3ALNA

Crystal structure of human non-phosphorylated mkk4 kinase domain complexed with amp-pnp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
307
structure length
270
Chain Sequence
SSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQYDVRSDVWSLGITLYELATGRFPYPKWTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 4
publication title Crystal structures of MKK4 kinase domain reveal that substrate peptide binds to an allosteric site and induces an auto-inhibition state
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 270
sequence length 307
chains with identical sequence B, C
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3alnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3alnA01
2XZSA 4PY1A 4C57A 3NMUF 2YIQA 4FEUA 3WF6A 2XKFA 2YDKA 3PRIA 4QNYA 4AT5A 3PPKA 4RX8A 2BTRA 4TNBA 4ZJVA 3UBDA 1A9UA 4G16A 2BHHA 4QOXA 5M57A 4BBFA 4WSYA 3BX5A 4RFYA 5HHWA 3QA8A 1TVOA 2PHKA 4DG2E 5GJFA 3H9OA 4D2RA 4M97A 1PY5A 5EYMA 1RW8A 3LFQA 3ZO1A 5E8ZA 3U6HA 3RWQA 5CXZA 1KE8A 4NM0A 3QD2B 2UZEA 2CCIA 4Z3VA 3F2NA 4E5BA 4YSJA 4K8AA 4NCTC 4NTTA 3I6WA 3DBEA 2PVRA 2HY0A 3PE1A 5LMKC 4IZ5A 2XM9A 2ZM3A 3GB2A 4TNDA 3BHTA 5HU9A 1XH5A 4KKHA 3E62A 4MXAA 3UPXA 4EOLA 5CU3A 1KE7A 2VTTA 3EQIA 5DR2A 3WILA 4ANBA 3NR9A 4JBVA 4XOYA 3MYGA 3UP7A 4QMXA 5CI6A 4MXXA 3EOCA 4MNEA 2YLEA 2X8IA 3VUKA 1M2PA 3GCPA 4O0TA 1WMKA 4YTCA 1WFCA 3BYUA 4FOCA 4F1MA 4A9SA 4HZSA 4B6LA 4RLKA 3UIXA 3DZQA 3G90X 5M06A 3C0IA 2BAKA 2FO0A 5D1JA 2ZDTA 4BKJA 4YJUA 3KL8A 4I94A 1FMKA 4LFIA 4AN3A 1FQ1B 2PWLA 1Z57A 3D7TB 3BLHA 5CVGA 4QTEA 3VRYA 3NWWA 5K0XA 4JI9A 4KIPA 4BIDA 4DH1A 2JIIA 1APME 3CPBA 4ACMA 4U44A 4F0GA 4P5QA 3W18A 4MF0A 2HENA 1SNXA 3A8WA 4PQNA 3R7GA 5LCJA 2CGVA 4J52A 4DGMA 3PXRA 5H9BA 3NNWA 3SDJA 4D5HA 3FKNA 4AXAA 5FG8A 3ZUUA 5JFSA 1OZ1A 3ROYA 3R8MA 4B4LA 2R3FA 5AP0A 4TL0A 2R3LA 1V0PA 5GZ8A 5I9XA 4BY9E 4V01A 3QRJA 4LV8A 2XK3A 4EH4A 3II5A 3G51A 2C6TA 2YWPA 4KRCA 4FI1A 5IQEA 3ZUTA 4E5WA 2R0IA 2ZMDA 2GS2A 2QHMA 2QG7A 3UQGA 2JKQA 4CZYB 4F99A 4ZTSA 4FA2A 3BWFA 4C36A 4O22A 4GT5A 1KWPA 4L44A 5I9UA 4D0XA 4CYIA 1WBTA 3MVLA 3O71A 2HWOA 4O86A 3RWPA 4OTHA 4G3CA 3JY0A 4NEUA 1WBPA 4ANOA 4ZY5A 3AOXA 2F4JA 5HLNA 4ANNA 4PL5A 2W99B 4FKPA 2X2MA 4MKCA 3P9JA 4ACDA 1UNGA 3FMDA 3PA4A 4FV6A 5AR2A 2BVAA 4M69A 2VX1A 2B1PA 2HY81 1P4FA 3QWKA 3TT0A 4AAAA 2BIYA 2HYYA 2V7AA 1AD5A 4D2PA 2W06A 3AD4A 3IW6A 2XVDA 4FEXA 2UW0A 4KIKA 5KBQA 2PE0A 3SXFA 5A6NA 4DFYA 2OZAB 4QMNA 5EKOA 2YM7A 2XIRA 4AFEA 2WEIA 1YHSA 2W4KA 4I6BA 3DK6A 3H9FA 4ANLA 5IUGA 2XIKA 4R78A 2C6EA 4TYIA 5F4NA 5H8EA 2YCFA 2X7FA 3A7HA 2BZHB 3IDBA 5A4LA 3UO5A 2VWBA 4J8NA 2HCKA 1UA2A 3QL8A 1XBAA 2QI8A 4IFGA 4G6NA 5CVFA 1YXUA 4Y73A 3HDMA 3FMEA 4MXYA 2XBJA 3H3CA 5L6PA 2PTKA 3Q6UA 3LXNA 3SOCA 1JKKA 2I6LA 5LOHA 3PRFA 2HW7A 5EH0A 3ORLA 5E92A 3L9LA 5A46A 4HGLA 2BCJA 2J5EA 1XHAA 5EDPA 4LOQA 5T3QA 3RZBA 1OIYA 4UWYA 5DYJA 2PMLX 4CGAA 3OW3A 2J6MA 3KB7A 5A4TA 3A8XA 4Y5QA 3R1NA 1MRYA 3TTIA 3NVKI 5EYKA 2UUEA 4AT3A 4CQEA 4FGRA 2B0QA 3NW5A 4U42A 3FPMA 3GCSA 3D5VA 1F3MC 3JS2A 1FVTA 1PKGA 2GNIA 3Q04A 3R7EA 4FSQA 2CMWA 3LCTA 5JMSA 4MD7E 4ENYA 1WVYA 5JK3A 2GTNA 4RPVA 2IPXA 1PXKA 5HLWA 3QTWA 3W8QA 2GQSA 3HA6A 2UZWE 4BL1A 4NJ3A 2B9IA 2B9HA 4OTFA 4WHZA 5EG3A 4L43A 3ZFXA 3FL4A 3LJ1A 5HG9A 3FXZA 3ULIA 3FJQE 5I9WA 4PMPA 4XRJA 2ZM4A 2XK6A 4O7YA 3BELA 2RG5A 3ZBFA 4RWKA 1K2PA 2VV9A 3VQHA 3U55A 3CBLA 4I4FA 4KS8A 5DPVA 2H34A 4JIAA 4NYEA 4O7RA 5HQ0A 2GNLA 4S34A 2GNFA 3MVJA 4ZTQA 4NWMA 4DTKA 2QOIA 4AACA 5BVWA 2Y4PA 4AT4A 2IW9A 1JKLA 1WVXA 4ZY6A 2PUPA 4DTBA 1JLUE 3I60A 4UN0C 3MY5A 5EOLA 3B8QA 4GU6A 3ZU7A 5AV1A 4EHGA 5EFQA 1TQIA 4EOKA 1LUFA 4HNFA 5HLPA 1GOLA 4U5JA 2HZIA 4C7TA 4DFUA 1G3NA 4F4PA 4FK6A 3F7ZA 2OBJA 5AM7A 1XWSA 1KE9A 3PVUA 3QHRA 3UJGA 1OL7A 1Q61A 1CDKA 3HRBA 3I79A 3EQCA 5KHXA 3C7QA 2BTSA 4X3FA 3D0EA 3GQIA 3KEXA 4FTKA 5KE0A 3UNJA 3W2PA 1PRYA 2CNVA 3O8UA 3RGFA 1QPDA 3Q53A 5L4QA 2OH0E 5AP2A 4YJPA 3CKXA 5CU4A 3WZDA 1XH7A 4OR5A 3IGGA 3E8CA 4Z9LA 4IAIA 4BKYA 3JPVA 4R5SA 2VTOA 4KSQA 4FIHA 5LARA 3RINA 4E4MA 1XBCA 5EI8A 3HV5A 3F2RA 5FBNC 3SG9A 3D2KA 4K33A 5IMXA 4WIHA 4O7TA 4O7LA 3DAKA 4FSTA 2NRYA 2RFNA 3IONA 3LCSA 2OJ9A 3NCZA 4OTRA 2OLCA 2OZAA 3G5DA 3LJ2A 5J1WA 4I3ZA 1H4LA 3W2SA 2JFMA 3OBGA 4MNFA 5LVMA 3PY3A 2ZV7A 3SRVA 1GJOA 3GU5A 2R9SA 1M7QA 2C47A 4FKSA 2W1DA 3T3UA 3OY1A 2PZIA 3UMXA 3P4KA 2YITA 4L52A 3MS9A 3ORKA 4IJ9A 3ZONA 4GFOA 1ZOHA 4BDAA 5C8KA 4JDJA 2W17A 1Z9XA 4F7NA 2QNJA 4BIBA 4GK3A 1QPEA 3N9XA 4XUFA 4E1ZA 4GFGA 4RVMA 2OO8X 4JS8A 3KXZA 4L46A 4IAAA 4ALWA 3FPQA 4CV8A 4B8LA 4BDBA 2QVSE 3UC4A 5EM8A 2QKWB 4XX9A 5BMMA 3VS0A 2VZ6A 3GBZA 4C4JA 4YNEA 4DF3A 3OXIA 4I6QA 4FTMA 1YDTE 4F1OA 4BR3A 1DS5A 1OMWA 3OS3A 4RJ5A 4PRJA 2XNNA 3OD6X 4NUSA 4BTJA 4EC8A 5HD4A 4ZTHA 2YDIA 3EIDA 3LPBA 4IB3A 1UNHA 4QMYA 5EDQA 3WE4A 4BGGA 1BKXA 2FH9A 4H58A 2O65A 2YJSA 3OBJA 2YCQA 3O8TA 2G2FA 3KRRA 2G9XA 3VWAA 1H00A 1JOWB 3K5VA 3I4BA 5AUXA 2C5OA 4KS7A 3R9DA 3T8OA 4D58A 2OIDA 3QTUA 4L01A 2CNQA 2IZSA 3U4UA 2OW3A 4YHJA 4UXLA 3EZVA 3R2BA 4E6CA 1W98A 3HAVA 3V5LA 5C03A 3RM7A 3IKAA 4BZNA 1KSWA 1W7HA 3MY0A 3OCSA 3VIDA 4L9IA 4DFZE 3O50A 4AZWA 5I0BA 5IH6A 5LVNA 2VX0A 2VTQA 3D4QA 4OTPA 4AA4A 4TYGA 2ZOQA 4AQCA 1O6KA 3GT8A 3PXZA 4A7CA 3ZZEA 1T46A 1WBSA 1ZZLA 5DMZA 4AWIA 2PZYA 4U80A 5K4JA 3DPKA 4IBMA 1JNKA 2H8HA 2Z2WA 3FI2A 3PA3A 5G1XA 3RAKA 1A06A 2ETRA 5D12A 1OECA 4MVFA 3FMJA 3NUYA 3BE2A 5L2WA 4RJ6A 5CU6A 4GT4A 5AIKA 3GNIB 3QKKA 4HGTA 4FVQA 3MDYA 3RMFA 4F9YA 4K6ZA 4PP9A 2WTKC 2C5VA 3R9RA 4LRMA 2J0JA 1QPJA 3I1AA 2P33A 3RPVA 2ZM1A 4AE6A 5LMBA 5AADA 5KMMA 1FVVA 4BGQA 2C6KA 4H1JA 3MH3A 4MF1A 2REIA 4R3PA 1FGIA 5DLSA 4GKHA 3OCTA 4BI2A 2HZ0A 3U87A 3FKOA 4D4YA 4HPUE 3OXTA 5J95A 4AF3A 1P14A 1IAJA 3AC8A 5CQUA 2Z7SA 3AT3A 4M0YA 4DAWA 5DE2A 3KFAA 4LM5A 3OWJA 2ITQA 3ZRMA 1M17A 5TF9A 2X6EA 4CG8A 4LUEA 2E9NA 3NAXA 3QXOA 4G34A 4XNEA 2HXLA 4QNAA 3VS4A 1RJBA 2J0MB 4AZVA 2H96A 3G6HA 1S9IA 3K3JA 1YI4A 4PPCA 2OU7A 2YIYA 4FTAA 5DG5A 2X4FA 5D7VA 3QTZA 5HI2A 1B39A 3DBDA 4A9UA 4AW1A 3CTHA 5AUVA 2VTRA 3DV3A 1OM1A 5HE2A 5EW9A 5J9YA 1JBPE 2WTJA 2YIXA 2F7XE 3ZBXA 4IAZA 4FKQA 4JDHA 4CT1A 4KKEA 5L6WL 2CHLA 3AC4A 2P4IA 1ZRZA 2V0DA 3EZRA 4G5PA 3KN5A 5A3XA 2ZB1A 5DBXA 2JDOA 5HCXA 3F5GA 5L2TA 4ZSJA 3C5IA 1Q41A 4X3JA 3ZHPC 2YABA 4IB0A 2EXEA 3E88A 3RPYA 5AV0A 3ZOSA 4CFUA 2XJ2A 4AOJA 2QLQA 5E8YA 4XG4A 2OSCA 5FBOA 4DT9A 2WQEA 4BWKA 4ZLOA 4C3PA 2UW3A 1B38A 3A7IA 4K18A 4EQCA 3PDTA 1HCLA 3DGKA 3VBTA 4ORKA 3ZC5A 4YJOA 3MGYA 5H3QA 2X2KA 4RJ3A 2VO0A 4RBLA 5HVKA 5IH4A 1JKSA 2OFUA 4X2JA 3PY1A 3TNQB 5L8JA 5DWRA 5IQBA 3PIZA 5CNNA 1L3RE 1OIRA 2OXYA 3P86A 2W96B 3AD5A 3NDMA 4CFXA 5HTCA 2XNEA 4EI4A 4HVSA 4X21A 3V3VA 1ZY4A 4YTFA 4EORA 5F94A 5C1QB 2OZOA 3DBFA 4I20A 4IWPA 1VYZA 2VTHA 4O0YA 3DQXA 3KCFA 5HTBA 1OIQA 3WZUA 1GNGA 3BV3A 5B7VA 2Y4IB 2YA9A 3EFWA 3NAYA 5E90A 3KXXA 3I7CA 5DT3A 5EW8A 1YDSE 3LOKA 3ZLXA 4PL3A 3NIEA 5HE0A 3GU8A 3LFFA 3POZA 3QCSA 4LI5A 4U79A 3GXLA 4P2KA 4DEHA 4L53A 5AA8A 5CAUA 5HVYA 4DCEA 3V6RA 4KUJA 2WTDA 2I40A 4WNOA 3NUXA 4D28A 2I0HA 4FG9A 3KK8A 2C6LA 4WG5A 4O81A 2Q83A 5HEZA 4EH2A 2F7ZE 3RBWA 4QP7A 2VTPA 3ZYAA 3CIKA 4XG3A 3RAIA 4MYGA 4O7NA 3N4UA 5L2QA 1IG1A 3KVXA 3DB8A 3OZ6A 4NIFA 5AR7A 3VUIA 1RQQA 5ICPA 3U51A 4CQGA 4EUUA 4GL9A 2YIRA 3LE6A 4RZWA 4OAUC 2BILB 3TNHA 5C8NA 4CEGA 2X8DA 2HW6A 4KKGA 3C13A 1QMZA 5BVOA 1UU7A 2R7BA 3L9MA 4YP8A 1XH6A 2R3IA 5B2KA 4BKZA 4D1SA 4HPTE 3NW7A 3LLAA 4L45A 2ACXA 3OF0A 5AUZA 2JIVA 3WF7A 5CNOA 2O3PA 4KWPA 1G5SA 3F61A 4KSPA 2C6IA 3R7IA 1GAGA 4Z7HA 3VAPA 2P0CA 5CU0A 4EH7A 3VUHA 1CM8A 3AT4A 1YI6A 4Y46A 4ZSEA 3ATTA 3R8LA 2JLDA 4K0YA 2HWPA 4QMPA 2EUFB 2C5NA 4DYMA 4X2NA 3VW6A 2VX3A 2B7AA 3F3VA 3CJFA 3EN5A 4J8MA 2YEXA 2BRNA 3E93A 1OUYA 3MH1A 3KREA 1KV1A 2J0IA 3LFSA 3BEAA 3LCOA 2BUJA 4XP3A 1UWHA 1GZNA 3VW8A 3C51A 4TKSA 4CMUA 4JBPA 2QO2A 4U43A 5E8VA 1CKPA 3CTQA 3AT2A 4FTNA 4L6QA 3R83A 4GCJA 3R8ZA 3QRUA 4Y72A 4Y5HA 4DBXA 2LGCA 5C4KA 3IDCA 4CFVA 5FDPA 1UWJA 3ODZX 4IVAA 4AA0A 4C34A 3RVGA 4O84A 4BDFA 3PSBA 3HV6A 1WBWA 2IWIA 4MWIA 3S1HA 4EZ7A 3OY3A 1JSVA 5M56A 3CSVA 2GPHA 3U9NA 3KULB 3DQWA 3FMMA 3P08A 4ITHA 2BRBA 3DB6A 4HVHA 4DGGA 2XK7A 1E1XA 4EJNA 4QTAA 4OW8A 4RA4A 5AR8A 3FAAA 5LQFA 5D10A 3IW4A 2PZRA 4LRJA 2VTSA 5IA1A 4ITJA 2OXDA 5J7HA 4JAJA 5BMSA 2RGPA 3HVCA 3HV7A 4QT1A 5C26A 4GYIA 4USDA 3VF8A 3L9PA 2X7GA 4EK5A 3R22A 5HE1A 4L3LA 4X3FC 3QQKA 2C4GA 3T9IA 4ZK5A 4YR8A 5E1SA 3HA8A 3EH9A 5CQWA 4L7SA 5CSVA 4FKGA 2JEDA 3RHXA 4ZY4A 4J97A 2IVTA 2Y6MA 1H1SA 4IDTA 4O0XA 4BDGA 5CENA 1YWVA 3DDPA 1Q97A 2XKDA 4O0VA 3M11A 4RC4A 2O0UA 3AC2A 1NVRA 3OWLA 4YZMA 5E8SA 5FXSA 1GIJA 2G2HA 2ONLA 4C4GA 4EOPA 2OWBA 1H0VA 3GU4A 4NH1A 5ANOA 5K5XA 3G15A 1YXXA 3IPHA 2XK4A 4FT3A 4XV1A 1NXKA 4OTIA 2ESMA 1OGUA 2BKKA 5GINE 2VWZA 3RCJA 4G6LA 3FLWA 1PHKA 4MBLA 4YMJA 5AUTA 3TNPC 4UX9A 2YN8A 4QMUA 5CEKA 5JKGA 2GDOA 3VS6A 2PVYA 5EI2A 3BHUA 2NRUA 4ZLYA 1H27A 3NUSA 2P55A 2ETKA 4EOMA 4D2WA 2PMOX 4OLIA 3QD0A 3MH2A 3E64A 4I93A 3D15A 5D9HA 1HCKA 3PSDA 3OCBA 1Q4LA 4CFMA 3O96A 4UB7A 5CSPA 2PPQA 1U59A 1NA7A 2J51A 3ALOA 3G9NA 1PXLA 3UODA 2NO3A 3LQ8A 4LGGA 4PNKA 5LCKA 1PXOA 4GG7A 5IG1A 4X6QC 5K4IA 4TYHB 2P2HA 4LMNA 3JXWA 3V8SA 1SYKA 4I6FA 3WF5A 3ZFYA 3PIXA 4BDIA 3CGFA 5M4CA 3UZRA 4EQUA 4IZ7A 3KVWA 5C8MA 3UDBA 5M4IA 3DKOA 4FK3A 5F95A 3MV5A 2PL0A 3D9VA 3TIYA 4FYOA 5K3YA 3OT3A 3O0GA 3MY1A 3MH0A 1H1PA 4NK9A 3PA5A 3R8VA 4QD6A 1OPLA 2VTMA 2XF0A 2ZV8A 2C1BA 3MPTA 4CLJA 2VWWA 3CR0A 3D94A 4BHNA 2JBOA 2W0JA 3R02A 5J8IA 3BWJA 3PG3A 1PKDA 3UPZA 1PXMA 2QOFA 2VTIA 4QP4A 1DI8A 3B2WA 4TWNA 3R1SA 1OUKA 4I23A 3A4PA 5DEWA 5L8LA 2PE1A 3Q5ZA 3O7LD 5CVHA 2WTCA 4IX3A 1YQJA 3MVHA 4H1MA 5FXQA 2CCHA 3EHAA 2WEVA 2WZJA 4A06A 5HU3A 4HYUA 4RMZA 2JC6A 3IOKA 5FP5A 4GYGA 3QQLA 1PXNA 4ZEGA 3Q4UA 4QPMA 5LXMA 5AFVA 2CDZA 3FXWA 3UZPA 4I21A 3EL8A 4U45A 5L3AA 3NUPA 4RQVA 5JRSA 4PP7A 4YUQA 5BVNA 4I5PA 4OTQA 4U9AA 1KE5A 4BCHA 2YFXA 3W2RA 4APPA 4K11A 3KRLA 5AV2A 3OXZA 4C4EA 2BDJA 2XYUA 2PVMA 1Q8WA 2V62A 4EK3A 1UV5A 4O96A 1GIIA 5EM7A 5A9UA 4XG9A 3QQFA 3V5PA 4HCVA 1OPKA 3QGYA 2B54A 3FE3A 4ERWA 2IVVA 3SA0A 4K1BA 3LLTA 4MAOA 3E8DA 4N57A 2WQMA 3V5QA 2C69A 3CXWA 4BDDA 3KK9A 3EQDA 4RIWB 3ZUVA 2UVZA 2HZNA 1TKIA 3OW4A 4ZZMA 3ZO3A 4B0GA 5CSHA 5DFPA 2IZTA 4ACHA 5FP6A 3FMKA 5CAQA 4WUAA 3D14A 3TG1A 2QD9A 2XA4A 1XR1A 2X81A 3DOGA 4DCAA 2B9FA 2WPAA 1X8BA 4FSWA 3TL8A 3RI1A 1M14A 4KIQA 3SVVA 1SZMA 3CLYA 1IA9A 4G1WA 3IW7A 2QR8A 4FZ6A 4JDKA 3FZTA 1LP4A 2BZIB 4DFXE 2H6DA 4UMQA 2G1TA 2I0YA 5BPYA 1LPUA 4FMQA 3HP5A 3R28A 3OT8A 2W1IA 4JQEA 4YZCA 1BL6A 4N6ZA 3WI6A 5BX0A 2CNUA 4EONA 4A9RA 3IK3A 3LFNA 4XCUA 1YKRA 5HBHA 4D0WA 5G6VA 1YXVA 4NM5A 1V0BA 3TV4A 5FD2A 3EN9A 3CGOA 3ENHA 3QU0A 4NT4A 4U40A 5DT0A 2VWUA 4FVPA 4QTBA 4TY1A 2FGIA 4XEYA 2RG6A 4DEIA 3BHYA 4N0SA 4FX3A 4FZAB 5KZIA 2UZBA 2XK8A 2X7OA 5AMNA 3L8SA 4L67A 5FEQA 3RK9A 5EDRA 3VC4A 4HVIA 1H1QA 5CF6A 5CYIA 2WFYA 3S95A 3VS2A 4EWHA 2QC6A 5AUYA 4DEDA 4OTDA 4EL9A 4EOJA 4RLLA 3BBWA 3E87A 5KO1A 1FMOE 2QOLA 3AC3A 3P5KA 1JAMA 2VU3A 4JG7A 5TOZA 5ACBC 3CQUA 4JL9A 3UVRA 1H1RA 2UW8A 4XH6A 4YGAA 4L3PA 5ANEA 4MBJA 1LEWA 1YOLA 2CLQA 3F3ZA 3F5XA 4FOBA 1YVJA 3Q9WA 4GRBA 4FKVA 5AAFA 3D5WA 4EYMA 3TV7A 1PW2A 3E92A 1PMNA 3PPJA 3VUDA 1M2QA 2W7XA 3LXLA 4R7BA 3Q96A 4YJQA 3ZRLA 3FC2A 3VQUA 4ZOGA 4BBMA 5CF8A 4DEBA 1PYXA 3H4JA 5M53A 2JITA 2FSLX 4YJSA 2PULA 4G31A 4IC8A 3SLSA 2XNMA 4F65A 4FT7A 4IB5A 3UG2A 3KGAA 3UTOA 4WSQA 1AGWA 3VUGA 4CT2A 1YWRA 2O8YA 3PFQA 4CRSA 5ITAA 5IU2A 3CKWA 4YO6A 2R64A 1WBVA 3LQ5A 5EI6A 4BI1A 4DA5A 2E2BA 4GSBA 2XMYA 4O0RA 3BZ3A 5AEPA 1U54B 2C30A 4HYSA 3JYAA 3RAWA 2IN6A 3RZFA 4GT3A 3QTIA 4OBQA 3F88A 2JDVA 3RK5A 4IAKA 3F5UA 2OIQA 4NW6A 4YPSA 2JGZA 1BI8A 4ASXA 4IX6A 4CFFA 3F6XA 5HTIA 1NW1A 2GQGA 1NVQA 2J2IB 2R3PA 1YI3A 4G9CA 4IWQA 4EZ3A 3MTFA 4WT6A 2WTIA 2XCHA 4ZJIA 3ANQA 5M07A 3NSZA 3FLZA 3MPMA 4FT9A 3L8PA 4EH9A 4BYIA 5GZAA 3TM0A 4O83A 2PVFA 3WZKA 1J7UA 3K3IA 4WA9A 1MUOA 3JR1A 3VN9A 3DJ7A 4NW5A 2HK5A 4QTDA 2W4OA 3QD3A 5L2SA 4YZDA 2FVDA 4YJVA 2RL5A 2XK9A 4R6VA 3OG7A 4J53A 3D7TA 4RJ7A 2Q0NA 3QUDA 3FQHA 4EOOA 4F1TA 5IEYA 2CKPA 4O2PA 5HNBA 4S30A 2RFSA 3SV0A 3AGLA 5AA9A 1YOJA 1VZOA 1LR4A 3NUUA 4MD9E 4NSTA 3MIAA 3WYXA 4PPAA 5EYDA 4C3RA 2EB3A 1XH8A 3QZFA 5CY3A 1BI7A 2KULA 2NPQA 3ORZA 5DA3A 4DEAA 2ITXA 2JIUA 4CV9A 3R71A 4A9YA 5D41A 5F1ZA 3RALA 4D9TA 1EH4A 2YCSA 3AXWA 4O0SA 2X2LA 3A7JA 3P0MA 2OFVA 1H01A 3CQEA 3QKMA 3OCGA 4XG7A 2UVYA 3VJOA 3VBQA 3VS5A 3N4TA 4O0UA 2WTVA 5IQDA 3NNVA 1GZKA 2XUUA 5EOBA 5M09A 1O6YA 2CSNA 4BVUA 4O2ZA 3VUTA 5BVKA 2W9FB 4F0IA 3GQLA 4IANA 4E20A 3IS5A 4GJ3A 4RSSA 3WZJA 4CZUA 3UOLA 4TYJA 2FSMX 5IA4A 3FZOA 4FSRA 3BE9A 4DLJA 4R7IA 5AP5A 1XH4A 2NP8A 4CKJA 4W9XA 1U5QA 3MFRA 4KRDA 1GIHA 4BYJA 3HUBA 1BL7A 4AE9A 2GCDA 5DGZA 4FUXA 2AC3A 5JEBA 4ALUA 3HAMA 5IQFA 4XBUA 3DFCB 5FTOA 3V5TA 1STCE 4FV1A 5DEYA 5GHVA 4W9WA 5EK7A 2LAVA 1REJA 5JGAA 4JT3A 4HJOA 4EHVA 2VGPA 2PMNX 4HCUA 3IW8A 4BDKA 3ID6C 2E9OA 4QP8A 1ZARA 3RNIA 4ENXA 4RX9A 5CAVA 4P4CA 3DKCA 3PVGA 3VBXA 4QMSA 4NU1A 3NCGA 4FSNA 1Y8YA 5CX9A 3ORIA 2XP2A 1DAYA 2ITPA 3BV2A 1P5EA 2ITWA 2WIPA 5KMKA 4C35A 2WB8A 3FEGA 3UNZA 2B53A 2R3MA 3AC5A 3BI6A 2WMWA 4FIGA 3VBWA 4G3DA 4PX6A 1URCA 3OMVA 4RG0A 5GJGA 2EB2A 4CMOA 1OKZA 4FEWA 4YLJA 2PUNA 2JFLA 4BICA 2EXMA 3M1SA 2HELA 1XKKA 3UIMA 2BROA 5ANGA 2ONLC 3P23A 1K9AA 5M51A 3IQ7A 3C0HA 3TIZA 4ITIA 4DTAA 5CSXA 5BQ0A 3RKBA 2C5YA 2E9VA 3QYZA 4V0GB 3WOWA 2FYSA 3Q9YA 5FLFA 5JZNA 4EH6A 5JQ5A 3FI8A 4N6YA 4KBAA 4TWOA 1S9JA 4B9DA 4IVBA 2E9UA 1CKIA 4AGCA 2BDWA 4J7BA 3NUAA 5IQIA 4ZP5A 4EJ7A 4KD1A 4X7QA 5KKRC 3PJ2A 2PYWA 3P78A 3UIBA 2WMQA 4M13A 3TXOA 3MA3A 3ZDUA 1OPJA 2BAJA 2J9MA 3I0OA 4FBXA 4BBEA 5BUEA 2WMVA 4MX9A 3NLBA 3ITZA 4P7EA 4ZSLA 3V04A 2GMXA 5M4UA 1MRUA 4BDHA 3N51A 5EM6A 2QOCA 3UGCA 4ERKA 5GIOE 3KC3A 4EK8A 5BYYA 4RA5A 4QYHA 2J0KA 2F57A 5ETFA 1I09A 3EQPA 3FZPA 3SW4A 4DGNA 4W4WA 4KB8A 2A4LA 3GI3A 5DR6A 1E9HA 3UE4A 2XS0A 4CFWA 3ZM9A 4LL0A 4FV2A 3EJ1A 4FSMA 3VHKA 4O7SA 3HV3A 3KMUA 5CASA 2QOBA 3DBQA 3NYXA 3BBTB 3FLSA 3JVSA 4TRLA 1FPUA 3VUMA 2B9JA 4PUZA 4AP7A 1J7IA 5AR5A 5IQAA 1WBNA 2PY3A 2OJFE 3F3TA 5LWNA 1XH9A 5IISA 3PE2A 2FA2A 4FL1A 3HMPA 3SQQA 3QCYA 4YBJA 5DVRA 2IVUA 3ZO4A 3TUCA 2JAMA 2Z7LA 5A4QA 4FKJA 4USFA 3PYYA 3FLNC 3W32A 2ZYBA 4IIRA 4M15A 4AZTA 2F2CB 3R6XA 5M4FA 4IEBA 3TNIA 3HUCA 2PVKA 4E5AX 5HZNA 4U97A 4X2GA 4O7ZA 2BFYA 4BHZA 4DFLA 4I6HA 5EHOA 3FSFA 4AN9A 2X0GA 3NZ0A 3OWKA 4IADA 4JQ7A 1M7NA 3FHIA 3SKCA 3THBA 3VS7A 4NFMA 4FYNA 3ZM4A 3G2FA 5A14A 2WMUA 4C59A 4FTQA 5HG7A 3O17A 3ACJA 4Q5HA 3MB7A 2ITVA 3U54A 4I22A 1YHWA 3KY2A 5CWZA 4DINA 2YM3A 1UU8A 2A19B 3FQSA 3GCQA 4NCTA 5HIBA 3W2CA 3CEKA 2WOTA 4YC8A 4RVTA 4WRGA 3RP9A 3EQFA 3FBVA 4IX5A 4DFNA 2G2IA 3IGOA 4XJ0A 3PVWA 4AUAA 2X39A 2BIKB 5LVLA 2HIWA 4I0RA 5DIAA 4F6UA 5HBJA 2RKUA 3CTJA 4EWQA 4AGDA 2XJ0A 4I24A 2V22A 4PTCA 5J7BA 2HXQA 4A07A 3V5JA 3QCQA 4Y85A 3A4OX 5KX8A 4QMOA 1Y6BA 3GC9A 4FV5A 4FIIA 4ZSGA 4AS0A 4FTTA 1XJDA 4BCGA 3GU6A 3N4VA 5FQDC 2I1MA 4ZTLA 4FTCA 4W4XA 3C5UA 3QLFA 3MESA 3FDNA 2XIZA 3LAUA 5HD7A 3SC1A 3WYYA 3KRJA 5CEMA 2QQ7A 3E8EA 3ACKA 2PVNA 2EXCX 4FTOA 4I5HA 3Q9ZA 3QUEA 3A7FA 3MVMA 5IA3A 3L8XA 4I41A 3UYTA 1J1BA 4RWLA 4UMRA 3VVHA 4NKSA 4EKLA 3GC8A 4BCOA 5L6OA 2UW6A 4JG8A 3VF9A 4V0GA 3KMWA 3A99A 3COMA 3MFUA 3HRCA 3WF8A 4Z7GA 4I92A 2GTMA 3TACA 5KUPA 5FM2A 4QYGA 3RPOA 5E8WA 2FUMA 4ACGA 3R04A 2I7QA 4L68A 4QP3A 5FUTA 4KNBA 1H25A 1AQ1A 3HV4A 3KXGA 4Q5EA 2A27A 5TT7A 3QD4A 1L8TA 4H36A 4FTLA 4RWJA 2W1EA 1Q5KA 1PMEA 2IW8A 3MI9A 4ONAA 5C9CA 3FY2A 4RZVA 3LZBA 4W8DA 4FR4A 3WARA 5CZIA 4Q9ZA 2Z60A 1KUTA 4LGHA 4D4VA 3TDVA 4CRLA 2QOOA 5HBEA 5AAEA 1T45A 1TQPA 4EBVA 5GJDA 2UVXA 3IW5A 3V6SA 3L8VA 4W4VA 4I4EA 3FMLA 2DUVA 3HZTA 2VTNA 3TN8A 3V8TA 5CF4A 5E4HA 1H26A 4OUCA 4H39A 3Q4ZA 4EK4A 4RGJA 2C0TA 2W1HA 3QZGA 4FF8A 4UYAA 5KNJA 4JAIA 3S00A 2W5AA 4XOZA 2VNWA 1GZOA 2OK1A 1Y8GA 4UALA 1V0OA 2A1AB 3BIZA 4BC6A 5IZFA 4BWPA 3NVMB 1O6LA 1ZMVA 4MTAA 4PMMA 2C6MA 4XG8A 4CCUA 5IA5A 4M3QA 4FGBA 2W9ZB 3BGZA 4ASZA 3HMMA 4JVGA 5E91A 5BVEA 3KRWA 1ZOEA 2HOGA 4FT0A 1HOWA 3MA6A 4GVJA 3DFAA 3BU6A 5HNIX 5ANKA 4OBPA 2GS7A 3CP9A 2UZVA 3H30A 4UY9A 3RHKA 3ULZA 2Y6OA 3E8NA 3IO7A 3EB0A 3OOMA 2RF9A 3VBVA 1R0PA 1JKTA 4FSYA 1ZY5A 3HYHA 3LCKA 4GG5A 1LEZA 3R9OA 5DR9A 4OT5A 1ZWSA 3C0GA 1O9UA 4FTUA 5IUIA 1WCCA 4IWDA 3Q60A 5IF1A 4F9AA 3VRZA 4EOSA 4UMPA 1R0EA 3FMHA 3PWDA 5HOAA 5BYLA 2YHVA 2AC5A 4TWPA 4PWNA 4EYJA 3LFDA 3C4WA 1YRPA 4PDOA 4JDIA 5E7RA 4B99A 3DXPA 3NGAA 3B8RA 2PVJA 4IZAA 2V7OA 4BDJA 3EQBA 5A54A 1ZZ2A 3O2MA 4O1OA 3IOPA 4YHTA 5FRIA 3DU8A 4XMOA 5JZJA 2C6OA 4RIOA 4U8ZA 4HVDA 1W0XC 2V55A 2VTJA 3DK7A 3NRMA 4UWCA 3ZLSA 3QYWA 4S33A 3TUBA 4QQCA 5E1EA 5KMNA 4GUBA 2C5XA 3DLSA 1WAKA 2ITTA 3QZHA 3S0OA 2W4JA 4TT7A 4BTMA 1H24A 3GVUA 4I1ZA 3WE8A 2PVLA 1UKHA 4ZTNA 3R21A 2XRWA 4BZDA 3UVQA 3OROA 3B2TA 3UOHA 5IMEA 2CN8A 5E8UA 2VTLA 3HEGA 3UOJA 3OP5A 1XO2B 1Q3WA 2VWXA 5HO7A 4P5ZA 3HDNA 2XEZA 4I0TA 2GU8A 1W83A 2VWYA 5JH6A 4O6EA 3FV8A 3D7ZA 4ZSAA 1YXSA 2W05A 5TKDA 1OL5A 4UEUA 4BCIA 4C62A 3U4WA 4BCNA 5J79A 3TDWA 5HCYA 3G6GA 3KQ7A 3S2PA 3R1QA 3FYJX 5C27A 4BWXA 4YJTA 2EVAA 4KAOA 1P2AA 2VTAA 1PXPA 3MJ1A 4G6OA 4C33A 4BIEA 1UNLA 1B6CB 3NYOA 2BRGA 2GNGA 4FEVA 3NW6A 2NNWB 2WTKB 3KXMA 3W10A 4YSMA 4IM2A 4USEA 4QYYA 4HCTA 2WU7A 2BRMA 1KOAA 5DNRA 4B7TA 5F20A 3GEQA 4ZLZA 3QKLA 3W8LA 2O63A 5JGDA 3QAME 1CKJA 3QQJA 1OKVA 1Y57A 1QL6A 4JX7A 4WRSA 2FSOX 3R73A 5EYCA 4C4IA 4F9WA 4IHPA 3FC1X 3ORPA 4CSVA 2JAVA 3MB6A 4YZ9A 1PJKA 3BYOA 1ZLTA 4E6QA 5EKNA 4BCFA 3PP1A 4E3CA 3P7BA 2WHBA 3A62A 2JDTA 4JR7A 3VHEA 3DKFA 3SXSA 3TEIA 3PJCA 4OT6A 2E9PA 4UV0A 2VWIA 4GH2A 4PNIA 3W1FA 4BGHA 2XJ1A 3HL7A 4MNEB 4C02A 4M8TA 4LGDA 2YIWA 3VS1A 4FUYA 4FNZA 3FUPA 2PUIA 2QONA 5I5ZA 4WKQA 1U4DA 4EUTA 4EOIA 3BPRA 5B2MA 4C8BA 4NJDA 4D5KA 3ZEWA 2HZ4A 2R3RA 1J3HA 4M0ZA 4PDSA 4RJ4A 4C2WA 4E73A 3LM0A 4J96A 4PTEA 4AZEA 3BCEA 3KMMA 4FV8A 3FL5A 2UW7A 4NZWB 4C37A 1Q3DA 2JBPA 3TUDA 3CCNA 3DNEA 3MJ2A 3UIUA 4CYJA 4ALVA 3HKOA 2ZV2A 3EQRA 5A4CA 3MW1A 4W4YA 2BAQA 2WMXA 3NX8A 3TZMA 5A6OA 1FBNA 4FE2A 2R5TA 4F7LA 4B8MA 2B55A 2BR1A 3C1XA 5B2LA 3GOKA 3AMYA 5BVFA 3UO4A 4GIHA 4WG4A 4JBOA 3R63A 3TZ9A 3ETAA 4YHFA 4YZBA 5AUUA 3OHTA 4FSUA 4IM0A 1REKA 4TZRA 2BFXA 4PV0A 3P7CA 4ZMFA 4BCPA 5HESA 4CTBA 5AAGA 2R3QA 2PVHA 5ETCA 4FIJA 2ITUA 2CN5A 2ETMA 3RNYA 2WU6A 5CXHA 2C0IA 2C3JA 3F3UA 1FVRA 3ZS5A 1W8CA 2ERKA 3GU7A 3Q52A 4ID7A 4QYFA 4TPTA 4BN1A 2XKCA 2PZ5A 3GC7A 1OL6A 2YJRA 4JLCA 5BYZA 4E7WA 3UMWA 4C3FA 3G9LX 3Q2JA 2GHMA 2YISA 2VNYA 2UV2A 1ZMUA 4FV0A 4Z55A 4EEVA 2YM5A 1Q8ZA 2UZNA 3MIYA 5BNJA 4X0MA 2P2IA 3HMOA 5DI1A 5IA0A 2X9FA 5HICA 1OVEA 5L8KA 3PPZA 1ZYLA 3LFAA 5EQYA 1WBOA 3ERKA 3WZEA 4D1ZA 4C4FA 3E7VA 2Z8CA 3K5UA 1CSNA 3Q4TA 3BU3A 3FY0A 3G0FA 4FKIA 4L3JA 3DCVA 4AW2A 4EQMA 4JQ8A 4QQJA 4O38A 5EW3A 4CFNA 4ZJJA 1PXJA 2RIOA 3SAYA 3HX4A 3PLSA 4Q2AA 4C38A 4MHAA 2KTYA 4MXCA 4DH8A 4RWIA 3EQGA 1JWHA 1R1WA 2Y0AA 3A7GA 3CQWA 4G3FA 4U81A 4O27B 4ARKA 2FSTX 5JFVA 3CS9A 5IA2A 3DZOA 5ANJA 4FVRA 4MWHA 4AN2A 4CLIA 4ACCA 4IW0A 3KULA 1SNUA 5CAOA 3MWUA 4HOKA 4G3GA 2QKRA 1DM2A 4PL4A 3W55A 4EK6A 4G9RA 1UU9A 4WNMA 3PJ8A 3UP2A 5AX9A 4QP9A 4QQ5A 3FKLA 3RPRA 4D1XA 3D83A 2J50A 3WF9A 1VYWA 2VN9A 4RX7A 4UXQA 2ITZA 2X9EA 4MQ2A 5CANA 3SD0A 5GNKA 3R7YA 5L2IA 1VR2A 4DG0E 3D2IA 5I9ZA 1BMKA 1J1CA 3EFLA 2RFDA 3I81A 2WMBA 5H2UA 5JSMA 1VEBA 5ETAA 1ND4A 2GQRA 4S32A 4DGOA 3OTUA 3LHJA 2X6DA 2SRCA 2Z7QA 3L9NA 3LCDA 2VD5A 3CY2A 2OF2A 2UW9A 4WG3A 1ZXEA 4HGEA 4IAYA 3UYSA 4JG6A 4H3QA 3UC3A 1IRKA 3QTQA 4E4NA 2YZAA 3PIYA 4HZRA 2GNHA 4RJ8A 3HMNA 3PXKA 5IUHA 4IDVA 3R2YA 2XRUA 2BZJA 3NNXA 2YDJA 3E63A 5IEVA 2PU8A 3BEGA 3EL7A 3O51A 4WNPA 4DLIA 3ELJA 4DG3E 3LXPA 4LQMA 5J9ZA 2F49A 4FV3A 3G33A 3KA0A 4U6RA 3FZRA 3DDQA 2J5FA 4JX3A 5EHLA 4MEDA 1PMVA 4E93A 2DYLA 1OBGA 3FZSA 4IFCA 3NNUA 5FM3A 5M44A 4OTWA 1F5QA 4IMYA 3RAHA 3TKUA 2BALA 3BQRA 3GUBA 5GZ9A 2HAKA 4HGSA 4GV1A 4YBKA 4GKIA 1QPCA 1Y91A 2WO6A 4UWBA 3R7UA 3UNKA 5AIRA 1OITA 3REPA 4DHFA 4N4SA 3Q32A 3Q5IA 5TE0A 5LWMA 5AUWA 3LFBA 2QOQA 4O6LA 4S31A 4TYEA 4E4LA 5IKWA 4QMQA 3T9TA 5KZ0A 5FXRA 4WOVA 3F9NA 3QTSA 1XQZA 5ETIA 2WIHA 3ZRKA 3R8UA 3I0QA 5IH5A 3ZSIA 2QHNA 2VO3A 3LXKA 3UQCA 3DTCA 3NS9A 2CPKE 4FKUA 4X6RA 2XKEA 5HG8A 4TYHA 1PF8A 4FNXA 5T68A 3JVRA 4ZXTA 4DGLC 5EQEA 3P1AA 1XBBA 3PZHA 4H3BA 4TTHB 2OIBA 4X3FB 3LMIA 3HRFA 4IZYA 5EM5A 4EH5A 4Y8DA 3W16A 4NM7A 4BB4A 3LFCA 5AV3A 4Y95A 4BRXA 3UVPA 1KE6A 4HVGA 1IAHA 3CC6A 4FZ7A 4FIFA 4AU8A 4CD0A 4HYIA 5E9EA 4JXFA 3LKMA 2R7IA 5J87A 3R9HA 3ZSHA 3E5AA 3I7BA 4G17A 4IC7A 5B0XA 2X8EA 5E8XA 4UYNA 4DH5A 5KMJA 4H05A 2ZV9A 3QUPA 1PMUA 4LMUA 3QTXA 3HGKA 4U3ZA 4D4SA 3OFMA 1PXIA 5K5NA 5J9LA 4BFMA 3OEFX 3ZEPA 3QRKA 4Z16A 4YURA 3UQFA 5HKMA 5IPJA 3GFWA 4K77A 4YJNA 4R77A 4RIYB 3EMGA 3F2AA 4FKTA 3SRVB 5HIDA 4LOPA 2IZUA 3SXRA 3RPSA 1H08A 2R0UA 3DJ6A 3H10A 5HO8A 3ZH8A 3JY9A 3QBNA 4X2FA 4YLKA 1DAWA 1I44A 5IQGA 2WTWA 3KKVA 2O5KA 5A4EA 3SW7A 3ALNA 5I9YA 4MXOA 3HLLA 3R00A 2JDRA 1SMHA 2CLXA 2IG7A 5KHWA 5JFXA 4GW8A 2X4ZA 3VBYA 5D11A 1YOMA 5DRBA 1OL1A 2XBAA 5IQCA 3AMBA 3BLRA 4WBOA 1ZMWA 4L7FA 2FB8A 4BI0A 4AG8A 2P3GX 1MRVA 3FZ1A 2CKQA 4E6AA 2IW6A 4DN5A 2CJMA 2YERA 3FLQA 2UZOA 3FMNA 4CG9A 5CEPA 5I3RA 1YHVA 5JT2A 2OGVA 4C4HA 2WMAA 3U6JA 4RIWA 1BUHA 2GS6A 5HG5A 2CGXA 4WD5A 1M2RA 3DNDA 4QO9A 2PK9A 4XV9A 2Y7JA 3GP0A 4FKLA 1MQ4A 4MQ1A 4UMUA 2QU6A 1Q8YA 1W82A 4KBCA 4MK0A 4RFZA 5HX6A 5CT7A 4AOTA 2YM4A 4M68A 3QTRA 4FL3A 4WNKA 5J5TA 5AP7A 1R78A 3M42A 4GU9A 5BUIA 1SVHA 4KA3A 4XG2A 3QQUA 1BYGA 4QTCA 5EHYA 2XNOA 2OI4X 1ZYSA 3RM6A 3BHVA 1J7LA 4BZOA 3JUHA 5JN2A 3U6IA 4I5CA 3ZFMA 3ZLYA 1YW2A 3TJCA 2QO7A 3QC9A 4ANSA 2QLUA 3DJ5A 3PG1A 3CD3A 4O7WA 1NT2A 3OUNB 4UBAA 4CXAA 3VO3A 2UZLA 4F7SA 3PP0A 5BUJA 4D9UA 4F6SA 2QG5A 4V05A 3UZTA 3SG8A 1RDQE 4QMLA 2CKEA 3DAJA 4BCMA 1K3AA 2G01A 4LOOA 4II5A 4UZHA 4ASDA 5CS6A 3PSCA 4AGWA 2YWVA 4FV7A 1SVGA 5DOSA 3QC4A 3K54A 4RC2A 4XBRA 3P7AA 2F2UA 1URWA 4Q9SA 4RIXB 3BGQA 5DT4A 1H1WA 5JGBA 2Q0BA 4RC3A 2QURA 3HNGA 5HNGA 2CGUA 3BRBA 5KMLA 3BLQA 4BCKA 3MSSA 3GOPA 2R3KA 5AR3A 3K2LA 3C4CA 4F09A 4ZZNA 4XV2A 4FNYA 4F0FA 4BTKA 3QFVA 4PMTA 4JR3A 3TKHA 5LVOA 4XS2A 2Y4IC 3EKNA 4YTIA 5H8BA 5TO8A 3KF7A 3QX2A 3FI3A 4RX5A 2C6DA 1FGKA 2YAAA 3IG7A 5I3OA 3PVBA 4ZAUA 4M7IA 2R3JA 4WBBB 4OTGA 4E4XA 1ZOGA 1U54A 3ZXTA 3COIA 2BRHA 4MBIA 3WIGA 3SHEA 4LYNA 4AGUA 4K2RA 4RIYA 2B52A 3R7VA 4QMTA 3DTWA 4M14A 3TKIA 1OI9A 4J71A 5J5SA 2R2PA 4FL2A 1GZ8A 2J90A 4FKOA 5CTPA 3GGFA 1BX6A 4QYEA 4A4LA 4DH3A 3BKBA 3TCPA 2XM8A 2BMCA 1Q8TA 3HECA 5CEOA 3A60A 3QQHA 2UZUE 5K9IA 4TN6A 1IASA 2WMTA 3VJNA 2BZKB 2EWAA 2W1ZA 3PXYA 4RT7A 5KCVA 5HE3A 5CZHA 2QOKA 4TXCA 2R3OA 4XV3A 4EZ5A 3ZZWA 5T6KA 2QR7A 3RK7A 3BYMA 4IAFA 5DHJA 4XP2A 4C61A 5F9EA 4IQ6A 3DT1A 3F66A 5JRQA 2BDFA 1G8AA 4IE9A 4XYFA 3S3IA 3WBLA 3PLAE 3WIKA 2XIXA 1H28A 3O8PA 5DN3A 3C4XA 4LV5A 5KBRA 4PPBA 5I4NA 1JSUA 3R01A 3ZO2A 4PTGA 3R1YA 3LVPA 5H8GA 4JNWA 4YTHA 5CAPA 3ODYX 2W5BA 2AUHA 5CEQA 4R3RA 4PDYA 2JKOA 1M52A 2YAKA 3D5XA 3LIJA 4RFMA 3V01A 2Z02A 2XNBA 4QMWA 4HW7A 4ZS0A 2F9GA 4YPDA 4C0TA 4P90A 4L8MA 4G2FA 4AFJA 1P4OA 2BPMA 3RCDA 2DS1A 2J7TA 2WKMA 2Y8OA 4QP6A 4D55A 2A2AA 4UMTA 5CSWA 3R9NA 1Y6AA 1YDRE 2DWBA 3H9RA 4U0IA 5CLPA 3QRIA 1A48A 2XNGA 3BQCA 3PXFA 5AR4A 3C4EA 2IVSA 5M55A 3OUKA 1PYEA 4NIFB 2IZRA 2YCRA 5HX8A 5LMKA 3VNTA 4DFBA 2YACA 2C1AA 3EYHA 5FDXA 3I5ZA 4IVCA 3R0TA 1FOTA 2R4BA 3UOKA 3D5UA 3ORMA 4XRLA 2W1GA 3EN4A 1OBDA 5LMAA 3CJGA 3LQ3A 2OXXA 2R3HA 4I5MA 4JRNA 4AA5A 3PWYA 4M67A 5LJJA 4O21A 2V5QA 3MTLA 3AD6A 3EN6A 3QA0A 3DKGA 4IJPA 3UO6A 1UU3A 5I9VA 4FT5A 1BLXA 1QCFA 4LG4A 3BYSA 1OIUA 4O7VA 3KU2A 5KMOA 3PJ3A 5CF5A 2WNTA 4FKWA 4M84A 4I0SA 4IH8A 2OJIA 4RIXA 2GSFA 3H0YA 2W1FA 2QCSA 3PTGA 4F64A 4HYHA 4BCJA 3M2WA 1KV2A 4N70A 4DBNA 3QZIA 5AP6A 2RSVA 3NPCA 3QQGA 3TNWA 3OC1A 4GUEA 5E8TA 5IDNA 3R8PA 2Z7RA 3CE3A 3AQVA 4G5JA 3LFEA 4CKIA 4RVLA 4D2TA 4FKRA 3S4QA 3KRXA 4YJRA 1YWNA 2OICA 3ZCLA 3RJCA 4NFNA 4RQKA 5AWMA 4GS6A 1TQMA 3G0EA 3OOGA 2XEYA 2XB7A 1FINA 5HORA 1ZAOA 3AC1A 2I0EA 4O82A 2JKKA 3R7OA 4ZS4A 3OWPA 4KABA 1ATPE 2OJJA 3FLYA 4LRKA 4BTFA 4GIIA 3L1SA 2DQ7X 4IM3A 3KF4A 2AYPA 4MD8E 3DLZA 5ACKA 4AX8A 4D4RA 5JQ8A 3LMHA 4WUNA 2I0VA 2O64A 4IX4A 4YU2A 4CCBA 4FSZA 1VJYA 4R1VA 4ZTMA 2GHGA 4LUDA 3ENMA 3FQEA 4FTIA 4GEOA 1W84A 4JBQA 4GMYA 3H0ZA 3O23A 3ET7A 2ZMCA 2ITYA 4CTCA 4OGRA 4M66A 3LM5A 3F82A 3LW0A 4O0WA 4E6DA 3ZLWA 4DC2A 4EOQA 4ZMEA 1JVPP 2C68A 4DITA 2PSQA 4FG7A 2OJGA 3ATSA 3KXNA 4CKRA 4EC9A 4FC0A 4AW0A 2CKOA 2WOUA 4ZIMA 4FICA 2XH5A 3MFTA 4F6WA 2QU5A 3GFEA 3DS6A 3ZC6A 2UZTA 3NYVA 4F63A 5AP1A 4F08A 2OG8A 3LJ0A 2OH4A 1R39A 3QALE 4ZTRA 4GJ2A 3EYGA 1MP8A 3F5PA 3FSKA 1IA8A 3BU5A 3DK3A 5HGIA 3FI4A 2C0OA 4O1PA 4QRCA 1GY3A 2R3NA 2CGWA 1E1VA 4X2KA 3SGCA 2VO6A 4YO4A 2WXVA 3LMGA 3BYVA 4NL0A 3Q3BA 3HP2A 3QX4A 1Q8UA 2QOHA 1ZYDA 2W5HA 2ZVAA 3EQHA 3ORXA 5AM6A 2QO9A 4CNHA 4EKKA 5IDPA 4AZSA 3KCKA 5CU2A 4J95A 1R3CA 5HIEA 3POOA 1H07A 3EN7A 4FTJA 5IQHA 3EFJA 2GHLA 2J4ZA 5KKRB 3A2CA 1UKIA 2YM6A 3E7OA 3PZEA 1H0WA 3C4ZA 3COHA 4FTRA 4IVDA 4K9YA 5D7AA 3TJDA 3ZDIA 5CALA 2C3IB 5C4LA 4QMZA 3QGWA 3Q4CA 4V04A 4XLVA 2UW4A 4FEQA 1ZYCA 1SVEA 3V5WA 4YC6A 4YLLA 3I6UA 3AMAA 3C9WA 5M08A 4IACA 3V8WA 4TWCA 3DAEA 4F70A 4Y83A 1U5RA 1IEPA 4YNOA 3IECA 3OEZA 1NVSA 4OBOA 2B4SB 3EWHA 3MN3A 4BF2A 4DH7A 3GC0A 4HNIA 4U3YA 4NM3A 4BDEA 2PZPA 3V51A 3FYKX 4WO5A 3TI1A 3T3VA 2VWVA 2YZLA 4MH7A 5FTQA 3ZMMA 4QQTA 4OAVB 5AJQA 2GFCA 4FV4A 4APCA 4L00A 4YZNA 5EQPA 3PJ1A 4J1RA 4FIEA 4XHKB 2WGJA 3DXNA 3DXQA 4NKAA 5HCZA 3ORNA 2QODA 4JRVA 3TZ7A 2XIYA 3PXQA 3TZ8A 3U8WA 3C4FA 3E3PA 4JOAA 3W2QA 1KOBA 3A61A 3QRTA 3MPAA 4EH8A 2ZJWA 3BGPA 2UW5A 3F3WA 3FHRA 1Z5MA 4FG8A 2WMRA 4DT8A 2GNJA 2WELA 1F0QA 3SX9A 1OKWA 1SM2A 2PE2A 3Q9XA 4BCQA 4CVAA 3HMIA 4AZFA 1WVWA 2EU9A 4KINA 1Q62A 3QHWA 4GFMA 4PDPA 3TTJA 3CPCA 3P79A 5K0KA 4EH3A 4KIOA 3ORTA 3DY7A 2WQOA 4QP2A 3UG1A 3GCVA 4NTSA 3SOAA 4L42A 3ZSGA 5GIPE 2JD5A 4GVAA 4E26A 2ITNA 3FXXA 3QXPA 4A4OA 2UZDA 4GK2A 5FGKA 3NEWA 3O7LB 4LL5A 2ERZE 1JSTA 3MBLA 4PF4A 3VS3A 4EHEA 5FEEA 4D2VA 4QPAA 3Q6WA 4D2SA 5C01A 3ZTXA 5FEDA 4C58A 2WQBA 3GENA 4A4XA 2C3LA 5JFWA 4ASEA 2BKZA 5TR6A 5AV4A 3EFKA 4DEEA 3DBCA 4AW5A 2OKRA 2ITOA 4FODA 1IR3A 3COKA 3PUPA 3W2OA 2Y9QA 1DI9A 4C2VA 5KMIA 1ERKA 2WMSA 4EHZA 2C3KA 3F69A 4R1YA 4RVKA 4A9TA 5IEXA 3AGMA 4F7JA 3U9CA 5ANDA 2VUWA 1OB3A 4GK4A 3OTVA 3QWJA 1H8FA 4XG6A 2XYNA 3BHHA 3CY3A 2YM8A 3EKKA 2X1NA 3R30A 4MCVA 5BVDA 2PUUA 2ZAZA 4XLIA 1NY3A 4JJRA 3E3BX 3VULA 3AG9A 3C50A 1CMKE 3OVVA 4QMMA 3NUNA 4J98A 3FWQA 4F9CA 4PMSA 2BHEA 2R3GA 1U46A 3DA6A 4QMVA 4R5YA 3ROCA 4E8AA 2RFEA 4YC3A 2YLFA 3GCUA 4DEGA 3NYNA 4ZZOA 2XNPA 4IB1A 4G3EA 5DRDA 2VAGA 3QF9A 4F9BA 5AP4A 4W8EA 2WD1A 4BDCA 4R7HA 2O2UA 4TW9A 1JQHA 4CZTA 3KXHA 2G15A 2OF4A 4JIKA 4KBKA 5CT0A 4ANQA 3IDPA 4U7ZA 2WQNA 1OL2A 2ZB0A 2VO7A 1CTPE 5FTGA 4R3CA 2WAJA 4FZDB 1Q24A 3F7WA 2A0CX 3ZXZA 1UVRA 1ZYJA 2IO6A 3KN6A 5HVJA 4M12A 2H9VA 4H3PA 3PY0A 5AX3A 4CMTA 1YXTA 4QPSA 2GFSA 2PMIA 4U41A 3QLGA 4R8QA 1WZYA 3Q2MA 4MXZA 5AP3A 3RTPA 4UZDA 2F7EE 5CEIA 3TWJA 4RRVA 1MQBA 2JDSA 3QCXA 3CD8A 1G8SA 2IJMA 4EBWA 4J99A 4S2ZA 3ANRA 2J0LA 1V1KA 4M69B 4XP0A 5FWKK 2W1CA 4ANMA 2JKMA 5ANIA 5CI7A 5J1VA 2VGOA 1OKYA 5LVPA 3TV6A 4IXPA 3NIZA 2ZDUA 3I5NA 4FZFB 1Q99A 4KIKB 3MFSA 1RE8A 4IWOA 5DH3A 4AOIA 4FV9A 4O91A 2XCKA 5HO6A 1J91A 2VRXA 3W33A 4QP1A 4FNWA 1JPAA 4DE4A
chains in the Genus database with same CATH superfamily
1TFFA 2XZSA 4PY1A 4C57A 3NMUF 2YIQA 4FEUA 3WF6A 2XKFA 2YDKA 3PRIA 4QNYA 4AT5A 3PPKA 4RX8A 2BTRA 4TNBA 4ZJVA 3UBDA 1A9UA 4G16A 2BHHA 4QOXA 4O4CA 5M57A 4BBFA 4WSYA 3BX5A 4RFYA 5HHWA 3QA8A 1TVOA 2PHKA 4DG2E 5GJFA 3H9OA 4D2RA 4M97A 1PY5A 5EYMA 1RW8A 3LFQA 3ZO1A 5E8ZA 3U6HA 3RWQA 5CXZA 1KE8A 4NM0A 3QD2B 2UZEA 2CCIA 4Z3VA 3F2NA 4E5BA 4YSJA 4K8AA 4NCTC 4NTTA 3I6WA 2XARA 3DBEA 2PVRA 2HY0A 3PE1A 5LMKC 4IZ5A 2XM9A 2ZM3A 3GB2A 4TNDA 3BHTA 5HU9A 1XH5A 4KKHA 3E62A 4MXAA 3UPXA 4EOLA 5CU3A 1KE7A 1OGYA 2VTTA 3EQIA 5DR2A 3WILA 4ANBA 3NR9A 4JBVA 4XOYA 3MYGA 3UP7A 4QMXA 5CI6A 4MXXA 3EOCA 4MNEA 2YLEA 2X8IA 3VUKA 1M2PA 3GCPA 4O0TA 1WMKA 4YTCA 1WFCA 3BYUA 4FOCA 4F1MA 4A9SA 4HZSA 4B6LA 4RLKA 3UIXA 3DZQA 3G90X 5M06A 3C0IA 2BAKA 2FO0A 5D1JA 2ZDTA 4BKJA 4YJUA 3KL8A 4I94A 1FMKA 4LFIA 4AN3A 1FQ1B 2PWLA 1Z57A 3D7TB 3BLHA 5CVGA 4QTEA 3VRYA 3NWWA 5K0XA 4JI9A 4KIPA 4BIDA 4DH1A 2JIIA 1APME 3CPBA 4ACMA 4U44A 4F0GA 4P5QA 3W18A 4MF0A 2HENA 1SNXA 3A8WA 4PQNA 3R7GA 5LCJA 2CGVA 2X0OA 4J52A 4DGMA 3PXRA 5H9BA 3NNWA 3SDJA 4D5HA 3FKNA 4AXAA 5FG8A 3ZUUA 5JFSA 1OZ1A 3ROYA 3R8MA 4B4LA 2R3FA 5AP0A 4TL0A 2R3LA 1V0PA 5GZ8A 4LDTA 5I9XA 4BY9E 4V01A 3QRJA 4LV8A 2XK3A 4EH4A 3II5A 3G51A 2C6TA 2YWPA 4KRCA 4FI1A 5IQEA 3ZUTA 4E5WA 4AXEA 2R0IA 2ZMDA 2GS2A 2QHMA 2QG7A 3UQGA 2JKQA 4CZYB 4F99A 4ZTSA 4FA2A 3BWFA 4C36A 4O22A 4GT5A 1KWPA 4L44A 5I9UA 4D0XA 4CYIA 1WBTA 3MVLA 3O71A 2HWOA 4O86A 3RWPA 4OTHA 4G3CA 3JY0A 4NEUA 1WBPA 4ANOA 4ZY5A 3AOXA 2F4JA 5HLNA 4ANNA 4PL5A 2W99B 4FKPA 2X2MA 4MKCA 3P9JA 4ACDA 1UNGA 3FMDA 3PA4A 4FV6A 5AR2A 2BVAA 4M69A 2VX1A 2B1PA 2HY81 1P4FA 3QWKA 3TT0A 4AAAA 2BIYA 2HYYA 2V7AA 1AD5A 4D2PA 2W06A 3AD4A 3IW6A 2XVDA 4FEXA 2UW0A 4KIKA 5KBQA 2PE0A 3SXFA 5A6NA 4DFYA 2OZAB 4QMNA 5EKOA 2YM7A 2XIRA 4AFEA 2WEIA 1YHSA 2W4KA 4I6BA 3DK6A 3H9FA 4ANLA 5IUGA 2XIKA 4R78A 2C6EA 4TYIA 5F4NA 5H8EA 2YCFA 2X7FA 3A7HA 2BZHB 3IDBA 5A4LA 3UO5A 2VWBA 4J8NA 2HCKA 1UA2A 3QL8A 1XBAA 2QI8A 4IFGA 4G6NA 5CVFA 1YXUA 4Y73A 3HDMA 3FMEA 4MXYA 2XBJA 3H3CA 5L6PA 2PTKA 3Q6UA 3LXNA 3SOCA 1JKKA 2I6LA 5LOHA 3PRFA 2HW7A 5EH0A 3ORLA 5E92A 3L9LA 5A46A 4HGLA 2BCJA 2J5EA 1XHAA 5EDPA 4LOQA 5T3QA 3RZBA 1OIYA 4UWYA 5DYJA 2PMLX 4CGAA 3OW3A 2J6MA 3KB7A 5A4TA 3A8XA 4Y5QA 3R1NA 1MRYA 3TTIA 3NVKI 5EYKA 2UUEA 4AT3A 4CQEA 4FGRA 2B0QA 3NW5A 4U42A 3FPMA 3GCSA 3D5VA 1F3MC 3JS2A 1FVTA 1PKGA 2GNIA 3Q04A 3R7EA 4FSQA 2CMWA 3LCTA 5JMSA 4MD7E 4ENYA 1WVYA 5JK3A 2GTNA 4RPVA 2IPXA 1PXKA 5HLWA 3QTWA 3W8QA 2GQSA 3HA6A 2UZWE 4BL1A 2IEWA 4NJ3A 2B9IA 2B9HA 4OTFA 4WHZA 5EG3A 4L43A 3ZFXA 3FL4A 3LJ1A 5HG9A 3FXZA 1W2CA 3FJQE 3ULIA 5I9WA 4PMPA 4XRJA 2ZM4A 2XK6A 4O7YA 3BELA 2RG5A 3ZBFA 4RWKA 1K2PA 2VV9A 3VQHA 3U55A 3CBLA 4I4FA 4KS8A 5DPVA 2H34A 4JIAA 4NYEA 4O7RA 5HQ0A 2GNLA 4S34A 2GNFA 3MVJA 4ZTQA 4NWMA 4DTKA 2QOIA 4AACA 5BVWA 2Y4PA 4AT4A 2IW9A 1JKLA 1WVXA 4ZY6A 2PUPA 4DTBA 4O4FA 1JLUE 3I60A 4UN0C 3MY5A 5EOLA 3B8QA 4GU6A 3ZU7A 5AV1A 4EHGA 5EFQA 1TQIA 4EOKA 1LUFA 4HNFA 5HLPA 1GOLA 4U5JA 2HZIA 4C7TA 4DFUA 1G3NA 4F4PA 4FK6A 3F7ZA 2OBJA 5AM7A 1XWSA 1KE9A 3PVUA 3QHRA 3UJGA 1OL7A 1Q61A 1CDKA 3HRBA 3I79A 3EQCA 5KHXA 3C7QA 2BTSA 4X3FA 3D0EA 3GQIA 3KEXA 4FTKA 4O4DA 5KE0A 3UNJA 3W2PA 1PRYA 2CNVA 3O8UA 3RGFA 1QPDA 3Q53A 5L4QA 2OH0E 5AP2A 4YJPA 3CKXA 5CU4A 3WZDA 1XH7A 4OR5A 3IGGA 3E8CA 4Z9LA 4IAIA 4BKYA 3JPVA 4R5SA 2VTOA 4KSQA 4FIHA 5LARA 3RINA 4E4MA 1XBCA 5EI8A 3HV5A 3F2RA 5FBNC 3SG9A 3D2KA 4K33A 5IMXA 4WIHA 4O7TA 4O7LA 3DAKA 4FSTA 2NRYA 2RFNA 3IONA 3LCSA 2OJ9A 3NCZA 4OTRA 2OLCA 2OZAA 3G5DA 3LJ2A 5J1WA 4I3ZA 1H4LA 3W2SA 2JFMA 3OBGA 4MNFA 5LVMA 3PY3A 2ZV7A 3SRVA 1GJOA 3GU5A 2R9SA 1M7QA 2C47A 4FKSA 2W1DA 3T3UA 3OY1A 2PZIA 3UMXA 3P4KA 2YITA 4L52A 3MS9A 3ORKA 4IJ9A 3ZONA 4GFOA 1ZOHA 4BDAA 5C8KA 4JDJA 2W17A 1Z9XA 4F7NA 2QNJA 4BIBA 4GK3A 1QPEA 3N9XA 2ZFYA 4XUFA 4E1ZA 4GFGA 4RVMA 2OO8X 4JS8A 3KXZA 4L46A 4IAAA 4ALWA 3FPQA 4CV8A 4B8LA 4BDBA 2QVSE 3UC4A 5EM8A 2QKWB 4XX9A 5BMMA 3VS0A 2VZ6A 3GBZA 4C4JA 4YNEA 4DF3A 3OXIA 4I6QA 4FTMA 1YDTE 4F1OA 4BR3A 1DS5A 1OMWA 3OS3A 4RJ5A 4PRJA 2XNNA 3OD6X 4NUSA 4BTJA 4EC8A 5HD4A 3O5AA 4ZTHA 2YDIA 3EIDA 3LPBA 4IB3A 1UNHA 4QMYA 5EDQA 3WE4A 3W0OA 4BGGA 1BKXA 2FH9A 4H58A 2O65A 2YJSA 3OBJA 2YCQA 3O8TA 2G2FA 2XANA 3KRRA 2G9XA 3VWAA 1H00A 1JOWB 3K5VA 3I4BA 5AUXA 2C5OA 4KS7A 3R9DA 3T8OA 4D58A 2OIDA 3QTUA 4L01A 2CNQA 2IZSA 3U4UA 2OW3A 4YHJA 4DDIA 4UXLA 3EZVA 3R2BA 4E6CA 1W98A 3HAVA 3V5LA 5C03A 3RM7A 3IKAA 4BZNA 1KSWA 1W7HA 3MY0A 3OCSA 3VIDA 4L9IA 4DFZE 3O50A 4AZWA 5I0BA 5IH6A 5LVNA 2VX0A 2VTQA 3D4QA 4OTPA 4AA4A 4TYGA 2X0QA 2ZOQA 4AQCA 1O6KA 3GT8A 3PXZA 4A7CA 3ZZEA 1T46A 1WBSA 1ZZLA 5DMZA 4AWIA 2PZYA 4U80A 5K4JA 3DPKA 4IBMA 1JNKA 2H8HA 2Z2WA 3FI2A 3PA3A 5G1XA 3RAKA 1A06A 2ETRA 5D12A 1OECA 4MVFA 3FMJA 3NUYA 3BE2A 5L2WA 4RJ6A 5CU6A 4GT4A 5AIKA 3GNIB 3QKKA 4HGTA 4FVQA 3MDYA 3RMFA 4F9YA 4K6ZA 4PP9A 2WTKC 2C5VA 3R9RA 4LRMA 2J0JA 1QPJA 3I1AA 2P33A 3RPVA 2ZM1A 4AE6A 5LMBA 5AADA 5KMMA 1FVVA 4BGQA 2C6KA 4H1JA 3MH3A 4MF1A 2REIA 4R3PA 1FGIA 5DLSA 4GKHA 3OCTA 4BI2A 2HZ0A 3U87A 3FKOA 4D4YA 4HPUE 3OXTA 5J95A 4AF3A 1P14A 1IAJA 3AC8A 5CQUA 2Z7SA 3AT3A 4M0YA 4DAWA 5DE2A 3KFAA 3NFGB 4LM5A 3OWJA 2ITQA 3ZRMA 1M17A 5TF9A 2X6EA 4CG8A 4LUEA 2E9NA 3NAXA 3QXOA 4G34A 4XNEA 2HXLA 4QNAA 3VS4A 1RJBA 2J0MB 4AZVA 2H96A 3G6HA 1S9IA 3K3JA 1YI4A 4PPCA 2OU7A 2YIYA 4FTAA 5DG5A 2X4FA 5D7VA 3QTZA 5HI2A 1B39A 3DBDA 4A9UA 4AW1A 3CTHA 5AUVA 2VTRA 3DV3A 1OM1A 5HE2A 5EW9A 5J9YA 1JBPE 2WTJA 2YIXA 2F7XE 3ZBXA 4IAZA 4FKQA 4JDHA 4CT1A 4KKEA 5L6WL 2CHLA 3AC4A 2P4IA 1ZRZA 2V0DA 3EZRA 4G5PA 3KN5A 5A3XA 2ZB1A 5DBXA 2JDOA 5HCXA 3F5GA 5L2TA 4ZSJA 3C5IA 1Q41A 4X3JA 3ZHPC 2YABA 4IB0A 2EXEA 3E88A 3RPYA 5AV0A 3ZOSA 4CFUA 2XJ2A 4AOJA 2QLQA 5E8YA 4XG4A 2OSCA 5FBOA 4DT9A 2WQEA 3KIOC 4BWKA 4ZLOA 4C3PA 2UW3A 1B38A 3A7IA 4K18A 4EQCA 3PDTA 1HCLA 3DGKA 3VBTA 4ORKA 3ZC5A 4YJOA 3MGYA 5H3QA 2X2KA 4RJ3A 2VO0A 4RBLA 5HVKA 5IH4A 1JKSA 2OFUA 4X2JA 3PY1A 3TNQB 5L8JA 5DWRA 5IQBA 3PIZA 5CNNA 1L3RE 1OIRA 2OXYA 3P86A 2W96B 3AD5A 3NDMA 4CFXA 5HTCA 2XNEA 4EI4A 4HVSA 4X21A 3V3VA 1ZY4A 4YTFA 4EORA 5F94A 5C1QB 2OZOA 3DBFA 4I20A 4IWPA 1VYZA 2VTHA 4O0YA 3DQXA 3KCFA 5HTBA 1OIQA 3WZUA 1GNGA 3BV3A 5B7VA 2Y4IB 2YA9A 3EFWA 3NAYA 5E90A 3KXXA 3I7CA 5DT3A 5EW8A 1YDSE 3LOKA 1ST0A 3ZLXA 4PL3A 3NIEA 5HE0A 3GU8A 3LFFA 3POZA 3QCSA 4LI5A 4U79A 3GXLA 4P2KA 4DEHA 4L53A 5AA8A 5CAUA 5HVYA 4DCEA 3V6RA 4KUJA 2WTDA 2I40A 4WNOA 3NUXA 4D28A 2I0HA 4FG9A 3KK8A 2C6LA 4WG5A 4O81A 2Q83A 5HEZA 4EH2A 2F7ZE 3RBWA 4QP7A 2VTPA 3ZYAA 3CIKA 4XG3A 3RAIA 4MYGA 1ST4A 3N4UA 5L2QA 1IG1A 4O7NA 3KVXA 3DB8A 3OZ6A 4NIFA 5AR7A 3VUIA 1RQQA 5ICPA 3U51A 4CQGA 4EUUA 4GL9A 2YIRA 3LE6A 4RZWA 4OAUC 2BILB 3TNHA 5C8NA 4CEGA 2X8DA 2HW6A 4KKGA 3C13A 1QMZA 5BVOA 1UU7A 2R7BA 3L9MA 4YP8A 1XH6A 2R3IA 5B2KA 4BKZA 4D1SA 4HPTE 3NW7A 3LLAA 4L45A 2ACXA 3OF0A 5AUZA 2JIVA 3WF7A 5CNOA 2O3PA 4KWPA 1G5SA 3F61A 4KSPA 2C6IA 3R7IA 1GAGA 4Z7HA 3VAPA 2P0CA 5CU0A 4EH7A 3VUHA 1CM8A 3AT4A 1YI6A 4Y46A 4ZSEA 3ATTA 3R8LA 2JLDA 4K0YA 2HWPA 4QMPA 2EUFB 2C5NA 4DYMA 4X2NA 3VW6A 2VX3A 2B7AA 3F3VA 3CJFA 3EN5A 4J8MA 2YEXA 2BRNA 3E93A 1OUYA 3MH1A 2AEGA 1KV1A 2J0IA 3KREA 3LFSA 3BEAA 3LCOA 2BUJA 4XP3A 1UWHA 1GZNA 3VW8A 3C51A 4TKSA 4CMUA 4JBPA 2QO2A 4U43A 5E8VA 1CKPA 3CTQA 3AT2A 4FTNA 4L6QA 3R83A 4GCJA 3R8ZA 3QRUA 4Y72A 4Y5HA 4DBXA 2LGCA 5C4KA 3IDCA 4CFVA 5FDPA 1UWJA 3ODZX 4IVAA 4AA0A 4C34A 3RVGA 4O84A 4BDFA 3PSBA 3HV6A 1WBWA 2IWIA 4MWIA 1XMMA 3S1HA 4EZ7A 3OY3A 1JSVA 5M56A 3CSVA 2GPHA 3U9NA 3KULB 3DQWA 3FMMA 3P08A 4ITHA 2BRBA 3DB6A 4HVHA 4DGGA 2XK7A 1E1XA 4EJNA 4QTAA 4OW8A 4RA4A 5AR8A 3FAAA 5LQFA 5D10A 3IW4A 2PZRA 3AKJA 4LRJA 2VTSA 5IA1A 4ITJA 2OXDA 5J7HA 4JAJA 5BMSA 2RGPA 3HVCA 3HV7A 4QT1A 5C26A 4GYIA 4USDA 3VF8A 3L9PA 2X7GA 4EK5A 3R22A 5HE1A 4L3LA 4X3FC 3QQKA 2C4GA 3T9IA 4ZK5A 4YR8A 4AXFA 5E1SA 3HA8A 3EH9A 5CQWA 4L7SA 5CSVA 4FKGA 2JEDA 3RHXA 4ZY4A 4J97A 2IVTA 2Y6MA 1H1SA 4IDTA 4O0XA 4BDGA 5CENA 1YWVA 3DDPA 1Q97A 2XKDA 4O0VA 3M11A 4RC4A 2O0UA 3AC2A 1NVRA 3OWLA 4YZMA 5E8SA 5FXSA 1GIJA 2G2HA 2ONLA 4C4GA 4EOPA 2OWBA 1H0VA 3GU4A 4FRFA 4NH1A 5ANOA 5K5XA 1YXXA 3IPHA 2XK4A 3G15A 4FT3A 4XV1A 1NXKA 4OTIA 2ESMA 1OGUA 2BKKA 5GINE 2VWZA 3RCJA 4G6LA 3FLWA 1PHKA 4MBLA 4YMJA 5AUTA 3TNPC 4UX9A 2YN8A 4QMUA 5CEKA 5JKGA 2GDOA 3VS6A 2PVYA 5EI2A 3BHUA 2NRUA 4ZLYA 1H27A 3NUSA 2P55A 2ETKA 4EOMA 4D2WA 3TYKA 2PMOX 4OLIA 3QD0A 3MH2A 3E64A 4I93A 3D15A 5D9HA 1HCKA 3PSDA 3OCBA 1Q4LA 2A98A 3O96A 4UB7A 4CFMA 5CSPA 1U59A 2PPQA 1NA7A 2J51A 3ALOA 3G9NA 1PXLA 3UODA 2NO3A 3LQ8A 2IF8A 4LGGA 4PNKA 5LCKA 1PXOA 4GG7A 5IG1A 4X6QC 5K4IA 4TYHB 2P2HA 4LMNA 3JXWA 3V8SA 1SYKA 2XALA 4I6FA 3WF5A 3ZFYA 3PIXA 4BDIA 3CGFA 5M4CA 3UZRA 4EQUA 4IZ7A 3KVWA 5C8MA 3UDBA 5M4IA 3DKOA 4FK3A 5F95A 3MV5A 2PL0A 3D9VA 3TIYA 4FYOA 5K3YA 3OT3A 3O0GA 3MY1A 3MH0A 1H1PA 4NK9A 3PA5A 3R8VA 4QD6A 1OPLA 2VTMA 2XF0A 2ZV8A 2C1BA 3MPTA 4CLJA 2VWWA 3CR0A 3D94A 4BHNA 2JBOA 2W0JA 3R02A 5J8IA 3BWJA 3PG3A 1PKDA 3UPZA 1PXMA 2QOFA 2VTIA 4QP4A 1DI8A 3B2WA 4TWNA 3R1SA 1OUKA 4I23A 3A4PA 5DEWA 5L8LA 2PE1A 3Q5ZA 3O7LD 5CVHA 2WTCA 4IX3A 1YQJA 3MVHA 4H1MA 5FXQA 2CCHA 3EHAA 2WEVA 2WZJA 4A06A 5HU3A 4HYUA 4RMZA 2JC6A 3IOKA 5FP5A 4GYGA 3QQLA 1PXNA 4ZEGA 3Q4UA 4QPMA 5LXMA 5AFVA 2CDZA 3FXWA 3UZPA 4I21A 3EL8A 4U45A 5L3AA 3NUPA 4RQVA 5JRSA 4PP7A 4YUQA 5BVNA 4I5PA 4OTQA 4U9AA 1KE5A 4BCHA 2YFXA 3W2RA 4APPA 4K11A 3KRLA 5AV2A 3OXZA 4C4EA 2BDJA 2XYUA 2PVMA 1Q8WA 2V62A 4EK3A 1UV5A 4O96A 1GIIA 5EM7A 5A9UA 4XG9A 3QQFA 3V5PA 4HCVA 1OPKA 3QGYA 2B54A 3FE3A 4ERWA 2IVVA 3SA0A 4K1BA 3LLTA 4MAOA 3E8DA 4N57A 2WQMA 3V5QA 2C69A 3CXWA 4BDDA 3KK9A 3EQDA 4RIWB 3ZUVA 2UVZA 2HZNA 1TKIA 3OW4A 4ZZMA 3ZO3A 4B0GA 5CSHA 5DFPA 2IZTA 4ACHA 5FP6A 3FMKA 5CAQA 4WUAA 3D14A 3TG1A 2QD9A 2XA4A 1XR1A 2X81A 3DOGA 4DCAA 2B9FA 2WPAA 1X8BA 4FSWA 3TL8A 3RI1A 1M14A 4KIQA 3SVVA 1SZMA 3CLYA 1IA9A 4G1WA 3IW7A 2QR8A 4FZ6A 4JDKA 3FZTA 1LP4A 2BZIB 4DFXE 2H6DA 4UMQA 2G1TA 2I0YA 5BPYA 1LPUA 4FMQA 3HP5A 3R28A 3OT8A 2W1IA 4JQEA 4YZCA 1BL6A 4N6ZA 3WI6A 5BX0A 2CNUA 2XAOA 4EONA 4A9RA 3IK3A 3LFNA 4XCUA 1YKRA 5HBHA 4D0WA 5G6VA 1YXVA 4NM5A 1V0BA 3TV4A 5FD2A 3EN9A 3CGOA 3ENHA 3QU0A 4NT4A 4U40A 5DT0A 2VWUA 4FVPA 4QTBA 4TY1A 2FGIA 4XEYA 2RG6A 4DEIA 3BHYA 4N0SA 4FX3A 4FZAB 5KZIA 2UZBA 2XK8A 2X7OA 5AMNA 3L8SA 4L67A 5FEQA 3RK9A 3AKLA 5EDRA 3VC4A 4HVIA 1H1QA 5CF6A 5CYIA 2WFYA 3S95A 3VS2A 4EWHA 2QC6A 5AUYA 4DEDA 4OTDA 4EL9A 4EOJA 4RLLA 3BBWA 3E87A 5KO1A 1FMOE 2QOLA 3AC3A 3P5KA 1JAMA 2VU3A 4JG7A 5TOZA 5ACBC 3CQUA 4JL9A 3UVRA 1H1RA 2UW8A 4XH6A 4YGAA 4L3PA 5ANEA 4MBJA 1LEWA 1YOLA 2CLQA 3F3ZA 3F5XA 4FOBA 1YVJA 3Q9WA 4GRBA 4FKVA 5AAFA 3D5WA 4EYMA 3TV7A 1PW2A 3E92A 1PMNA 3PPJA 3VUDA 1M2QA 2W7XA 3LXLA 4R7BA 3Q96A 4YJQA 3ZRLA 3FC2A 3VQUA 4ZOGA 4BBMA 5CF8A 4DEBA 1PYXA 3H4JA 5M53A 2JITA 2FSLX 4YJSA 2PULA 4G31A 4IC8A 3SLSA 2XNMA 4F65A 4FT7A 4IB5A 3UG2A 3KGAA 3UTOA 4WSQA 1AGWA 3VUGA 4CT2A 1YWRA 2O8YA 3PFQA 4CRSA 5ITAA 5IU2A 3CKWA 4YO6A 2R64A 1WBVA 3LQ5A 5EI6A 4BI1A 4DA5A 2E2BA 4GSBA 2XMYA 4O0RA 3BZ3A 5AEPA 1U54B 2C30A 4HYSA 3JYAA 3RAWA 2IN6A 3RZFA 4GT3A 3QTIA 4OBQA 3TMOA 3F88A 2JDVA 3RK5A 4IAKA 3F5UA 2OIQA 4NW6A 4YPSA 2JGZA 1BI8A 4ASXA 4IX6A 4CFFA 3F6XA 5HTIA 1NW1A 2GQGA 1NVQA 2J2IB 2R3PA 1YI3A 4G9CA 4IWQA 4EZ3A 3MTFA 4WT6A 3PFYA 2WTIA 2XCHA 4ZJIA 3ANQA 5M07A 3NSZA 3FLZA 3MPMA 4FT9A 3L8PA 4EH9A 4BYIA 5GZAA 3TM0A 4O83A 2PVFA 3WZKA 1J7UA 3K3IA 4WA9A 1MUOA 3JR1A 3VN9A 3DJ7A 4NW5A 2HK5A 4QTDA 2W4OA 3QD3A 5L2SA 4YZDA 2FVDA 4YJVA 2RL5A 2XK9A 4R6VA 3OG7A 4J53A 3D7TA 4RJ7A 2Q0NA 3QUDA 3FQHA 4EOOA 4F1TA 5IEYA 2CKPA 4O2PA 5HNBA 4S30A 2RFSA 3SV0A 3AGLA 5AA9A 1YOJA 1VZOA 1LR4A 3NUUA 4MD9E 4NSTA 3MIAA 3AKKA 3WYXA 4PPAA 5EYDA 4C3RA 2EB3A 1XH8A 3QZFA 5CY3A 1BI7A 2KULA 2NPQA 3ORZA 5DA3A 4DEAA 2ITXA 2JIUA 4CV9A 3R71A 4A9YA 5D41A 5F1ZA 3RALA 4D9TA 1EH4A 2YCSA 3AXWA 4O0SA 2X2LA 3A7JA 3P0MA 2OFVA 1H01A 3CQEA 3QKMA 3OCGA 4XG7A 2UVYA 3VJOA 3VBQA 3VS5A 3N4TA 4O0UA 2WTVA 5IQDA 3NNVA 1GZKA 2XUUA 5EOBA 5M09A 1O6YA 2CSNA 4BVUA 4O2ZA 3VUTA 5BVKA 2W9FB 4F0IA 3GQLA 4IANA 4E20A 3IS5A 4GJ3A 4RSSA 3WZJA 4CZUA 3UOLA 4TYJA 2FSMX 5IA4A 3FZOA 4FSRA 3BE9A 4DLJA 4R7IA 5AP5A 1XH4A 2NP8A 4CKJA 4W9XA 1U5QA 3MFRA 4KRDA 1GIHA 4BYJA 3HUBA 1BL7A 4AE9A 2GCDA 5DGZA 4FUXA 2AC3A 5JEBA 4ALUA 4DHJA 3HAMA 5IQFA 4XBUA 3DFCB 5FTOA 3V5TA 1STCE 4FV1A 5DEYA 5GHVA 4W9WA 5EK7A 2LAVA 1REJA 5JGAA 4JT3A 4HJOA 4EHVA 2VGPA 2PMNX 4HCUA 3IW8A 4BDKA 3ID6C 2E9OA 4QP8A 1ZARA 3RNIA 4ENXA 4RX9A 5CAVA 4P4CA 3DKCA 3PVGA 3VBXA 4QMSA 4NU1A 3W0PA 3NCGA 4FSNA 1Y8YA 5CX9A 3ORIA 2XP2A 1DAYA 2ITPA 3BV2A 1P5EA 2ITWA 2WIPA 5KMKA 4C35A 2WB8A 3FEGA 3UNZA 1W2DA 2B53A 2R3MA 3AC5A 3BI6A 2WMWA 4FIGA 3VBWA 4G3DA 4PX6A 1URCA 3OMVA 4RG0A 5GJGA 2EB2A 3W0NA 4CMOA 1OKZA 4FEWA 4YLJA 2PUNA 2JFLA 4BICA 2EXMA 3M1SA 2HELA 1XKKA 3UIMA 4DHIB 2BROA 5ANGA 2ONLC 3P23A 1K9AA 5M51A 3IQ7A 3C0HA 3TIZA 4ITIA 4DTAA 5CSXA 5BQ0A 3RKBA 2C5YA 2E9VA 3QYZA 4V0GB 3WOWA 2FYSA 3Q9YA 5FLFA 5JZNA 4EH6A 5JQ5A 3FI8A 4N6YA 4KBAA 4TWOA 1S9JA 4B9DA 4IVBA 2E9UA 1CKIA 4AGCA 2BDWA 4J7BA 3NUAA 3P5JC 4ZP5A 5IQIA 4EJ7A 4KD1A 4X7QA 5KKRC 3PJ2A 2PYWA 3P78A 3UIBA 2WMQA 4M13A 3TXOA 3MA3A 3ZDUA 1OPJA 2BAJA 2J9MA 3I0OA 4FBXA 4BBEA 5BUEA 2WMVA 4MX9A 3NLBA 3ITZA 4P7EA 4ZSLA 3V04A 2GMXA 5M4UA 1MRUA 4BDHA 3N51A 5EM6A 2QOCA 3UGCA 4ERKA 5GIOE 3KC3A 4EK8A 5BYYA 4RA5A 4QYHA 2J0KA 2F57A 5ETFA 1I09A 3EQPA 3FZPA 3SW4A 4DGNA 4W4WA 4KB8A 2X0PA 2A4LA 3GI3A 5DR6A 1E9HA 3UE4A 2XS0A 4CFWA 3ZM9A 4LL0A 4FV2A 3EJ1A 4FSMA 3VHKA 4O7SA 3HV3A 3KMUA 5CASA 2QOBA 3DBQA 3NYXA 3BBTB 3FLSA 3JVSA 4TRLA 1FPUA 3VUMA 2B9JA 4PUZA 4AP7A 1J7IA 5AR5A 5IQAA 1WBNA 2PY3A 2OJFE 3F3TA 5LWNA 1XH9A 5IISA 3PE2A 2FA2A 4FL1A 3HMPA 3SQQA 3QCYA 4YBJA 5DVRA 2IVUA 3ZO4A 3TUCA 2JAMA 2Z7LA 5A4QA 4FKJA 4USFA 3PYYA 3FLNC 3W32A 2ZYBA 4IIRA