA 2YHVA 1U54B 2B55A 1YVJA 2LGCA 3VS5A 5LJJA 2B53A 3OXIA 4RVKA 4U3ZA 2UZUE 3DKOA 3RHKA 3RAHA 2KULA 4WA9A 4WNKA 4AZEA 2Q0NA 2BAKA 1H8FA 1UV5A 5FXSA 3VS1A 3TEIA 3Q9WA 3OCSA 3E3PA 2I6LA 5ETCA 3PZHA 4L3PA 3MJ2A 4MXOA 4EOKA 4O7TA 4FZFB 4GW8A 5H3QA 5CAVA 3QQHA 3R0TA 4O0SA 3RJCA 2XM8A 5J9ZA 3SA0A 5AIRA 3QA0A 2F57A 2R0IA 3AGMA 3EB0A 3HZTA 1PMVA 4FKTA 2RSVA 3Q4ZA 1OKWA 2B9HA 2VZ6A 2YM5A 2WTKB 2ONLA 4MTAA 4RVTA 5F4NA 1M2RA 2W9FB 3VUTA 4HPTE 3I4BA 3RAIA 4QTEA 2PUPA 4O7ZA 5TE0A 4QMQA 2CHLA 4BTFA 2R3LA 3V01A 3VBWA 3AMYA 3LZBA 4K1BA 4YLLA 4TWCA 3UYTA 4CFWA 3LMHA 3AT4A 3T8OA 3FMJA 2GNHA 4B99A 4YZNA 5DRDA 3AT2A 4YZMA 4CYIA 3KCKA 3OTVA 4O0RA 3KVWA 4U45A 5FM2A 3ZFYA 5TR6A 4CFMA 3RK7A 3OCTA 4XMOA 3FEGA 4EHEA 3KVXA 3ORZA 2R9SA 4MAOA 3P7AA 5AV1A 3FJQE 3BHYA 4X0MA 3VBQA 5JK3A 4XV9A 3RBWA 3QRUA 3EIDA 5E8UA 3OXZA 2I40A 3PXZA 4J8MA 4K9YA 4BDAA 1PYEA 4O83A 3GOPA 2GFCA 4O7SA 4R7IA 1W8CA 3QLGA 3V04A 1Q97A 1NW1A 3S4QA 2PVYA 3CKWA 4EOLA 3EMGA 3VBVA 1Q61A 2WU6A 1OL1A 2FSMX 2EB2A 1U54A 3HVCA 1M7QA 2B4SB 3UMWA 4U44A 1A48A 3GGFA 4PDYA 1OKZA 4WSYA 3ORPA 5GZAA 4L53A 2JEDA 3QTIA 3R22A 3P79A 4L00A 2UZOA 1DAYA 4OTIA 1P5EA 4N57A 4WG3A 4X2FA 5G6VA 2X9EA 2QU6A 2VN9A 4Y5QA 3R7GA 2Z60A 1W98A 2YWVA 3NVMB 4DFYA 5EKOA 2OF4A 3HRFA 5I0BA 4XG3A 4QMYA 2WMSA 2YCSA 4IM0A 4KNBA 4FTMA 4FNWA 3UOKA 3O51A 1JKLA 5C8NA 1XQZA 3ORNA 4O81A 4W9XA 3B8QA 2CKOA 3UPXA 2R2PA 3UZPA 2ITUA 4EYMA 4L9IA 3UGCA 2UUEA 4CFUA 1XBAA 3S0OA 2H9VA 3F9NA 3O2MA 3FXZA 4NM3A 2W1CA 3E93A 3MH2A 4M69B 4G16A 5DT4A 5C03A 3VBTA 1OPJA 4ZAUA 5IA2A 3R7VA 3O8TA 2J0MB 3ZO4A 3QX2A 5FD2A 3EN6A 5FEDA 4CCUA 3V5LA 4JI9A 3HA6A 1YXXA 4RIXA 4LOOA 2C6TA 2J4ZA 4P5QA 4X6QC 5E91A 4FTNA 5DMZA 3Q5IA 5CQUA 4TPTA 2IZUA 4EK5A 3MTLA 2H6DA 4CNHA 3CPCA 3D5UA 2ITQA 1XH8A 3F2NA 4CFFA 3UOJA 4C58A 2PVNA 3RALA 3OEZA 2G1TA 1X8BA 3C4WA 5AWMA 1SZMA 5K3YA 2JAMA 4CZTA 3QX4A 4XNEA 1CM8A 3WE8A 2CDZA 2JIIA 5EHLA 2BRGA 5HICA 2IW8A 4ZS0A 3DQXA 3O71A 4C2WA 4FV1A 2HZ4A 5HVKA 4JIAA 3HMNA 2J0LA 2ZM3A 2F7ZE 4FI1A 4BZDA 5CANA 4MXZA 3QCQA 2ZV7A 4WG5A 2A27A 4I94A 3QA8A 3HAVA 3ITZA 3MVHA 2OJ9A 4RX5A 1T45A 3EQFA 3HUBA 1YKRA 3IW8A 3EN4A 4H1MA 5ACBC 1UU9A 3JXWA 1UKIA 2WU7A 3L8XA 4O22A 4Y73A 3TNQB 4RMZA 3V5TA 5CTPA 2B52A 3QU0A 4ZSJA 3ZDUA 3ID6C 4IQ6A 1PMUA 3VC4A 2GQGA 3QAME 4IH8A 1YDRE 4YHFA 4D2VA 3THBA 4RG0A 1YOMA 2BRHA 3ZONA 4EC8A 1PKDA 2XK8A 3L9LA 2IO6A 3P5KA 2PZRA 4KIKA 4L43A 2W4OA 3FQEA 4EI4A 4EH4A 2Z02A 4USFA 4M12A 4WSQA 3TKUA 2IW6A 3NNUA 2J9MA 2R3GA 2WMUA 4XP2A 2X9FA 3MDYA 4Y5HA 4DEBA 2CKEA 2OZOA 3KB7A 2ITXA 4EOPA 3DLSA 3MTFA 4IB1A 2C0TA 2R5TA 5JEBA 3FL5A 5M08A 1LUFA 2R3PA 3LQ8A 3SRVB 2YJSA 3L9NA 3NLBA 4MK0A 4FKGA 2IJMA 1RE8A 2C6EA 1J91A 2C5VA 2IVSA 2UW7A 1CKJA 3OF0A 4XLIA 5CX9A 2Y9QA 3UZRA 5CSWA 5ANGA 3P78A 1XH7A 3W2SA 3ZH8A 3W2CA 1SNXA 2EB3A 2PSQA 1OL6A 2XKEA 3Q32A 4X2NA 1NVRA 4GIHA 3R73A 4D1ZA 1JAMA 4H3QA 4JDJA 4FTTA 3V6RA 4EOQA 3NS9A 5BYLA 3W32A 2OH0E 4D2SA 3Q96A 3PXFA 4XEYA 3ZOSA 4CMUA 3S00A 4KBAA 5KMMA 5AA9A 2HIWA 4NKSA 2J5FA 3NW7A 1H28A 5EQYA 5BUJA 4JQ8A 5LMKC 2PVRA 2XJ2A 3VS6A 4DG3E 1IEPA 2FGIA 3FMKA 4R5YA 2PZ5A 3FC2A 4E73A 3EQGA 3KXNA 4EYJA 2X2LA 4S31A 4XV2A 5HTCA 4R1VA 4FT7A 3TIZA 3KU2A 4DAWA 1UNGA 2CPKE 5J1WA 2UW0A 3M42A 4W8DA 2VUWA 3QZHA 4IB5A 4CKRA 4M14A 4UMPA 2FSTX 5HGIA 4J7BA 4H3PA 4UV0A 4B4LA 4BIEA 2EXMA 3C4EA 4S34A 3FKOA 3UC3A 4EKKA 2F9GA 3PRFA 1SVHA 4RLLA 4B8MA 4Q2AA 2J50A 4FEVA 5CF5A 1YHSA 2V7AA 1U5RA 4YNOA 5JZNA 5AM7A 3PTGA 3QQGA 5FXQA 2ZDTA 5AAFA 4UY9A 4R3CA 4YLKA 3N4VA 3FL4A 3OHTA 4X2JA 2C3JA 4HJOA 4GRBA 4FSTA 4EJNA 2F2UA 3GUBA 4KWPA 5E8XA 1QPCA 2PK9A 5D9HA 4IAYA 4S2ZA 4QMNA 5L8JA 3E87A 5ANIA 2JBOA 5AR8A 2XEZA 2QOQA 2V62A 3CTJA 5T3QA 4AOJA 2XNPA 3GT8A 3CQWA 4RT7A 4I93A 4E4LA 4O6LA 5IPJA 4IBMA 3ZLYA 4ACHA 1H24A 1REKA 4RLKA 3QUPA 3R9NA 4JR3A 4QQJA 4F64A 2X4FA 5M4CA 3LFQA 5TT7A 2FUMA 3CY3A 3ZRLA 4RIOA 3CD3A 1CTPE 3DK6A 1PJKA 5F95A 4MEDA 4DTKA 3HV3A 3GU7A 4F9WA 2EVAA 1JSTA 1ZOEA 4Q5EA 2Y4IB 5LWNA 4ASDA 5M51A 3MWUA 3ANQA 3EFWA 4YTIA 4BDFA 2BZJA 3LJ1A 3OEFX 3R71A 4QO9A 4U7ZA 4EZ7A 2Y8OA 5AP0A 3E92A 1ZWSA 4GG5A 3V8SA 3ZC5A 3HRBA 4PTEA 3KQ7A 3V5JA 1WBVA 3GC0A 2QLUA 2DYLA 4EONA 2YERA 3ULZA 5IZFA 3CKXA 2XJ0A 4IW0A 5AP6A 3GOKA 5CNOA 3BV2A 2C3KA 2X7GA 3BYSA 3ZSGA 4FV8A 4YO4A 5AIKA 4LUEA 4EK8A 2YZAA 5CWZA 3DK7A 5B2LA 1R0EA 5C8KA 4IM3A 2V5QA 4ALWA 3R01A 5F94A 3CTHA 2QURA 1H4LA 4ALVA 2XIXA 4EK6A 4F1OA 5IQDA 4L3LA 4TYHB 2W5BA 5L2IA 5CXHA 4FKUA 4BTJA 5IF1A 4PDSA 4OTHA 3TZ8A 3EZRA 2UZNA 5AMNA 4CLJA 1APME 3AGLA 1WBOA 2UVZA 3FYJX 4GYGA 4MX9A 4XLVA 3BEGA 2B0QA 2YIWA 3V8TA 4I5CA 4R8QA 3PIZA 2WMRA 1UU8A 3GCUA 3VIDA 1U4DA 3BBWA 3OZ6A 4U8ZA 3QD4A 4YJRA 3MW1A 4YP8A 4U9AA 3PXKA 4ZTQA 2YCFA 1U46A 1QL6A 5TO8A 3RMFA 5HHWA 3GCSA 2FSOX 4C34A 5EDRA 3PIYA 4HVIA 2R3OA 1JBPE 1R0PA 4FSMA 4M7IA 2PULA 5HCZA 3LJ0A 5LWMA 5AR7A 3K3IA 4YZDA 3Q9ZA 3IDCA 4DFLA 2QD9A 2R0UA 4H1JA 3ZU7A 3FZTA 3ZSIA 4R3PA 4EOOA 4FICA 3LMGA 1STCE 3IQ7A 2NO3A 4ZSEA 4CKIA 4UN0C 3ORKA 4IDVA 2OF2A 4PMSA 5EOLA 4AX8A 3KC3A 4RGJA 5C01A 3DDQA 2YZLA 1XH9A 5I3RA 2HAKA 3DK3A 3EZVA 3VBXA 4S33A 2VWZA 2R3NA 3HECA 3DKCA 2QHNA 2UZEA 5EYCA 4EZ3A 1IG1A 4A7CA 5L4QA 3A7HA 3SOCA 1B39A 5J95A 3OOGA 5M55A 2G15A 3UO6A 5CEOA 5CSPA 3PZEA 2WPAA 3ALNA 4F08A 1TKIA 2OFUA 3LXKA 4ALUA 1GY3A 5AUTA 4NJDA 2O0UA 2GTMA 5BVWA 3QUDA 2GNJA 3SC1A 4TWOA 2Z7QA 3ZUTA 3GC8A 4ZP5A 4YJSA 5HE2A 3QKMA 4NL0A 4Z3VA 4PDOA 5TOZA 1XHAA 4XRJA 4V0GB 3QQUA 1E1VA 4MBJA 5ANJA 4X3FC 3PP1A 3WF7A 3PJ2A 4FV4A 4TW9A 3RNYA 1V1KA 4F7JA 2G2HA 4I1ZA 3HP2A 4CRLA 3IG7A 5JFWA 2OXYA 1FINA 2WOUA 4D58A 3ERKA 2BFXA 5IA4A 3MPMA 3K54A 3KY2A 4WUNA 5T6KA 3KRJA 3Q4UA 3L9PA 4DH5A 5B2MA 4FTQA 1VEBA 2C1AA 4IFGA 4BZOA 3PWYA 4P5ZA 5A46A 1SYKA 3NW6A 4ZS4A 2JGZA 4OTFA 2BDJA 5ANOA 1SVEA 4RA4A 4DG2E 3OT8A 2YEXA 2ITVA 5CT7A 5AUXA 4OTWA 1P2AA 4DGLC 3DXNA 3FXWA 2C30A 3F3UA 4ENYA 2ZMCA 2AC3A 4E5BA 3LE6A 3BU6A 5DHJA 4L01A 5D11A 5IA3A 3VRZA 4E6CA 3PSBA 4RJ5A 5AM6A 5DLSA 2PVLA 3RI1A 3BGPA 3KXHA 3VRYA 3D94A 3U51A 3ZS5A 2A19B 3SKCA 3E8EA 5CU6A 4D4RA 3RK5A 3FPQA 4U5JA 4G9RA 3SG9A 4AXAA 5LVPA 2WQMA 3GC7A 3H9OA 3MFRA 4GU9A 3FI2A 1YWVA 4U79A 4AZFA 3ZM4A 1UNLA 4DN5A 3RPOA 3NAYA 2NRYA 2BCJA 5E7RA 1H0VA 3OOMA 4DYMA 3DJ6A 1ZY4A 3PY3A 4E3CA 4IZ7A 4MNEB 3N4TA 3VQUA 2C0IA 2WTDA 4RIWB 5E8YA 3BLQA 4LYNA 4GFOA 4TL0A 5KUPA 4V0GA 4ZTHA 4FYNA 3R8PA 4BDKA 2KTYA 4HYSA 2B9IA 1ATPE 3BYOA 3R02A 1URCA 1OUYA 4JJRA 2WMXA 5KO1A 2X4ZA 2UVYA 3HA8A 4FV7A 4BR3A 4QPAA 3FSFA 4X7QA 3P9JA 2IZSA 3ZRKA 2ERZE 4FV9A 1OZ1A 3F82A 4PPBA 5HE0A 4AZWA 3BLHA 4H58A 5IH6A 3TZMA 5KKRC 3FHRA 4HZSA 2PVMA 2PU8A 1IASA 5AP7A 5M44A 1PXLA 1JNKA 3R2YA 4QQTA 1OB3A 2YAKA 2RFNA 1H07A 4JDIA 5BYZA 3DB6A 3CPBA 3ZFMA 3FI8A 4GKIA 4KUJA 4JVGA 4F0GA 1LPUA 4F65A 4FIHA 3HV4A 1FPUA 4CTCA 4UYNA 2BIYA 2CLQA 3ROCA 4AFJA 4YHJA 4I23A 4QYFA 1FVTA 4NYEA 5DEWA 4WHZA 2WMVA 4FKOA 1W7HA 4JIKA 1KV2A 4Z7HA 5KBQA 1Z5MA 2Y6OA 4ZIMA 4F0IA 1OIQA 4N6ZA 3EL8A 5CAUA 2C5XA 5HVJA 4YJTA 5DVRA 2O65A 3AC2A 3NUYA 1OIUA 4M0ZA 5LOHA 3C13A 3DAKA 4IVCA 5L2SA 4C4EA 5L3AA 5E1SA 3FPMA 3KKVA 3G15A 3BHUA 3PA3A 2DQ7X 2XK9A 3RINA 5BX0A 5CALA 5EDPA 1JKSA 3F2AA 1H01A 4FZDB 4YNEA 4FIEA 3U55A 2XK4A 4ERWA 1PMEA 3QRIA 4YZBA 4BFMA 1GIHA 4YC8A 4NSTA 4M68A 4RWIA 2A2AA 5L6WL 3ORTA 4WRSA 4NW5A 4MWHA 4TKSA 4Y72A 2Z2WA 4BC6A 3EQHA 3FZOA 2UZDA 4QP7A 1NVSA 4O0TA 4D1SA 3HDNA 3QUEA 3FDNA 2PUUA 5HVYA 3R00A 2ZMDA 4KKEA 2W1GA 4L8MA 4L52A 4J96A 4GUBA 4K0YA 3QGWA 4BDCA 4ZJVA 2ZV9A 3UNJA 4MKCA 3SAYA 4U41A 4BWXA 2QNJA 2WMBA 2YIRA 1RJBA 3BYUA 3R7OA 3WZEA 3N51A 4G17A 3FMNA 4UX9A 2F7XE 2VWBA 5ETIA 4APCA 4CLIA 4IX6A 3CD8A 5KHXA 2BMCA 4AOIA 3Q4TA 4BN1A 1J7IA 3CJGA 1ZYSA 3QXOA 3AC3A 3GENA 2JC6A 3IK3A 4LFIA 3COIA 5DGZA 3S1HA 1YDSE 4FUXA 4GK3A 4M84A 3JUHA 3TJDA 5FTQA 4DITA 5CLPA 2DUVA 1KOBA 4FV2A 4QYEA 3ORLA 2QC6A 3ODYX 3QTQA 1YRPA 4BDBA 3RPYA 4QTAA 4DTBA 2IVTA 3LFNA 3VW6A 3P08A 1BKXA 5BVEA 5GNKA 4CFXA 2RKUA 4FF8A 3ZEWA 2QG7A 4ZY5A 2VAGA 4LM5A 4HYIA 2GSFA 4PQNA 4BL1A 5IQCA 2GDOA 3RPRA 4O6EA 2ZDUA 4XBUA 4PP7A 4I0SA 1JOWB 2WIHA 4NW6A 4EZ5A 5JT2A 4AZTA 4BGGA 1CMKE 4F7SA 2PMLX 2PVKA 4AUAA 3QXPA 2RFSA 2W5HA 3HUCA 2GNFA 1IRKA 2J2IB 5HX6A 5K4JA 4ANSA 5A4EA 1YXVA 2P2HA 4ARKA 3AD5A 4W4VA 3SV0A 4KD1A 5DR9A 5AUWA 3ANRA 2QVSE 1OL5A 4GU6A 4KBCA 2YLEA 3UIMA 3KL8A 3V5PA 5CEIA 2WAJA 2IZTA 1MRUA 4FZAB 4XCUA 4B7TA 4QP1A 4X2GA 4B9DA 1WFCA 1AD5A 3B2TA 4PTGA 4FSZA 3AD6A 2V22A 1E1XA 4ONAA 4JOAA 4DBNA 4FNXA 5TKDA 2PMOX 2YACA 4OUCA 4DEEA 3OBGA 3O96A 4I6BA 4TYGA 2DS1A 3FXXA 4RX7A 1BI7A 3BGQA 3T9TA 1XBCA 4YJPA 3QFVA 5DPVA 3F5PA 4HCVA 3OBJA 2YFXA 4I0TA 4QMVA 5I4NA 1KE5A 2R7IA 4IAZA 4ANMA 5AP2A 2JD5A 3TNHA 3KULB 3WE4A 3F3VA 3KEXA 3C4XA 5DYJA 3LW0A 2V55A 3CLYA 4IWPA 5EHYA 3QQKA 3K3JA 4C38A 4X21A 4BI2A 1NY3A 4LL0A 2UW9A 3VAPA 3NAXA 4HVDA 3Q9YA 1Y6BA 5EG3A 5GIOE 2QOBA 4DLIA 2XKCA 2W1FA 3O7LB 4I0RA 5KBRA 1O9UA 3FSKA 4G5JA 2XM9A 3CTQA 2B9JA 5CSVA 3ZDIA 1V0OA 2Y6MA 3H10A 3L8VA 5A3XA 2ZAZA 4MD8E 3NVKI 1FGIA 2WQBA 3QGYA 3QTUA 4I6HA 3CXWA 3F7WA 3KN5A 2PZYA 3DCVA 4OBPA 5H8EA 3TN8A 3AG9A 4FNYA 2OJIA 2VTMA 3F3TA 5AUVA 4G6LA 4O86A 2PY3A 1OIYA 1Q24A 4RVMA 5JGBA 4Z9LA 4FTAA 3MJ1A 4WKQA 4J95A 5LVOA 2QR8A 4KA3A 4RIYB 5J7HA 3R9DA 3ACJA 3SQQA 5LMAA 4FT9A 5L2WA 2JLDA 2OICA 2RG5A 2PUIA 4U42A 2XNOA 3Q6UA 4D4SA 3BZ3A 3MI9A 3C4FA 5KMLA 2X6DA 4CMTA 1QPEA 1Q3WA 2RL5A 4D55A 3DA6A 4JG7A 1J3HA 2A4LA 4AQCA 3AC4A 4FSUA 1WBNA 4ZTMA 4R77A 3COKA 4JX3A 4QMWA 4YPDA 3WILA 3DFCB 5HIEA 5CSXA 4FEXA 2B9FA 3OD6X 3KRXA 3UNZA 3NUAA 1ZRZA 3EQCA 2WMAA 3I5NA 3UVQA 4KKHA 3T3UA 1WAKA 4MQ1A 2R64A 5EM7A 4IWQA 3COMA 3OT3A 3QYZA 3MIYA 4QMMA 4LL5A 4O96A 4F6SA 4L7FA 5C26A 2C5YA 3AC1A 4BF2A 3NW5A 3GC9A 4MVFA 2HCKA 5KMNA 3DJ7A 4FV5A 3LLAA 2WMWA 4HYHA 4NU1A 3KA0A 1ZYDA 2UW3A 3AOXA 5M53A 2X7FA 3C4CA 3MY1A 4K77A 1P4OA 4IZ5A 4ENXA 2AYPA 3UQFA 3DBDA 2OSCA 4C57A 4D2PA 3LCTA 1H0WA 2QU5A 2CNQA 3PVWA 4DC2A 2XNMA 3A60A 4ZZOA 3ATSA 4CT1A 3EWHA 2EU9A 2PTKA 3BHVA 2YIXA 2YM8A 4P90A 4QNYA 3UQGA 5L6OA 3EQDA 5FP5A 3TDVA 3HEGA 1XH5A 1L3RE 3DS6A 4KABA 3JVSA 4DE4A 5CYIA 2REIA 2JAVA 3DJ5A 3FUPA 2G2FA 3NWWA 2R3MA 5HBHA 5J8IA 4FSYA 2WTCA 2WELA 4LOPA 4C33A 5IQHA 4MHAA 3LVPA 4PL5A 1AQ1A 4RIYA 3BQRA 4XG9A 4WNOA 4GJ3A 2I0EA 4PTCA 3QCSA 4NJ3A 5J5TA 4II5A 4CGAA 3HYHA 4CVAA 3E3BX 3R7YA 5HORA 2PL0A 2UZWE 4PX6A 3PFQA 2OJGA 5K9IA 1Y91A 3G33A 4GT5A 1CSNA 2HOGA 3KF7A 5GJDA 2W1IA 2GMXA 5CI7A 3HMMA 3DAJA 4D9TA 5J79A 4O7WA 4FKSA 5A6NA 4QMOA 1GIIA 5IH4A 4BHNA 4KIOA 3NCGA 3R1SA 3RAKA 3G9LX 4BBEA 4E7WA 4BCJA 4JS8A 3E8CA 4X3JA 3D7ZA 1EH4A 3D0EA 4FK3A 3NEWA 1JQHA 2VTRA 4MNFA 4IEBA 2GHGA 5CENA 2ZVAA 4IMYA 4RWKA 3RAWA 3TV6A 3VNTA 5FXRA 5JMSA 1YI3A 4ZSLA 4A9TA 4EBVA 4CYJA 5IEXA 1GZOA 3DZQA 3R63A 3W1FA 4J53A 4XBRA 3REPA 4EUTA 3ZFXA 4R7BA 4CG8A 3IO7A 4WT6A 3G2FA 3BPRA 4ZOGA 1G3NA 4PPAA 4F99A 4KAOA 4EHVA 2OK1A 3PJ8A 4A07A 3TUCA 2OIDA 1VJYA 3VN9A 4O21A 3UIBA 4B8LA 3SD0A 2OO8X 2CN5A 2XCHA 4I5HA 3VW8A 4OBQA 3L9MA 3LQ3A 4IAFA 4PNKA 4FTOA 3U54A 5KNJA 2OZAB 2J6MA 2BZIB 2C6KA 5AV4A 4O82A 3SX9A 4HCTA 1FOTA 3C5IA 2C6MA 4RJ4A 3RNIA 2W17A 4N4SA 2J5EA 5JZJA 4M69A 5HIDA 3PDTA 2Y4PA 4G3FA 3EHAA 3ET7A 2IG7A 3PSCA 4D1XA 4C8BA 5BVFA 3BX5A 4E1ZA 3DT1A 3O23A 4FTUA 4RQKA 4FKJA 1YXSA 2VTSA 3TL8A 4JT3A 4QP4A 4HNIA 5GJGA 4CQEA 4XG4A 4NM0A 4CRSA 4D4YA 2O64A 4H3BA 1BYGA 3EN7A 5JFXA 3JS2A 5EYKA 4CFNA 3GBZA 2W9ZB 1I09A 4EH3A 5L8KA 2F49A 2QONA 4JL9A 5AX9A 4FT5A 3CEKA 4G34A 4ZJIA 5EM8A 5GIPE 3NDMA 4MCVA 3FV8A 4RSSA 2YM7A 4RA5A 3K2LA 3WI6A 2YWPA 3WOWA 1H00A 1ZXEA 3FZSA 4OTGA 5EDQA 3I0QA 4WG4A 2XP2A 4FV6A 1PKGA 3MESA 1PHKA 3MVMA 4LV8A 1T46A 3LAUA 2I0YA 3ZXTA 1IR3A 4M15A 3R9OA 4D2RA 4D5KA 3C0GA 3FQHA 4FUYA 1YQJA 3Q4CA 4A4XA 3TI1A 2ETRA 4JXFA 3ZMMA 3LPBA 3O7LD 5BVKA 5AAGA 1XKKA 3JY0A 3VWAA 3PP0A 2WTWA 5B0XA 4C62A 1SNUA 2WQNA 3HRCA 2YM4A 3EN5A 3CGOA 5HU3A 2HZNA 4YJUA 2XIRA 4DGNA 2HYYA 2CGXA 4UALA 3DB8A 2BRBA 2JDSA 4WD5A 2OZAA 4R5SA 5I3OA 3SGCA 1PXJA 4IAAA 3SG8A 5IMEA 1Y8YA 4W4WA 3AMAA 3RP9A 4ZTNA 3ZZWA 3R7IA 2GQSA 5EQEA 1RW8A 2QOOA 3QC4A 4EORA 5KHWA 4YC3A 2QKWB 4QD6A 3MVLA 3QYWA 4OGRA 5EI8A 5HO8A 4DEDA 5I9YA 4FE2A 3H9FA 1WZYA 3KXZA 3SRVA 3DAEA 5LQFA 4FIJA 4MNEA 4L45A 5HZNA 1J7LA 2ETKA 4ANNA 2X2MA 3OFMA 3TIYA 3RWQA 1A06A 4GIIA 2Z7LA 5IQIA 5FGKA 2XNBA 2W5AA 2CGWA 2OWBA 2WHBA 3OROA 4NH1A 4O0UA 4WOVA 2CNVA 4N70A 4QP2A 2CGVA 4WRGA 5GZ9A 3II5A 2P3GX 5AP5A 2PVJA 2NPQA 4YGAA 4E4NA 3W2OA 2E9PA 3NYOA 5E8WA 4DT8A 1WVWA 3FLQA 4E6QA 2GPHA 4AW2A 4DGOA 5CAOA 4PF4A 2Q83A 4AU8A 3UJGA 4MXCA 2ETMA 1KE8A 1GIJA 1YWNA 4UMTA 4UMUA 5DWRA 1FVRA 3TKHA 5BVNA 4PUZA 3LJ2A 2VNYA 1WBPA 3MYGA 3LLTA 1S9IA 2AUHA 4NEUA 1JSUA 2BDFA 3M2WA 1ZMWA 4G9CA 3CC6A 4ZK5A 4IWOA 1JKKA 1M14A 5ETFA 5CF6A 3IS5A 4IZAA 3PXRA 4A4OA 1H1QA 1ZMUA 2RFEA 2YM6A 4BDEA 5E1EA 2UZTA 2XB7A 4DGGA 3EOCA 4FOCA 4X3FB 5FLFA 4JAIA 3FBVA 2JFMA 3TUDA 5B2KA 3AD4A 4QP8A 3RWPA 2XUUA 4EOIA 4J97A 4BKJA 4I4EA 5EKNA 4HNFA 3GU6A 2JFLA 4BI0A 4PL3A 4JQEA 3UQCA 4FYOA 1OL2A 3F2RA 3OVVA 3F6XA 4BVUA 2QOFA 2E9OA 4FL3A 3TTJA 3C9WA 4LUDA 3EYGA 2W1EA 4BWKA 5DIAA 5CNNA 3K5VA 1ZYJA 5HCYA 4W4XA 4GFGA 5K5NA 2WTVA 2Z7RA 3IECA 1H1PA 4DLJA 1R78A 3PPKA 3BIZA 4XHKB 4QYYA 3Q04A 3W2PA 2XK3A 4NTSA 3MSSA 4WO5A 3P23A 1ZYLA 2C6DA 4EOJA 4DTAA 4F9CA 4FMQA 2C3IB 5AP3A 1ZOGA 3FQSA 4F4PA 5AFVA 3DY7A 3A8WA 5L8LA 1WBTA 3DTCA 5DBXA 5AR5A 4O38A 1BL7A 4K11A 4I4FA 4BCOA 4JRVA 3SXFA 2JKKA 1R1WA 4IANA 2OI4X 3QWKA 1BI8A 3FLYA 4BGHA 3WF8A 4JBPA 4B6LA 4YTFA 5BPYA 5E90A 1NT2A 2GNIA 4CEGA 3NIEA 2VD5A 2VRXA 2I0VA 3C4ZA 3CP9A 4FSQA 4QP9A 3U6HA 3U6IA 3I6UA 3ORXA 2W99B 4TYEA 4IHPA 2I1MA 4DA5A 1RQQA 4W9WA 3G6GA 4D2TA 5I9XA 2C3LA 5KMIA 4E5AX 5JFVA 5DN3A 1BMKA 3PVBA 4HGLA 4KINA 3ROYA 4D2WA 2R3RA 4EQUA 5HNGA 4XG2A 4I3ZA 5CS6A 4X3FA 5FBNC 1YWRA 3EJ1A 3EL7A 4GJ2A 4AA0A 3PWDA 1H26A 3QL8A 4R1YA 3H0YA 1ZYCA 5E8SA 4AGCA 4BI1A 2NNWB 2GNLA 4DFBA 4FTIA 3H4JA 3WARA 4CZUA 3A7JA 1K9AA 3A8XA 4AT5A 2EXCX 3U87A 2FO0A 3FI4A 3D83A 4RBLA 5KKRB 1BL6A 4BCKA 3R21A 2P2IA 4WIHA 3U8WA 4M66A 5JQ8A 4TYHA 4D4VA 4YZ9A 4DH1A 2AC5A 1J1BA 2ZJWA 4ORKA 4DT9A 5CAPA 1G8SA 5HG7A 3IGGA 5JRSA 3SVVA 4LGHA 3GFWA 4D28A 4L42A 5HX8A 4EH9A 3NNXA 4FZ7A 2UW4A 4M8TA 5CU3A 1ZOHA 3Q2JA 3R8ZA 4IDTA 2B1PA 4IX5A 3PIXA 2JIUA 4HCUA 3OY1A 4Z16A 4UB7A 5HQ0A 2YABA 4XV1A 4NWMA 5GHVA 4YJOA 3UC4A 4BZNA 3LIJA 2OW3A 4M13A 1ZMVA 3TXOA 5AA8A 4DGMA 3G0FA 4E6DA 1FMKA 1P4FA 5JQ5A 4TYJA 3DXPA 3HMPA 3ODZX 5CVHA 3MBLA 3NNVA 4I24A 1TQPA 4LRJA 5DEYA 4FG7A 1OBDA 4FVQA 4F1MA 4EJ7A 2VTNA 5BVDA 4E4XA 4XOYA 4C0TA 5IDPA 2CSNA 5I9ZA 3A61A 3CJFA 4ANQA 5DRBA 2X1NA 3V8WA 5DI1A 1M7NA 2X0GA 3NIZA 5AV0A 5HI2A 3O50A 3RZBA 4TNBA 5ETAA 2QO9A 4K18A 4F9AA 5HLWA 4S32A 2VTQA 2CN8A 5EYMA 3UOLA 4Q9SA 4U6RA 2XMYA 3PXQA 4G3CA 3GFEA 2CKQA 4Y8DA 5M56A 4IVAA 3MH3A 4IAIA 3GU5A 1BX6A 2XJ1A 3VVHA 4BIBA 4XG6A 4OR5A 2QOKA 3FMLA 3W8LA 4NT4A 1HCLA 2PWLA 2W1DA 4F1TA 2ERKA 5C4KA 4QOXA 4FG8A 3IPHA 4TRLA 4FKIA 3QCYA 3FY2A 1Q8WA 3I6WA 1ZLTA 4IE9A 5IUIA 4AT4A 4BDDA 4EK3A 3ZTXA 2C69A 3E7OA 3U4UA 4GFMA 2J90A 3IDPA 4TWPA 3CS9A 3FHIA 2FVDA 1PYXA 1WBSA 4QMUA 5HD4A 1J1CA 4DEHA 1R39A 4U97A 3BI6A 4DH8A 3IW4A 4FNZA 4USDA 1YW2A 1LEZA 2YCQA 3TWJA 3EQBA 4C37A 4CFVA 1Z57A 2UVXA 1W82A 1IAHA 4DCAA 4MH7A 3VS0A 4ZMFA 3C0HA 2GTNA 2O63A 5CZHA 3A62A 3UVRA 3SW7A 4A9SA 2O5KA 4C4IA 5CAQA 4O7LA 4PDPA 4F7LA 3C1XA 2XK6A 5AR2A 2QO2A 3DFAA 4O7YA 2O3PA 3BGZA 2VTPA 5HCXA 3ALOA 4ERKA 3JY9A 3EQPA 3FLZA 5BQ0A 3HNGA 4R6VA 4TTHB 2NRUA 3W2QA 4H39A 2QHMA 3MIAA 1H27A 3MPAA 4IC8A 3ZBXA 3MFTA 3HDMA 3DBQA 4YZCA 4Z55A 3QZFA 5FDPA 2HWOA 2JKMA 5E4HA 4KKGA 5CY3A 2Z8CA 2PZIA 4C2VA 4CV8A 3KRLA 3WZUA 4ITHA 3WF6A 4FSRA 2Z7SA 3I5ZA 4O0WA 5HU9A 3BE9A 5FEEA 3CQUA 4OAVB 4PY1A 3QLFA 3MFUA 3LFCA 3OTUA 1V0BA 5BNJA 1LR4A 4IM2A 5KZ0A 2PHKA 3SDJA 3EFJA 2JITA 2O2UA 4EKLA 5HTIA 1Q8TA 5IH5A 5CF4A 3EN9A 3ZRMA 2GFSA 3FMHA 3DKGA 4MBLA 4AW1A 4AWIA 3RHXA 4RIWA 1OVEA 4G6OA 4R3RA 2IVVA 4AS0A 3W2RA 4QTDA 2OLCA 1IA8A 4V01A 2DWBA 4E5WA 5AR4A 2ITNA 2YISA 3VUGA 4IACA 5J9YA 3COHA 2WOTA 5H8BA 2XK7A 4FC0A 3HV7A 3A7FA 3VQHA 1PY5A 4NFMA 5EW8A 2XBAA 4AW5A 1GAGA 4FX3A 4EBWA 1KV1A 1JWHA 1FQ1B 4UBAA 3O17A 4UXLA 4JAJA 4NM5A 3GI3A 4YUQA 2OXXA 4TZRA 3LXLA 2ZM4A 1P14A 3KMUA 4MF0A 3D5WA 4OAUC 1HOWA 2OJFE 2WQEA 4G5PA 3NYVA 3PA5A 2WIPA 1Q41A 3QRKA 4A9RA 4YJNA 2VTTA 2R3IA 2CMWA 4OTQA 3QRJA 1XH6A 5BMSA 3OY3A 1K2PA 3NMUF 1VYWA 4HVGA 3IW7A 3LXNA 4I20A 4FZ6A 4NUSA 2WGJA 4OLIA 4ZMEA 3RVGA 4ZY6A 5AV3A 1IA9A 1UNHA 2BUJA 4C3FA 1PXPA 4AT3A 4YO6A 4PNIA 5DE2A 3UP2A 3LFDA 4O0VA 4J1RA 2PVFA 1PXKA 3QBNA 3IOKA 3VF8A 2VO6A 1YI6A 4QPSA 3LOKA 3OXTA 3V5QA 5AUYA 1TVOA 4GEOA 3PG3A 4GG7A 5JFSA 4CKJA 4QQ5A 2WO6A 5DFPA 2CJMA 3W8QA 4BCFA 3DGKA 5EM5A 1QPDA 2BRMA 3TZ7A 2XH5A 4FKQA 2ESMA 3LFFA 5E8TA 3ZZEA 2VU3A 4EH7A 4C4FA 4F09A 2XNEA 3UIXA 4ITJA 2XYUA 2WNTA 4ZTLA 5BUIA 3EQRA 1A9UA 3UNKA 2XIZA 1PXOA 2UW6A 2RGPA 2WD1A 2HK5A 3LCSA 4J52A 2HXLA 4IZYA 5C8MA 5JGDA 5HLNA 3UTOA 5I9UA 2C6IA 2YN8A 3BCEA 4D0WA 2QOHA 4YJQA 2VWVA 3F5XA 4UEUA 5FQDC 4BIDA 4YJVA 3PG1A 4FT3A 3G51A 1KE7A 4O0YA 3ZEPA 4DHFA 4Q9ZA 1QMZA 3E5AA 3I1AA 4GMYA 2SRCA 3FAAA 2HW7A 4ZTSA 4YSMA 4AFEA 4IIRA 5B7VA 4RC3A 2XNGA 4Q5HA 1YOJA 3I60A 5HIBA 3KCFA 1OPKA 3R30A 4XS2A 4DCEA 3F3WA 5JN2A 4YU2A 2J0KA 3P7CA 4ACDA 2QCSA 3FZPA 4AGWA 1H25A 4BDJA 1OKYA 4DF3A 3KF4A 4A4LA 3LM5A 2C6OA 3LFSA 4JG6A 2WTJA 3H30A 3VUHA 3DBEA 2GHLA 3MY5A 4OT5A 1OMWA 4TT7A 5A9UA 3QALE 3KK9A 4NCTC 4GVJA 2UV2A 4LMUA 3Q2MA 3WF5A 4TY1A 1ZAOA 4AGDA 4EUUA 2BTRA 3VS7A 1DAWA 3E62A 3ENHA 2EXEA 2YCRA 3POZA 4ZLZA 1ZARA 5ICPA 1KE6A 1YHVA 2QQ7A 3BV3A 5CQWA 3R9RA 5AAEA 3LFAA 2HW6A 2R3KA 3O8UA 2CCHA 2IPXA 4FKLA 3F7ZA 3F88A 1KSWA 4FV0A 1F0QA 3H3CA 2JKQA 2CGUA 4OW8A 4ASZA 3TUBA 2VX1A 3A4PA 3FY0A 4O1OA 1IAJA 4RRVA 4IVDA 4D0XA 4GUEA 5HNIX 4MQ2A 3L8PA 2H96A 2Q0BA 4FG9A 5D10A 2I0HA 2W7XA 3EKKA 2VO7A 4S30A 4QYGA 4UYAA 2ITOA 1B6CB 4IVBA 2QR7A 3F69A 1AGWA 4YLJA 5CT0A 2X2KA 4IJPA 5HEZA 2GS7A 2W0JA 3AC8A 3JVRA 4L44A 4QRCA 3IOPA 3WZJA 5BYYA 4BCIA 4GVAA 3R28A 3PLSA 3E63A 3DDPA 3BEAA 4AA5A 4CSVA 2JDRA 4BKYA 4UWBA 1OIRA 3FE3A 3NX8A 4QMZA 3OWLA 3ZCLA 2VO0A 4BDHA 4HGEA 2HENA 2JIVA 2YITA 4RWJA 1REJA 4TYIA 1BUHA 3PVUA 3OC1A 4P7EA 4QMSA 4AW0A 5LXMA 1M2QA 2VTOA 2VX0A 4QMTA 4OTRA 4IB3A 3W18A 5CEMA 5I5ZA 2VTHA 2ZOQA 4HGSA 3BBTB 5IEYA 2VTAA
chains in the Genus database with same CATH superfamily
2HZ0A 3ZLWA 3KULA 1ZY5A 3P1AA 4ZJJA 3ZUVA 2YAAA 4LV5A 5KCVA 3IKAA 2XIKA 4GL9A 2BHEA 3RZFA 2PPQA 1GZNA 3T9IA 3QZIA 5LCKA 4U0IA 4C3RA 4QP6A 4ZLYA 4RJ8A 4RPVA 4JLCA 2V7OA 3HLLA 3RPVA 4RIXB 3O8PA 4EWQA 1GOLA 2G9XA 4RJ3A 2A0CX 3MN3A 3RM7A 3V5WA 3UMXA 4QT1A 3VUDA 3JYAA 4I5MA 4DDGA 2G2IA 5M4FA 3PE1A 4P4CA 2WEVA 5EYDA 5DT3A 2Y7JA 4C4GA 1DS5A 3UPZA 2ONLC 5TF9A 3I81A 4ZY4A 3WYYA 4BYIA 1Q62A 5CEPA 4BCGA 4CXAA 2XZSA 4O1PA 2EWAA 4K6ZA 5EFQA 1WVYA 4BCNA 5FUTA 1H08A 1ZZLA 2IN6A 5HNBA 4QMPA 4RX9A 4IWDA 2X39A 5BUEA 3PSDA 4LRMA 3IW6A 2FH9A 3BHHA 3C0IA 5F1ZA 4FBXA 3FYKX 3BELA 4BCHA 5IISA 2OXDA 3TACA 1JPAA 5LMBA 1MQ4A 2UW8A 1W2FA 2OBJA 3BYVA 4WNMA 2JKOA 1O6YA 3GNIB 5ANDA 4ZSGA 3HGKA 4ASEA 4E20A 3RCJA 4EOMA 1PF8A 1HCKA 3ZO2A 5AJQA 3ZXZA 2QO7A 2BRNA 4KIPA 4FGBA 3TT0A 5DA3A 5CI6A 3WZDA 1XH4A 4G31A 2VGPA 3NUPA 4FK6A 4JRNA 4ZEGA 3D9VA 3DNEA 1GNGA 3OUKA 4KIKB 4CD0A 4C35A 1PXIA 3NUXA 3DBFA 4JG8A 4KS7A 2WQOA 3TTIA 4P2KA 2XYNA 3ACKA 1WBWA 4CT2A 4QYHA 4G1WA 5D41A 4JNWA 4MF1A 2E9NA 4D5HA 4KSQA 3SW4A 1YI4A 1TZDA 2QLQA 4K33A 3DBCA 4W8EA 3WF9A 3FLNC 3PY0A 4EOSA 5LVMA 3PPJA 3VJOA 4J98A 4MUQA 3KRWA 4XJ0A 4BGQA 3I7BA 3PLAE 5EW9A 2W4JA 3K5UA 2Y0AA 4F6UA 5IU2A 5M57A 4E4MA 4RFMA 1ST4A 3JR1A 5HO7A 4KBKA 2C68A 3NPCA 3CSVA 3UVPA 2X7OA 4BTKA 5ITAA 5K0KA 2UZLA 1GZKA 3BQCA 3NYXA 4DBXA 4EHZA 5CEKA 4XRLA 2WTKC 4JR7A 2PUNA 3BWJA 5IQBA 3KGAA 5EI6A 2E9UA 3RKBA 4DH7A 3KFAA 4ASXA 3PUPA 3KMMA 2WFYA 3AXWA 2BTSA 4DH3A 2R3FA 5C27A 5JKGA 3NUUA 4ZZMA 4ACMA 3W0SA 3BU3A 4F63A 2HWPA 3KREA 3QRTA 5DG5A 5FBOA 3R8VA 2PE0A 3PJ3A 2HY81 3W16A 3ZLSA 2BROA 3FC1X 4CMOA 5ACKA 1J7UA 1S9JA 2XNNA 2C1BA 2GU8A 4IJ9A 3LHJA 5HESA 5JGAA 3TV7A 2HZIA 4GCJA 2HY0A 3DKFA 4GS6A 4LOQA 4O2ZA 4U81A 3BWFA 4JDKA 4FA2A 4EH8A 4R78A 2HELA 5ANEA 2X81A 4AA4A 5KX8A 3UZTA 3GVUA 5LMKA 3ATTA 3R7UA 2JBPA 4FTRA 4O27B 2WMQA 4U80A 5HLPA 3FI3A 5FEQA 2VV9A 3R7EA 4AQKA 4BCQA 5IUHA 3A7GA 5DR2A 3ZYAA 2BAJA 3C7QA 3R8UA 3P86A 3S95A 4OT6A 1WCCA 2X6EA 5KMJA 5M07A 3G5DA 4DEAA 3FZ1A 2OG8A 2XF0A 4LMNA 4UZHA 4I5PA 3AKJA 4L67A 4HPUE 4FKVA 3IDBA 4BWPA 2F2CB 4O4FA 3TKIA 3UOHA 3JPVA 2FA2A 5E92A 3L8SA 1H1WA 3ZHPC 4O7VA 1Y8GA 4XP3A 1YOLA 5D7AA 4TWNA 3NRMA 4MXAA 5FWKK 5HE3A 4PMPA 4AP7A 2XRWA 1URWA 4LQMA 1Q4LA 5CZIA 5D1JA 2C6LA 4O2PA 2V0DA 4LGGA 4Z7GA 4PP9A 4RC2A 1I44A 4YPSA 4FT0A 4F7NA 4EH2A 3BL9A 2XEYA 3G9NA 4TXCA 5GINE 3KXMA 2PMIA 3PRIA 5C1QB 4GSBA 4EQMA 2CNUA 3PJ1A 4AAAA 3OWPA 5LARA 2P33A 5EOBA 1PXMA 4UWCA 1W2CA 4N6YA 1UVRA 3I7CA 5IUGA 1DI8A 4GYIA 3QQJA 4QNAA 4PMTA 5T68A 3UIUA 3P7BA 2XBJA 5FTOA 5A4LA 3OS3A 1KUTA 4UZDA 1FVVA 1OM1A 2PMNX 4F9YA 3HV5A 2OH4A 3OG7A 5A4QA 4FKWA 2A1AB 5IA1A 2XKFA 2W06A 1VR2A 4XV3A 3M1SA 4EC9A 1CDKA 4I6FA 3RM6A 4FEQA 2BPMA 3D14A 4AN3A 2XVDA 2GQRA 2OFVA 4WNPA 3QCXA 4C02A 3QTSA 4M0YA 4C61A 3ZC6A 2W4KA 4JDHA 2XAMA 5EI2A 3U6JA 2BR1A 3F66A 5GZ8A 3NR9A 5AUUA 5J1VA 3UP7A 3OW4A 1Q8YA 4YHTA 3TNIA 3MS9A 3VULA 4FEUA 2VGOA 5H9BA 5AUZA 3TCPA 4C59A 4IX3A 5IA0A 5M4UA 4O7RA 1K3AA 1O6KA 3IGOA 3MPTA 4G6NA 5A4CA 5FTGA 5AEPA 1LEWA 3R2BA 4AAYA 1O6LA 4E6AA 4D9UA 1G8KA 1JVPP 2O8YA 3FWQA 4O91A 3UG1A 1BLXA 1ZZ2A 5HG5A 2WMTA 1W2DA 3EYHA 5G1XA 3CIKA 4ZSAA 4ID7A 5EHOA 2ZV2A 5F9EA 5L2TA 2BFYA 3NZ0A 3VBYA 2UW5A 4F9BA 3HMIA 1FBNA 5HBEA 5J9LA 2XRUA 5CVGA 2BALA 2QOCA 3UDZA 2YDIA 1OL7A 2C47A 4LGDA 3M11A 2YLFA 2QODA 3GXLA 3V51A 1TQIA 3DOGA 2OIBA 3R8LA 4EK4A 2WB8A 4O84A 2J7TA 3UBDA 4UMRA 4QQCA 3QD2B 4FL2A 3SXRA 2WEIA 2R4BA 1YXUA 4MXYA 5IQEA 4FV3A 5C4LA 2QOLA 3MB7A 3OCGA 4BB4A 3BU5A 2ITYA 2BVAA 4GKHA 4FEWA 4QTBA 4AZSA 4NFNA 4AOTA 1OPLA 2QOIA 5KE0A 4TNDA 5KMKA 3HMOA 2VTIA 3W10A 4BRXA 3PJCA 1JLUE 5A54A 1NXKA 5HG8A 1SM2A 3CGFA 4R7HA 4C3PA 5CU2A 4AE9A 3PPZA 2XIYA 1MP8A 4BHZA 3LFEA 1OI9A 4YBKA 4YMJA 5BV3A 2UZBA 4OTDA 4USEA 2W05A 4YTCA 3OP5A 4E26A 2P4IA 1PXNA 1QCFA 4U43A 4BDGA 2RFDA 3OWKA 4UWYA 3EQIA 3RPSA 4CG9A 3WIGA 5FP6A 4EL9A 3F5GA 4UXQA 4BBMA 4DINA 4HVHA 2VWXA 4U40A 3P5JC 1G8AA 4FKPA 4AN9A 4RJ6A 3ULIA 5HBJA 1GZ8A 2OU7A 4Y95A 5CXZA 4FOBA 4J99A 3FMDA 5M06A 4YTHA 4G3DA 5H2UA 2R3JA 4JQ7A 4QMXA 3I79A 1CKPA 4H05A 4EWHA 3MH0A 2YJRA 4FODA 3FMMA 3E88A 4HZRA 4QPMA 4I21A 4C4HA 2W96B 3OMVA 3F61A 3TG1A 1CKIA 4F6WA 2J51A 5CF8A 5CASA 3BLRA 3QWJA 4AE6A 4FIIA 4YURA 2YIYA 3A2CA 5AP4A 2PE1A 4O0XA 4BCPA 4V04A 5LCJA 4AG8A 5AR3A 1F3MC 2JDVA 3DNDA 4CQGA 5KMOA 2H34A 3Q5ZA 5ANKA 1UA2A 2BDWA 4OTPA 5CU4A 2H8HA 1MRYA 2ITZA 2PVHA 2FB8A 3MY0A 2VWIA 3B8RA 3MA3A 3D4QA 4FSWA 2JDTA 4CCBA 2BZKB 3C50A 3UDBA 1L8TA 1JKTA 1XJDA 2NP8A 3GEQA 4RX8A 4YBJA 3MV5A 5LVLA 3NSZA 4DFUA 4PV0A 2PZPA 4ITIA 4BJJB 2CLXA 3T3VA 1F5QA 3FZRA 5EH0A 3WBLA 3WIKA 4IAKA 3QTXA 3ZSHA 3R1QA 3POOA 2OJJA 1B38A 4AZVA 4IADA 2QI8A 3SOAA 1KWPA 3E7VA 4DFNA 3DXQA 3ENMA 3BRBA 4HVSA 1OUKA 2Y4IC 3QD3A 4DFXE 5E9EA 2VTJA 3PVGA 4WUAA 5M09A 4O7NA 3FKLA 3LCDA 2W1HA 3KK8A 4IFCA 4DG0E 3GQLA 4ANBA 4KIQA 5IA5A 5FRIA 2QG5A 1PW2A 1YHWA 3VONA 2C5NA 2WXVA 3G6HA 5F20A 4HOKA 4WBBB 4RJ7A 3E64A 4U3YA 5DH3A 1OGUA 5E8ZA 3CR0A 3RK9A 3NYNA 3VF9A 3ZBFA 4DEGA 2W1ZA 3RCDA 4HW7A 3ZUUA 5FDXA 1U59A 4MBIA 2YDJA 1ERKA 2YIQA 3DZOA 2IWIA 3P0MA 4K2RA 4RFYA 2A98A 3KXGA 3LQ5A 3D2KA 2G01A 4NKAA 5IKWA 3UODA 3WYXA 4JX7A 4EH6A 5J5SA 2LAVA 3N4UA 3ORIA 3CY2A 2R7BA 2VNWA 3Q60A 4G3GA 5DT0A 1UU3A 4MXXA 3U4WA 1OITA 2YM3A 3PY1A 4AF3A 3E8NA 2X8IA 1SVGA 4FSNA 3DU8A 1OECA 3FKNA 4PMMA 4ACCA 5EW3A 2QKRA 4FKRA 3OCBA 4XOZA 2BKZA 1MRVA 4GK4A 4KSPA 3ELJA 4RQVA 4Y83A 1LP4A 4AACA 5H8GA 3R8MA 3MFSA 5A14A 5EK7A 2BAQA 2RIOA 5AX3A 4DEIA 4E93A 4FTKA 4NTTA 4LG4A 1MQBA 5AADA 2EUFB 4RWLA 1Q8ZA 3KRRA 4G3EA 4JBQA 1XO2B 3VS3A 5FG8A 4ACGA 4CZYB 4EEVA 4GV1A 5AV2A 2XCKA 4MD7E 3HX4A 4BYJA 3S2PA 4AGUA 2UZVA 3HKOA 3D15A 2E2BA 3A4OX 2VO3A 1WMKA 3VHEA 4BKZA 3QQFA 1XMLA 1W0XC 4HGTA 4APPA 3R83A 2VWUA 3NUSA 1M52A 4ZXTA 4RZWA 4EH5A 2ITWA 2IVUA 3GQIA 4PRJA 3A99A 1FMOE 5J87A 5HTBA 4B0GA 1V0PA 2GNGA 4L6QA 5JH6A 3BE2A 3Q3BA 3R9HA 1Y6AA 4RFZA 3R04A 3CE3A 3PYYA 5HG9A 5CEQA 2C5OA 5K4IA 4PPCA 1VZOA 3RTPA 5AP1A 4YR8A 4CTBA 4FR4A 3EH9A 3TV4A 4FVRA 3SHEA 1Q8UA 4KS8A 2JDOA 4FGRA 1QPJA 1MUOA 2ZYBA 3NGAA 5E8VA 4GH2A 3TJCA 1XWSA 3VHKA 3E8DA 5CSHA 3UO4A 3AT3A 3CQEA 3UYSA 3ETAA 2IW9A 5BVOA 3CCNA 3SXSA 5KZIA 4C7TA 3VJNA 1R3CA 4F78A 5GJFA 1JSVA 4K8AA 4RVLA 2VWYA 1WVXA 2GS6A 2ZB0A 1U5QA 4L3JA 3TNPC 3D5XA 4IB0A 4Y85A 1W83A 1DM2A 2FSLX 3Q53A 4M67A 5IQFA 2B7AA 3U9NA 2CCIA 5K5XA 3VO3A 3A7IA 2F4JA 5A6OA 3TZ9A 2XS0A 3DTWA 4XG7A 4AN2A 1UKHA 3QC9A 3EFLA 3D5VA 5DNRA 1VYZA 3H9RA 3L1SA 5HO6A 4J8NA 3F5UA 4E8AA 5K0XA 3ZO1A 3FMEA 2ZV8A 2GHMA 4KRDA 4BTMA 2OKRA 3TDWA 2J0JA 3PXYA 4XYFA 4NM7A 3D2IA 4C36A 3ORMA 2RF9A 3BKBA 4M3QA 5HE1A 2CKPA 1DI9A 4NIFB 5IEVA 3AMBA 3UO5A 3CBLA 1E9HA 5LVNA 3KMWA 4I6QA 4ZLOA 4BY9E 2X8DA 3QHWA 4XH6A 1NA7A 5IG1A 3DV3A 4FIGA 4KRCA 3W33A 4ANOA 5JRQA 3MA6A 3VUIA 4G2FA 4XP0A 4L46A 4IX4A 3LXPA 1KOAA 2XA4A 2E9VA 2HXQA 3GU4A 3ZLXA 3O0GA 4QMLA 3D7TB 3GCVA 4XG8A 4BBFA 2OIQA 3VS2A 3NUNA 3QQLA 2GS2A 3I0OA 1G5SA 3Q9XA 4UMQA 5FM3A 3TM0A 3QTWA 1TQMA 3Q52A 4F70A 4AXCA 4IC7A 5I9WA 2YA9A 1H1SA 3GCQA 1GJOA 4JBOA 2BILB 3QTRA 4LRKA 5D7VA 4YSJA 2C0OA 4ANLA 4BCMA 3HAMA 2R3QA 3GU8A 3QD0A 3MGYA 3QZGA 3BHTA 3GB2A 3GCPA 3VUKA 3W0PA 4X2KA 3R1YA 4GT3A 5L2QA 2WZJA 4XX9A 1M2PA 3QTZA 4FTLA 4FTCA 5A4TA 2BHHA 4WBOA 3HL7A 4BDIA 2FYSA 3IONA 4GK2A 5IMXA 3PA4A 4MD9E 4X6RA 3UE4A 4ZZNA 3N9XA 1W84A 2I7QA 2VX3A 3AC5A 3EFKA 4Y46A 5L6PA 2ITPA 3OW3A 5J7BA 5HKMA 2BIKB 3OUNB 4PL4A 2PE2A 1YDTE 4CV9A 2R3HA 3C5UA 3P4KA 1SMHA 5EQPA 4DHJA 5DOSA 3LCKA 1OKVA 1UWJA 2BZHB 2ZB1A 3G90X 1XBBA 3PE2A 1Z9XA 2GCDA 3HV6A 3RGFA 4QTCA 5CVFA 3TNWA 4NIFA 3IW5A 3S3IA 4O4EA 3LMIA 2WKMA 3BYMA 4HYUA 5DR6A 2PYWA 4LI5A 4V05A 4A9YA 3LM0A 1RDQE 1UWHA 2VWWA 3MB6A 3W55A 3DPKA 4BICA 2WTIA 4JBVA 3LFBA 5D12A 3MVJA 4L68A 3MH1A 5IDNA 4FVPA 2AEGA 4EQCA 3UG2A 1NVQA 2C4GA 3D7TA 3QKLA 4DFZE 3F3ZA 4I22A 4PWNA 3LKMA 3VUMA 4A9UA 2P0CA 4NCTA 1TFFA 3DQWA 1ND4A 2BKKA 2XKDA 2B54A 5IQGA 3LCOA 3WZKA 4FTJA 4TN6A 3DLZA 3C51A 4KB8A 4YC6A 3H0ZA 4EHGA 1PMNA 3OWJA 3EKNA 2ITTA 2ACXA 4ZTRA 4F0FA 1PRYA 2J0IA 3QHRA 3R6XA 4FIFA 4H36A 3B2WA 1Q5KA 3ZO3A 4L7SA 5JSMA 2RG6A 3KXXA 4IXPA 4GT4A 4C4JA 1H1RA 1XR1A 2F7EE 2OGVA 3FLWA 5I9VA 5EM6A 3Q6WA 3SLSA 4NK9A 3G0EA 4I41A 4QP3A 4M97A 4XUFA 4OBOA 3FLSA 3KN6A 4MWIA 4NZWB 4FL1A 3V3VA 3AQVA 2VTLA 4MYGA 4W4YA 1Q99A 4A06A 1Y57A 5IQAA 5HOAA 3VS4A 1YXTA 2YDKA 5CU0A 3QF9A 5M4IA 2P55A 3HP5A 1KE9A 1UU7A 3QKKA 3ZM9A 3V6SA 2X8EA 5HD7A 5BMMA 3GP0A 1OBGA 3NNWA 3U9CA 3ML1A 4RC4A 4J71A 4N0SA 1FGKA 3R1NA 4I92A 2ZM1A 5C9CA 1M17A 2IZRA 3NCZA 1Q3DA 2YHVA 1U54B 2B55A 1YVJA 2LGCA 3VS5A 5LJJA 2B53A 3OXIA 4RVKA 4U3ZA 2UZUE 3DKOA 3RHKA 3RAHA 2KULA 4WA9A 4WNKA 4AZEA 2Q0NA 2BAKA 1H8FA 1UV5A 5FXSA 3VS1A 3TEIA 3Q9WA 3OCSA 3E3PA 2I6LA 5ETCA 3PZHA 4L3PA 3MJ2A 4MXOA 4EOKA 2XANA 4O7TA 4FZFB 4GW8A 5H3QA 5CAVA 3QQHA 3R0TA 4O0SA 3RJCA 2XM8A 5J9ZA 3SA0A 5AIRA 3QA0A 2F57A 2R0IA 3AGMA 3EB0A 3W0MA 3HZTA 1PMVA 4FKTA 2RSVA 3Q4ZA 1OKWA 2B9HA 2VZ6A 2YM5A 2WTKB 2ONLA 4MTAA 4RVTA 5F4NA 1M2RA 2W9FB 3VUTA 4HPTE 3I4BA 3RAIA 4QTEA 2PUPA 4O7ZA 5TE0A 4QMQA 2CHLA 4BTFA 2R3LA 3V01A 3VBWA 3AMYA 3LZBA 4K1BA 4YLLA 4TWCA 3UYTA 4CFWA 3AKLA 3LMHA 3AT4A 3T8OA 3FMJA 2GNHA 4B99A 4YZNA 5DRDA 3AT2A 4YZMA 4CYIA 3KCKA 3OTVA 4O0RA 3KVWA 4U45A 5FM2A 3ZFYA 5TR6A 4CFMA 3RK7A 3OCTA 4XMOA 3FEGA 4EHEA 3KVXA 3ORZA 2R9SA 4MAOA 3P7AA 5AV1A 3FJQE 3BHYA 4X0MA 3VBQA 5JK3A 4XV9A 3RBWA 3QRUA 3EIDA 5E8UA 3OXZA 2I40A 3PXZA 4J8MA 4K9YA 4BDAA 1PYEA 4O83A 3GOPA 2GFCA 4O7SA 4R7IA 1W8CA 3QLGA 3V04A 1Q97A 1NW1A 3S4QA 2PVYA 3CKWA 4EOLA 3EMGA 3VBVA 1Q61A 2WU6A 1OL1A 2FSMX 2EB2A 1U54A 3HVCA 1M7QA 2B4SB 3UMWA 4U44A 1A48A 3GGFA 4PDYA 1OKZA 4WSYA 3ORPA 5GZAA 4L53A 2JEDA 3QTIA 3R22A 3P79A 4L00A 2UZOA 1DAYA 4OTIA 1P5EA 4N57A 4WG3A 4X2FA 5G6VA 2X9EA 2QU6A 2VN9A 4Y5QA 3R7GA 2Z60A 1W98A 2YWVA 3NVMB 4DFYA 5EKOA 2OF4A 3HRFA 5I0BA 4XG3A 4QMYA 2WMSA 2YCSA 4IM0A 4KNBA 4FTMA 4FNWA 3UOKA 3O51A 1JKLA 5C8NA 1XQZA 3ORNA 4O81A 4W9XA 3B8QA 2CKOA 3UPXA 2R2PA 3UZPA 2ITUA 4EYMA 4L9IA 3UGCA 2UUEA 4CFUA 1XBAA 3S0OA 2H9VA 3F9NA 3O2MA 3FXZA 4NM3A 2W1CA 3E93A 3MH2A 4M69B 4G16A 5DT4A 5C03A 3VBTA 1OPJA 4ZAUA 4JMQA 5IA2A 3R7VA 3O8TA 2J0MB 3ZO4A 3QX2A 4AXDA 5FD2A 3EN6A 5FEDA 4CCUA 3V5LA 4JI9A 3HA6A 1YXXA 4RIXA 4LOOA 2C6TA 2J4ZA 4P5QA 4X6QC 5E91A 4FTNA 5DMZA 3Q5IA 5CQUA 4TPTA 2IZUA 4EK5A 3MTLA 2H6DA 4CNHA 1OGYA 3CPCA 3D5UA 2ITQA 1XH8A 3F2NA 4CFFA 3UOJA 4C58A 2PVNA 3RALA 3OEZA 2G1TA 1X8BA 3C4WA 5AWMA 1SZMA 5K3YA 2JAMA 4CZTA 3QX4A 4XNEA 1CM8A 3WE8A 2CDZA 2JIIA 5EHLA 2BRGA 5HICA 2IW8A 4ZS0A 3DQXA 3O71A 4C2WA 4FV1A 2HZ4A 5HVKA 4JIAA 3HMNA 2J0LA 2ZM3A 2F7ZE 4FI1A 4BZDA 5CANA 4MXZA 3QCQA 2ZV7A 4WG5A 2A27A 4I94A 3QA8A 3HAVA 3ITZA 3MVHA 2OJ9A 4RX5A 1T45A 3EQFA 3HUBA 1YKRA 3IW8A 3EN4A 4H1MA 5ACBC 1UU9A 3JXWA 1UKIA 2WU7A 3L8XA 4O22A 4Y73A 3TNQB 4RMZA 4O4BB 5CTPA 2B52A 3QU0A 4ZSJA 3V5TA 3ZDUA 4IQ6A 3ID6C 1PMUA 3VC4A 2GQGA 3QAME 4IH8A 1YDRE 4YHFA 4D2VA 3THBA 4RG0A 1YOMA 2BRHA 3ZONA 4EC8A 1PKDA 2XK8A 3L9LA 2IO6A 3P5KA 2PZRA 4KIKA 4L43A 2W4OA 3FQEA 4EI4A 4EH4A 2Z02A 4USFA 4M12A 4WSQA 3TKUA 2IW6A 3NNUA 2J9MA 2R3GA 2WMUA 4XP2A 2X9FA 3MDYA 4Y5HA 4DEBA 2CKEA 2OZOA 3KB7A 2ITXA 4EOPA 3DLSA 3MTFA 4IB1A 2C0TA 2R5TA 5JEBA 3FL5A 5M08A 1LUFA 2R3PA 3LQ8A 3SRVB 2YJSA 3L9NA 3NLBA 4MK0A 4FKGA 2IJMA 1RE8A 2C6EA 1J91A 2C5VA 2IVSA 2UW7A 1CKJA 3OF0A 4XLIA 5CX9A 2Y9QA 3UZRA 5CSWA 5ANGA 3P78A 1XH7A 3W2SA 3ZH8A 3W2CA 1SNXA 2EB3A 2PSQA 1OL6A 2XKEA 3Q32A 4X2NA 1NVRA 4GIHA 3R73A 4D1ZA 1JAMA 4H3QA 4JDJA 4FTTA 3V6RA 4EOQA 2X0OA 3NS9A 5BYLA 3W32A 2OH0E 4D2SA 3Q96A 3PXFA 4XEYA 3ZOSA 4CMUA 3S00A 4KBAA 5KMMA 5AA9A 2HIWA 4NKSA 2J5FA 3NW7A 1H28A 5EQYA 5BUJA 4JQ8A 5LMKC 2PVRA 2XJ2A 3VS6A 4DG3E 1IEPA 2FGIA 3FMKA 4R5YA 2PZ5A 3FC2A 4E73A 3EQGA 3KXNA 4EYJA 2X2LA 4S31A 4XV2A 5HTCA 3W0NA 4R1VA 4FT7A 3TIZA 3KU2A 4DAWA 1UNGA 2CPKE 5J1WA 2UW0A 3M42A 4W8DA 2VUWA 3QZHA 4IB5A 4CKRA 4M14A 4UMPA 2FSTX 5HGIA 4J7BA 4H3PA 4UV0A 4B4LA 4BIEA 2EXMA 3C4EA 4S34A 3FKOA 3UC3A 4EKKA 2F9GA 3PRFA 1SVHA 4RLLA 4B8MA 4Q2AA 2J50A 4FEVA 5CF5A 1YHSA 2V7AA 1U5RA 3AKKA 4YNOA 5JZNA 5AM7A 3PTGA 3QQGA 5FXQA 2ZDTA 5AAFA 4UY9A 4R3CA 4YLKA 3N4VA 3FL4A 3OHTA 4X2JA 2C3JA 4HJOA 4GRBA 4FSTA 4EJNA 2F2UA 3GUBA 4KWPA 5E8XA 1QPCA 2PK9A 5D9HA 4IAYA 4S2ZA 4QMNA 5L8JA 3E87A 5ANIA 2JBOA 5AR8A 2XEZA 2QOQA 2V62A 3CTJA 5T3QA 2XARA 4AOJA 2XNPA 3GT8A 3CQWA 4RT7A 4I93A 4E4LA 4O6LA 5IPJA 4IBMA 3ZLYA 4ACHA 1H24A 1REKA 4RLKA 3QUPA 3R9NA 4JR3A 4QQJA 4F64A 2X4FA 5M4CA 3LFQA 5TT7A 2FUMA 3CY3A 3ZRLA 4RIOA 3CD3A 1CTPE 3DK6A 1PJKA 5F95A 4MEDA 4DTKA 3HV3A 3GU7A 4F9WA 2EVAA 1JSTA 1ZOEA 4Q5EA 2Y4IB 5LWNA 4ASDA 5M51A 3MWUA 3ANQA 3EFWA 4YTIA 4BDFA 2BZJA 3LJ1A 3OEFX 3R71A 4QO9A 4U7ZA 4EZ7A 2Y8OA 5AP0A 3E92A 1ZWSA 4GG5A 3V8SA 3ZC5A 3HRBA 4PTEA 3KQ7A 3V5JA 1WBVA 3GC0A 2QLUA 2DYLA 4EONA 2YERA 3ULZA 5IZFA 3CKXA 2XJ0A 4IW0A 4DHIB 5AP6A 3GOKA 5CNOA 3BV2A 2C3KA 2X7GA 3BYSA 3ZSGA 4FV8A 4YO4A 5AIKA 4LUEA 4EK8A 2YZAA 5CWZA 3DK7A 5B2LA 1R0EA 5C8KA 4IM3A 2V5QA 4ALWA 3R01A 5F94A 3CTHA 2QURA 1H4LA 4ALVA 2XIXA 4EK6A 4F1OA 5IQDA 4L3LA 4TYHB 2W5BA 5L2IA 5CXHA 4FKUA 4BTJA 5IF1A 4PDSA 4OTHA 3TZ8A 3EZRA 2UZNA 5AMNA 4CLJA 1APME 3AGLA 1WBOA 2UVZA 3FYJX 4GYGA 4MX9A 4XLVA 3BEGA 2B0QA 2YIWA 3V8TA 4I5CA 4R8QA 3PIZA 2WMRA 1UU8A 3GCUA 3VIDA 1U4DA 3BBWA 3OZ6A 4U8ZA 3QD4A 4YJRA 3MW1A 4YP8A 4U9AA 3PXKA 4ZTQA 2YCFA 1U46A 1QL6A 5TO8A 3RMFA 5HHWA 3GCSA 2FSOX 4C34A 5EDRA 3PIYA 4HVIA 2R3OA 1JBPE 1R0PA 4FSMA 4M7IA 2PULA 5HCZA 3LJ0A 5LWMA 5AR7A 3K3IA 4YZDA 3Q9ZA 3IDCA 4DFLA 2QD9A 2R0UA 4H1JA 3ZU7A 3TYKA 3FZTA 3ZSIA 4R3PA 4EOOA 4FICA 3LMGA 1STCE 3IQ7A 2NO3A 4ZSEA 4CKIA 4UN0C 3ORKA 4IDVA 2OF2A 4PMSA 5EOLA 4AX8A 3TMOA 3KC3A 4RGJA 5C01A 3DDQA 2YZLA 1XH9A 5I3RA 2HAKA 3DK3A 3EZVA 3VBXA 4S33A 2VWZA 2R3NA 3HECA 3DKCA 2QHNA 2UZEA 5EYCA 4EZ3A 1IG1A 4A7CA 5L4QA 3A7HA 3SOCA 1B39A 5J95A 3OOGA 5M55A 2G15A 3UO6A 5CEOA 5CSPA 3PZEA 2WPAA 3ALNA