2YISA

Triazolopyridine inhibitors of p38 kinase.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
325
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title Design and Synthesis of Inhaled P38 Inhibitors for the Treatment of Chronic Obstructive Pulmonary Disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 325
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yisA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yisA01
5JN2A 4BCGA 4FEQA 5LMKA 5HNIX 2OJ9A 3OTUA 3ZO2A 5E8ZA 4O1PA 3UG1A 4CFNA 3O7LB 1IR3A 4L7SA 5GIPE 4KAOA 3NR9A 1UU9A 2UZWE 3TDVA 3MIAA 2PVLA 5HO7A 5FXSA 3QD0A 4U9AA 5DI1A 3LCSA 4KS8A 5CU6A 2XK6A 3CEKA 4XHKB 5C9CA 4J71A 4FE2A 4QMOA 1OGUA 5KMKA 3U6JA 2QOHA 3I6UA 4M3QA 3ITZA 4LOQA 5HE0A 4EK8A 3TN8A 3QTIA 4MXXA 4O7ZA 3A8WA 3BLQA 3KULB 4HGTA 4YZ9A 3Q4TA 5ANGA 5AR5A 5FLFA 3ZM4A 4UEUA 1OL7A 2YAKA 3BE9A 4NUSA 4HNIA 5CSHA 5DBXA 4CEGA 4F6SA 1URWA 3NMUF 3IECA 3FL5A 3ANQA 3LHJA 1PXLA 3NLBA 1Q8WA 3KK8A 3EMGA 4RMZA 1W7HA 2CN5A 4ZXTA 2NRYA 4O0UA 3VIDA 3VS2A 4BYIA 3EZVA 4FSYA 5EH0A 4FZAB 4PPBA 4RVTA 4BI2A 4IFCA 3BLRA 4XP3A 3TTJA 4QMSA 2W17A 1YHVA 2PMIA 4YMJA 2V22A 3BHVA 4NYEA 1OIQA 5TT7A 5C4LA 4C4HA 4D2SA 3S00A 3DBEA 2GFSA 4TWCA 4BCIA 2CKOA 3PTGA 3PZHA 2CDZA 1JVPP 4L67A 2R3FA 3FMHA 3R2YA 4C61A 4XRJA 3R7IA 3OW4A 2F7EE 1Q8TA 3C13A 3R73A 3CPBA 3DY7A 4GRBA 3MVMA 3E88A 1OKZA 4N6YA 5D7VA 4I0RA 4RIOA 5B7VA 3JUHA 2ZB1A 2Y0AA 4MEDA 1SZMA 3RPSA 4BBMA 4IWOA 4DGOA 2Q0NA 4E6AA 3L8SA 4F65A 5M4FA 4FSZA 2WTVA 5CENA 4WG4A 4FIGA 4TN6A 2PE2A 2B53A 3H9OA 4HCTA 3QQUA 2ZJWA 4O2PA 2E9OA 2OSCA 4EOMA 4IZAA 4JQEA 5IMEA 4OTFA 2CCHA 4I5HA 4ZZOA 2Z7QA 2J0IA 2ITWA 3QD4A 4FKOA 4L3PA 5BNJA 2XVDA 4BBFA 4CXAA 5FBOA 1IA9A 1FGKA 4PNKA 3PY1A 4GIIA 4JAIA 5AIKA 2YFXA 5HBJA 2BZIB 3IGOA 4K77A 4L00A 4BDIA 3MY0A 2Z7SA 5L4QA 3TUBA 4EH4A 2HZIA 5F9EA 4CV8A 4LL0A 3ZO3A 4J53A 2RF9A 4MKCA 5KX8A 2JDTA 3L9MA 2R7BA 1B39A 4ZTLA 4O38A 5E4HA 2XYUA 5HVJA 3W2OA 4TW9A 3E5AA 4AT5A 5IH6A 4GUBA 1XJDA 5CXHA 5E8SA 2PPQA 4O0WA 2VTJA 4NM5A 4ZSLA 3QQKA 3UVRA 3DAKA 3IW7A 4OGRA 2C5OA 2WMWA 3QGWA 4HYIA 4IX5A 4RZVA 3GC0A 2H8HA 5AUZA 4IWQA 4AOIA 3NX8A 1RQQA 4DT9A 4IIRA 2IWIA 3VS1A 2IN6A 4CYIA 3WF7A 3ZSHA 3ZFMA 4FL2A 1DI9A 2QHMA 5CEKA 3OEFX 4ARKA 2X4FA 3LFFA 3RNIA 2FH9A 2R4BA 3RAKA 4NKAA 2H96A 4PPCA 3HMPA 3GU5A 2ITUA 4YC6A 4KBCA 2YDIA 4BTFA 2YZLA 1XH6A 2H9VA 3PJ8A 2V7AA 1ZOHA 4R1YA 4IFGA 4RJ8A 2QCSA 3W2QA 2B9FA 3A60A 5I3OA 3K5UA 3ZC5A 3NVKI 3RP9A 3R0TA 3RCJA 3TZMA 3V8TA 4BRXA 2C30A 3LJ2A 4I0SA 4WBOA 4FC0A 5EOBA 3SOAA 2O2UA 3UIMA 2BAKA 4Z55A 3HX4A 2WKMA 2HZ4A 2ZMCA 2BKZA 1PXIA 2C6IA 5CVGA 2AYPA 3HA8A 2BKKA 4QPMA 4EZ7A 3QCSA 2SRCA 5AUTA 3VBQA 4ENYA 3M11A 4FI1A 4GG5A 1SVHA 4YJUA 4KB8A 2V5QA 2WO6A 3DNEA 5HE1A 3VBTA 4JQ8A 5A4CA 1Q62A 3EFLA 4N0SA 3VUTA 3BBTB 1UU3A 4M0YA 3TUDA 4QTBA 4HZSA 5BX0A 5AP6A 5FGKA 4F0FA 2W9ZB 5AAGA 4FZ7A 4W9XA 4EHGA 3HYHA 3GU8A 3THBA 3DV3A 2PHKA 5E8UA 3Q2JA 4ANMA 3EQPA 3Q53A 4KS7A 3CD3A 4RVLA 5LJJA 2Z60A 2WELA 1XQZA 3Q32A 3F66A 3VS5A 3KGAA 4YBJA 4AOJA 3PG3A 5DT4A 4QP1A 4QYHA 4IWPA 5HOAA 3O23A 4TWNA 3OT3A 1GOLA 3G9LX 1NW1A 3CTHA 4C59A 2VTAA 1OUKA 5K3YA 2ERZE 2CGWA 4R5YA 5HBHA 4N70A 3FC1X 1YOJA 3DAEA 4FEVA 3LQ8A 3KK9A 2WEIA 3PP0A 4G2FA 4H3QA 2QO7A 4IVAA 4ZZMA 1ND4A 3DPKA 4J99A 3EFKA 2I0YA 5DLSA 2H34A 2PMLX 4XS2A 3CC6A 4F7NA 5K4JA 3RK5A 2I1MA 4D0WA 2JDRA 2JGZA 2JIUA 3PE1A 3JR1A 4BR3A 1K2PA 3LXNA 2R3RA 1GZKA 2J9MA 3F69A 4XG9A 4XP2A 5E1SA 5AP4A 3VF8A 3ZSIA 4BCKA 4CMOA 4DEDA 4MXCA 2E9VA 3R7OA 3TZ9A 3MESA 3AG9A 3QD3A 3ORLA 4FG9A 3BLHA 5FP6A 5GZAA 5IA0A 1GZ8A 3QZFA 1Y91A 1L3RE 3KRWA 1R1WA 4G3CA 4RLLA 2CPKE 4BKYA 4AT4A 2BDJA 4EL9A 3KRJA 2J0KA 4FEWA 1YXTA 3EHAA 4HPUE 4U7ZA 5CI7A 2XNMA 3U4UA 3FZ1A 3QHRA 3G5DA 1YDSE 3CJFA 1WCCA 2VTIA 4A9YA 4CLIA 4PMTA 1FBNA 4HVSA 2EB3A 3LMHA 2PVJA 5CSPA 1YOLA 2GNHA 1J3HA 5AR3A 3MIYA 3UMXA 4C4EA 5C8NA 4LGGA 2GS6A 1OL5A 4FKRA 1YQJA 1DI8A 1OKVA 4A7CA 5M08A 2ZDUA 3FMKA 3SC1A 4OTPA 4D4YA 4RIXA 3FC2A 4I94A 3RMFA 5HG5A 4BCHA 2ZMDA 4IB5A 3W32A 2QURA 4I6HA 3KMWA 3MPTA 1QL6A 3K3JA 3P79A 1WFCA 3LQ5A 3Q9WA 4ZSJA 4AGDA 4CFUA 3FDNA 3SQQA 5FTGA 2W5HA 3C0IA 3D7ZA 3ATSA 4YPDA 3AMAA 4QMPA 5IDNA 4F70A 2VWBA 3P23A 4GH2A 1WBSA 2QU6A 5BVFA 1J1BA 3PZEA 4FV4A 3BWJA 1BL6A 3QWKA 3EH9A 2UW8A 2GQRA 3AGLA 3F3TA 3L8XA 3MVHA 3R1YA 5HD4A 4YHTA 2BROA 1W84A 4FV6A 4C3FA 4QMUA 1UWJA 1UNHA 5EYKA 3W55A 1GY3A 2B7AA 4MD9E 2VTHA 2J51A 3OFMA 4FTQA 3HECA 2CSNA 3MSSA 4LGDA 5FEDA 4O82A 4L68A 1W83A 2ONLC 2XM9A 3QCXA 4X6QC 4BWXA 3COKA 5EDRA 3TV6A 4ALWA 4E3CA 2FVDA 1B38A 3KU2A 4I41A 5JH6A 3UZRA 4JBPA 3ZONA 4PUZA 3R83A 4R7BA 3BHTA 2YM4A 2W1HA 4KBAA 5IUHA 2V7OA 4G3FA 4NZWB 2ZV8A 3ORIA 2NO3A 3QUPA 3DXQA 3GCQA 2UZDA 3ROYA 4II5A 5IA1A 5B0XA 3GNIB 2V55A 4MCVA 4RC4A 4EH7A 4BCPA 4ZAUA 3C4EA 3UDBA 2I6LA 4HNFA 5AAFA 4TNBA 4PL4A 3FZOA 4YSMA 3ORTA 1BMKA 4CT1A 4QTAA 2RIOA 4M97A 5CNOA 3KF7A 3T3UA 4BVUA 1Z9XA 2YM8A 3PJ1A 3D7TB 3LKMA 1H1PA 2XKFA 4LRMA 4ZZNA 3FMJA 5M57A 4O7RA 5DEYA 1JAMA 1MP8A 3E7OA 3QQGA 4BC6A 4OTRA 4RX8A 3EN7A 4FL3A 1F0QA 4GFGA 1H01A 1W8CA 3HL7A 5AP2A 1URCA 5EDPA 4DH8A 4IW0A 4EUUA 5KHXA 3WZUA 2I0HA 4JNWA 1JOWB 4CRLA 4GG7A 3G15A 2WQOA 5AM7A 3ZXZA 3A4OX 4AQCA 4YTFA 4MBIA 1MRYA 4E1ZA 5J5TA 3GC8A 4P5ZA 3FWQA 3DBFA 3PVBA 2VWXA 3DU8A 4FTAA 4U0IA 2R7IA 5BPYA 4W4YA 5EM6A 5F1ZA 4BIDA 5HX8A 4KUJA 4AW1A 1KE6A 3I5ZA 4FTOA 2CNVA 3UP7A 4RWKA 4WA9A 5AV1A 1XWSA 3C51A 3E8DA 5LVOA 5HG9A 2GHMA 2QOLA 4HW7A 4K6ZA 1PXPA 3MW1A 2HW6A 2QR7A 3IG7A 3MWUA 4I0TA 3IK3A 4QRCA 2GSFA 5CT0A 1KWPA 4RGJA 2P3GX 3EQDA 3TEIA 4O2ZA 4X2JA 4E5AX 4EBVA 3BEGA 4D4RA 1ZYLA 2IVTA 2G01A 5DNRA 1J1CA 3LFEA 3MGYA 2O5KA 4X0MA 4NW5A 4DEEA 1SNXA 1JNKA 2JFMA 3P08A 4A9TA 2BRGA 3REPA 5IQFA 5BQ0A 2J6MA 2PZRA 4L42A 4IBMA 4V0GA 3HMMA 4A06A 4C35A 4FV8A 4FSUA 5BVWA 3QTQA 3A7JA 3E62A 4USEA 5M55A 4UALA 4QP8A 4GT4A 3ORMA 2PULA 3BYOA 1T46A 3HMNA 3AOXA 2VWWA 3OWLA 2PE1A 4S33A 4RC2A 1YI6A 5GZ9A 4XV2A 5G6VA 4RJ6A 4RQKA 4Y85A 4ERKA 3EQFA 1FGIA 2GNFA 3GXLA 2IZSA 4GEOA 4O0XA 1WAKA 5LMKC 2B55A 3QRUA 3RM6A 5ITAA 5CSVA 4PNIA 5HI2A 2PVNA 2GU8A 3CY3A 3VN9A 1Q61A 1YXXA 2QI8A 4EQCA 3AC4A 4UMPA 4AACA 3HKOA 4LG4A 4PDYA 2AC5A 1QPJA 3Q60A 4ASXA 2QOFA 4DEIA 3RTPA 3UYTA 2VD5A 4E8AA 4CG8A 4RG0A 2WEVA 2QOQA 4D9UA 5ANOA 4FL1A 4PWNA 1TQMA 3PXRA 2W5BA 4MTAA 4KIKB 3FXZA 3E92A 3TWJA 2XK8A 2GTMA 4K8AA 5CVHA 4ZY6A 4BGQA 4C4GA 4QP2A 4GV1A 4EJNA 4EOPA 3CQUA 3NYNA 5E8VA 1ZYDA 1Y57A 2XBJA 1JLUE 2EXMA 5BYLA 3N4VA 2VX0A 4AP7A 4AW2A 3RAWA 4BKJA 2GDOA 5AV3A 4BL1A 5EFQA 4O7LA 3CKXA 2XM8A 4QD6A 3QTWA 5T3QA 4V05A 3CD8A 3SXFA 3F3WA 2XEYA 2WMXA 3UOLA 3VJNA 4GK4A 2WNTA 3RPOA 1OI9A 4C4IA 2JD5A 5BVOA 3R9RA 3GBZA 4EEVA 4ACMA 2R0UA 1R78A 4OAUC 1FVRA 4UMUA 3IQ7A 3OY3A 3A4PA 5BUJA 3WF6A 1R0EA 4DGGA 2BMCA 1UKIA 3SXRA 2QO9A 3GUBA 4JAJA 2ZYBA 2R64A 4Y83A 4F9YA 4EJ7A 2F9GA 3GU7A 3FLZA 3FMLA 4JX7A 4XEYA 2VGOA 3NZ0A 4W8DA 2HOGA 3OWPA 3T3VA 2W0JA 4IX6A 5H9BA 5KO1A 1P2AA 5CALA 4DFYA 4WSYA 3UZPA 1KOBA 3QQJA 4XMOA 3NYVA 1IG1A 2J90A 2XMYA 4U81A 5GJGA 3W18A 4YP8A 5L2SA 3VBVA 1OPJA 4PY1A 3N9XA 5KHWA 3PPJA 2GFCA 3LM5A 1QPCA 3RCDA 1HOWA 2XKEA 3C4FA 3MI9A 4C02A 4L3LA 4CV9A 1ZOEA 2G1TA 4RWIA 1TQIA 4C4JA 3FHIA 3P5KA 3QC4A 3FZSA 4AFJA 4AZWA 2LGCA 4DH1A 5C4KA 2OIDA 4DCAA 3B2TA 4FK6A 4KIPA 2O64A 4EORA 3TNQB 4TYJA 1R3CA 3MFRA 3O2MA 1U5RA 2R3KA 1M17A 1FINA 4B0GA 3QALE 3FKLA 2A4LA 2YEXA 3W2SA 4BDBA 3ALOA 3F5GA 3IS5A 3OZ6A 4R7IA 4RVMA 2BRNA 5HE3A 2ZB0A 4XRLA 3PXZA 3SW7A 1GNGA 2GHLA 4CRSA 4FSQA 3Q04A 5D12A 3DLZA 3Q96A 3W10A 3AMYA 3OOMA 4OAVB 2CJMA 5GJDA 4BTJA 2EB2A 5CZHA 5G1XA 4HJOA 4LUDA 3R9NA 4L53A 2P55A 2X0GA 2QO2A 2YACA 2G9XA 3F5PA 3IW5A 4MBJA 4QTEA 2FYSA 5IA3A 1S9IA 5HIDA 4YSJA 5B2KA 2W1ZA 3G0EA 5IQIA 1JPAA 1PXMA 2BHHA 4QP7A 3VHKA 3OVVA 5AUWA 2WTCA 3L8PA 3QRJA 3EQHA 5K0XA 3OCBA 3MFSA 5I9UA 2ZVAA 4B4LA 3KREA 4BKZA 3U9NA 1XH4A 1YWVA 5AFVA 4FNXA 2OF2A 4J96A 2UW3A 4G3DA 2DQ7X 1PXNA 2E9NA 5ANDA 4AGWA 4E4MA 4APCA 4EOJA 2BDWA 1GIIA 4I21A 2OI4X 4RJ3A 2ITOA 4M69A 4O6LA 3E8EA 4S2ZA 4D4VA 3FI2A 4TXCA 5IQHA 5HCYA 3D5WA 4KIKA 2C3JA 4FT3A 4FZDB 3VS3A 3UNKA 3V5QA 5CAUA 4YLKA 3MB6A 5DR6A 2HIWA 4U8ZA 3V6SA 2W7XA 3E3BX 5KMNA 4CZUA 2Z7LA 4CMTA 3TTIA 4GK3A 1Y6BA 3DBQA 4FYOA 5ANJA 1FMOE 4XNEA 3GCVA 3PA3A 2J4ZA 4FVPA 3OWJA 5C8KA 5CEMA 1KSWA 4O21A 5DR2A 5KBQA 3D2KA 4O7NA 4CTCA 2P2IA 5J7BA 2JLDA 4IVCA 2B0QA 3DJ6A 4HCUA 3R00A 2B9HA 4PP7A 1DAYA 2E9UA 2GMXA 4J7BA 3RPVA 3IDPA 3OCGA 3BGZA 5DGZA 3D2IA 3I7BA 4Q9SA 3CQEA 4PTGA 5E92A 5BVNA 2C6DA 3ORKA 4PMSA 1LEWA 4FX3A 3R22A 5CTPA 3OCSA 4CCBA 2P4IA 4AN3A 3KB7A 3U6IA 3RGFA 3GQIA 4ZS0A 1GIHA 1ATPE 4IMYA 3C0HA 3KN5A 2QC6A 5I4NA 3SXSA 3W16A 2I7QA 2HY0A 3RI1A 4D2VA 3FSFA 3N4UA 3E64A 2A19B 3AT2A 4EKLA 4FKSA 4ASZA 3UBDA 2WOUA 3IDBA 3I81A 5ETCA 3R04A 3QYWA 3BV2A 4Y73A 5HGIA 5TF9A 3VRYA 5AP3A 5HIBA 4NU1A 3A61A 4M12A 3DXPA 4JT3A 4UZDA 3OD6X 3U9CA 4ZJVA 5TOZA 3KA0A 3QX4A 4M67A 5CI6A 3F3UA 4A9RA 2ITNA 4FG8A 1J7UA 2HENA 4ZJIA 5DIAA 1J7IA 4E93A 5AX9A 4B8MA 4YTCA 5IH4A 4TPTA 3TT0A 4Y8DA 4L01A 3TM0A 2BZKB 1EH4A 5J9LA 3F61A 2PY3A 4BB4A 3R7VA 5KNJA 2C6MA 4EOSA 2PVHA 3KCFA 5FEEA 4ZTQA 2QQ7A 3DDPA 4AZEA 1H1QA 3O0GA 4AZVA 2F49A 4D1SA 3ZFXA 4K9YA 3T9IA 4D28A 4WBBB 1Q3WA 3MA6A 4C33A 3ZU7A 3HNGA 3QU0A 2FUMA 3ZO4A 4K0YA 5HCXA 3UQGA 3FSKA 3MVJA 5FQDC 1UV5A 3FLYA 1M7QA 4I3ZA 4OUCA 1XBBA 2VTQA 2YISA 4ZS4A 3QZGA 4IM2A 4G5PA 3TJCA 4KBKA 2OW3A 2PMOX 5E8TA 2PVYA 3R71A 5TO8A 2YM7A 4KRCA 3F7ZA 3UO6A 4E73A 3UP2A 4ZY5A 3VRZA 2EXEA 2XB7A 4B99A 2Q83A 3HRFA 2DUVA 4E6CA 5AAEA 1P4FA 3HAMA 3CIKA 3FQHA 5CF8A 2UW9A 2OZOA 2C6KA 1SVGA 4I5PA 3ORNA 2X2LA 3FBVA 4EZ3A 4WRGA 1AD5A 3WZEA 4DGLC 4RIXB 5GINE 3UC4A 3CTJA 4ANOA 3KVWA 3EQIA 4DG3E 4JL9A 3NW5A 3N51A 3ZCLA 2BAQA 2WTIA 3NUUA 4UMTA 1IRKA 4C62A 4C8BA 4BBEA 5KMLA 3AD4A 4RQVA 3Q9XA 3CPCA 4QMYA 3P7BA 2PZ5A 4TYIA 2CKEA 4XX9A 2C6LA 4RIWA 5DHJA 5E8YA 4DE4A 2PZPA 4LGHA 4NM7A 4NIFA 2QLUA 4ITHA 2PVFA 3ZM9A 3FY0A 1JSUA 3GCUA 4HPTE 3ZRKA 5EHLA 4YJSA 5HZNA 4X3JA 1PRYA 3FXXA 2OFUA 3GT8A 3Q5ZA 3SG9A 4QPAA 5EQEA 4JDJA 3HGKA 3CGOA 2UVZA 4FV9A 3HRBA 4GJ3A 4XG3A 3ZUTA 5M06A 4GW8A 3KXGA 4DFBA 1VJYA 1UU7A 3LFBA 1J91A 4TWPA 2VTPA 3OBGA 2ITVA 4H3PA 2EXCX 3NUNA 2WHBA 1GZOA 4D0XA 4PMMA 3C5UA 2J5FA 4UXQA 3ZH8A 4Z3VA 2P33A 3KQ7A 4IZYA 4TYEA 5JZNA 3HRCA 2R3NA 3P1AA 1G8SA 2Q0BA 5GIOE 4DFNA 4EHVA 2WFYA 5KBRA 3TKUA 2E9PA 2C5YA 2OKRA 3DAJA 3PYYA 4B6LA 4KSPA 4YHFA 1H26A 4X2FA 2X81A 4UMRA 4RX9A 5AX3A 2DWBA 5M44A 4FTUA 4HOKA 5HVKA 4BI1A 4MXOA 4GS6A 3S95A 1TKIA 4BCMA 4BGHA 4RFZA 2UZNA 5JSMA 4B8LA 4O86A 3PSBA 3Q2MA 2O65A 2Y6MA 5C1QB 5T68A 4O0TA 2ETMA 3I7CA 3LFNA 4KIQA 2XKCA 1PYXA 3Q6WA 5IG1A 5L8JA 2ZM4A 4BHNA 4RVKA 2VTSA 3CR0A 3DQXA 2W4JA 4Q9ZA 2YDJA 4MYGA 4BI0A 1UA2A 4IHPA 3WF9A 4FA2A 2YHVA 2OO8X 1YVJA 2ACXA 3PIZA 3R7GA 4JQ7A 1CMKE 5HORA 4GFOA 3W2CA 5HLNA 5HQ0A 4IANA 1H1RA 2BILB 4PL5A 3ETAA 2WU6A 4RWLA 4ACCA 4AOTA 5I3RA 3RZFA 1M2PA 3QTZA 2XKDA 3ORPA 2X1NA 4DFUA 4CSVA 4R78A 3PIXA 4AXAA 4QMZA 4NT4A 4GL9A 5J1VA 3RBWA 4KWPA 3ULZA 1WVXA 4Y5HA 4YZDA 3K3IA 4XCUA 4X2GA 4EHEA 5HU3A 1SMHA 3SRVA 2V0DA 4TYHA 1PXJA 3DDQA 3H30A 3U4WA 4WNOA 3UTOA 3MS9A 4GU6A 3BPRA 4QP9A 3QA0A 5FD2A 4BDCA 5F95A 4YJRA 4Z7HA 4DLIA 4H39A 4TT7A 5FXQA 4F6WA 2ETRA 2WD1A 5EKNA 4Q2AA 2XNGA 3NYOA 3ZHPC 4LI5A 1SNUA 4TZRA 4D55A 3TNPC 3NUSA 2WMAA 4X2KA 1Q4LA 3R28A 3UOJA 4E7WA 3BEAA 3V5PA 4A9UA 4ZTRA 3LFAA 5A6NA 3EWHA 1FMKA 4G6NA 2YDKA 3ODYX 4BCJA 3CGFA 3SAYA 2W1FA 3LPBA 4V0GB 4MXAA 4AF3A 1VR2A 1AQ1A 5CEQA 3PUPA 4WT6A 5M4CA 4ZP5A 2UZOA 4A9SA 3O96A 4C36A 3HVCA 4IQ6A 1VYZA 3FZTA 4LFIA 5KMMA 5LMAA 1ZRZA 4L43A 5HNGA 3OUKA 1S9JA 2IZRA 3MTLA 4G3GA 4DTKA 4KIOA 4KD1A 5JMSA 2BAJA 4IWDA 4F9WA 1LR4A 2QKRA 2UZVA 5IQDA 3F2NA 1CKJA 4C58A 1CM8A 5ACKA 1OL6A 5JFSA 1PMVA 1YW2A 2XRUA 3I1AA 3COHA 3RWPA 2PUIA 3ZRLA 1YWNA 3CLYA 3D5XA 2XJ1A 3NIZA 3FPQA 4MF1A 3PSCA 4DFZE 3V3VA 4JDHA 5L6WL 3IDCA 4YO6A 2VWIA 4HYUA 2QOIA 5FXRA 5CU0A 4M0ZA 3TKIA 4CQGA 4IEBA 3PFQA 4O0VA 3DK6A 3TKHA 3QWJA 2RFNA 3ZUVA 3WZDA 3QTXA 3BU6A 4RBLA 2YM6A 4DH5A 5J79A 4MNEA 3UOHA 4UXLA 2QOOA 2X4ZA 5HTIA 3JXWA 5I5ZA 2VO7A 3DCVA 2R5TA 2Y4IC 1YXVA 2QVSE 2YABA 3AT4A 1W82A 3ERKA 3KF4A 1BI8A 4J8NA 1H27A 3FE3A 4JDIA 3QKMA 3RPRA 3V6RA 4S30A 1JSVA 4X3FA 3MH3A 3V5TA 4DEGA 4DCEA 4FKLA 1Y8YA 4ASEA 4C4FA 3VS6A 3FI4A 4FT9A 4PTCA 4JIAA 5E9EA 2XCKA 2FSTX 3WE4A 5A46A 5L2WA 4FKVA 3OHTA 5E8WA 2X39A 4WUAA 3A7GA 3MH1A 3R8PA 2GNGA 3HUBA 2HELA 3QA8A 2Y4IB 3A8XA 1FQ1B 4X7QA 4F6UA 4FV3A 3CBLA 3O8PA 3GVUA 2WMRA 5DA3A 4F9CA 3NDMA 1CSNA 5TR6A 4CFWA 4G16A 1MQ4A 4PV0A 5IISA 3ORZA 2WMUA 3KXMA 2WZJA 4U97A 3D5UA 3UMWA 3LE6A 2HXLA 3BIZA 3HV4A 3PY0A 2VWZA 2ITPA 2WTDA 3AC2A 3NWWA 3OXTA 4ANBA 4UWYA 1R39A 4YR8A 4H1MA 3Q4ZA 2YCRA 5LMBA 5FRIA 3S3IA 3TACA 3PA5A 5EM7A 2CKQA 2JBPA 2NPQA 4CYJA 4AAAA 1XH8A 5C27A 1E1XA 2IW9A 1PMEA 3E8CA 5I9YA 1PY5A 4QNYA 2RG6A 1QPEA 4CFMA 4BIEA 2AUHA 4WNPA 4M7IA 4M8TA 4RJ4A 2C69A 4Y95A 2RFSA 3BE2A 4YJPA 4ZEGA 4LMNA 4HZRA 5D10A 2GNJA 3PVWA 4OT5A 3VHEA 3IKAA 4YUQA 3R01A 3SD0A 1U4DA 5KMIA 3FUPA 3DT1A 1ZOGA 3OW3A 3EFWA 2C6OA 3QKLA 5AP5A 1UVRA 3SW4A 1ZMWA 3GCSA 4CKIA 3AC5A 5KCVA 4DF3A 1ZXEA 3OUNB 4E4XA 4FF8A 3BHYA 4R3RA 2UZTA 5JGAA 1BX6A 1V0OA 3H3CA 4YJTA 4BDAA 3QX2A 3I0OA 3HP2A 5EI8A 1OM1A 3QBNA 1OL2A 1DS5A 3COMA 1SVEA 3DKGA 3HLLA 4DINA 2WMBA 3R21A 2JDVA 4O84A 5TKDA 5JGBA 2LAVA 2OK1A 2X7OA 4ZSGA 4P4CA 3GI3A 2HZNA 4DTAA 2YIYA 1PHKA 3P0MA 3TNWA 4DH7A 3R8UA 3BX5A 4U80A 2IVUA 3ULIA 4NH1A 1YXSA 3QRIA 4XG4A 2HW7A 2PK9A 5KMOA 3NUAA 4EYMA 2XA4A 3IPHA 3F6XA 3RWQA 1F5QA 2RFDA 1OB3A 5AP0A 4BTMA 3OXZA 3C4CA 4M69B 2YIRA 2VN9A 3UO4A 3GFEA 1YWRA 1IA8A 3VS4A 1OVEA 4NSTA 3GB2A 3E63A 2WTJA 3PVUA 2J50A 3SLSA 2BR1A 4CT2A 4RX5A 5IA4A 4FTJA 3W1FA 5FM2A 3A7IA 3CS9A 4OTQA 3SA0A 4DTBA 4QMXA 1ZY4A 1H08A 3ZBXA 4AW0A 2ZAZA 2IZTA 3UQFA 4FSMA 3P86A 3PXFA 1H00A 4G1WA 5HE2A 3WF5A 3LFQA 2RL5A 4FSNA 5BVKA 3NW6A 3RM7A 5M53A 1XR1A 2PVRA 4DC2A 1OBDA 4OT6A 1E1VA 1ZYCA 2CGVA 2JC6A 2WIPA 3PWYA 3TL8A 3NSZA 3H9FA 4IAYA 4YHJA 2WTWA 1H28A 3ACKA 4USDA 1PW2A 4TWOA 5H8EA 4R3CA 4XOYA 3OC1A 4C3PA 4QQCA 3ZEWA 3B8QA 4FIFA 3GQLA 1Q97A 4EK3A 3WE8A 2Y8OA 5HESA 5M56A 2C5XA 2HY81 3C7QA 2VTOA 5EYDA 4UX9A 5EM5A 5HHWA 4QO9A 5IQCA 4LQMA 4GMYA 5K5XA 2YA9A 3C9WA 3PY3A 2PUUA 3RVGA 2CKPA 5DPVA 1KUTA 2CMWA 1WMKA 2WMSA 4ASDA 4J98A 4NTTA 3UVQA 3FKOA 3K5VA 3NAYA 4R77A 4W8EA 3GC7A 3W33A 4FIIA 4P5QA 3FV8A 4LYNA 4TRLA 4BCFA 4MWIA 4E26A 2BIYA 4F7SA 3VAPA 3LFDA 1JQHA 3UYSA 3M42A 2WPAA 4Q5HA 2W4OA 5IQAA 3BYMA 1GIJA 2ZDTA 3G0FA 3PIYA 4TYGA 3PDTA 3V51A 3QUEA 2OXDA 3EL7A 1P4OA 2ITYA 2YCSA 3R02A 4HGSA 4AX8A 2BVAA 4U5JA 4KA3A 3T8OA 3E87A 4JIKA 3TDWA 3WZJA 2C3KA 5LQFA 1FVTA 4I4FA 3JYAA 4LV5A 3OMVA 3AT3A 3V5LA 2UW7A 2WOTA 3CXWA 4Y72A 2J2IB 4U43A 4BY9E 3TV4A 2BFYA 3I6WA 3QC9A 4FKIA 4MHAA 3AC8A 3DK7A 3EQRA 4M13A 3RJCA 4BDGA 3F3VA 2WTKC 5AR2A 1REJA 2HWOA 2B4SB 4FSTA 3VQUA 1NVRA 4W4WA 1V0BA 1NVQA 4FOCA 4TNDA 1JBPE 2YAAA 3ALNA 2IG7A 4CKRA 3U8WA 4FTMA 4O91A 3R8MA 3HV7A 4BZNA 4BWKA 4C0TA 4G6OA 1UU8A 3F3ZA 3JY9A 3NUPA 4EOIA 4UMQA 4PP9A 3BHUA 5LARA 5C26A 3QTUA 4YTIA 3QQHA 5JQ8A 3PE2A 4LL5A 4IB1A 4EUTA 3NVMB 4QQJA 5CU2A 4ZLOA 5HLWA 4O7SA 3PPZA 3OY1A 3TZ8A 2WTKB 5KKRC 4IVDA 1BLXA 4WO5A 4D5KA 3VBWA 1P5EA 2A27A 3DZOA 2FSMX 4E5BA 3MYGA 3PVGA 4I5MA 4U3YA 3VO3A 5CAVA 4DITA 3ZRMA 3G51A 3QYZA 2DS1A 2VTTA 2O63A 4BCQA 3QTSA 3G6GA 3I79A 4BDDA 3KXZA 3A7HA 5FP5A 2YM5A 4FV1A 3KN6A 2WB8A 1G5SA 4FNZA 4EZ5A 2YWVA 1RDQE 4RIWB 3POZA 3DOGA 4YJOA 2ETKA 3OEZA 5E90A 4UYNA 3VVHA 5IUIA 4AFEA 4AN9A 3TI1A 4XBRA 2X8IA 3UVPA 5HIEA 5KKRB 5HO8A 1OPKA 5DVRA 3VC4A 3V5WA 4O83A 4K11A 4AGCA 2RG5A 4XP0A 4PF4A 2UVXA 3VBYA 1AGWA 1T45A 1M2QA 2WQBA 4L3JA 2OIQA 3FY2A 3DA6A 5IZFA 3SHEA 3MA3A 3BELA 5FDPA 4EOQA 3KFAA 3L9LA 3W2PA 3ZLYA 2I0EA 3C1XA 5IUGA 2B9IA 4BDHA 1H07A 2JKMA 4TY1A 3KCKA 5HU9A 3TXOA 4GJ2A 4K18A 4H1JA 3G90X 4XYFA 4R5SA 5EYCA 3WYYA 1KE7A 4MH7A 2X6EA 5J7HA 2RSVA 4CCUA 4HVGA 5EKOA 4AZSA 4BZDA 4CD0A 3GENA 1IEPA 3EJ1A 4I6BA 4CGAA 4FEUA 1QMZA 2BTRA 2YIQA 3FKNA 4I22A 1VYWA 1ZMVA 3CQWA 4PQNA 4W4VA 5DMZA 4BZOA 3U55A 4CZYB 5CU4A 1Z5MA 4NCTA 4USFA 4D2TA 2ZOQA 3GOKA 2R9SA 3H4JA 3KRLA 3FJQE 1WVYA 3O7LD 3LAUA 4P7EA 2R3GA 2OF4A 5DRBA 3BQRA 3RZBA 3TNIA 3ZEPA 4C2WA 5IA2A 4O7VA 2J0MB 3COIA 3RK7A 3VS7A 2YCQA 3AD6A 1U46A 3F5XA 2VO3A 3U54A 3QFVA 3MFTA 2YLFA 1KE8A 4FGRA 2CCIA 4U41A 3OBJA 5LCKA 1NA7A 5EQYA 2F2UA 1OL1A 4JG7A 5AR7A 3VW8A 5D9HA 2WMTA 5IKWA 2UZLA 4APPA 2FGIA 1U5QA 3LMGA 3QCYA 5H2UA 3LJ1A 4KABA 1PXKA 2BALA 3HAVA 4FKPA 3LQ3A 2R2PA 4KKGA 3SRVB 1A48A 5CSWA 4TYHB 5AM6A 4KKHA 4ANQA 3JVRA 2A1AB 4AW5A 2C3IB 3OS3A 4I5CA 4ZOGA 5D1JA 3UODA 4ZSEA 3ZYAA 4HYHA 4MXZA 4DEBA 5HICA 5ACBC 2XIYA 4MX9A 2IW6A 2YCFA 3FMEA 4JXFA 5CF6A 2FB8A 3BU5A 4RC3A 5K0KA 1M52A 2BUJA 3SKCA 4AA0A 5DWRA 3OG7A 3KVXA 5CEPA 5TE0A 4IM3A 2XRWA 2BHEA 2JEDA 4I24A 4F63A 4OTGA 4JDKA 1O6KA 2IVSA 4IE9A 3RPYA 5K5NA 2OJJA 3EB0A 4U44A 3UIXA 3O50A 2ZV7A 2WIHA 2C5VA 1MRVA 4Y5QA 3ATTA 5H8BA 3CCNA 3I5NA 1KV2A 3KC3A 5AADA 5IEYA 4JG6A 3GEQA 2UZEA 4G6LA 4BDJA 5CASA 3Q5IA 4X2NA 5L2IA 2Y9QA 3FZRA 4YO4A 3CKWA 4QMTA 4FVQA 4EH9A 3LXKA 3EYGA 3RAHA 4AE9A 1XH9A 2YM3A 3ZUUA 3MTFA 4O7TA 4IXPA 2Z7RA 3CJGA 4MNFA 3NNXA 4ACGA 1BL7A 4IX3A 5JEBA 2BTSA 2ZV2A 4P90A 3WI6A 3MN3A 4ERWA 5J1WA 4X3FC 4D2PA 4U40A 4QMLA 3PA4A 4YZNA 4EH5A 4RJ7A 4GYIA 3FYJX 1REKA 4D2RA 2HWPA 2XK9A 3LLTA 1K3AA 4CNHA 3LFCA 3ZTXA 4C3RA 3EYHA 4FV7A 5CX9A 3IW4A 4MNEB 3D5VA 3ZMMA 2OFVA 5KZIA 2F7ZE 3Q9YA 3NNUA 4ANNA 5M4IA 4ONAA 4YURA 3EQBA 4WRSA 4LOOA 1FPUA 5EYMA 2FA2A 4X3FB 4EC9A 4GCJA 3IW8A 4FSWA 2R0IA 4FKTA 5J87A 3ZLSA 5LVMA 4J8MA 3CP9A 4FTKA 5J95A 3SV0A 2ERKA 3LZBA 5JKGA 3C50A 4JRVA 2EVAA 4NW6A 3UOKA 4DN5A 3FPMA 3LCDA 3M2WA 4E4NA 4OBQA 4Z9LA 5M09A 3PPKA 2VWYA 2G2IA 3GFWA 4TL0A 4IADA 3BGQA 1CKPA 4O22A 4BFMA 2RKUA 4QYYA 2UW6A 5F20A 3UIUA 3MB7A 4AN2A 3LFSA 4BICA 5BMMA 1YRPA 4JOAA 1PMNA 4EK4A 4CQEA 1A06A 2DYLA 2PVKA 3CY2A 2VWVA 3PRFA 5A3XA 4F9BA 2XK3A 1Z57A 1ZLTA 1PXOA 2C4GA 4O81A 3L8VA 2F7XE 3KXNA 1CKIA 3AMBA 3B2WA 1UNGA 5IPJA 3SGCA 1OIYA 3Q52A 4D1XA 2O8YA 2OGVA 3OT8A 1JKTA 3OF0A 4IDTA 3R8VA 3DKFA 4EOLA 4AS0A 3II5A 2XIKA 4DEHA 5KMJA 3POOA 4FTCA 5HG8A 5JRQA 5DRDA 4EONA 2GTNA 4NM3A 2XK4A 2XJ2A 4RJ5A 4NKSA 3IO7A 3SVVA 4JVGA 3PSDA 5DR9A 4F7LA 2UZUE 2W4KA 4L52A 2OJFE 4F09A 1PKGA 3LCKA 4GUEA 4ZTMA 1MQBA 4WOVA 3FI3A 5K4IA 3K2LA 4O0RA 4D1ZA 1LEZA 1G8AA 2JAVA 1X8BA 4ZY4A 5C01A 4C7TA 3EN5A 1O9UA 1ZY5A 2WMVA 2YITA 4OBPA 4XV3A 3IOPA 4S32A 4YTHA 3T9TA 2KTYA 2R3JA 2R3OA 4L7FA 2J0LA 4IB3A 4MWHA 4NK9A 4XG8A 3KRRA 3G9NA 3OTVA 4DBNA 3EQCA 4E20A 3PXYA 3FQSA 3QAME 4I92A 2OZAA 5CT7A 2UUEA 3VWAA 5I0BA 2JKOA 4C57A 2ZM3A 2J0JA 1RJBA 2YN8A 3MPMA 4XLIA 2QG7A 3SG8A 4CTBA 2HK5A 5K9IA 1M14A 5LVNA 1L8TA 4UB7A 1ERKA 4IACA 3ZZWA 4DH3A 3QQLA 5AJQA 2OG8A 2VNYA 1H1WA 1M2RA 3IW6A 3DNDA 3U51A 3NNVA 4KNBA 4XLVA 3QRKA 4JBOA 4LV8A 2I40A 2GNIA 4FTTA 2VU3A 1HCKA 3VUMA 3BWFA 5HEZA 3FYKX 2PUNA 1JKLA 4CFFA 4IAKA 3OWKA 3TZ7A 4XG2A 1A9UA 3ZFYA 3BI6A 3BZ3A 5CWZA 3KRXA 4RFMA 2UV2A 2REIA 4FV5A 3KKVA 3WIGA 4F4PA 3DQWA 2VGPA 3HEGA 1NVSA 3LM0A 2C0OA 4O96A 4F0IA 2QOBA 3L9NA 3LCTA 5ICPA 2R3LA 1KE5A 3Q4CA 4RRVA 2OXYA 3WYXA 3PRIA 3VW6A 3HDMA 3ZDUA 2QD9A 1OITA 1Y8GA 4G3EA 4M84A 4UWCA 3W8LA 4YLJA 1M7NA 3ORXA 1VEBA 1ZARA 4QYFA 3F7WA 2XIZA 5CF4A 1PMUA 3AGMA 4EC8A 1ZZLA 3AC1A 1ZWSA 3U87A 2WQMA 3ZXTA 3PWDA 3HP5A 2HAKA 2YERA 3A7FA 4FKQA 3NS9A 5D41A 3WIKA 5AUUA 4FV0A 2ESMA 2UW4A 3BCEA 4EH3A 4HVIA 2VWUA 2IW8A 4CZTA 5LXMA 5AUXA 3EZRA 3LMIA 4FG7A 2PZYA 1LPUA 1SYKA 4YJNA 3MFUA 3Q3BA 4IVBA 3UG2A 3D15A 4U3ZA 3ACJA 4UV0A 4F0GA 4HGLA 5IQGA 3LLAA 2BIKB 4KRDA 4DFXE 5JFXA 3KMUA 3EN4A 4AGUA 2WQEA 4CFXA 3JPVA 1YKRA 5CAPA 1BI7A 4LRJA 5L2TA 3QUDA 4G9CA 1XKKA 2W96B 5CY3A 2Z02A 4FMQA 1RW8A 4MD7E 4NFMA 4RIYA 3GU6A 2CLXA 4IC8A 4ZTNA 3H9RA 1Q24A 1XBAA 4RFYA 3UNZA 2OJGA 4BN1A 3AXWA 5CS6A 2R3MA 1FOTA 3VUHA 4UBAA 3VULA 1P14A 2CLQA 4DA5A 4XJ0A 4ZMFA 2JDSA 4FKUA 4FT7A 3FHRA 3QLGA 4QMQA 5A6OA 4GT3A 2OBJA 1W98A 4KINA 4BIBA 2P0CA 3QXOA 2PTKA 4QTCA 5CSXA 3S4QA 3PLAE 4M68A 5JRSA 4RSSA 4FICA 2CGXA 1XHAA 3HV5A 4DAWA 4NEUA 3ZOSA 3KL8A 2XCHA 5L8LA 2XZSA 3BYSA 1OBGA 1Q8YA 5CQWA 3QL8A 5CQUA 4DGNA 4FV2A 4ZJJA 3HMIA 2ITXA 3FAAA 2EUFB 2QKWB 3FLQA 4UZHA 3RK9A 3ZS5A 4AT3A 4XBUA 4HVHA 2XF0A 3E8NA 2PVMA 2X2MA 3C4ZA 4OBOA 4QMMA 5CEIA 3DB8A 3BYVA 5FUTA 5IMXA 4I23A 2GS2A 4FTLA 3GOPA 2YWPA 4RX7A 5B2MA 4WIHA 4R6VA 5J8IA 5C03A 4R3PA 3L9PA 4RPVA 1U54A 3ROCA 4AZTA 3F88A 3C0GA 4YC3A 5LCJA 2E2BA 4WSQA 4FR4A 3MV5A 3FMNA 4RWJA 2WAJA 4FIHA 2XP2A 5EHOA 4F64A 1OUYA 4QMNA 2C68A 4JRNA 3DKOA 3MJ1A 4E4LA 1ZAOA 1WBPA 4L9IA 2QHNA 4WG5A 5CVFA 4YZMA 1CTPE 5I9XA 3NGAA 5L8KA 4FIJA 4F7JA 5CANA 1WZYA 4I20A 5AUYA 3EFJA 4D2WA 3UIBA 3DZQA 3DB6A 3CTQA 5L2QA 1WBVA 4FUYA 4V01A 3LOKA 5HVYA 3OOGA 4IZ7A 2ITZA 2CNQA 4BDEA 5DT0A 2XEZA 4JG8A 2RFEA 2C1BA 2EU9A 4YNOA 4EYJA 1IASA 5ANIA 3D14A 3O17A 3SDJA 3EKKA 3FLNC 1OKYA 1E9HA 2O0UA 5A4QA 2QNJA 4M14A 3VJOA 4GSBA 4U42A 4E6DA 4CVAA 5CZIA 3D83A 2PMNX 3PLSA 3ODZX 4FT5A 4NWMA 3QGYA 2QOKA 2IZUA 2G2FA 2F57A 1BYGA 2B9JA 2G2HA 1FVVA 5CLPA 3GCPA 5DE2A 1I44A 1JSTA 4IJPA 5EK7A 3C4WA 4ZTHA 2JKQA 2GQGA 4RLKA 4EOKA 5BUIA 5E91A 4H05A 3NNWA 3BU3A 2HYYA 5EI6A 4U79A 3A2CA 1WBNA 1WVWA 5L6PA 5AV0A 4P2KA 4I1ZA 3V8WA 5IQEA 2JKKA 2W1GA 4IB0A 2AC3A 5HX6A 3D94A 2PU8A 2JAMA 3ZLWA 5BYYA 4A4OA 5IQBA 3CSVA 1IAJA 2XNBA 3R7UA 3P78A 5DN3A 3UE4A 3ZLXA 3RAIA 4JI9A 1OKWA 3R9HA 4EOOA 3F2RA 2P2HA 5FTQA 3EIDA 1KOAA 1W0XC 3PP1A 5I9WA 4QQ5A 4GKHA 4ZMEA 4U6RA 5HG7A 1V0PA 4JS8A 3ENHA 4QOXA 3V01A 4L44A 4BF2A 5FDXA 3DJ7A 2HXQA 1NXKA 4I4EA 1Q8UA 4NCTC 3VUIA 5A4LA 2H6DA 3MDYA 1RE8A 4CFVA 3KULA 5JK3A 4FKGA 2IVVA 2CN8A 1GZNA 2Z8CA 3H10A 4AG8A 3MVLA 4N57A 3UO5A 3BKBA 3QD2B 5AP1A 5CXZA 4MAOA 3SX9A 3RNYA 3R63A 5IU2A 2VNWA 4D9TA 4BHZA 1F3MC 2W1IA 3PJ2A 5HD7A 1YDRE 5ANKA 3EL8A 3ZDIA 4EH8A 1QCFA 4XOZA 4FYNA 2ITQA 2Z2WA 5J9YA 4FNYA 1Q99A 4YLLA 5AIRA 5A9UA 4BCOA 3GU4A 3NW7A 3O8UA 3RHKA 2W05A 1K9AA 2WXVA 2Y4PA 3D0EA 3R1SA 3LXPA 4HGEA 1H0WA 2GHGA 2O3PA 4X21A 4WNMA 1YI4A 3RINA 4ACHA 3VS0A 2PE0A 4IAFA 4XV1A 4EH2A 3EKNA 4L8MA 4NM0A 3HA6A 4H36A 2YJRA 4FZFB 4JR3A 4A4LA 3FI8A 3DTCA 5A54A 5GHVA 2VV9A 2BRMA 5ANEA 2C6TA 3RALA 3GP0A 4FEXA 3RHXA 3MBLA 5KUPA 5A4TA 1BUHA 3MJ2A 4IZ5A 2FO0A 2FSLX 3UNJA 4JBVA 4PDPA 5JZJA 3VUGA 2IO6A 3TIYA 2KULA 4G9RA 5LWNA 3VUKA 4GKIA 3JS2A 5I9VA 2VX1A 3EN6A 5DEWA 5IEVA 4EK5A 3QKKA 1LUFA 2PWLA 1H25A 4ITJA 4ZK5A 3Q4UA 4YC8A 1UNLA 3BBWA 3DJ5A 2YJSA 3A99A 4BCNA 2BDFA 4K2RA 5C8MA 3NCGA 5AUVA 4WUNA 3R6XA 3LIJA 3KXXA 2GQSA 3QCQA 1H4LA 2WQNA 2GCDA 2BRHA 3R8LA 4M15A 3QZHA 5LVPA 3BQCA 4AU8A 4EQMA 3I60A 2C6EA 1OZ1A 3BRBA 4ZIMA 3QLFA 3O71A 5L6OA 2NP8A 3R30A 3GGFA 4GT5A 5HO6A 3JY0A 3QF9A 3BGPA 3TNHA 3UPZA 4FBXA 5IEXA 2QU5A 1NY3A 4LM5A 1UWHA 5FG8A 5J9ZA 2UW0A 5EM8A 1VZOA 4HCVA 2UW5A 4JR7A 5HCZA 5AP7A 5HTCA 1WBOA 3PJ3A 5JT2A 2C0IA 5LOHA 2YIXA 5EW3A 1IAHA 2XBAA 3LXLA 3ZBFA 2C5NA 3TIZA 4AZFA 3ZSGA 1STCE 4G31A 2W5AA 3BHHA 3NIEA 5EG3A 3UC3A 1GJOA 3V04A 5DOSA 4EQUA 3M1SA 3H0ZA 4XV9A 5CYIA 5HLPA 2PUPA 2ZV9A 4NFNA 4H3BA 4EK6A 2QR8A 4IM0A 2I0VA 4AUAA 3ID6C 3NRMA 4ZSAA 5IDPA 3DLSA 3DS6A 4GFMA 4MQ2A 3EQGA 5IA5A 4QT1A 4PDOA 2C3LA 4QYEA 2J5EA 4F1OA 2JBOA 5AA9A 4DT8A 5ETIA 4FOBA 3BV3A 3KXHA 1PJKA 3V8SA 2QOCA 5LWMA 5E7RA 4WHZA 4YBKA 4M66A 4FTNA 4OR5A 5DT3A 3DXNA 4YNEA 4ALVA 1NT2A 4GU9A 4O7WA 5E1EA 2OICA 1J7LA 4CG9A 2W9FB 4ITIA 3HV3A 2XH5A 2ITTA 5A4EA 1BKXA 3F9NA 3QTRA 4IC7A 3V5JA 2QLQA 2XNPA 5HTBA 4MD8E 2BFXA 2XNOA 5KE0A 1YHWA 2YLEA 4JJRA 4ORKA 3VUDA 2VTMA 3NPCA 5D11A 4FIEA 1KE9A 5CEOA 4C37A 4GVAA 3PJCA 4GYGA 3NCZA 1ZMUA 3R9DA 3TJDA 5A14A 4B9DA 1XH5A 4G34A 2BRBA 2VTLA 3FZPA 3R7EA 4F9AA 2OH4A 4K33A 3WOWA 5KZ0A 5DH3A 4QMWA 4R1VA 4YZBA 4JLCA 3Q6UA 4FVRA 4PTEA 4YPSA 4FTIA 4DG2E 4B7TA 1DAWA 3O51A 5BVEA 1Q3DA 5JFWA 5IH5A 1G3NA 1APME 4DFLA 4DGMA 5CF5A 4MF0A 3UZTA 3MH0A 3NEWA 4C2VA 5M07A 3WBLA 2OH0E 3UJGA 4IDVA 3TV7A 4DG0E 2GPHA 5AMNA 3MH2A 4O0YA 5DYJA 3D4QA 2XNEA 3P7CA 3F5UA 2W1EA 3HUCA 5HKMA 3FLSA 4LRKA 5JGDA 5L3AA 5BVDA 3NUXA 4K1BA 4O1OA 4PL3A 2GNLA 4FNWA 4FSRA 1SM2A 2OWBA 2XIRA 3G33A 1H24A 3FXWA 3F2AA 4NJDA 5BYZA 4DEAA 5DFPA 2VAGA 3HZTA 4I6FA 2PL0A 4LOPA 2UVYA 4PX6A 5D7AA 3AD5A 5FEQA 4BWPA 4F99A 4HYSA 4NIFB 4U45A 1Q5KA 5AR4A 1OIUA 5LVLA 2CGUA 3O8TA 1KV1A 4LMUA 4BDFA 2OJIA 4IAAA 5ETAA 5AWMA 4NTSA 4QP3A 1XH7A 1LP4A 3G6HA 2ZM1A 4GK2A 5EHYA 3LW0A 3LVPA 4HVDA 5HNBA 4EWHA 1JKKA 2B1PA 2R3HA 3ET7A 1B6CB 4BTKA 4QP6A 2Y6OA 4Y46A 2JITA 2PYWA 5CNNA 3MY1A 3H0YA 1TVOA 2CNUA 2C0TA 4H58A 4N4SA 4DYMA 1V1KA 1O6YA 2OZAB 4DBXA 4PDSA 4GIHA 4JX3A 3R1QA 1TQPA 3ZZEA 3I0QA 4XH6A 2BCJA 3KEXA 5H8GA 1PYEA 5IF1A 5F94A 3FMDA 4YGAA 3E93A 5EW8A 4BYJA 4J97A 4ZLZA 4R7HA 4UYAA 4ACDA 3E7VA 3DKCA 4MQ1A 2VRXA 2X9EA 2JIVA 2R3PA 1JWHA 2QODA 4CKJA 5AV4A 3I4BA 3EOCA 4O0SA 4TTHB 5EOLA 4NJ3A 3CE3A 4UY9A 3FL4A 3WILA 4FKWA 4OW8A 2F2CB 4IAIA 4PPAA 2XIXA 2VTNA 4QYGA 3GC9A 3SOCA 4DHFA 4J95A 1XO2B 3R2BA 2A2AA 2B54A 5F4NA 3FEGA 3ANRA 4KKEA 3VBXA 4Q5EA 2X6DA 2WGJA 4L45A 4OTHA 5AEPA 5ETFA 3S1HA 3FQEA 4F1TA 1OECA 3DBCA 3K54A 1I09A 3QHWA 1ZZ2A 3E3PA 4OTDA 1U59A 4YJQA 4D5HA 3L1SA 1GAGA 4OTWA 4E6QA 2W1DA 4A4XA 5CU3A 1Y6AA 4EH6A 4G5JA 5FM3A 3PXQA 4ZLYA 5EW9A 1HCLA 2FSOX 2GS7A 4QTDA 4WNKA 4CMUA 3ZO1A 1CDKA 1ZYJA 2X2KA 2BZJA 2IJMA 4C34A 3TG1A 2R3IA 4IX4A 5E8XA 2W1CA 2VO0A 4ID7A 4FUXA 1MRUA 3IONA 2VUWA 4V04A 2C47A 2V62A 4UWBA 4C38A 4FTRA 5AV2A 5BUEA 4KSQA 2VX3A 3F82A 4EWQA 4X6RA 4RA5A 1WBTA 2ONLA 4PRJA 3P4KA 4J1RA 2JFLA 5EQPA 4ENXA 5CAOA 1YOMA 4W4XA 4ANLA 3R7YA 4F1MA 3LCOA 2G15A 3D9VA 3RKBA 4FODA 4MBLA 3D7TA 3LJ0A 1OPLA 4NL0A 3FMMA 4FGBA 4FK3A 4JBQA 4RIYB 2R3QA 3A62A 2QONA 5GNKA 1H1SA 3N4TA 3C4XA 3R9OA 4I93A 2QG5A 3ELJA 4YZCA 4YJVA 1JKSA 2VTRA 2X9FA 4ANSA 3P7AA 4BGGA 2XNNA 3WZKA 1YDTE 2RGPA 4F08A 2JIIA 3OCTA 4WG3A 4FZ6A 4LUEA 4AWIA 4EKKA 3HMOA 4CLJA 3NUYA 3QXPA 3VQHA 2F4JA 3DGKA 2Y7JA 4MVFA 1PF8A 3AC3A 5GZ8A 3QRTA 3FLWA 5AR8A 3UGCA 5EI2A 1UKHA 2HCKA 4O7YA 2OU7A 2PZIA 4RZWA 3DFCB 4OTIA 4YU2A 3S0OA 1R0PA 3DBDA 4O27B 3PXKA 3PG1A 4IJ9A 3UPXA 4ZTSA 4Z7GA 1O6LA 5M51A 3C5IA 2PSQA 2C1AA 1H0VA 4G17A 3W8QA 4FKJA 5CAQA 1WBWA 3VNTA 4WKQA 1U54B 4S34A 4GVJA 4IAZA 5JFVA 3ZC6A 1PKDA 5FBNC 4UN0C 3U6HA 2VO6A 4XG6A 3DTWA 3W2RA 4W9WA 2CHLA 2NRUA 5FWKK 5BMSA 5AA8A 2XK7A 1OMWA 3MPAA 3S2PA 2A0CX 4TKSA 2HZ0A 2XS0A 4O6EA 1MUOA 3EN9A 3HV6A 3OP5A 4QP4A 3G2FA 4AE6A 4BDKA 3Q9ZA 3DFAA 3HDNA 2XJ0A 5J5SA 3ENMA 4OLIA 2W06A 3DK3A 3R8ZA 4DLJA 1XBCA 3WF8A 5B2LA 5GJFA 4RA4A 4MK0A 4Z16A 1H8FA 5H3QA 3R1NA 4L6QA 3P9JA 4RT7A 4D4SA 2IPXA 2X7GA 2OLCA 4EI4A 4S31A 5T6KA 3VF9A 4I6QA 2J7TA 1DM2A 4N6ZA 3QQFA 2X8DA 3IOKA 2WU7A 3MY5A 3NAXA 2EWAA 4D58A 4QQTA 4A07A 2W99B 3KY2A 4R8QA 3TCPA 3AQVA 4QMVA 4QNAA 3BYUA 4AA4A 4J52A 2WMQA 3B8RA 5JQ5A 1Q41A 2BPMA 4WD5A 3OROA 4MXYA 2XUUA 3QZIA 2BZHB 2B52A 2NNWB 5EDQA 2XYNA 3OXIA 1YI3A 3WARA 5I9ZA 4IH8A 3IGGA 2OIBA 2X7FA 3UQCA 3KMMA 4XUFA 4EHZA 1Q8ZA 1YHSA 2JDOA 4FT0A 2YZAA 4L46A 4XG7A 2VZ6A 5HBEA 5M4UA 4QPSA 2YIWA 5FTOA 4ALUA 4E5WA 1OIRA 4EBWA 4AA5A 4PMPA 1YXUA 1QPDA 5DG5A 3TUCA 3NYXA 3JVSA 2X8EA 1ZYSA 2UZBA 2OXXA
chains in the Genus database with same CATH superfamily
5JN2A 4BCGA 4FEQA 5LMKA 5HNIX 4AXCA 2OJ9A 3OTUA 3ZO2A 5E8ZA 4O1PA 3UG1A 4CFNA 3O7LB 1IR3A 4L7SA 5GIPE 4KAOA 3NR9A 1UU9A 2UZWE 3TDVA 3MIAA 2PVLA 5HO7A 5FXSA 3QD0A 4U9AA 5DI1A 3LCSA 4KS8A 5CU6A 2XK6A 3CEKA 4XHKB 5C9CA 4J71A 4FE2A 4QMOA 1OGUA 5KMKA 3U6JA 2QOHA 3I6UA 4M3QA 3AKKA 3ITZA 4LOQA 5HE0A 4EK8A 3TN8A 3QTIA 4MXXA 4O7ZA 3A8WA 3BLQA 3KULB 4HGTA 4YZ9A 3Q4TA 5ANGA 5AR5A 5FLFA 3ZM4A 4UEUA 1OL7A 2YAKA 3BE9A 4NUSA 4HNIA 5CSHA 5DBXA 4CEGA 4F6SA 1URWA 3NMUF 3IECA 3FL5A 3ANQA 3LHJA 1PXLA 3NLBA 1Q8WA 3KK8A 3EMGA 4RMZA 1W7HA 2CN5A 4ZXTA 2NRYA 4O0UA 3VIDA 3VS2A 4BYIA 3EZVA 4FSYA 5EH0A 4FZAB 4PPBA 4RVTA 4BI2A 4IFCA 3BLRA 4XP3A 3TTJA 4QMSA 2W17A 1YHVA 2PMIA 4YMJA 2V22A 3BHVA 4NYEA 1OIQA 5TT7A 5C4LA 4C4HA 4D2SA 3S00A 3DBEA 2GFSA 4TWCA 4BCIA 2CKOA 3PTGA 3PZHA 2IEWA 2CDZA 1JVPP 4L67A 2R3FA 3FMHA 3R2YA 4C61A 4XRJA 3R7IA 3OW4A 2F7EE 1Q8TA 3C13A 3R73A 3CPBA 3DY7A 4GRBA 3MVMA 3E88A 1OKZA 4N6YA 5D7VA 4I0RA 4RIOA 5B7VA 3JUHA 2ZB1A 2Y0AA 4MEDA 1SZMA 3RPSA 4BBMA 4IWOA 4DGOA 2Q0NA 4E6AA 3L8SA 4F65A 5M4FA 4FSZA 2WTVA 5CENA 4WG4A 4FIGA 4TN6A 2PE2A 2B53A 3H9OA 4HCTA 3QQUA 2ZJWA 4O2PA 2E9OA 2OSCA 4EOMA 4IZAA 4JQEA 5IMEA 4OTFA 2CCHA 4I5HA 4ZZOA 2Z7QA 2J0IA 4AXFA 2ITWA 3QD4A 4FKOA 4L3PA 5BNJA 2XVDA 4BBFA 4CXAA 5FBOA 1IA9A 1FGKA 4PNKA 3PY1A 4GIIA 4JAIA 5AIKA 2YFXA 5HBJA 2BZIB 3IGOA 4K77A 4L00A 4BDIA 3MY0A 2AEGA 2Z7SA 5L4QA 3TUBA 4EH4A 2HZIA 5F9EA 4CV8A 4LL0A 3ZO3A 4J53A 2RF9A 4MKCA 5KX8A 2JDTA 3L9MA 2R7BA 1B39A 4ZTLA 4O38A 5E4HA 2XYUA 5HVJA 3W2OA 4TW9A 3E5AA 4AT5A 5IH6A 4GUBA 1XJDA 5CXHA 5E8SA 2PPQA 4O0WA 2VTJA 4NM5A 4ZSLA 3QQKA 3UVRA 3DAKA 3IW7A 4OGRA 2C5OA 2WMWA 3QGWA 4HYIA 4IX5A 4RZVA 3GC0A 2H8HA 5AUZA 4IWQA 4AOIA 3NX8A 1RQQA 4DT9A 4IIRA 2IWIA 3VS1A 2IN6A 4CYIA 3WF7A 3ZSHA 3ZFMA 4FL2A 1DI9A 2QHMA 5CEKA 3OEFX 4ARKA 2X4FA 3LFFA 3RNIA 2FH9A 2R4BA 3RAKA 4NKAA 2H96A 4PPCA 3HMPA 2X0OA 3GU5A 2ITUA 4YC6A 4KBCA 2YDIA 4BTFA 1ST4A 2YZLA 1XH6A 2H9VA 3PJ8A 2V7AA 3PUFC 1ZOHA 4R1YA 4IFGA 4RJ8A 2QCSA 3W2QA 2B9FA 3A60A 5I3OA 3K5UA 3ZC5A 3NVKI 3RP9A 3R0TA 3RCJA 3TZMA 3V8TA 4BRXA 2C30A 3LJ2A 4I0SA 4WBOA 4FC0A 5EOBA 3SOAA 2O2UA 3UIMA 2BAKA 4Z55A 3HX4A 2WKMA 2HZ4A 2ZMCA 2BKZA 1PXIA 2C6IA 5CVGA 2AYPA 3HA8A 2BKKA 4QPMA 4EZ7A 3QCSA 2SRCA 5AUTA 3VBQA 4ENYA 3M11A 4FI1A 4GG5A 1SVHA 4YJUA 4KB8A 2V5QA 2WO6A 3DNEA 5HE1A 3VBTA 4JQ8A 5A4CA 1Q62A 3EFLA 4N0SA 3VUTA 3BBTB 1UU3A 4M0YA 3TUDA 4DHIB 4QTBA 4HZSA 5BX0A 5AP6A 5FGKA 4F0FA 2W9ZB 5AAGA 4FZ7A 4W9XA 4EHGA 3HYHA 3GU8A 3THBA 3DV3A 2PHKA 5E8UA 3Q2JA 4ANMA 3EQPA 3Q53A 4KS7A 3CD3A 4RVLA 5LJJA 2Z60A 2WELA 1XQZA 3Q32A 3F66A 3VS5A 3KGAA 4YBJA 4AOJA 3PG3A 5DT4A 2XARA 4QP1A 4QYHA 4IWPA 5HOAA 3O23A 4TWNA 3OT3A 1GOLA 3G9LX 1NW1A 3CTHA 4C59A 2VTAA 1OUKA 5K3YA 2ERZE 2CGWA 4R5YA 5HBHA 4N70A 3FC1X 1YOJA 3DAEA 4FEVA 3LQ8A 3KK9A 2WEIA 3PP0A 4G2FA 4H3QA 2QO7A 4IVAA 4ZZMA 1ND4A 3DPKA 4J99A 3EFKA 2I0YA 5DLSA 2H34A 2PMLX 4XS2A 3CC6A 4F7NA 5K4JA 3RK5A 2I1MA 4D0WA 2JDRA 2JGZA 2JIUA 3PE1A 3JR1A 4BR3A 1K2PA 3LXNA 2R3RA 1GZKA 2J9MA 3F69A 4XG9A 4XP2A 5E1SA 5AP4A 3VF8A 3ZSIA 4BCKA 4CMOA 4DEDA 4MXCA 2E9VA 3R7OA 3TZ9A 3MESA 3AG9A 3QD3A 4MUQA 3ORLA 4FG9A 3BLHA 5FP6A 5GZAA 5IA0A 2XALA 1GZ8A 3QZFA 1Y91A 1L3RE 3KRWA 1R1WA 4G3CA 4RLLA 2CPKE 4BKYA 4AT4A 2BDJA 4EL9A 3KRJA 2J0KA 4FEWA 1YXTA 3EHAA 4HPUE 4U7ZA 5CI7A 2XNMA 3U4UA 3FZ1A 3QHRA 3G5DA 1YDSE 3CJFA 1WCCA 2VTIA 4A9YA 4CLIA 4PMTA 1FBNA 4HVSA 2EB3A 3LMHA 2PVJA 5CSPA 1YOLA 2GNHA 1J3HA 5AR3A 3MIYA 3UMXA 4C4EA 5C8NA 4LGGA 2GS6A 1OL5A 4FKRA 1YQJA 1DI8A 1OKVA 4A7CA 5M08A 2ZDUA 3FMKA 3SC1A 4OTPA 4D4YA 4RIXA 3FC2A 4I94A 3RMFA 5HG5A 4BCHA 2ZMDA 4IB5A 3W32A 2NYAA 2QURA 4I6HA 3KMWA 3MPTA 1QL6A 3K3JA 3P79A 1WFCA 3LQ5A 3Q9WA 4ZSJA 4AGDA 4CFUA 3FDNA 3SQQA 5FTGA 2W5HA 3C0IA 3D7ZA 3ATSA 4YPDA 3AMAA 4QMPA 5IDNA 4F70A 2VWBA 3P23A 4GH2A 1WBSA 2QU6A 5BVFA 1J1BA 3PZEA 4FV4A 3BWJA 1BL6A 3QWKA 3EH9A 2UW8A 2GQRA 3AGLA 3F3TA 3L8XA 3MVHA 3R1YA 5HD4A 4YHTA 2BROA 1W84A 4FV6A 4C3FA 4QMUA 1UWJA 1UNHA 5EYKA 3W55A 1GY3A 2B7AA 4MD9E 2VTHA 2J51A 3OFMA 4FTQA 3HECA 2CSNA 3MSSA 4LGDA 5FEDA 4O82A 4L68A 1W83A 2ONLC 2XM9A 3QCXA 4X6QC 4BWXA 3COKA 5EDRA 3TV6A 4ALWA 4E3CA 2FVDA 1B38A 3KU2A 4I41A 5JH6A 3UZRA 4JBPA 3ZONA 4PUZA 3R83A 4R7BA 3BHTA 2YM4A 2W1HA 4KBAA 5IUHA 2V7OA 4G3FA 4NZWB 2ZV8A 3ORIA 2NO3A 3QUPA 3DXQA 1XMMA 3GCQA 2UZDA 3ROYA 4II5A 5IA1A 5B0XA 3GNIB 2V55A 4MCVA 4RC4A 4EH7A 4BCPA 4ZAUA 3C4EA 3UDBA 2I6LA 4HNFA 5AAFA 4TNBA 4PL4A 3FZOA 4YSMA 3ORTA 1BMKA 4CT1A 4QTAA 2RIOA 4M97A 5CNOA 3KF7A 3T3UA 4BVUA 1Z9XA 2YM8A 3PJ1A 3D7TB 3LKMA 1H1PA 2XKFA 4LRMA 4ZZNA 3FMJA 5M57A 4O7RA 5DEYA 3UDSA 1JAMA 1MP8A 3E7OA 3QQGA 4BC6A 4OTRA 4RX8A 3EN7A 4FL3A 1F0QA 4GFGA 1H01A 1W8CA 3HL7A 5AP2A 1URCA 5EDPA 4DH8A 4IW0A 4EUUA 5KHXA 3WZUA 2I0HA 4JNWA 1JOWB 4CRLA 4GG7A 3G15A 2WQOA 5AM7A 3ZXZA 3A4OX 4AQCA 4YTFA 4MBIA 1MRYA 4E1ZA 5J5TA 3GC8A 4P5ZA 3FWQA 3DBFA 3PVBA 2VWXA 3DU8A 4FTAA 4U0IA 2R7IA 5BPYA 4W4YA 5EM6A 5F1ZA 4BIDA 5HX8A 4KUJA 4AW1A 1KE6A 3I5ZA 4FTOA 2CNVA 3UP7A 4RWKA 4WA9A 5AV1A 1XWSA 3C51A 3E8DA 5LVOA 5HG9A 2GHMA 2QOLA 4HW7A 4K6ZA 1PXPA 3MW1A 2HW6A 2QR7A 3IG7A 3MWUA 4I0TA 3IK3A 4QRCA 2GSFA 5CT0A 1KWPA 4RGJA 2P3GX 3EQDA 3TEIA 4O2ZA 4X2JA 4E5AX 4EBVA 3BEGA 4D4RA 1ZYLA 2IVTA 2G01A 5DNRA 1J1CA 3LFEA 3MGYA 2O5KA 4X0MA 4NW5A 4DEEA 1SNXA 1JNKA 2JFMA 3P08A 4A9TA 2BRGA 3REPA 5IQFA 5BQ0A 2J6MA 2PZRA 4L42A 4IBMA 4V0GA 3HMMA 4A06A 4C35A 4FV8A 4FSUA 5BVWA 3QTQA 3A7JA 3E62A 4USEA 5M55A 4UALA 4QP8A 4GT4A 3ORMA 2PULA 3BYOA 1T46A 3HMNA 3AOXA 2VWWA 3OWLA 2PE1A 4S33A 4RC2A 1YI6A 5GZ9A 4XV2A 5G6VA 4RJ6A 4RQKA 4Y85A 4ERKA 3EQFA 1FGIA 2GNFA 3GXLA 2IZSA 4GEOA 4O0XA 1WAKA 5LMKC 2B55A 3QRUA 3RM6A 5ITAA 4QDEA 5CSVA 4PNIA 5HI2A 2PVNA 2GU8A 3CY3A 3VN9A 1Q61A 1YXXA 2QI8A 4EQCA 3AC4A 4UMPA 4AACA 3HKOA 4LG4A 4PDYA 2AC5A 1QPJA 3Q60A 4ASXA 2QOFA 4DEIA 3RTPA 3UYTA 2VD5A 4E8AA 4CG8A 4RG0A 2WEVA 2QOQA 4D9UA 5ANOA 4FL1A 3TYKA 4PWNA 1TQMA 3PXRA 2W5BA 4MTAA 4KIKB 3FXZA 3E92A 3TWJA 2XK8A 2GTMA 4K8AA 5CVHA 4ZY6A 4BGQA 4C4GA 4QP2A 4GV1A 4EJNA 4EOPA 3CQUA 3NYNA 5E8VA 1ZYDA 1Y57A 2XBJA 1JLUE 2EXMA 5BYLA 3N4VA 2VX0A 4AP7A 4AW2A 3RAWA 4BKJA 2GDOA 5AV3A 4BL1A 5EFQA 4O7LA 3CKXA 2XM8A 4QD6A 3QTWA 5T3QA 4V05A 3CD8A 3SXFA 3F3WA 2XEYA 2WMXA 3UOLA 3VJNA 4GK4A 2WNTA 3RPOA 1OI9A 4C4IA 2JD5A 5BVOA 3R9RA 3GBZA 4EEVA 4ACMA 2R0UA 1R78A 4OAUC 1FVRA 4UMUA 3IQ7A 3OY3A 3A4PA 5BUJA 3WF6A 1R0EA 4DGGA 2BMCA 1UKIA 3SXRA 2QO9A 3GUBA 4JAJA 2ZYBA 2R64A 4Y83A 4F9YA 4EJ7A 2F9GA 3GU7A 3FLZA 3FMLA 4JX7A 4XEYA 3NFFB 2VGOA 3NZ0A 4W8DA 2HOGA 3OWPA 3T3VA 2W0JA 4IX6A 5H9BA 5KO1A 1P2AA 5CALA 1XMLA 4DFYA 4WSYA 3UZPA 1KOBA 3QQJA 4XMOA 3NYVA 1IG1A 2J90A 2XMYA 4U81A 5GJGA 3W18A 4YP8A 5L2SA 3VBVA 1OPJA 4PY1A 3N9XA 5KHWA 3PPJA 2GFCA 3LM5A 1QPCA 3RCDA 1HOWA 2XKEA 3C4FA 3MI9A 4C02A 4L3LA 4CV9A 1ZOEA 2G1TA 4RWIA 1TQIA 4C4JA 3FHIA 3P5KA 3QC4A 3FZSA 4AFJA 4AZWA 2LGCA 4DH1A 5C4KA 3UDZA 2OIDA 4DCAA 3B2TA 4FK6A 4KIPA 2O64A 4EORA 4AXDA 3TNQB 4TYJA 1R3CA 3MFRA 3O2MA 1U5RA 2R3KA 1M17A 1FINA 4B0GA 3QALE 3FKLA 2A4LA 2YEXA 3W2SA 1W2FA 3ALOA 3F5GA 3IS5A 3OZ6A 4R7IA 4RVMA 2BRNA 5HE3A 2ZB0A 4XRLA 3PXZA 3SW7A 1GNGA 2GHLA 4CRSA 4FSQA 3Q04A 5D12A 3DLZA 3Q96A 3W10A 3NFGB 3AMYA 3OOMA 4OAVB 2CJMA 5GJDA 4BTJA 2EB2A 5CZHA 5G1XA 4HJOA 4LUDA 3R9NA 4L53A 2P55A 2X0GA 2QO2A 2YACA 2G9XA 3F5PA 3IW5A 4MBJA 4QTEA 2FYSA 5IA3A 1S9IA 5HIDA 4YSJA 5B2KA 2W1ZA 3G0EA 5IQIA 1JPAA 1PXMA 2BHHA 4QP7A 3VHKA 3OVVA 5AUWA 2WTCA 3L8PA 3QRJA 3EQHA 5K0XA 3OCBA 3MFSA 5I9UA 2ZVAA 4B4LA 3KREA 4BKZA 3U9NA 1XH4A 1YWVA 5AFVA 4FNXA 2OF2A 4J96A 2UW3A 4G3DA 2DQ7X 1PXNA 2E9NA 5ANDA 4AGWA 4E4MA 4APCA 4EOJA 2BDWA 1GIIA 4I21A 2OI4X 4RJ3A 2ITOA 4M69A 4O6LA 3E8EA 4S2ZA 4D4VA 3FI2A 4TXCA 5IQHA 5HCYA 3D5WA 4KIKA 2C3JA 4FT3A 4FZDB 3VS3A 3UNKA 3V5QA 5CAUA 4YLKA 3MB6A 5DR6A 2HIWA 4U8ZA 3V6SA 2W7XA 3E3BX 5KMNA 4CZUA 2Z7LA 4CMTA 3TTIA 4GK3A 1Y6BA 3DBQA 4FYOA 5ANJA 1FMOE 4XNEA 3GCVA 3PA3A 4BJJA 2J4ZA 4FVPA 3OWJA 5C8KA 5CEMA 1KSWA 4O21A 5DR2A 5KBQA 3D2KA 4O7NA 4CTCA 2P2IA 5J7BA 2JLDA 4IVCA 2B0QA 3DJ6A 4HCUA 3R00A 2B9HA 4PP7A 1DAYA 2E9UA 2GMXA 4J7BA 3RPVA 3IDPA 3OCGA 3BGZA 5DGZA 3D2IA 3I7BA 4Q9SA 1VLRA 3CQEA 4PTGA 5E92A 5BVNA 2C6DA 3ORKA 4PMSA 1LEWA 4FX3A 3R22A 5CTPA 3OCSA 4CCBA 2P4IA 4AN3A 3KB7A 3U6IA 3RGFA 3GQIA 4ZS0A 1GIHA 1ATPE 4IMYA 3C0HA 3KN5A 2QC6A 5I4NA 3SXSA 3W16A 2I7QA 2HY0A 3RI1A 4D2VA 3FSFA 3N4UA 3VONA 3E64A 2A19B 3AT2A 4EKLA 4FKSA 4ASZA 3UBDA 2WOUA 3IDBA 3I81A 5ETCA 3R04A 3QYWA 3BV2A 4Y73A 5HGIA 5TF9A 3VRYA 5AP3A 5HIBA 4NU1A 3A61A 4M12A 3DXPA 4JT3A 4UZDA 3OD6X 3U9CA 4ZJVA 5TOZA 3KA0A 3QX4A 4M67A 5CI6A 3F3UA 4A9RA 2ITNA 4FG8A 1J7UA 2HENA 4ZJIA 5DIAA 1J7IA 4E93A 5AX9A 4B8MA 4YTCA 5IH4A 4TPTA 3TT0A 4Y8DA 4L01A 3TM0A 2BZKB 1EH4A 4LV7A 5J9LA 3F61A 2PY3A 4BB4A 3R7VA 5KNJA 2XAMA 2C6MA 4EOSA 2PVHA 3KCFA 5FEEA 4ZTQA 2QQ7A 3DDPA 4AZEA 1H1QA 3O0GA 4AZVA 2F49A 4D1SA 3ZFXA 4K9YA 3T9IA 4D28A 4WBBB 1Q3WA 3MA6A 4C33A 3ZU7A 3HNGA 3QU0A 2FUMA 3ZO4A 4K0YA 5HCXA 3UQGA 3FSKA 3MVJA 5FQDC 1UV5A 3FLYA 1M7QA 4I3ZA 4OUCA 1XBBA 2VTQA 2YISA 4ZS4A 3QZGA 4IM2A 4G5PA 3TJCA 4KBKA 2OW3A 2PMOX 5E8TA 2PVYA 3R71A 5TO8A 2YM7A 4KRCA 3F7ZA 3UO6A 4E73A 3UP2A 4ZY5A 3VRZA 2EXEA 2XB7A 4B99A 2Q83A 3HRFA 2DUVA 4E6CA 5AAEA 1P4FA 3HAMA 3CIKA 3FQHA 5CF8A 2UW9A 2OZOA 2C6KA 1SVGA 4I5PA 3ORNA 2X2LA 3FBVA 4EZ3A 4WRGA 1AD5A 3WZEA 4DGLC 4RIXB 3P5JC 5GINE 3UC4A 3CTJA 4ANOA 3KVWA 3EQIA 4DG3E 4JL9A 3NW5A 3N51A 3ZCLA 2BAQA 2WTIA 3NUUA 4UMTA 1IRKA 4C62A 4C8BA 4BBEA 5KMLA 3W0PA 3AD4A 4RQVA 3Q9XA 3CPCA 4QMYA 3P7BA 2PZ5A 4TYIA 2CKEA 4XX9A 2C6LA 4RIWA 5DHJA 5E8YA 4DE4A 2PZPA 4LGHA 4NM7A 4NIFA 2QLUA 4ITHA 2PVFA 3ZM9A 3FY0A 1JSUA 3GCUA 4HPTE 3ZRKA 5EHLA 4YJSA 5HZNA 4X3JA 1PRYA 3FXXA 2OFUA 3GT8A 3Q5ZA 3SG9A 4QPAA 5EQEA 4JDJA 3HGKA 3CGOA 2UVZA 4FV9A 3HRBA 4GJ3A 4XG3A 3ZUTA 5M06A 4GW8A 3KXGA 4DFBA 1VJYA 1UU7A 3LFBA 1J91A 4TWPA 2VTPA 3OBGA 2ITVA 4H3PA 2EXCX 3NUNA 2WHBA 1GZOA 4D0XA 4PMMA 3C5UA 2J5FA 4UXQA 3ZH8A 4Z3VA 2P33A 3KQ7A 4IZYA 4TYEA 5JZNA 3HRCA 2R3NA 3P1AA 1G8SA 2Q0BA 5GIOE 4DFNA 4EHVA 2WFYA 5KBRA 3TKUA 2E9PA 2C5YA 2OKRA 3DAJA 3PYYA 4B6LA 4KSPA 4YHFA 1H26A 4X2FA 2X81A 4UMRA 4RX9A 5AX3A 2DWBA 5M44A 4FTUA 4HOKA 5HVKA 4BI1A 4MXOA 4GS6A 3S95A 1TKIA 4BCMA 4BGHA 4DDGA 4RFZA 2UZNA 5JSMA 4B8LA 4O86A 3PSBA 3Q2MA 2O65A 2Y6MA 5C1QB 5T68A 4O0TA 2ETMA 3I7CA 3LFNA 4KIQA 2XKCA 1PYXA 3Q6WA 5IG1A 5L8JA 2ZM4A 4BHNA 4RVKA 2VTSA 3CR0A 3DQXA 2W4JA 4Q9ZA 2YDJA 4MYGA 4BI0A 1UA2A 4IHPA 3WF9A 4FA2A 2YHVA 2OO8X 1YVJA 2ACXA 3PIZA 3R7GA 4JQ7A 1CMKE 5HORA 4GFOA 3W2CA 5HLNA 5HQ0A 4IANA 1H1RA 2BILB 4PL5A 3ETAA 2WU6A 4RWLA 4ACCA 4AOTA 5I3RA 3RZFA 1M2PA 3QTZA 2XKDA 3ORPA 2X1NA 4DFUA 4CSVA 4R78A 3PIXA 4AXAA 4QMZA 4NT4A 4GL9A 5J1VA 3RBWA 4KWPA 3ULZA 1WVXA 4Y5HA 4YZDA 3K3IA 4XCUA 4X2GA 4EHEA 5HU3A 1SMHA 3SRVA 2V0DA 4TYHA 1PXJA 3DDQA 3H30A 3U4WA 4WNOA 3UTOA 3MS9A 4GU6A 3BPRA 4QP9A 3QA0A 5FD2A 4BDCA 5F95A 4YJRA 4Z7HA 4DLIA 4H39A 4TT7A 5FXQA 4F6WA 3W0QA 2ETRA 2WD1A 5EKNA 4Q2AA 2XNGA 3NYOA 3ZHPC 4LI5A 1SNUA 4TZRA 4D55A 3TNPC 3NUSA 2WMAA 4X2KA 1Q4LA 3R28A 3UOJA 4E7WA 3BEAA 3V5PA 4A9UA 4ZTRA 3LFAA 5A6NA 3EWHA 1FMKA 4G6NA 2YDKA 3ODYX 4BCJA 3CGFA 3SAYA 2W1FA 3LPBA 4V0GB 4MXAA 4AF3A 1VR2A 1AQ1A 5CEQA 3PUPA 4WT6A 5M4CA 4ZP5A 2UZOA 4A9SA 3O96A 4C36A 3HVCA 4IQ6A 1VYZA 3FZTA 4LFIA 5KMMA 5LMAA 1ZRZA 4L43A 5HNGA 3OUKA 1S9JA 2IZRA 3MTLA 4G3GA 4DTKA 4KIOA 4KD1A 5JMSA 2BAJA 4IWDA 4O4EA 1LR4A 2QKRA 2UZVA 4F9WA 5IQDA 3F2NA 1CKJA 4C58A 1CM8A 5ACKA 1OL6A 5JFSA 1PMVA 1YW2A 2XRUA 3I1AA 3COHA 3RWPA 2PUIA 3ZRLA 1YWNA 3CLYA 3D5XA 2XJ1A 3NIZA 3FPQA 1G8KA 4MF1A 3PSCA 4DFZE 3V3VA 4JDHA 5L6WL 3IDCA 4YO6A 2VWIA 4HYUA 2QOIA 5FXRA 5CU0A 4M0ZA 3TKIA 4CQGA 4IEBA 3PFQA 4O0VA 3DK6A 3TKHA 3QWJA 2RFNA 3ZUVA 3WZDA 3QTXA 3BU6A 4RBLA 2YM6A 4DH5A 5J79A 4MNEA 3UOHA 4UXLA 2QOOA 2X4ZA 5HTIA 3JXWA 5I5ZA 2VO7A 3DCVA 2R5TA 2Y4IC 1YXVA 2QVSE 2YABA 3AT4A 1W82A 3ERKA 3KF4A 1BI8A 4J8NA 1H27A 3FE3A 4JDIA 3QKMA 4F78A 3RPRA 3V6RA 4S30A 1JSVA 4X3FA 3MH3A 3V5TA 4DEGA 4DCEA 4FKLA 1Y8YA 4ASEA 4C4FA 3VS6A 3FI4A 4FT9A 4PTCA 3KIOC 4JIAA 5E9EA 2XCKA 2FSTX 3WE4A 5A46A 5L2WA 4FKVA 3OHTA 5E8WA 2X39A 4WUAA 4AAYA 3A7GA 4O4BB 3MH1A 3R8PA 2GNGA 3HUBA 2HELA 3QA8A 2Y4IB 3A8XA 1FQ1B 4X7QA 4F6UA 4FV3A 3CBLA 3O8PA 3GVUA 2WMRA 5DA3A 4F9CA 3NDMA 1CSNA 5TR6A 4CFWA 4G16A 1MQ4A 4PV0A 5IISA 3ORZA 2WMUA 3KXMA 2WZJA 4U97A 3D5UA 3UMWA 3LE6A 2HXLA 3BIZA 3HV4A 3PY0A 2VWZA 2ITPA 2WTDA 3AC2A 3NWWA 3OXTA 4ANBA 4UWYA 1R39A 4YR8A 4H1MA 3Q4ZA 2YCRA 5LMBA 5FRIA 3S3IA 3TACA 3PA5A 5EM7A 2CKQA 2JBPA 2NPQA 4CYJA 4AAAA 1XH8A 5C27A 1E1XA 2IW9A 1PMEA 3E8CA 5I9YA 1PY5A 4QNYA 2RG6A 1QPEA 4CFMA 4BIEA 2AUHA 4WNPA 4M7IA 4M8TA 4RJ4A 2C69A 4Y95A 4AQKA 2RFSA 3BE2A 4YJPA 4ZEGA 4LMNA 4HZRA 5D10A 2GNJA 3PVWA 4OT5A 3VHEA 3IKAA 4YUQA 3R01A 3SD0A 1U4DA 5KMIA 3FUPA 3DT1A 1ZOGA 3OW3A 3EFWA 2C6OA 3QKLA 5AP5A 1UVRA 3SW4A 1ZMWA 3GCSA 4CKIA 3AC5A 5KCVA 4DF3A 1ZXEA 3OUNB 3BL9A 4E4XA 4FF8A 3BHYA 4R3RA 2UZTA 5JGAA 1BX6A 1V0OA 3H3CA 4YJTA 4BDAA 3QX2A 3I0OA 3HP2A 5EI8A 1OM1A 3QBNA 1OL2A 1DS5A 3COMA 1SVEA 3DKGA 3HLLA 4DINA 2WMBA 3R21A 2JDVA 4O84A 5TKDA 5JGBA 2LAVA 2OK1A 2X7OA 4ZSGA 4P4CA 3GI3A 2HZNA 4DTAA 2YIYA 1PHKA 3P0MA 3TNWA 4DH7A 3R8UA 3BX5A 4U80A 2IVUA 3ULIA 4NH1A 1YXSA 3QRIA 4XG4A 2HW7A 2PK9A 5KMOA 3NUAA 4EYMA 2XA4A 3IPHA 3F6XA 3RWQA 1F5QA 2RFDA 1OB3A 5AP0A 4BTMA 3OXZA 3C4CA 4M69B 2YIRA 2VN9A 3UO4A 3GFEA 1YWRA 1IA8A 3VS4A 1OVEA 4NSTA 3GB2A 3E63A 2WTJA 3PVUA 2J50A 3SLSA 2BR1A 4CT2A 4RX5A 5IA4A 4FTJA 3W1FA 5FM2A 3A7IA 3CS9A 4OTQA 4BDBA 3SA0A 4DTBA 4DDIA 4QMXA 1ZY4A 1H08A 3ZBXA 4AW0A 2ZAZA 2IZTA 3UQFA 4FSMA 3P86A 3PXFA 1H00A 4G1WA 5HE2A 3WF5A 3LFQA 2RL5A 4FSNA 5BVKA 3NW6A 3RM7A 5M53A 1XR1A 2PVRA 4DC2A 1OBDA 4OT6A 1E1VA 1ZYCA 2CGVA 2JC6A 2WIPA 3PWYA 3TL8A 3NSZA 3H9FA 4IAYA 4YHJA 2WTWA 1H28A 3ACKA 4USDA 1PW2A 4TWOA