3BU6A

Crystal structure of the insulin receptor kinase in complex with irs2 krlb phosphopeptide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
294
Chain Sequence
DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords insulin receptor subunit beta
publication title Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 294
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bu6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bu6A01
4OBOA 4BKZA 4IM0A 2XNBA 4GMYA 2J0MB 5I9YA 3NUNA 4O7ZA 4P90A 2BKZA 3IW5A 2C69A 4YC6A 4W4XA 2EXCX 3VULA 5LMKC 4CRLA 3R9RA 3KF4A 4UMTA 3PLAE 5M4UA 3F88A 4W9XA 4BBMA 1GNGA 4I0TA 3O7LB 3DBFA 1Z9XA 5HVYA 3HGKA 4O38A 3E93A 3OT3A 3D5WA 5IISA 1OBDA 3KN5A 2HK5A 3MPMA 4GVJA 4NT4A 1IAJA 3UGCA 3NEWA 4GT4A 4ZJIA 4FA2A 3WYXA 1ZMWA 4ZY4A 1PXLA 4D28A 5AWMA 2QOFA 4WG3A 1YOMA 2XYNA 4O1PA 4RRVA 4WOVA 5IQEA 1OUKA 2RGPA 3BEGA 4WBBB 4U45A 2JDRA 3KN6A 3A4OX 3OFMA 4X2JA 1YXXA 4X3FB 4YBJA 2G2HA 2FSOX 5DBXA 1VR2A 5GJGA 4CKRA 2C6IA 3NYNA 4FZAB 3K3IA 4JBQA 3PVWA 5E1SA 4DN5A 1XKKA 3OCGA 4DBXA 4S2ZA 3MY1A 1AD5A 4O84A 4YJRA 3ZRLA 4TPTA 4DGOA 4ALWA 2YIYA 3D14A 3GC9A 3R1YA 4ZXTA 3KREA 5ETIA 4A9UA 5DVRA 2QONA 4ENYA 4L52A 3ACJA 2XH5A 2W1HA 4MWHA 5AX3A 5FDXA 3OCTA 1H26A 1JSTA 3TDWA 1WVXA 1XO2B 4RIYA 3FZOA 3QC9A 3W32A 4KAOA 5IG1A 5M53A 4BR3A 2AC5A 2XNGA 1V0BA 5DGZA 5L2IA 2W1FA 5M06A 1Q41A 3CJGA 5GINE 3P7CA 3D15A 3OZ6A 1XWSA 2R3IA 3CE3A 4FR4A 3VHKA 3D9VA 5L2SA 1L8TA 2V7OA 3FPQA 3NVKI 5CI6A 3BGZA 4D4RA 4G5PA 4PL4A 3RTPA 4HJOA 4W8DA 3G6GA 4F1OA 5GZ8A 3JYAA 4CZTA 3G2FA 5JQ8A 2WD1A 1M7QA 4FV3A 5DR2A 2X9FA 3ZEPA 1KOBA 4ZSJA 4Z7GA 2HZ0A 2W5AA 4MAOA 3NZ0A 2J7TA 1PHKA 3ID6C 4IH8A 3G5DA 4CQEA 4FKJA 3QGWA 4WT6A 4MKCA 2ZYBA 3ZXTA 5ETFA 4YO4A 3WE8A 3WZDA 4JOAA 3RHXA 1FMOE 5JFVA 4FZFB 3F3VA 1JWHA 3R7UA 4F7JA 3O2MA 2XK3A 2XF0A 5CEPA 1B39A 4KKGA 1H1QA 5CT0A 5J7HA 3KRXA 4ASZA 4HCVA 3F6XA 1Q62A 3LOKA 4AG8A 2WELA 2OJIA 2UV2A 3VO3A 3G33A 3HMNA 3OCSA 5JGBA 2PPQA 3ORPA 5GNKA 4QMZA 4NIFA 1GZKA 4LRJA 2X2KA 4E4NA 4CNHA 1OPLA 5HU9A 2XRWA 4FV4A 3RCJA 4KRDA 3OEFX 4FTAA 4CSVA 2R7IA 5EQPA 3FI2A 2VWYA 5BYYA 3SW7A 3BE2A 4IDTA 3R9DA 3QZHA 3UG2A 3ZBXA 3HAMA 2FUMA 2Y4IB 4F70A 3LHJA 3PTGA 3VHEA 3GUBA 3UVQA 5BYLA 4AN2A 1YI6A 3B2TA 3MB6A 2WTWA 1SNUA 4OTWA 2XEZA 4S32A 2WEVA 1X8BA 5HLPA 5HE1A 2VNWA 4IB5A 5KKRB 3OXIA 4KSPA 1F3MC 2WZJA 3QD0A 3R00A 4UB7A 3FHIA 3SOAA 2J0IA 3Q53A 3R73A 4O91A 3REPA 4BGQA 2GQGA 4BTKA 4D9TA 1VYZA 2ACXA 4EZ7A 4ZZNA 5EFQA 2G01A 2JAVA 4ANNA 3LFEA 1U59A 3T3UA 2PYWA 3JXWA 4ZK5A 2XS0A 5DLSA 2PVFA 3Q9WA 3ENHA 1XH7A 5AUVA 3T3VA 4DTBA 2BILB 3TWJA 3AC1A 3MH2A 5ICPA 4DFUA 4FKVA 2OKRA 2XEYA 4IZ7A 2VUWA 3BE9A 5DYJA 4YJPA 2VGOA 4XRLA 4JG7A 4H1JA 4RC4A 3A7HA 4ZOGA 2WMRA 5IQHA 3UZRA 5ANGA 4ACGA 1BL7A 5IA4A 4EYMA 5EHOA 4G3CA 4UWCA 5HLWA 4QP4A 4M14A 4FTOA 4QP8A 2PZ5A 5L2QA 2PMLX 3LFSA 3E64A 3W55A 1YHSA 2QOIA 5IQCA 4MNEB 4F09A 3QZFA 3MVLA 5JGAA 5HG7A 4NFMA 3RCDA 3ZYAA 4QP9A 3U9CA 3TKHA 4WHZA 2B9IA 5HTBA 4BI1A 3F5UA 2HW6A 3QTSA 1JKKA 3HV7A 3OHTA 3ZOSA 1OKYA 4EWQA 3I4BA 4YJTA 1F5QA 3QYZA 4A07A 3AMBA 3QRTA 5C8KA 2Y6MA 2HZIA 4X21A 4E7WA 2Z02A 1KE8A 5E8XA 3FWQA 4ANSA 2XNEA 5HBEA 3UP2A 1VYWA 4FEWA 2IW8A 4ZS4A 3VQHA 2QU6A 1PW2A 2FSMX 3H0ZA 2J5FA 5KZ0A 2SRCA 3QHWA 2DQ7X 2A2AA 5AIKA 4EI4A 4X2FA 2XK6A 3GT8A 4R77A 3O8TA 3P7AA 1IASA 4AZSA 3PSBA 4BHZA 5E1EA 5HE2A 2GHGA 3EN7A 2B53A 1BL6A 4TZRA 2WTDA 4PUZA 2UUEA 4J8MA 5HO7A 4ZMFA 4KIKA 3GBZA 2J50A 1O6LA 3U6HA 3CCNA 4JBPA 5EM7A 3LQ8A 3L9PA 3KB7A 4WSYA 1Z5MA 2CCIA 4GU6A 4FIJA 4KS8A 3SXSA 3ZLWA 4IJPA 2C0IA 3ET7A 2RF9A 4FTIA 2J0LA 3ZC5A 3C5UA 2BTRA 3DTWA 4FKWA 4QTCA 4B0GA 2QOLA 3EN5A 4IFCA 5M51A 3F2RA 4DT9A 3GCUA 2W4OA 2XA4A 3DFCB 4J1RA 2UW6A 2I7QA 1TQIA 1OPJA 4JNWA 4ZEGA 3PY1A 2WQNA 2Y0AA 3EFLA 4JQ7A 3Q96A 3ZCLA 4MX9A 1ZRZA 3EQFA 2WMSA 4IHPA 2XJ2A 5DR9A 4ASDA 1PF8A 5I9VA 2ZV8A 2R3OA 5CU0A 4CMOA 4C02A 4YUQA 4K9YA 4J95A 2QHNA 4BTJA 3PJ2A 5AJQA 3NYVA 3PUPA 1GOLA 1O6YA 4DAWA 3TUBA 3CEKA 4QYGA 4RVMA 3U55A 1YRPA 4GUBA 4WSQA 3G9NA 5I9XA 4FIHA 2X8DA 4J71A 4AW5A 3BQRA 2EB3A 3HYHA 2IO6A 4LGGA 4YSMA 5HCXA 5LCJA 3ANQA 5IA0A 4OTPA 3PA5A 2CKQA 4YZ9A 3MY5A 4RVTA 3OMVA 2WTKB 3ULIA 2FSTX 4APCA 2OU7A 4IIRA 4OAVB 3DJ6A 3PY3A 3TJDA 1J91A 1OM1A 3LCKA 4USEA 2GNHA 4G3FA 4FV8A 2RL5A 2XK8A 4RT7A 3PE1A 3Q4ZA 3AD5A 4MWIA 2B1PA 3DNEA 1OMWA 4DCAA 3GU6A 4H36A 5CXHA 2PTKA 4E4LA 3CPBA 4DH8A 4K33A 3SG8A 2X2LA 4FT7A 4IQ6A 4NCTC 4XG4A 4OBPA 2CGVA 2JKKA 4O7VA 3CP9A 1JQHA 4FG8A 3RAIA 1BI7A 3Q3BA 5IDPA 2GCDA 3TL8A 4I6BA 3PPKA 1UU8A 3Q60A 4FTTA 4U81A 4IM2A 3R7YA 3TV7A 1Q61A 2YHVA 3D5XA 3KF7A 5AP7A 3QTUA 2R9SA 2X4ZA 2XIRA 3R0TA 3LXPA 2VD5A 1GIHA 3C50A 4PMSA 2OF4A 4JG8A 3CKWA 4E1ZA 3DNDA 3UDBA 4DH1A 4I6QA 2WFYA 4GYIA 4B8MA 3R8ZA 5AR3A 3UIBA 2BKKA 2QO7A 3MN3A 3SOCA 4CZYB 3C4CA 4EJNA 5CAUA 2GU8A 2Q0BA 5KO1A 4MD9E 5DT0A 5F95A 4LG4A 1SNXA 4IC7A 4IMYA 2PK9A 3ZSIA 2UZOA 4BCKA 5JFXA 3EQRA 3P0MA 4CT1A 1ZYCA 2ETMA 3ZFMA 3ZDUA 5BVFA 3C51A 2YCSA 1H07A 2E9OA 1JKTA 4JT3A 2QNJA 4U44A 5KMMA 2PMNX 3B8RA 4DEHA 3I0QA 3GB2A 5HIBA 2C3LA 4ANBA 3TNHA 3VF8A 5M08A 3KQ7A 3DJ5A 3HA6A 4NM0A 4GIIA 3DDPA 3LIJA 2V5QA 4IBMA 4ZS0A 5EYKA 3FQEA 4D55A 4FE2A 4PRJA 4FL1A 4ANLA 3R9OA 4YZDA 4UXQA 4RLKA 4TKSA 3MH1A 4EQMA 2O2UA 3IW8A 3WILA 1UU7A 4WBOA 4AQCA 1QPCA 4L6QA 3QUDA 4GVAA 3QXOA 4LI5A 3TT0A 5G6VA 4FNWA 3L9LA 5F4NA 4MBLA 4AOIA 5IA1A 3CTJA 3QTWA 3I7BA 4IM3A 4O82A 3IDBA 4OLIA 5CU2A 3ZONA 4TL0A 3E92A 3FMNA 4XHKB 5FGKA 5HNBA 4D5HA 4RJ8A 4PNKA 3IS5A 3F2NA 4KBKA 4W4VA 4HGSA 3U4WA 2VRXA 2YIRA 3L1SA 5CF5A 4HGLA 3VBVA 4RQKA 3TNWA 4D4VA 3FLYA 3K2LA 4JXFA 3ORNA 3QQHA 3F61A 4IXPA 3T9TA 1CM8A 5A54A 3PP0A 4AF3A 4OTHA 2IZUA 3C4XA 3DAJA 2W0JA 2YCQA 4LRKA 5CSHA 3QQJA 3V6RA 1BMKA 2BZIB 3FZRA 3NGAA 1NVRA 4R1YA 4W8EA 2YJRA 2QODA 3KXMA 3UYTA 4C2VA 4BF2A 3TI1A 3OTUA 2BHHA 3LJ1A 4EH2A 3E7VA 2JGZA 3EN4A 3K3JA 3FZTA 4DG2E 4IVBA 3VUDA 3ZSGA 5F94A 1KV2A 3LM5A 5AFVA 4EK3A 3RINA 3C7QA 3EFJA 2BZJA 2VWBA 4F7SA 1YDRE 4IB3A 2NRUA 1K3AA 4GFOA 4P5QA 5KMJA 2XM9A 4A9SA 1Y57A 4QT1A 4X3FC 4FGBA 2X8IA 1XR1A 2WMQA 4U6RA 1CMKE 1YWNA 1IRKA 2CPKE 4IDVA 4JX3A 4IWDA 1JSUA 3AD6A 4QMSA 4U5JA 1ZLTA 4DH7A 5AMNA 4O86A 4R5SA 3R2BA 2HAKA 2VTIA 2Q0NA 4L44A 4LGDA 4FV5A 4L7SA 3R01A 1IEPA 3R2YA 4EHEA 1Q99A 3Q4CA 3F66A 4BIBA 3UOLA 4FV7A 3RK7A 2BMCA 2G9XA 5ANDA 3EQBA 2QOBA 4QYYA 5FTQA 3COKA 4DCEA 4EOKA 5LJJA 2GNGA 2YERA 3AT3A 2J51A 2IVUA 4RZVA 5IQGA 2ITOA 2HY0A 3PY0A 3R63A 4UZHA 4Z3VA 4M68A 5K0KA 5BUEA 2QR7A 2W1IA 2UVYA 2V55A 2PVKA 4ZZOA 1NT2A 2WPAA 5FLFA 2IN6A 4GW8A 4RIYB 3QRJA 4Y73A 4U42A 3V8SA 3UIUA 2CGUA 2VO6A 3A61A 3MI9A 4TWPA 4Y5HA 4UV0A 4OT5A 3M11A 3R8LA 5BPYA 3OWKA 4YC3A 3VUTA 2PVJA 1K9AA 4O0RA 3RK9A 4AX8A 4BDFA 4EK5A 2BTSA 4RWIA 2C6LA 2ZV9A 2W1DA 4V01A 4YP8A 4BZNA 4IX6A 4D2PA 3UQGA 4PP7A 2P4IA 3KXGA 2BZHB 2B9JA 3BYOA 1OIRA 2RIOA 3GCVA 4RWJA 3ZUUA 3PVGA 2HW7A 4NK9A 3BRBA 3RMFA 3UJGA 3DKOA 2BAKA 4K6ZA 3GENA 1XQZA 5C8NA 1ZY5A 4IAIA 2YDJA 2QKWB 2NPQA 3DLZA 4XBRA 3NYOA 2A1AB 4C35A 4HNIA 2J90A 5DWRA 1SYKA 1STCE 1WZYA 3EKNA 4OTGA 4RFZA 1YWVA 2PVNA 2ITXA 2R3NA 3EKKA 2W5HA 3ODYX 4R3CA 4C0TA 4EKLA 4XNEA 4W4YA 5CSWA 2PUUA 2F7XE 2WTCA 3HDNA 4KKEA 3WF7A 5DEWA 1FOTA 4ZZMA 3FQHA 4FK3A 4TWOA 5DN3A 4AA5A 5DOSA 4U8ZA 4J99A 5B2KA 4EH6A 2X39A 3O8UA 2ERZE 5HHWA 3KFAA 1GJOA 3E7OA 4DT8A 2BRGA 3F5XA 3LFFA 3ORXA 3HL7A 3PLSA 4DGNA 4KBCA 2JKOA 2BDJA 1G3NA 2F49A 2XM8A 3O8PA 4C4GA 4EZ5A 3V8TA 2JBPA 5ANJA 4U3YA 2ZM4A 3GU8A 5LXMA 3JS2A 1FGKA 5JN2A 2EVAA 5AR8A 5T6KA 4X6QC 3K54A 4BIEA 3MH0A 1PXPA 4IB0A 2GFSA 1Q8ZA 4ZTHA 3P5KA 5A6NA 2YM3A 3ZM9A 4F99A 2I0HA 2OGVA 2VTQA 4D0WA 4RIWA 2EU9A 4BCIA 4BBEA 4FGRA 4IX5A 3PSCA 3A7FA 4BICA 2W1EA 5GIPE 4LUEA 2B4SB 1REJA 3WARA 2OF2A 5D41A 4TWNA 3PIZA 4AACA 3LMGA 5A4CA 3U51A 5EHYA 3WZEA 4E6DA 3HZTA 4RJ6A 4CZUA 2C6TA 3QX2A 5ITAA 3I1AA 2I1MA 2AYPA 3UNZA 2GHMA 1MQBA 3RZFA 4CKIA 2XMYA 2BDWA 1TKIA 3HMMA 5DT3A 5J95A 4EH8A 3BBTB 2OSCA 5HOAA 2GTMA 5A3XA 2WQMA 4W9WA 2O5KA 4XG9A 1OZ1A 5CAQA 3Q9YA 1RW8A 5A4QA 4YNEA 3O23A 3QX4A 2A27A 5K5XA 3QFVA 2PHKA 4U9AA 1BKXA 3MA3A 3MJ2A 4FT5A 3WYYA 4C3FA 3OY1A 4ZJJA 3LFAA 4L01A 1GZOA 3O51A 1UWHA 1BLXA 4I41A 1UA2A 4UMRA 3HVCA 3RJCA 4YZCA 4JLCA 2JKQA 2O65A 4IC8A 3EYHA 5FXQA 3TM0A 3UPXA 4LV5A 3RPRA 4AT4A 3UNKA 4X2GA 1W7HA 2CSNA 2AUHA 4FODA 4H1MA 3A60A 3PJ1A 1V1KA 3P23A 5ANKA 3G0EA 4AW1A 4IEBA 4BGGA 4BDDA 4BDGA 3MPTA 2YISA 4RVLA 1UV5A 1PRYA 2UZTA 3FI3A 3Q6UA 3OEZA 3QD3A 3JY0A 4K77A 4O0VA 4C4JA 2OXDA 4FNYA 1SVGA 4K8AA 3NW6A 4IWOA 2YWPA 2WMTA 4FV2A 5HICA 3CC6A 4AFJA 3RK5A 3UZPA 2KULA 3BHUA 4FKGA 3PJCA 3UQCA 5I5ZA 4FIFA 4NWMA 4RJ5A 5FTGA 2R3FA 1UKHA 4MQ2A 4GJ3A 4U43A 1WBPA 4PF4A 3RVGA 3DBCA 4IWQA 2BRNA 5AV4A 1DAWA 5I9UA 3AC4A 2X6EA 3IPHA 4QP6A 4I20A 3VVHA 4RX5A 3E8DA 1S9IA 4CCUA 3PYYA 3DV3A 4HCUA 4L00A 3DZOA 2FA2A 4AZWA 4E6CA 1OECA 2CJMA 2PUNA 4L3PA 4U40A 3FEGA 5BVOA 3UVPA 4KINA 3HV6A 1MUOA 5ANEA 4O21A 2HYYA 4IANA 4MEDA 5DA3A 5HZNA 3MIYA 4E3CA 4XP3A 1R1WA 4BCHA 4YPDA 5H8BA 2WXVA 4WUNA 4YLJA 5AIRA 3D5UA 2PZRA 3TKUA 3VS4A 4BCQA 4DEGA 4YJOA 2GFCA 3OROA 4AFEA 2R0UA 2R3GA 3BWJA 3GCQA 4JIAA 5FEQA 3SV0A 4D9UA 2C6MA 1IA9A 4P4CA 1OL2A 4CFFA 3NR9A 4PP9A 3TJCA 3CXWA 4K1BA 2F7ZE 2RFNA 3FMJA 3ZLSA 4E20A 3GU7A 4QQJA 5AM7A 3KY2A 5E4HA 2IVTA 4G31A 3KK9A 2FYSA 2X0GA 4F6WA 3AOXA 3RI1A 3F2AA 4YSJA 3VS1A 2GMXA 5EI2A 4Y72A 1DM2A 1MRVA 5HBHA 4JG6A 2JD5A 3D2IA 2WTKC 3VBXA 2E9PA 4TYHA 5HD4A 5AV0A 2JFLA 5LWNA 5J8IA 3HLLA 3CSVA 4F9AA 3W8LA 4JL9A 5M57A 3FV8A 2I0YA 5IEYA 3UVRA 2ITQA 4MBJA 2G2IA 2GNJA 2ZV2A 5HVKA 4QYFA 5EM6A 5HVJA 3FMEA 2CKOA 2QD9A 4RX8A 2C5VA 4V0GB 2XKCA 5GZ9A 2IW9A 2W17A 1K2PA 3I79A 4FL3A 4D1SA 3VJOA 3VW8A 4CLJA 5EM5A 4ITIA 5M4CA 2XK7A 5KMIA 5EQEA 4FC0A 4BN1A 4EOIA 5L8LA 3EQIA 1H1RA 2UZNA 4EC8A 3P79A 4EC9A 3PXRA 1Y6BA 2ETRA 3DBQA 3Q5IA 4C4IA 4YR8A 5KHWA 4C8BA 5HE3A 1KV1A 2PY3A 3SDJA 4OTFA 3AGLA 2B52A 2WOUA 3JR1A 2R3LA 2J5EA 3GNIB 3QAME 3HMPA 4FKTA 4FOBA 4MBIA 4MXZA 3I81A 4BI2A 3F3ZA 4U3ZA 3FMLA 4PMTA 2IG7A 3G0FA 4FTKA 2WTIA 2RFDA 2WQBA 1NA7A 1ZXEA 2R3KA 3HX4A 3PZEA 3HV4A 5CNNA 3KEXA 1SVHA 2JBOA 2O3PA 4MH7A 4U79A 3R9HA 2F7EE 4YMJA 4Z16A 5H8GA 1FGIA 3TEIA 4EH9A 2JIVA 5D7AA 4YTCA 5A4TA 4Y83A 4B9DA 4H58A 1OKZA 2REIA 3FPMA 5CF4A 1JKLA 1U54B 5IQBA 4CFNA 2QQ7A 4I94A 4FKRA 4YU2A 2F2CB 2W9FB 3BYUA 2QO9A 2OBJA 4F63A 4RBLA 3M2WA 3CD8A 3R8PA 3UO4A 4QPSA 2ZAZA 4C33A 4EOMA 3FLNC 2NRYA 3FBVA 3LPBA 4FKOA 4C58A 4R5YA 4DGGA 3FLQA 3UYSA 3ENMA 2G2FA 3DS6A 4L46A 2AC3A 2ITTA 4RA5A 3B8QA 2OFUA 3BPRA 3GXLA 4Y85A 4ZTLA 3ZM4A 4C2WA 2G15A 1H00A 1Q5KA 4U41A 4RSSA 3DKGA 3KCFA 4UY9A 5HORA 1YW2A 3RAWA 4BZOA 3ATSA 1P4FA 3NWWA 4QMYA 1HCLA 3R04A 3BYVA 3HEGA 2QHMA 2UZLA 3DAKA 4DHFA 4ACCA 4JDJA 3NLBA 3UO5A 1WAKA 2R3QA 3PG1A 2C5OA 3NAYA 4I6HA 5BMSA 3DAEA 4G9RA 5E8SA 4BVUA 3QQFA 5JGDA 1KE7A 5FXSA 1RE8A 4L7FA 2OH4A 4F7NA 5B7VA 3RWQA 2O63A 2BFYA 2W4JA 4ZIMA 4QQCA 2PU8A 3GQLA 2Z7RA 4E5WA 4PTGA 2B0QA 1H27A 1SMHA 1UNLA 2WQOA 5CVGA 4HYHA 4FF8A 3T9IA 4BZDA 4LL5A 1AGWA 2XVDA 4KWPA 3VNTA 4H39A 1XBBA 4XV2A 2CLQA 3F3TA 4FKUA 3LFQA 4JS8A 1Q3DA 2C0OA 3HRCA 1JNKA 5J5TA 3A8XA 3NPCA 4N70A 3C5IA 1VJYA 2ITNA 2VTHA 1PY5A 3NUYA 4O0XA 3WOWA 1OL1A 3FLWA 4KSQA 3TV4A 2YABA 5D12A 3UE4A 4AZFA 2JLDA 3R7VA 3VRYA 3KGAA 1ZOHA 3UNJA 3KRJA 4L67A 2OXXA 2ZOQA 2WGJA 2J4ZA 4ZY5A 4UALA 3N9XA 5HIDA 4AOJA 1PXIA 4OTRA 2OG8A 4A9RA 4EHVA 3OC1A 2PULA 3DZQA 5ANOA 4X2NA 4GS6A 1PMEA 3VUMA 2R7BA 4GRBA 4H05A 4XX9A 5EDRA 4AXAA 4ANOA 4NL0A 3JY9A 2ZMCA 3QKKA 4II5A 4FI1A 5IQAA 1LUFA 3RNYA 3W1FA 3VUIA 2WU7A 5CSPA 4F9WA 4FG7A 4DEIA 1E1VA 4YC8A 4EH4A 1QPEA 5LMBA 2J2IB 4EUUA 5AUZA 2C6EA 4MXAA 4EL9A 3F3WA 5AUXA 4FMQA 2XNMA 2OZAB 2O0UA 3MBLA 3EJ1A 1XBCA 1URWA 1PYEA 1H01A 4S31A 3CJFA 5D1JA 2DUVA 5KMKA 3D7TA 5AM6A 5LCKA 2GQRA 2YIQA 3EFKA 5IH5A 1SM2A 4OTIA 1AQ1A 3CY3A 5IZFA 1ZOGA 4QP2A 3JUHA 4IAAA 3QC4A 3BGQA 4RMZA 3WF8A 4USDA 4A7CA 4O0UA 3KMWA 5AX9A 5TO8A 2YAAA 2C1AA 2ETKA 2J6MA 4J98A 2HZNA 3THBA 3ATTA 3AQVA 3HDMA 4M0YA 4OTDA 2UZUE 5C27A 2XZSA 3FXZA 1OIYA 2UZVA 3R7IA 3SD0A 4DYMA 1U46A 2X8EA 4JDKA 4E93A 4F6SA 2CHLA 4ZLZA 3H9RA 4D2VA 1T46A 4QMVA 4CCBA 3UODA 4HPUE 4PV0A 1YI3A 1YXSA 5L8JA 3VC4A 4KS7A 1UU3A 4FUYA 5DE2A 5HG9A 3OWLA 5AUWA 3EFWA 2VU3A 3MB7A 4OBQA 1XJDA 1I44A 4L42A 3ZS5A 5A6OA 4J52A 4NCTA 4RJ4A 3RPSA 5CZIA 5E8TA 3LMHA 4PL3A 1LEZA 4QPMA 2GHLA 2HOGA 3QWJA 3BYMA 2OFVA 2WU6A 3NCZA 3D7ZA 2ESMA 4IACA 3QTIA 5CY3A 1Y8YA 4QMPA 2B9FA 1DI8A 3SXRA 3HAVA 3H10A 4CD0A 2V0DA 2UVXA 3SLSA 2QI8A 2C0TA 3KU2A 4RPVA 3UIXA 4BGHA 5FXRA 3BU6A 2FB8A 3NUAA 3LVPA 3NSZA 2ZDUA 4M69A 3E62A 2XKFA 3PVUA 5DI1A 3HMIA 4C57A 1Z57A 2QU5A 2YACA 1YI4A 3BHTA 4G6NA 4BYJA 3UZTA 4LRMA 3UP7A 4U7ZA 2OIBA 4GJ2A 3WE4A 1H0WA 3ELJA 3V5LA 5HX6A 1PKDA 3FXXA 3HRBA 5AP3A 2UW4A 4CFXA 4EJ7A 2BALA 3IONA 3EQPA 5T68A 1WBNA 4Q9ZA 1M7NA 5EYMA 3NNWA 1J1CA 3OCBA 1UWJA 5JFWA 4FVQA 1JAMA 3EN9A 4FT0A 1QPJA 2PSQA 4FKPA 4FTUA 4BWPA 4DEAA 1H28A 1KE9A 1OPKA 4FZ7A 4AGUA 3FY2A 2HELA 2R0IA 2YZLA 3VAPA 4EZ3A 4M8TA 4Q2AA 2Y9QA 5L3AA 4FKQA 3IKAA 3RHKA 2YM4A 3QKLA 3MTLA 5DNRA 3RZBA 4MNFA 5H8EA 3GP0A 3ZZEA 4O0TA 3NW5A 3E63A 5E8ZA 5KZIA 3AT4A 1PMUA 4J97A 3UC3A 2HXQA 3T8OA 4M66A 3L8PA 4QMMA 2CCHA 2R3RA 4TT7A 4RIXB 4G2FA 1J3HA 3VBQA 4X6RA 4C4HA 3QUPA 3SRVB 3QRIA 5AV1A 3QHRA 5FEDA 3LMIA 4FZ6A 3GU4A 1W84A 4UYNA 4PMPA 3F5PA 2ZM1A 4M13A 2X7GA 3OXTA 3S4QA 3DFAA 1MP8A 3Q04A 4FYNA 4ZTMA 5AUYA 4H3BA 4FTRA 3ROYA 2CNUA 4QMQA 2XNOA 1H1WA 1ZMUA 2RKUA 1QPDA 2A0CX 4TW9A 1ZAOA 2IVSA 3EQDA 3S95A 5KCVA 4BB4A 2P2IA 5KE0A 5L4QA 3E87A 1H1PA 2YDKA 4EK8A 2XJ1A 4XV1A 5LVPA 4X3FA 4RIOA 3V01A 2VWZA 5H9BA 1PXMA 3NIEA 3R1NA 4KB8A 1Q4LA 3QLFA 1Q97A 2NO3A 2BIKB 3C1XA 2VX3A 3IDCA 4IZ5A 4UN0C 4UX9A 4GKIA 3IW6A 4FNZA 4F7LA 4DBNA 1OB3A 4BCNA 3KRWA 4MHAA 3DPKA 4X0MA 4IX3A 5M4FA 2QC6A 3PIYA 3RPVA 4ACHA 3EHAA 3UTOA 4O27B 3SVVA 1P2AA 3K5UA 4PWNA 3DKCA 4RG0A 3UMWA 5JSMA 5LARA 2WEIA 1YXVA 3MH3A 3W33A 3GC8A 4CTBA 2ZMDA 1SZMA 4PDYA 1YOLA 2Z2WA 3GC0A 3ETAA 3PXQA 4BL1A 3H0YA 4XEYA 2YJSA 5FDPA 3A99A 3L9NA 3MA6A 2QLQA 4D1ZA 4QP1A 3GOPA 5EHLA 4RQVA 4TYJA 3W2QA 4HVSA 4FV9A 4QYEA 3GC7A 4D2SA 3C4WA 4XH6A 5KMOA 4DEBA 1YXTA 2BDFA 3RAKA 1KSWA 2CMWA 3DK3A 3R8UA 3POZA 3ZLXA 3DY7A 4HGTA 2HZ4A 4JJRA 3G9LX 4UMUA 5JRQA 2XCHA 5JT2A 2HIWA 4A4XA 4WUAA 3DB8A 3DKFA 3G51A 3QUEA 3TUCA 4FNXA 5HG8A 4FTQA 4IAYA 4E73A 3KL8A 1ZY4A 3R8MA 2CNVA 3NUPA 3GOKA 4D2RA 4ITHA 5D10A 4ORKA 5BVEA 3IO7A 2OJFE 3JVSA 5KMNA 3V5TA 2DS1A 4NW6A 4IVCA 1QMZA 2OI4X 1ZZ2A 2WIPA 5AR7A 4BRXA 4CFWA 3TZ7A 5BUJA 4CT2A 3VS2A 3TTJA 4AOTA 3ZXZA 3UO6A 1A48A 4BY9E 4NH1A 1YVJA 1ATPE 3BGPA 4UXLA 2E9UA 1H8FA 3OOGA 2OK1A 3C0IA 3EB0A 3LXLA 1JSVA 3IECA 2YCRA 3D4QA 3MTFA 4GK2A 4LQMA 2P33A 5TR6A 4HVDA 4CMUA 1R0PA 5DIAA 3MDYA 5JK3A 5KX8A 4DINA 3MYGA 2W1CA 3RNIA 4ITJA 1WBOA 3HP5A 4LM5A 4NTSA 3O96A 4YO6A 3VBWA 3WBLA 4EH5A 2DWBA 3V5PA 4IADA 5K3YA 1P14A 2BRMA 3BU3A 5BNJA 3DK6A 5LQFA 4O7SA 5E8UA 4RC3A 4CYJA 3QCSA 2UZWE 1Q3WA 2VX1A 4K11A 2JKMA 4PTEA 3CKXA 1R3CA 2R2PA 5GJFA 4BTFA 4EKKA 5KBQA 2YWVA 3CTHA 2OICA 3IG7A 2ZB1A 3TNIA 5EDPA 3ORKA 2PMIA 4FEVA 2WTVA 3RPOA 2HWPA 3D0EA 5TE0A 3MFRA 4IJ9A 4WRSA 4E6AA 2CGXA 3OTVA 4M97A 5DHJA 3VJNA 3E3PA 5JH6A 1OL7A 2PZYA 2VV9A 2YA9A 5CAVA 3CQWA 2QOHA 2VTRA 4F9BA 3V51A 5EI8A 4R7HA 5J87A 4QP7A 2Z7SA 4C4FA 3W10A 1CDKA 4FTMA 4M15A 3TV6A 3QLGA 3ZTXA 3O7LD 4CG8A 5I4NA 5ACBC 3W2SA 3MGYA 4QMXA 3DXPA 3CLYA 2ITYA 3KULA 4MF1A 4G3GA 3GCSA 5HO6A 3V5JA 1H0VA 2PVYA 2F9GA 4YTHA 4BFMA 4XOYA 1M2RA 1I09A 3QA8A 4PDOA 4HVIA 4M7IA 1PXNA 4NEUA 4DFZE 4HZRA 4PQNA 4X7QA 1CSNA 1QCFA 3AMAA 5AR4A 3I0OA 4CTCA 4EUTA 3G15A 3UC4A 5IUGA 1PXJA 4Z9LA 5EW8A 5C26A 3GEQA 4DEDA 2QO2A 4AUAA 2GNFA 4S34A 4NYEA 4MNEA 4YNOA 1FPUA 4QMUA 2WMUA 3IGOA 3S3IA 3TN8A 5L2TA 4IW0A 4WD5A 4C38A 2BFXA 5C1QB 3TXOA 5A14A 3L8XA 2VX0A 3R1SA 3VS0A 2X2MA 4M0ZA 3LQ5A 2XBJA 3OD6X 4F0IA 3W2PA 3Q9ZA 3IOPA 5LVLA 2XJ0A 3LXNA 3V6SA 3QQUA 3F69A 1WVWA 2JDTA 2XB7A 5IQIA 3SGCA 5LVMA 4QD6A 1R78A 1W83A 1BI8A 4OT6A 3R21A 5EW3A 5AAEA 4YTIA 5F9EA 4HGEA 5C8MA 5A9UA 3PIXA 4LL0A 4IVAA 2VWUA 2WMAA 3NW7A 4AWIA 3U6JA 2Y4IC 4YLLA 4YZNA 3ZMMA 4O6LA 3FHRA 1W0XC 1WBVA 1YQJA 2ITUA 3BBWA 3PG3A 3Q6WA 4NIFB 4Q9SA 5DRBA 3UMXA 3ZC6A 4A4LA 4AN9A 4QMLA 3WZJA 5CEMA 5JQ5A 3BV2A 3P7BA 4NJDA 3GCPA 3FSFA 1ZMVA 3HNGA 3KK8A 5C4LA 4LYNA 1W8CA 3MFTA 2BRHA 3BLHA 3D2KA 3ZFYA 2CN8A 4TN6A 1L3RE 1RDQE 5KKRC 4NSTA 5CEKA 4CG9A 3NRMA 3KXNA 2E9VA 3SAYA 2X6DA 3H30A 2GS2A 5FM3A 4I22A 4PDPA 4F9YA 2UW9A 3N4UA 5AR5A 5K4JA 2B54A 4XP2A 5AV3A 3U4UA 1MRUA 5ETCA 4EYJA 2EUFB 4N0SA 5T3QA 5L6PA 3CS9A 2RSVA 4O7WA 4CMTA 3KA0A 3WZUA 1ZZLA 4LOOA 5AA8A 3ZLYA 4YJVA 4BKYA 2IZSA 1M2QA 2PVMA 2H34A 3C13A 3N51A 4V04A 3VUHA 3DJ7A 4NM7A 4U80A 3HV3A 2HENA 3TKIA 4FSZA 3BHVA 1HOWA 1GIJA 4HVHA 3QD2B 4CFUA 3BYSA 3C4EA 1B38A 3QQGA 5HE0A 3E3BX 2YFXA 1V0OA 5CASA 2VWIA 1OL5A 4FZDB 4GKHA 2IJMA 1KE5A 5F20A 2R5TA 4FYOA 2XBAA 4F1TA 4GK3A 2VTSA 4NZWB 4DA5A 3AG9A 5G1XA 4Q5EA 3W8QA 3FUPA 4M12A 4BDAA 4IWPA 1B6CB 4C62A 4AE9A 3LCDA 5AP2A 3C0HA 3COMA 3DXNA 3EL8A 1DAYA 4K18A 4ALUA 2PE1A 4GUEA 1R0EA 3DA6A 1O9UA 2CGWA 3R28A 2WO6A 4GV1A 4XOZA 5AAGA 4HCTA 5HIEA 3EOCA 2PE2A 4JBOA 3MVHA 2BHEA 3FLZA 3VRZA 2OW3A 5IEVA 5FBOA 4DFLA 3PXZA 3BHHA 4DG0E 4C61A 3BELA 3ODZX 3VS3A 4FUXA 5CU3A 3RAHA 4ERWA 4BDJA 2J0KA 2VTPA 3EQGA 5AP4A 4I0SA 4B99A 1MRYA 4APPA 4ZTSA 3NS9A 3DT1A 4HZSA 4O6EA 4DF3A 3P1AA 4K2RA 3KXZA 4ALVA 4CKJA 5IUHA 2GPHA 3DDQA 5K0XA 3WIGA 3F82A 4F0GA 4YLKA 5JZJA 3OP5A 4UWBA 5EOLA 4EEVA 2JIUA 2R3HA 3AGMA 3HKOA 3PVBA 3MFUA 4AE6A 1Q8UA 3TUDA 1ERKA 3I5ZA 1YKRA 3TTIA 3EN6A 4LUDA 5HCZA 5M07A 4GSBA 2FSLX 3QCYA 4O96A 5CYIA 4CQGA 4EH3A 1Q8WA 4TYEA 4LOQA 4WNMA 4BDCA 4JR3A 5LVOA 4I92A 4KIKB 4M69B 2WAJA 3KMUA 5EDQA 5EW9A 3PZHA 2VO3A 3LCTA 5AP6A 4KKHA 2Y8OA 4BCGA 1H25A 5E90A 4O7NA 3ZEWA 2WQEA 4LGHA 1WVYA 4HYUA 4KIQA 4EWHA 5I3RA 3MPAA 5I9ZA 1OGUA 2NP8A 2E9NA 1HCKA 1OI9A 3UOJA 5DR6A 5LWMA 5AEPA 4P2KA 1TVOA 1G8AA 1CKIA 1NW1A 2I0VA 4DEEA 1ZYDA 3LXKA 5ANIA 4L53A 2BZKB 2UW3A 4G5JA 4XLVA 2JAMA 4DH5A 4EBWA 4F9CA 4YTFA 2I6LA 2QCSA 4FSWA 4G1WA 4EOLA 1NXKA 3I6UA 4AP7A 1PJKA 2HWOA 5CQWA 1LP4A 3DK7A 5IU2A 5I3OA 3ALOA 1G5SA 4I21A 4QTEA 2R3PA 4O22A 4TY1A 4U0IA 3NAXA 4R7BA 1XHAA 1XBAA 1XH5A 1T45A 4D2TA 2HY81 2PVLA 4ACDA 2GS7A 5B2MA 5IMEA 3S0OA 3VS5A 5J9LA 2VTAA 4IE9A 4QTAA 5J5SA 2WKMA 1ND4A 2BPMA 1YDTE 2FH9A 2VZ6A 2YLFA 3Q9XA 2KTYA 3QTZA 3R30A 4KRCA 2OIDA 2XIYA 4L43A 4NTTA 5A4LA 5FWKK 3QCXA 4CRSA 4F08A 4EBVA 2C3KA 4FV0A 3MVMA 4FVRA 4FSNA 3EWHA 4RX7A 4ARKA 3COIA 3A4PA 2VNYA 5FP5A 4C59A 3OW4A 4ZSAA 3G90X 3BI6A 5HESA 3BEAA 3VUKA 1YOJA 3PXKA 4MD8E 5HD7A 2XNPA 4JDIA 3ZHPC 2YAKA 2Y7JA 3OWJA 3PFQA 3ALNA 4AU8A 4IAKA 1Q24A 2IW6A 3A7JA 5IQFA 2FO0A 2ITZA 3P9JA 1WBTA 3OWPA 3OXZA 2OJ9A 5IA2A 5FBNC 1J7IA 4DG3E 2VTNA 2YITA 3HRFA 4FIEA 3LM0A 3VQUA 4DLIA 5B0XA 3S2PA 3G6HA 4FIIA 4V05A 3W2CA 4XS2A 2QG7A 3OUKA 5TOZA 4ZLYA 4J96A 1TQMA 3M42A 5DRDA 3E88A 4ZAUA 1V0PA 1M17A 5CVHA 2BROA 3FYKX 4GYGA 4G3DA 4UMQA 5DMZA 4FKSA 4FK6A 2ONLA 2HXLA 4NJ3A 3QRUA 3U6IA 4I5MA 1GAGA 5AP5A 2QVSE 5M44A 4ZMEA 4XG7A 1XH9A 4YPSA 3U9NA 4PL5A 4ANMA 4NUSA 4CGAA 5AUUA 4G6OA 3FLSA 5K5NA 2A4LA 4PPBA 2FVDA 4G16A 5HU3A 4IB1A 1KUTA 1PXOA 4BCFA 1FINA 4FL2A 4AZEA 4FEXA 4D5KA 5IMXA 1W82A 1NVQA 3BKBA 1H1SA 4HOKA 4Z55A 2YLEA 4H3PA 1UNGA 3SKCA 4XLIA 3M1SA 4S33A 3FZ1A 5L8KA 2XK4A 3CGOA 1UU9A 3OOMA 1LR4A 3QGYA 5EYCA 3Q4UA 4AGDA 3DTCA 1J7LA 2OLCA 1O6KA 4FV6A 4O1OA 4ASXA 3DU8A 4XP0A 5BVWA 3MIAA 3PRFA 5ETAA 2ITPA 1PXKA 2BAQA 3CGFA 3ORLA 3VBYA 1BUHA 5AP1A 3LE6A 2GTNA 4QTBA 5CENA 3UIMA 2P0CA 1WBWA 3ZO1A 4AZVA 4YJQA 3LLAA 3ORMA 3GQIA 3WF9A 1PMVA 3SHEA 3A2CA 4WKQA 5K9IA 5CEIA 3KXHA 1XH6A 2JDVA 4PPAA 4UMPA 3NX8A 1JOWB 3TZMA 4TTHB 3DQXA 4BI0A 1OKVA 3PDTA 4QYHA 3NNUA 5JZNA 4ZJVA 2P3GX 3FKLA 5FQDC 3LZBA 2VTJA 4RFYA 5FP6A 5FRIA 4D4YA 1CKJA 4UEUA 2NNWB 4FTLA 3MY0A 1REKA 2YEXA 3L8SA 4RA4A 2IZRA 4I1ZA 5BVDA 1GZ8A 1UNHA 4OAUC 5J9YA 4XUFA 2W9ZB 5CAPA 3CTQA 4PY1A 3TZ9A 5H2UA 4TWCA 4HW7A 2Z7LA 4FSTA 3OBGA 4ZSGA 4I4EA 1KE6A 1UVRA 2ZM3A 3QTRA 4JVGA 4YBKA 3NVMB 2VTMA 3O17A 4EK6A 1A06A 1URCA 3OVVA 4AGCA 4AT3A 3S1HA 5CQUA 5EK7A 4EH7A 2ONLC 2CLXA 4N4SA 3DXQA 3TNQB 4YJSA 5J9ZA 4RGJA 2JIIA 3ZDIA 3QYWA 4FKLA 5J1VA 3UPZA 3Q32A 2R3MA 3R1QA 4E5BA 3D83A 3P78A 4O0YA 5CTPA 4CXAA 4EOJA 4O0WA 2YDIA 4RJ7A 3CR0A 5IA3A 3OW3A 3TCPA 5BVNA 2W5BA 2VWXA 4B4LA 3W16A 4TYGA 2YM6A 3ROCA 3ZSHA 2IPXA 3H3CA 2XUUA 3V04A 3NIZA 4NU1A 3R7GA 1FVVA 4E4MA 4JIKA 2RFEA 4LMUA 4R6VA 2QOOA 4G6LA 4C36A 3E8CA 4XG8A 3DOGA 2E2BA 5FM2A 5BYZA 2EB2A 2PMOX 4ACMA 5A4EA 5EKOA 4E6QA 3LCSA 4WNKA 1JVPP 3PJ8A 2H8HA 4QO9A 2YIWA 4MXCA 3FC2A 1F0QA 3QTXA 5E8YA 3V3VA 1WMKA 1YXUA 3KULB 4BHNA 3VIDA 4TXCA 4JQ8A 3BU5A 5CU6A 3BCEA 2UVZA 4EOSA 3F7ZA 2J0JA 1RQQA 2XYUA 3U87A 2IVVA 2W1GA 2WB8A 5EM8A 3SC1A 4EHGA 3QU0A 3LFBA 4XCUA 3SW4A 2PUPA 2VGPA 3KMMA 3PA4A 2JFMA 3QA0A 1J1BA 1FVRA 3ACKA 4Y8DA 3C0GA 3RBWA 3SG9A 2BVAA 3A8WA 1OVEA 3MSSA 2W96B 1TQPA 4QQTA 5AA9A 1FBNA 3UBDA 1YHVA 4S30A 5E8VA 1H08A 2VO0A 4IVDA 5TKDA 4BC6A 4BDEA 4BCOA 2C5NA 3MS9A 4KBAA 2X9EA 2Z7QA 4LMNA 2C3IB 4CV9A 5AADA 2BIYA 5HO8A 3O0GA 3QCQA 4JAJA 4R78A 3AXWA 3DLSA 4NW5A 3QKMA 4ASEA 1H4LA 4FSMA 3EYGA 5IPJA 2ERKA 4WIHA 4JRVA 2C6DA 5JKGA 3WF6A 3BIZA 4OTQA 3ANRA 4MVFA 4B7TA 3BWFA 4NFNA 4D0XA 4OGRA 3SXFA 1KWPA 2WOTA 2CKPA 3FQSA 2C5XA 2F4JA 2PVHA 4GEOA 4HNFA 4YJNA 2VO7A 2QOQA 3RWPA 3JVRA 2W4KA 5B2LA 5M09A 3VBTA 3BX5A 3FMKA 4BDKA 2B9HA 3DCVA 4MQ1A 4RLLA 2J9MA 3TACA 2X1NA 1NVSA 1IG1A 4XG2A 4DH3A 2O64A 3V5WA 3H4JA 5HCYA 3ORIA 5TF9A 3R6XA 3R8VA 3U8WA 3TDVA 4WA9A 4CYIA 3IDPA 5E7RA 2QLUA 2Q83A 4FTCA 4GT3A 2X7FA 5GIOE 4RIWB 1APME 3LAUA 2H6DA 4HPTE 4RWLA 4U97A 1XH8A 4ZSEA 5GJDA 2QOCA 2GS6A 3LKMA 3E8EA 3Q4TA 4BCJA 5M4IA 2PE0A 5E9EA 2R4BA 5KMLA 3DGKA 3PWDA 2P2HA 5C9CA 3HUBA 4Z7HA 3EQCA 2Y6OA 2YN8A 4FICA 3ULZA 1LPUA 4IAZA 3EIDA 3NMUF 3QWKA 2XKDA 3LFNA 3OUNB 3LCOA 4MF0A 4YHFA 2YM8A 3CD3A 2V62A 4I93A 4QRCA 2C68A 4QQ5A 3QQKA 4DC2A 2QR8A 4XG6A 3F3UA 3LJ2A 4UBAA 3BLRA 1RJBA 2X4FA 4EQUA 1Q8YA 3F9NA 3WIKA 4NM3A 5D9HA 3LFCA 3UG1A 4C4EA 3A62A 4F65A 4ZTQA 5HTIA 2PVRA 3CQUA 3VF9A 2ZDTA 4ZSLA 2Y4PA 3ZO2A 4B8LA 3SA0A 2C5YA 2V22A 5BMMA 2XIKA 3KC3A 3UOKA 1CKPA 2UW5A 2JDSA 2GDOA 4BKJA 4TNDA 4EORA 2UW0A 5CVFA 5HI2A 3A7GA 5CEQA 2WMBA 1YDSE 2ITVA 2JEDA 1OITA 3E5AA 3KKVA 4G17A 5HNGA 5I0BA 5J79A 4QTDA 4O7YA 1Q8TA 5HGIA 4CLIA 3QRKA 5EQYA 5L2WA 3IOKA 3OF0A 3PE2A 3ZO4A 4OR5A 3ITZA 1FQ1B 1WCCA 4V0GA 4C34A 3R9NA 1Y91A 3NUUA 4MXYA 4RJ3A 3HV5A 2GQSA 5FUTA 1P5EA 4I24A 4L45A 4RVKA 2VTTA 2CNQA 3W2OA 5KHXA 4JDHA 4D2WA 4WRGA 3TIYA 2A19B 4PNIA 4X2KA 3RP9A 4GH2A 2LAVA 1DI9A 3AC3A 1PYXA 3QTQA 3D94A 4OUCA 4D58A 4A06A 1BX6A 4J7BA 4RWKA 5CWZA 4MXOA 4USFA 4X3JA 2ITWA 4D4SA 2EXMA 5IF1A 2CDZA 3NYXA 4DFXE 3FYJX 4L68A 3FSKA 3MJ1A 4BIDA 3VS7A 2OH0E 2ZJWA 2QKRA 4XBUA 3WI6A 1ZARA 2UW8A 3O50A 4GK4A 3DQWA 3LJ0A 3ORTA 2C3JA 3AC8A 3POOA 5IH6A 4FOCA 2B55A 4IZAA 3FZSA 3NCGA 3H9FA 4KIOA 4BYIA 4P5ZA 4DTKA 4O2ZA 5CANA 1U54A 3PXYA 5AAFA 3R7EA 2I0EA 4XYFA 3EH9A 5KNJA 5J1WA 3GU5A 3RKBA 3RGFA 3ZBFA 2VTLA 3GI3A 5BQ0A 2XRUA 4MYGA 3FDNA 4FX3A 4IX4A 4O2PA 5LVNA 5BX0A 1M14A 4A4OA 2QG5A 3FKNA 4JAIA 5K4IA 1YHWA 1FMKA 3GFEA 4BCPA 4ID7A 4F4PA 1U4DA 4C7TA 4MXXA 2UW7A 2BAJA 1PKGA 1ZYJA 4G34A 3UQFA 3IW4A 2C4GA 3TG1A 5EKNA 4ZLOA 1ZYSA 2VWWA 3TNPC 2YCFA 5HG5A 3GGFA 3P86A 1YWRA 4KA3A 4HYSA 3OBJA 4NM5A 1KOAA 4FG9A 3LLTA 2PUIA 4FSQA 3H9OA 4YHTA 4Y46A 4WNOA 5DFPA 3PJ3A 2XK9A 3RM6A 3FL5A 1QL6A 4G9CA 3BV3A 5IKWA 4D1XA 3FKOA 4I5HA 2I40A 2PZIA 3A7IA 4L9IA 2OZOA 2OO8X 5AV2A 3R83A 3SX9A 4FSRA 4DFNA 1M2PA 2BUJA 2UZBA 3FI4A 4MK0A 1JLUE 2WMWA 4EOPA 4F1MA 3QALE 2UZEA 2WIHA 5DEYA 3LQ3A 4GFGA 4TYHB 3KRLA 4NKSA 4I23A 4W4WA 2OJJA 4EONA 4AA4A 5CZHA 3EL7A 3OY3A 5CI7A 4AZTA 4CFVA 1WBSA 1BYGA 2C6KA 3K5VA 4BBFA 3R71A 4FSUA 2Z8CA 5E92A 4DITA 5AR2A 4AS0A 2RFSA 5CS6A 3TZ8A 2BR1A 4DGMA 3KCKA 4O83A 5M55A 5JEBA 5DT4A 5C4KA 1ZOEA 4I6FA 1JBPE 1R39A 3AMYA 3L9MA 2RG6A 4R3PA 4XRJA 3HUCA 3QQLA 4XV9A 3CIKA 4I5PA 1IA8A 2W1ZA 5HQ0A 1JPAA 1ZYLA 3FAAA 4FEQA 4BDIA 4CEGA 2XCKA 4Q5HA 5J7BA 3FJQE 2OXYA 2F57A 2H9VA 3JPVA 2X81A 4GFMA 2VAGA 3P08A 3UOHA 4ZTNA 3ZZWA 3DBEA 2FGIA 2XNNA 3II5A 3Q2MA 3QBNA 3R22A 3EZVA 4R3RA 4RC2A 2OZAA 1SVEA 4QNAA 4EOQA 4FTNA 5KBRA 2WTJA 5GZAA 1W98A 5HLNA 2V7AA 2W06A 5CT7A 3HA8A 4FVPA 5DPVA 4PMMA 5CU4A 4O7TA 3CY2A 4JRNA 3KVXA 4R8QA 4EOOA 3PWYA 1OBGA 3KRRA 5IH4A 1S9JA 4HVGA 4E26A 4UWYA 1G8SA 1DS5A 4TRLA 3HMOA 4XG3A 3C4ZA 4P7EA 2C1BA 2IWIA 4K0YA 5JFSA 5H3QA 4PX6A 4H3QA 5HEZA 4C3RA 2CKEA 3AC2A 4UYAA 5CF8A 1VEBA 4DFYA 2BCJA 2C6OA 2R3JA 4J53A 3QXPA 4GG7A 5BVKA 3VWAA 1OL6A 3VW6A 5IDNA 3SQQA 1MQ4A 2UZDA 5ACKA 3FE3A 4BWXA 4QPAA 3MESA 4QNYA 3DB6A 1IAHA 4A9TA 4I3ZA 4FEUA 1A9UA 1Y8GA 1H24A 3D5VA 2JC6A 3HECA 2C30A 3MFSA 3NUSA 3OS3A 4GU9A 2ZV7A 4QMWA 5FD2A 1J7UA 2XIZA 5C01A 2W7XA 3NNXA 2GNLA 2R64A 4ZY6A 3N4VA 2XKEA 4BTMA 4O81A 1GIIA 3PRIA 1OIQA 4E8AA 4M84A 1M52A 5C03A 3AC5A 3DBDA 2DYLA 3FMDA 3NUXA 5CXZA 3I60A 4DLJA 4YZBA 4XMOA 3ZRKA 3EQHA 4JX7A 1XH4A 3IK3A 5CX9A 3ZH8A 4MTAA 1U5QA 2PWLA 4G3EA 4R1VA 1ZWSA 5HKMA 2WMXA 4YHJA 4GL9A 2OJGA 3OG7A 3ZFXA 4O0SA 3EZRA 4F0FA 2HCKA 4L3JA 4A9YA 3FI8A 4FT3A 5CAOA 3N4TA 4LOPA 5CF6A 5AUTA 2YM5A 4YZMA 4BCMA 2W99B 3KXXA 4YURA 4FTJA 4JI9A 4QOXA 2EWAA 5AP0A 2CN5A 1WFCA 3NDMA 4TYIA 5M56A 2WMVA 2F2UA 3C4FA 4KD1A 4HYIA 5KUPA 1VZOA 5CEOA 2G1TA 3VN9A 2GNIA 4GG5A 4EHZA 2PZPA 2H96A 2P55A 4N6YA 3ZO3A 4WG5A 4TNBA 5DG5A 4KUJA 5CLPA 3FZPA 3FY0A 3ORZA 4E4XA 3MW1A 5E8WA 3FMHA 3QD4A 4ONAA 1CTPE 4R7IA 3Q2JA 4L3LA 4PPCA 2QURA 4WNPA 1OIUA 5LMAA 5IEXA 1IR3A 4I5CA 4AW2A 3PSDA 3V5QA 4F64A 3CQEA 4CVAA 3ZUVA 3AD4A 4OW8A 3IW7A 4AN3A 2ZB0A 5BUIA 3D7TB 2QOKA 4FT9A 4QMOA 2C47A 4UZDA 4WG4A 5E91A 3RALA 5HNIX 2X7OA 4EK4A 2JITA 5IA5A 4AAAA 2PL0A 4FBXA 4AA0A 1E9HA 3COHA 3GVUA 1GZNA 3QZGA 4KABA 4M67A 2YZAA 3ZUTA 4AT5A 4J8NA 4XJ0A 4O7LA 4C37A 5CALA 4NKAA 4YGAA 2YIXA 4ERKA 4RIXA 1Y6AA 3V8WA 4EQCA 3SRVA 3HP2A 2OIQA 1LEWA 2EXEA 2W05A 3ERKA 3QF9A 4F6UA 3Q52A 5FTOA 3CBLA 3NNVA 3PXFA 5JRSA 5FG8A 3L8VA 3CPCA 2ZVAA 4L8MA 5CSVA 3MVJA 3RM7A 3QZIA 5EYDA 3BHYA 5DH3A 4DE4A 3FC1X 4KIPA 5D7VA 2XP2A 1OKWA 3BZ3A 4FIGA 1P4OA 5I9WA 5LMKA 3FXWA 3OT8A 4CV8A 3AT2A 4PDSA 4Y5QA 5FEEA 4IZYA 4KNBA 4E5AX 4GT5A 3RPYA 4FSYA 3B2WA 3ZRMA 4B6LA 4C3PA 5EH0A 3P4KA 3Q5ZA 5L6WL 5A46A 4RX9A 1GY3A 3GFWA 3I7CA 2GSFA 5EOBA 5GHVA 3F7WA 3MWUA 4N6ZA 5HTCA 5LOHA 4YJUA 4I4FA 4N57A 3WZKA 2B7AA 5EG3A 4QMTA 4QMNA 2IZTA 3BLQA 4IFGA 1EH4A 1E1XA 5L6OA 4LV8A 2RG5A 3W2RA 3F5GA 2OWBA 3IQ7A 4MD7E 5EI6A 3BQCA 4I0RA 2JDOA 4JBVA 4DTAA 2BRBA 4JQEA 1U5RA 4ZTRA 2LGCA 3VUGA 4ENXA 5CNOA 3PPJA 4GCJA 2WNTA 3MV5A 3TIZA 3WF5A 4M3QA 2WHBA 5IUIA 1PMNA 1JKSA 1NY3A 4RFMA 3EMGA 4PTCA 5JMSA 3FL4A 4BWKA 4JR7A 5HX8A 1OUYA 1UKIA 5TT7A 5CSXA 4ZP5A 5F1ZA 4BDHA 3U54A 2O8YA 4CFMA 4O7RA 4ANQA 3KVWA 3O71A 4AGWA 1FVTA 3R02A 4AW0A 3IGGA 3LW0A 3I5NA 4FKIA 4LFIA 3C9WA 3LFDA 4Y95A 3QL8A 4QP3A 4BDBA 3S00A 3FMMA 3W18A 3R7OA 2VN9A 5D11A 3PP1A 5IQDA 2XIXA 3VS6A 4DGLC 2VWVA 4XV3A 4GIHA 3I6WA 4MCVA 3PA3A 4FV1A 4IAFA 4DFBA 2Z60A 3PPZA 2VTOA 3E8NA 2YM7A 4RZWA 5HBJA 4WO5A 3ZU7A
chains in the Genus database with same CATH superfamily
4OBOA 4BKZA 4IM0A 2XNBA 4GMYA 2J0MB 5I9YA 3NUNA 4O7ZA 4P90A 2BKZA 3IW5A 2C69A 4YC6A 4W4XA 2EXCX 3VULA 5LMKC 4CRLA 3R9RA 3KF4A 4UMTA 3PLAE 5M4UA 3F88A 4W9XA 4BBMA 1GNGA 4I0TA 3O7LB 3DBFA 1Z9XA 5HVYA 3HGKA 4O38A 3E93A 3OT3A 3D5WA 5IISA 1OBDA 3KN5A 2HK5A 3MPMA 4GVJA 4NT4A 1IAJA 3UGCA 3NEWA 4GT4A 4ZJIA 4FA2A 3WYXA 1ZMWA 4ZY4A 1PXLA 4D28A 5AWMA 2QOFA 4WG3A 1YOMA 2XYNA 4O1PA 4RRVA 4WOVA 5IQEA 1OUKA 2RGPA 3BEGA 4WBBB 4U45A 2JDRA 3KN6A 3A4OX 3OFMA 4X2JA 1YXXA 4X3FB 4YBJA 2G2HA 2FSOX 5DBXA 1VR2A 5GJGA 4CKRA 2C6IA 3NYNA 4FZAB 3K3IA 4JBQA 3PVWA 5E1SA 4DN5A 1XKKA 3OCGA 4DBXA 4S2ZA 3MY1A 1AD5A 4O84A 4YJRA 3ZRLA 4TPTA 4DGOA 4ALWA 2YIYA 3D14A 3GC9A 3R1YA 4ZXTA 3KREA 5ETIA 4A9UA 5DVRA 2QONA 4ENYA 4L52A 3ACJA 2XH5A 2W1HA 4MWHA 5AX3A 5FDXA 1W2FA 1H26A 1JSTA 3OCTA 3TDWA 1WVXA 1XO2B 4RIYA 3FZOA 3QC9A 3W32A 4KAOA 5IG1A 5M53A 4BR3A 2AC5A 2XNGA 1V0BA 5DGZA 5L2IA 2W1FA 5M06A 1Q41A 3CJGA 5GINE 3P7CA 3D15A 3OZ6A 1XWSA 2R3IA 3CE3A 4FR4A 3VHKA 3D9VA 5L2SA 1L8TA 2V7OA 3FPQA 3NVKI 5CI6A 3BGZA 4D4RA 4G5PA 4PL4A 3RTPA 2AQXA 4HJOA 4W8DA 3G6GA 4F1OA 5GZ8A 3JYAA 4CZTA 3G2FA 5JQ8A 2WD1A 1M7QA 4FV3A 5DR2A 2X9FA 3ZEPA 1KOBA 4ZSJA 4Z7GA 2HZ0A 2W5AA 4MAOA 3NZ0A 2J7TA 1PHKA 3ID6C 4IH8A 3G5DA 4CQEA 4FKJA 3QGWA 4WT6A 4MKCA 2ZYBA 3ZXTA 5ETFA 4YO4A 3WE8A 3WZDA 5BV3A 4JOAA 3RHXA 1FMOE 5JFVA 4FZFB 3F3VA 1JWHA 3R7UA 4F7JA 3O2MA 2XK3A 2XF0A 5CEPA 1B39A 3HAMA 4KKGA 1H1QA 5CT0A 5J7HA 3KRXA 4ASZA 4HCVA 3F6XA 1Q62A 3LOKA 4AG8A 2WELA 2OJIA 2UV2A 3VO3A 3G33A 3HMNA 3OCSA 5JGBA 2PPQA 3ORPA 5GNKA 4QMZA 4NIFA 1GZKA 4LRJA 2X2KA 4E4NA 4CNHA 1OPLA 5HU9A 2XRWA 4FV4A 3RCJA 4KRDA 3OEFX 4FTAA 4CSVA 2R7IA 5EQPA 3FI2A 2VWYA 5BYYA 3SW7A 3BE2A 4IDTA 3R9DA 3QZHA 3UG2A 3ZBXA 2NYAA 2FUMA 2Y4IB 4F70A 3LHJA 3PTGA 3VHEA 3GUBA 3UVQA 5BYLA 4AN2A 1YI6A 3B2TA 3MB6A 2WTWA 1SNUA 4OTWA 2XEZA 4S32A 2WEVA 1X8BA 5HLPA 5HE1A 2VNWA 3AKLA 4IB5A 5KKRB 3OXIA 4KSPA 1F3MC 2WZJA 3QD0A 3R00A 4UB7A 3FHIA 3SOAA 1W2DA 2J0IA 3Q53A 3R73A 4O91A 3REPA 2GQGA 4BGQA 4BTKA 1VYZA 2ACXA 4EZ7A 4ZZNA 5EFQA 3UDSA 2G01A 2JAVA 4ANNA 3LFEA 1U59A 3T3UA 2PYWA 3JXWA 4ZK5A 2XS0A 5DLSA 2PVFA 3Q9WA 3ENHA 1XH7A 5AUVA 3T3VA 2XAMA 4DTBA 2BILB 3TWJA 3AC1A 3MH2A 5ICPA 4DFUA 4FKVA 2OKRA 2XEYA 4IZ7A 2VUWA 3BE9A 5DYJA 4YJPA 2VGOA 4XRLA 4JG7A 4H1JA 4RC4A 3A7HA 4ZOGA 2WMRA 5IQHA 3UZRA 5ANGA 4ACGA 1BL7A 3BLAA 5IA4A 4EYMA 5EHOA 4G3CA 4UWCA 5HLWA 4QP4A 4M14A 4FTOA 4QP8A 2PZ5A 5L2QA 2PMLX 3LFSA 3E64A 3W55A 1YHSA 2QOIA 5IQCA 4MNEB 4F09A 3QZFA 3MVLA 5JGAA 5HG7A 4NFMA 3RCDA 3ZYAA 4QP9A 3U9CA 3TKHA 4WHZA 2B9IA 5HTBA 4BI1A 3F5UA 2HW6A 3QTSA 1JKKA 3HV7A 3OHTA 3ZOSA 1OKYA 4EWQA 3I4BA 4YJTA 1F5QA 3QYZA 4A07A 3AMBA 3QRTA 5C8KA 2Y6MA 4DHZA 2HZIA 4X21A 4E7WA 2Z02A 1KE8A 5E8XA 3FWQA 4ANSA 2XNEA 5HBEA 3UP2A 1VYWA 4FEWA 2IW8A 4ZS4A 3VQHA 2QU6A 1PW2A 2FSMX 3H0ZA 2J5FA 5KZ0A 2SRCA 3QHWA 2DQ7X 2A2AA 5AIKA 4EI4A 4X2FA 2XK6A 3GT8A 4R77A 3O8TA 3P7AA 1IASA 4AZSA 4AQKA 3PSBA 4BHZA 5E1EA 5HE2A 2GHGA 3EN7A 2B53A 1BL6A 4TZRA 2WTDA 4PUZA 4DHIB 2UUEA 4J8MA 5HO7A 4ZMFA 1TFFA 4KIKA 3GBZA 2J50A 1O6LA 3U6HA 3CCNA 4JBPA 5EM7A 3LQ8A 3L9PA 3KB7A 4WSYA 1Z5MA 2CCIA 4GU6A 4FIJA 4KS8A 3SXSA 3ZLWA 4IJPA 2C0IA 3ET7A 2RF9A 4FTIA 2J0LA 3ZC5A 3C5UA 2BTRA 3DTWA 4FKWA 4QTCA 4B0GA 2QOLA 3EN5A 4IFCA 5M51A 3F2RA 4DT9A 3GCUA 2W4OA 2XA4A 3DFCB 4J1RA 2UW6A 2I7QA 1TQIA 1OPJA 4JNWA 4ZEGA 3PY1A 2WQNA 2Y0AA 3EFLA 4JQ7A 3Q96A 3ZCLA 4MX9A 1ZRZA 3EQFA 2WMSA 4IHPA 2XJ2A 5DR9A 4ASDA 1PF8A 5I9VA 2ZV8A 2R3OA 4D9TA 5CU0A 4CMOA 4C02A 4YUQA 4K9YA 4J95A 2QHNA 4BTJA 3PJ2A 5AJQA 3NYVA 4LV7A 3PUPA 1GOLA 1O6YA 4DAWA 3TUBA 3CEKA 4QYGA 4RVMA 3U55A 1YRPA 4GUBA 4WSQA 3G9NA 5I9XA 4FIHA 2X8DA 4J71A 4AW5A 3BQRA 2EB3A 3HYHA 2IO6A 4LGGA 4YSMA 5HCXA 5LCJA 3ANQA 5IA0A 4OTPA 3PA5A 2CKQA 4YZ9A 3MY5A 4RVTA 3OMVA 2WTKB 3ULIA 2FSTX 4APCA 2OU7A 4IIRA 4OAVB 3DJ6A 3PY3A 3TJDA 1J91A 1OM1A 3LCKA 4USEA 2GNHA 4G3FA 4FV8A 2RL5A 2XK8A 4RT7A 3PE1A 3Q4ZA 3AD5A 4MWIA 2B1PA 3DNEA 1OMWA 4DCAA 3GU6A 4H36A 5CXHA 2PTKA 4E4LA 3CPBA 4DH8A 4K33A 3SG8A 2X2LA 4FT7A 4IQ6A 4NCTC 4XG4A 4OBPA 2CGVA 2JKKA 4O7VA 3CP9A 1JQHA 4FG8A 3RAIA 1BI7A 3Q3BA 5IDPA 2GCDA 3TL8A 4I6BA 3PPKA 1UU8A 3Q60A 4FTTA 4U81A 4IM2A 3R7YA 3TV7A 1Q61A 2YHVA 3D5XA 3KF7A 5AP7A 3QTUA 2R9SA 2X4ZA 2XIRA 3R0TA 3LXPA 2VD5A 1GIHA 3C50A 4PMSA 2OF4A 4JG8A 3CKWA 4E1ZA 3DNDA 3UDBA 4DH1A 1VLRA 4I6QA 2WFYA 4GYIA 4B8MA 3R8ZA 5AR3A 3UIBA 2BKKA 2QO7A 3MN3A 3SOCA 4CZYB 3C4CA 4EJNA 5CAUA 2GU8A 2Q0BA 5KO1A 4MD9E 5DT0A 5F95A 4LG4A 1SNXA 4IC7A 4IMYA 2PK9A 3ZSIA 2UZOA 4BCKA 5JFXA 3EQRA 2X0OA 3P0MA 4CT1A 1ZYCA 2ETMA 3ZFMA 3ZDUA 5BVFA 3C51A 2YCSA 1H07A 2E9OA 1JKTA 4JT3A 2QNJA 4U44A 5KMMA 2PMNX 3B8RA 4DEHA 3I0QA 3GB2A 5HIBA 2C3LA 4ANBA 3TNHA 3VF8A 5M08A 3KQ7A 3DJ5A 3HA6A 4NM0A 4GIIA 3DDPA 3LIJA 2V5QA 4IBMA 4ZS0A 5EYKA 3FQEA 4D55A 4FE2A 4PRJA 4FL1A 4ANLA 3R9OA 4YZDA 4UXQA 4RLKA 4TKSA 3MH1A 4EQMA 2O2UA 3IW8A 3WILA 1UU7A 4WBOA 4AQCA 1QPCA 4L6QA 3QUDA 4GVAA 3QXOA 4LI5A 3TT0A 5G6VA 4FNWA 3L9LA 5F4NA 4MBLA 4AOIA 5IA1A 3CTJA 3QTWA 3I7BA 4IM3A 4O82A 3IDBA 4OLIA 5CU2A 3ZONA 4TL0A 3E92A 3FMNA 4XHKB 5FGKA 5HNBA 4D5HA 4RJ8A 4PNKA 3IS5A 3F2NA 4KBKA 4W4VA 4HGSA 3U4WA 2VRXA 2YIRA 3L1SA 5CF5A 4HGLA 3VBVA 4RQKA 3TNWA 4D4VA 3FLYA 3K2LA 4JXFA 3ORNA 3QQHA 3F61A 4IXPA 3T9TA 1CM8A 5A54A 3PP0A 4AF3A 4OTHA 2IZUA 3C4XA 3DAJA 2W0JA 2YCQA 4LRKA 5CSHA 3QQJA 3V6RA 1BMKA 2BZIB 3FZRA 3NGAA 1NVRA 4R1YA 4W8EA 2YJRA 2QODA 3KXMA 3UYTA 4C2VA 4BF2A 3TI1A 3OTUA 2BHHA 3LJ1A 4EH2A 3E7VA 2JGZA 3EN4A 3K3JA 3FZTA 4DG2E 4IVBA 3VUDA 3ZSGA 5F94A 1KV2A 3LM5A 5AFVA 4EK3A 3RINA 3C7QA 3EFJA 2BZJA 2VWBA 4F7SA 1YDRE 4IB3A 2NRUA 1K3AA 4GFOA 4P5QA 5KMJA 2XM9A 4A9SA 1Y57A 4QT1A 4X3FC 4FGBA 2X8IA 1XR1A 2WMQA 4U6RA 1CMKE 1YWNA 1IRKA 2CPKE 4IDVA 4JX3A 4IWDA 1JSUA 3AD6A 4QMSA 4U5JA 1ZLTA 4DH7A 5AMNA 4O86A 4R5SA 3R2BA 2HAKA 2VTIA 2Q0NA 4L44A 4LGDA 4FV5A 4L7SA 3R01A 1IEPA 3R2YA 4EHEA 1Q99A 3Q4CA 4QEBA 3F66A 4BIBA 3UOLA 4FV7A 3RK7A 2BMCA 2G9XA 5ANDA 3EQBA 2QOBA 4QYYA 5FTQA 3COKA 4DCEA 4EOKA 5LJJA 2GNGA 2YERA 3AT3A 2J51A 2IVUA 4RZVA 5IQGA 2ITOA 2HY0A 3PY0A 3R63A 4UZHA 4Z3VA 4M68A 5K0KA 5BUEA 2QR7A 2W1IA 2UVYA 2V55A 2PVKA 4ZZOA 1NT2A 2WPAA 5FLFA 2IN6A 4GW8A 4RIYB 3QRJA 4Y73A 4U42A 3V8SA 3UIUA 2CGUA 2VO6A 3A61A 3MI9A 4TWPA 4Y5HA 4UV0A 4OT5A 3M11A 3R8LA 5BPYA 3OWKA 4YC3A 3VUTA 2PVJA 1K9AA 4O0RA 3RK9A 4AX8A 4BDFA 4EK5A 2BTSA 4RWIA 2C6LA 2ZV9A 2W1DA 4O4EA 4V01A 4YP8A 4IX6A 4BZNA 3UQGA 4D2PA 2P4IA 4PP7A 3KXGA 2BZHB 2B9JA 3BYOA 1OIRA 2RIOA 3GCVA 4RWJA 3ZUUA 3PVGA 2HW7A 4NK9A 3BRBA 3RMFA 3UJGA 3DKOA 2BAKA 4K6ZA 3GENA 1XQZA 5C8NA 1ZY5A 4IAIA 2YDJA 2QKWB 2NPQA 3DLZA 4XBRA 3NYOA 2A1AB 4C35A 4HNIA 2J90A 5DWRA 1SYKA 1STCE 1WZYA 3EKNA 4OTGA 1W2CA 1YWVA 4RFZA 2PVNA 2ITXA 2R3NA 3EKKA 2W5HA 3ODYX 4R3CA 4C0TA 4EKLA 4XNEA 4W4YA 5CSWA 2PUUA 2F7XE 2WTCA 3HDNA 4KKEA 3WF7A 5DEWA 1FOTA 4ZZMA 3FQHA 4FK3A 4TWOA 5DN3A 4AA5A 5DOSA 4U8ZA 4J99A 5B2KA 4EH6A 2X39A 3O8UA 2ERZE 5HHWA 3KFAA 1GJOA 3E7OA 4DT8A 2BRGA 3F5XA 3LFFA 3ORXA 3HL7A 3PLSA 4DGNA 4KBCA 2JKOA 2BDJA 1G3NA 2F49A 2XM8A 3O8PA 4C4GA 4EZ5A 3V8TA 2JBPA 5ANJA 4U3YA 2ZM4A 3GU8A 5LXMA 3JS2A 1FGKA 5JN2A 2EVAA 5AR8A 5T6KA 4X6QC 3K54A 4BIEA 3MH0A 1PXPA 4IB0A 2GFSA 1Q8ZA 4ZTHA 3P5KA 5A6NA 2YM3A 3ZM9A 4F99A 2I0HA 2OGVA 2VTQA 4D0WA 4RIWA 2EU9A 4BCIA 4BBEA 4FGRA 4IX5A 3PSCA 3A7FA 4BICA 2W1EA 5GIPE 4LUEA 2B4SB 1REJA 3WARA 2OF2A 5D41A 4TWNA 3PIZA 4AACA 3LMGA 5A4CA 3U51A 5EHYA 3WZEA 4E6DA 3HZTA 4RJ6A 4CZUA 2C6TA 3QX2A 5ITAA 3I1AA 2I1MA 2AYPA 3UNZA 2GHMA 1MQBA 3RZFA 4CKIA 2XMYA 2BDWA 1TKIA 3HMMA 5DT3A 5J95A 4EH8A 3BBTB 2OSCA 5HOAA 2GTMA 5A3XA 2WQMA 4W9WA 2O5KA 4XG9A 1OZ1A 5CAQA 3Q9YA 2IF8A 1RW8A 5A4QA 4YNEA 3O23A 3QX4A 2A27A 5K5XA 3QFVA 2PHKA 4U9AA 1BKXA 3MA3A 3MJ2A 4FT5A 3WYYA 4C3FA 3OY1A 4ZJJA 3LFAA 4L01A 1GZOA 3O51A 1UWHA 1BLXA 4I41A 1UA2A 4UMRA 3HVCA 3RJCA 4YZCA 4JLCA 2JKQA 2O65A 4IC8A 3EYHA 5FXQA 3TM0A 3UPXA 4LV5A 3RPRA 4AT4A 3UNKA 4X2GA 1W7HA 2CSNA 2AUHA 4FODA 4H1MA 3A60A 3PJ1A 1V1KA 3P23A 5ANKA 3G0EA 4AW1A 4IEBA 4BGGA 4BDDA 4BDGA 3MPTA 2YISA 4RVLA 1UV5A 1PRYA 2UZTA 3FI3A 3Q6UA 3OEZA 3QD3A 3JY0A 4K77A 4O0VA 4C4JA 2OXDA 4FNYA 1SVGA 4K8AA 3NW6A 4IWOA 4MUQA 2YWPA 2WMTA 4FV2A 5HICA 3CC6A 4AFJA 3RK5A 3UZPA 2KULA 3BHUA 4FKGA 3PJCA 4O4FA 3UQCA 5I5ZA 4FIFA 4NWMA 4RJ5A 5FTGA 2R3FA 1UKHA 4MQ2A 4GJ3A 4U43A 1WBPA 4PF4A 3RVGA 3DBCA 4IWQA 2BRNA 5AV4A 1DAWA 5I9UA 3AC4A 2X6EA 3IPHA 4QP6A 4I20A 3VVHA 4RX5A 3E8DA 1S9IA 4CCUA 3PYYA 3DV3A 4HCUA 4L00A 3DZOA 2FA2A 4AZWA 4E6CA 1OECA 2CJMA 2PUNA 4L3PA 4U40A 3FEGA 5BVOA 3UVPA 4KINA 3HV6A 1MUOA 5ANEA 4O21A 2HYYA 4IANA 4MEDA 5DA3A 5HZNA 3MIYA 4E3CA 4XP3A 1R1WA 4BCHA 4YPDA 5H8BA 2WXVA 4WUNA 4YLJA 5AIRA 3D5UA 2PZRA 3TKUA 3VS4A 4BCQA 4DEGA 4YJOA 2GFCA 3OROA 4AFEA 2R0UA 2R3GA 3BWJA 3GCQA 4JIAA 5FEQA 3SV0A 4D9UA 2C6MA 1IA9A 4P4CA 1OL2A 4CFFA 3NR9A 4PP9A 3TJCA 3PUFC 3CXWA 4K1BA 2F7ZE 2RFNA 3FMJA 3ZLSA 4E20A 3GU7A 4QQJA 5AM7A 3KY2A 5E4HA 2IVTA 4G31A 3KK9A 2FYSA 2X0GA 4F6WA 3AOXA 3RI1A 3F2AA 4YSJA 3VS1A 2GMXA 5EI2A 4Y72A 1DM2A 1MRVA 5HBHA 4JG6A 2JD5A 3D2IA 2WTKC 3VBXA 2E9PA 4TYHA 5HD4A 5AV0A 2JFLA 5LWNA 5J8IA 3HLLA 3CSVA 4F9AA 3W8LA 4JL9A 5M57A 3FV8A 2I0YA 5IEYA 3UVRA 2ITQA 4MBJA 2G2IA 2GNJA 2ZV2A 5HVKA 4QYFA 5EM6A 5HVJA 3FMEA 2CKOA 2QD9A 4RX8A 2C5VA 4V0GB 2XKCA 5GZ9A 2IW9A 2W17A 1K2PA 3I79A 4FL3A 4D1SA 3VJOA 3VW8A 4CLJA 5EM5A 4ITIA 5M4CA 2XK7A 5KMIA 5EQEA 4FC0A 4BN1A 4EOIA 5L8LA 3EQIA 1H1RA 2UZNA 4EC8A 3P79A 4EC9A 3PXRA 1Y6BA 2ETRA 3DBQA 3Q5IA 4C4IA 4YR8A 5KHWA 4C8BA 5HE3A 4LDTA 1KV1A 2PY3A 3SDJA 4OTFA 3AGLA 2B52A 2WOUA 3JR1A 4QDEA 2R3LA 2J5EA 3GNIB 3QAME 3HMPA 4FKTA 4FOBA 4MBIA 4MXZA 3I81A 1ST0A 4BI2A 3F3ZA 4U3ZA 3FMLA 4PMTA 2IG7A 3G0FA 4FTKA 2WTIA 2RFDA 2WQBA 1NA7A 1ZXEA 2R3KA 3HX4A 3PZEA 3HV4A 5CNNA 3KEXA 1SVHA 2JBOA 2O3PA 4MH7A 4U79A 3R9HA 2F7EE 4YMJA 4Z16A 5H8GA 1FGIA 3TEIA 4EH9A 2JIVA 5D7AA 4YTCA 5A4TA 4Y83A 4B9DA 4H58A 1OKZA 2REIA 3FPMA 5CF4A 1JKLA 1U54B 5IQBA 4CFNA 2QQ7A 4I94A 4FKRA 4YU2A 2F2CB 2W9FB 3BYUA 2QO9A 2OBJA 4F63A 4RBLA 3M2WA 3CD8A 3R8PA 3UO4A 4QPSA 2ZAZA 4C33A 4EOMA 3FLNC 2NRYA 3FBVA 3LPBA 4FKOA 4C58A 4R5YA 4DGGA 3FLQA 3UYSA 3ENMA 2G2FA 3DS6A 4L46A 2AC3A 2ITTA 4RA5A 3B8QA 2OFUA 3BPRA 3GXLA 4Y85A 4ZTLA 3ZM4A 4C2WA 2G15A 1H00A 1Q5KA 4U41A 4RSSA 3DKGA 3KCFA 4UY9A 5HORA 1YW2A 3RAWA 4BZOA 3ATSA 1P4FA 3NWWA 4QMYA 1HCLA 3R04A 3BYVA 3HEGA 2QHMA 2UZLA 3DAKA 4DHFA 4ACCA 4JDJA 3NLBA 3UO5A 1WAKA 2R3QA 3PG1A 2C5OA 3NAYA 4I6HA 5BMSA 3DAEA 4G9RA 5E8SA 4BVUA 3QQFA 5JGDA 1KE7A 5FXSA 1RE8A 4L7FA 2OH4A 4F7NA 5B7VA 3RWQA 2O63A 2BFYA 2W4JA 4ZIMA 4QQCA 2PU8A 3GQLA 2Z7RA 4E5WA 4PTGA 2B0QA 1H27A 1SMHA 1UNLA 2WQOA 5CVGA 4HYHA 4FF8A 3T9IA 4BZDA 4LL5A 1AGWA 2XVDA 4KWPA 3VNTA 4H39A 1XBBA 4XV2A 2CLQA 3F3TA 4FKUA 3LFQA 4JS8A 1Q3DA 2C0OA 3HRCA 1JNKA 5J5TA 3A8XA 3NPCA 4N70A 3C5IA 1VJYA 2ITNA 2VTHA 1PY5A 3NUYA 4O0XA 3WOWA 4QDVA 1OL1A 3FLWA 4KSQA 3TV4A 2YABA 5D12A 3UE4A 4AZFA 2JLDA 3R7VA 3VRYA 3KGAA 1ZOHA 3UNJA 3KRJA 3O5AA 4L67A 2OXXA 2ZOQA 2WGJA 2J4ZA 4ZY5A 4UALA 3N9XA 5HIDA 4AOJA 1PXIA 4OTRA 1OGYA 2OG8A 4A9RA 4EHVA 3OC1A 2PULA 3DZQA 5ANOA 4X2NA 4GS6A 1PMEA 3VUMA 2R7BA 4GRBA 4H05A 4XX9A 5EDRA 4AXAA 4ANOA 4NL0A 3JY9A 2ZMCA 3QKKA 4II5A 4FI1A 5IQAA 1LUFA 3RNYA 3W1FA 3VUIA 2WU7A 5CSPA 4F9WA 4FG7A 4DEIA 1E1VA 4YC8A 4EH4A 1QPEA 5LMBA 2J2IB 4EUUA 5AUZA 2C6EA 4MXAA 4EL9A 3F3WA 5AUXA 4FMQA 2XNMA 2OZAB 2O0UA 3MBLA 3EJ1A 1XBCA 1URWA 1PYEA 1H01A 4S31A 3CJFA 5D1JA 2DUVA 5KMKA 3D7TA 5AM6A 5LCKA 2GQRA 2YIQA 3EFKA 5IH5A 1SM2A 4OTIA 1AQ1A 3CY3A 5IZFA 1ZOGA 4QP2A 3JUHA 4IAAA 3QC4A 3BGQA 4RMZA 3WF8A 4USDA 4A7CA 4O0UA 3KMWA 5AX9A 5TO8A 2YAAA 2C1AA 2ETKA 2J6MA 4J98A 2HZNA 3THBA 3ATTA 3AQVA 3HDMA 4M0YA 4OTDA 2UZUE 5C27A 2XZSA 3FXZA 1OIYA 2UZVA 3R7IA 3SD0A 4DYMA 1U46A 2X8EA 4JDKA 4E93A 4F6SA 2CHLA 4ZLZA 3TYKA 3H9RA 4D2VA 1T46A 4QMVA 4CCBA 3UODA 4HPUE 4PV0A 1YI3A 1YXSA 5L8JA 3VC4A 4KS7A 1UU3A 4FUYA 5DE2A 5HG9A 3OWLA 5AUWA 3EFWA 2VU3A 3MB7A 4OBQA 1XJDA 1I44A 4L42A 3ZS5A 5A6OA 4J52A 4NCTA 4RJ4A 3RPSA 5CZIA 5E8TA 3LMHA 4PL3A 1LEZA 4QPMA 2GHLA 2HOGA 3QWJA 3BYMA 2OFVA 2WU6A 3NCZA 3D7ZA 2ESMA 4IACA 3QTIA 5CY3A 1Y8YA 4QMPA 2B9FA 1DI8A 3SXRA 3HAVA 3H10A 4CD0A 2V0DA 2UVXA 3SLSA 2QI8A 2C0TA 3KU2A 4RPVA 3UIXA 4BGHA 5FXRA 3BU6A 2FB8A 3NUAA 3LVPA 3NSZA 2ZDUA 4M69A 3E62A 2XKFA 3PVUA 5DI1A 3HMIA 4C57A 1Z57A 2QU5A 2YACA 1YI4A 3BHTA 4G6NA 4BYJA 3UZTA 4LRMA 3UP7A 4U7ZA 2OIBA 4GJ2A 3WE4A 1H0WA 3ELJA 3V5LA 5HX6A 4F78A 2ZFYA 1PKDA 3FXXA 3HRBA 5AP3A 2UW4A 4CFXA 4EJ7A 2BALA 3IONA 3EQPA 5T68A 3BL9A 1WBNA 4Q9ZA 1M7NA 5EYMA 3NNWA 1J1CA 3OCBA 1UWJA 5JFWA 4FVQA 1JAMA 3EN9A 4FT0A 1QPJA 2PSQA 4FKPA 4FTUA 4BWPA 4DEAA 1H28A 1TZDA 1KE9A 1OPKA 4FZ7A 4AGUA 3FY2A 2HELA 2R0IA 2YZLA 3VAPA 4EZ3A 4M8TA 4Q2AA 2Y9QA 5L3AA 4FKQA 3IKAA 3RHKA 2YM4A 3QKLA 3MTLA 5DNRA 3RZBA 4MNFA 5H8EA 3GP0A 3ZZEA 4O0TA 3NW5A 3E63A 5E8ZA 5KZIA 3AT4A 1PMUA 4J97A 3UC3A 2HXQA 3T8OA 4M66A 3L8PA 4QMMA 2CCHA 2R3RA 4TT7A 4RIXB 4G2FA 1J3HA 3VBQA 4X6RA 4C4HA 3QUPA 3SRVB 3QRIA 5AV1A 3QHRA 5FEDA 3LMIA 4FZ6A 3GU4A 1W84A 4UYNA 4PMPA 3F5PA 2ZM1A 4M13A 2X7GA 3OXTA 3S4QA 3DFAA 1MP8A 3Q04A 4FYNA 4ZTMA 5AUYA 4H3BA 4FTRA 3ROYA 2CNUA 4QMQA 2XNOA 1H1WA 1ZMUA 2RKUA 1QPDA 2A0CX 4TW9A 1ZAOA 2IVSA 3EQDA 3S95A 5KCVA 4BB4A 2P2IA 5KE0A 5L4QA 3E87A 1H1PA 2YDKA 4EK8A 2XJ1A 4XV1A 5LVPA 4X3FA 4RIOA 3V01A 2VWZA 5H9BA 1PXMA 3NIEA 3R1NA 4KB8A 1Q4LA 3QLFA 1Q97A 2NO3A 2BIKB 3C1XA 2VX3A 3IDCA 4IZ5A 4UN0C 4UX9A 4GKIA 3IW6A 4FNZA 4F7LA 4DBNA 1OB3A 4BJJB 4BCNA 3KRWA 4MHAA 3DPKA 4X0MA 4IX3A 5M4FA 2QC6A 3PIYA 3RPVA 4ACHA 3EHAA 3UTOA 4O27B 3SVVA 1P2AA 3K5UA 4PWNA 3DKCA 4RG0A 3UMWA 5JSMA 5LARA 2WEIA 1YXVA 3MH3A 3W33A 3GC8A 4CTBA 2ZMDA 1SZMA 4PDYA 1YOLA 2Z2WA 3GC0A 3ETAA 3PXQA 4BL1A 3H0YA 4XEYA 2YJSA 5FDPA 3A99A 3L9NA 3MA6A 2QLQA 2XALA 4D1ZA 4QP1A 3GOPA 5EHLA 4RQVA 4TYJA 3W2QA 4HVSA 4FV9A 4QYEA 3GC7A 4D2SA 3C4WA 4XH6A 5KMOA 4DEBA 1YXTA 2BDFA 3RAKA 1KSWA