3ALNA

Crystal structure of human non-phosphorylated mkk4 kinase domain complexed with amp-pnp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
307
structure length
270
Chain Sequence
SSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQYDVRSDVWSLGITLYELATGRFPYPKWTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 4
publication title Crystal structures of MKK4 kinase domain reveal that substrate peptide binds to an allosteric site and induces an auto-inhibition state
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 270
sequence length 307
chains with identical sequence B, C
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3alnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3alnA01
4J8NA 3D7TB 3M2WA 4IWDA 4YNEA 3WBLA 2BRHA 3W55A 3MVHA 2BTRA 2VWIA 4MBIA 4CQEA 2OZOA 4MEDA 4O0RA 3HGKA 4FKTA 2VTIA 2RGPA 3QQFA 2OIBA 3TTJA 1CSNA 2J5EA 3AT2A 3M1SA 4G34A 4X21A 4IZYA 3ROYA 4EH2A 3CXWA 5HG7A 4HGSA 4MXZA 1H08A 2X4FA 2Y9QA 4RWLA 5E91A 3WARA 4GS6A 4BYJA 4CV8A 4QMNA 5J7BA 1VJYA 2C5OA 4L45A 5CXHA 1YKRA 4QP2A 4UWBA 4I5CA 4X3JA 4L01A 3W33A 4FYNA 3O7LB 5L8JA 3FUPA 3WZJA 4L67A 2P55A 4TYIA 3JYAA 2FSOX 5A6OA 1UNHA 3IK3A 1IR3A 3ZTXA 4EJNA 4F9WA 1GZNA 3EL7A 4ZTRA 4Z55A 3R21A 4IX5A 3PVBA 5TT7A 2FSLX 3OFMA 4KINA 3O23A 4XRJA 1IAJA 2JAVA 5AR3A 2FSTX 3NYVA 3UO4A 2YLFA 1Y6BA 3GCVA 3KK9A 4BWXA 1CM8A 1Y8GA 4J99A 4YJNA 2P0CA 1SM2A 4FTOA 2WU7A 4Y83A 5AR5A 5EOBA 4X3FA 3R73A 3WE8A 1PMNA 3OT8A 3PY3A 5A4TA 3MPTA 4BCGA 2B9IA 4EWHA 5DLSA 3DBEA 1PXJA 2EVAA 3G90X 3LFNA 2PVYA 2E9VA 3PG1A 4GUBA 5HU9A 5E9EA 4FGBA 4KKEA 4G31A 3ANRA 5I3RA 4I21A 5TO8A 3QD2B 2C0IA 2QOQA 3BHTA 5M4UA 3MJ2A 3DTWA 4FX3A 3HX4A 5JQ5A 5M09A 2R3HA 3EMGA 3Q32A 2JD5A 1V0OA 4RG0A 4M67A 3Q2JA 3P9JA 4IMYA 2WQNA 2UUEA 2RL5A 3F3ZA 4C34A 3BYMA 1PKGA 5AIRA 3TIYA 2XF0A 4FL3A 1S9IA 4CMOA 3ZHPC 1U54B 4GSBA 3LLTA 3R63A 4PNKA 5IQEA 3OW3A 1MQBA 3P7CA 5CEOA 4KBKA 3NNUA 2ZB1A 3WILA 3KCFA 5KHXA 5T68A 3WF7A 1HCLA 1E1VA 1O6KA 1YDSE 3EQGA 4O0UA 4GK2A 2WKMA 5GZAA 4AS0A 4HZRA 3UVRA 5KKRC 3UMWA 5DT3A 5CTPA 2UZEA 3NUYA 2XIRA 3BHHA 4FF8A 4NUSA 4EC9A 5CAQA 4YGAA 3RK7A 2VN9A 5HQ0A 5E8YA 4MXAA 3FZOA 4IADA 4G3EA 4YC3A 4TYHA 4D2VA 1YVJA 4HCUA 3R8VA 2C1BA 1PXLA 3HRCA 4QMSA 5D11A 1ZYDA 3RPSA 2R0UA 2H34A 3QQUA 4ACDA 3HYHA 4IFCA 4K18A 5IPJA 4DTBA 4XP0A 2GQSA 3ORMA 4F6UA 2VX1A 4AOJA 4S31A 2O0UA 3FLSA 3RZFA 4DLJA 4IB1A 4ZTHA 4YPSA 4BDCA 4YU2A 5EOLA 2BZHB 2YM3A 1XH5A 5LOHA 3SC1A 1SVHA 3R1SA 5E1SA 4HYUA 4W8DA 3D5XA 3AXWA 3PZHA 4ZTNA 1OUYA 4RRVA 2YWPA 2XKFA 3W10A 2IO6A 2IW6A 3LFBA 3GI3A 3ZRLA 3S3IA 2UW5A 3QTQA 4EH9A 4OBPA 4GK4A 4E4MA 3PLSA 4D58A 3H4JA 4R78A 5J95A 4R8QA 2J0JA 1DM2A 4CXAA 1KE7A 1OKZA 4EZ7A 4U41A 4UMTA 3RM6A 4RWIA 4RX8A 4AZFA 1T46A 5HE1A 4IACA 4JT3A 3O51A 3U6HA 2E2BA 4CMTA 5HBHA 4U7ZA 1A48A 2OI4X 5HO7A 3WI6A 2Y4PA 4GKHA 5CT0A 2HWPA 4J97A 2RFNA 2BIYA 2W1DA 2YCRA 4LMNA 4CGAA 2B55A 2ZJWA 1RDQE 3NEWA 3QAME 4MNEA 4X2JA 1JSTA 3TXOA 4EWQA 1R3CA 5AUXA 3F66A 2HY81 4KIPA 4JDKA 3E8NA 2F7XE 2C5XA 5FM2A 2JDSA 2ZDUA 3DBDA 5CEKA 5L2TA 4OT6A 3GXLA 1ZY5A 5EW8A 5K3YA 2VTAA 4PPBA 3G15A 2OH4A 3PXFA 2CGVA 2HZ4A 2UW6A 4UMPA 3D7ZA 3VHKA 3VUKA 2W0JA 5ETIA 4EHZA 3R00A 5FXRA 2B1PA 1BMKA 2UZUE 4N57A 5BYZA 5F9EA 3OCTA 4J7BA 4NIFA 4YJPA 1YOLA 4ENXA 2JKQA 2WQOA 2O3PA 3AMBA 3NUPA 4O38A 4P7EA 5AP7A 4ZMEA 1KV2A 3QHWA 5CALA 4EK8A 1OB3A 3KN5A 1WZYA 3KULA 2A19B 2IZTA 4ACHA 2OLCA 4USFA 3FMLA 2CPKE 1IRKA 5JRSA 5KZ0A 2JFMA 4BYIA 2J5FA 1YRPA 2XEZA 3R28A 3LKMA 2HIWA 3OCSA 1MRYA 4KBAA 3KMMA 2CKQA 3DZQA 3MJ1A 4FEWA 1Q3DA 3C13A 2WMAA 3PVUA 4BDJA 3SW7A 4PDOA 2G01A 3HEGA 2OJIA 4IX6A 4JS8A 3SGCA 3GFWA 4EH6A 1MRUA 2ERKA 4FODA 5B0XA 1UU9A 5EDQA 2OXDA 2BVAA 4WKQA 5C1QB 2R3RA 3C5IA 5LXMA 4TT7A 1OUKA 5GZ8A 4F6SA 4FIHA 4R5SA 4HJOA 2IPXA 3CTHA 3W32A 3FMDA 2WQEA 1J7IA 3FWQA 5ANJA 3FC1X 1BUHA 1OMWA 4RJ7A 4WT6A 2W1FA 5DA3A 2PK9A 2BAKA 4QPMA 5M56A 4GJ2A 3KRRA 1VEBA 1F5QA 4F08A 4I6FA 4MHAA 3NX8A 2XBAA 4RQVA 3EIDA 3GCPA 3Q9YA 2UVXA 3QCSA 5CEQA 2XNOA 3O8PA 4HCVA 4O22A 4E4NA 4DGMA 4AN9A 1ZARA 3QCXA 1PXPA 3NNWA 4RJ4A 1URCA 4UWYA 2AC5A 1WBSA 3MFUA 3GU7A 2FGIA 3G0EA 3OROA 4JRVA 3QUEA 4XCUA 4QP6A 4E93A 3FMNA 4BCPA 2C3LA 3PIXA 4G3GA 4KKGA 4QYGA 4NEUA 4EC8A 1Q8WA 5TE0A 5F94A 4OLIA 3HV7A 1P4OA 2X7OA 3HMIA 4JIKA 3CS9A 3Q3BA 1OPLA 3IS5A 2OXYA 3EZRA 5JRQA 3BE2A 1DS5A 3F2RA 5FDXA 2OXXA 3AGMA 3KF4A 4Q5EA 5H3QA 2B7AA 5I9WA 3EN5A 4GU6A 3ITZA 2W5HA 5EDRA 3D7TA 3CLYA 5IA4A 3E88A 5IA3A 3QGWA 1ZMWA 5BMSA 3NUXA 4HYHA 4BTFA 5CZHA 4BZOA 4UYAA 3HV4A 3FKOA 5KNJA 4PY1A 4V05A 4M69B 4GFGA 3HZTA 4A07A 5C9CA 3KXZA 4YTHA 5LVNA 4LM5A 3QX4A 2AYPA 3CQEA 3FI3A 5HG8A 5HESA 5DWRA 2XNNA 4WNKA 1XHAA 2WIPA 2X9FA 4K6ZA 5KO1A 5HE3A 2Q83A 5CU4A 3HLLA 1YI6A 3MDYA 4DFLA 2ZAZA 2Y8OA 2PVKA 5D9HA 4YJVA 5IKWA 3BGZA 3UOLA 5M08A 2JBOA 5E4HA 2EWAA 4I4FA 3ZXZA 3R7GA 4MD9E 1E9HA 2UW8A 1P5EA 4RIWB 1Q97A 5BQ0A 3IQ7A 3KKVA 3QQJA 2IJMA 3HVCA 5IQGA 2OIQA 3VBXA 5LMKC 4JQ8A 3C4ZA 3GQIA 2IVUA 3LMGA 4C8BA 1YI3A 2QOBA 2YFXA 4QYYA 4ZLOA 5BNJA 3A62A 1R78A 3DQXA 5FTQA 4Y46A 3BYOA 2BDJA 4BI0A 4P2KA 3LMIA 2RF9A 4NT4A 1SVEA 2G1TA 2B54A 4CG9A 3SW4A 4HGLA 5HBJA 4QMOA 3OWLA 2ZOQA 4EH7A 3UO5A 2PUIA 3GU6A 4QQ5A 2BR1A 3SKCA 1NVSA 2Z7QA 5CLPA 2H8HA 3Q4ZA 3UQCA 3H9FA 4EI4A 3OF0A 4MQ1A 4NCTA 5IQDA 2XK8A 4BKJA 3CGOA 4C4GA 5DR6A 1F0QA 3PP0A 5HCXA 4LGGA 3ALNA 4FNYA 4L8MA 4IEBA 4XH6A 3T8OA 3V51A 3VJNA 5HVJA 4XNEA 1J1BA 4RMZA 4NFMA 3LE6A 4FEUA 4BI1A 2QI8A 3FHRA 3A8XA 3DK3A 3OXTA 3TEIA 4EHEA 1U54A 4I1ZA 4QMTA 4ZP5A 2J0LA 1PXIA 1UU8A 2OSCA 3UQFA 3ZLWA 3FMEA 3CD8A 3OBGA 4WRSA 4AP7A 2V0DA 2YCSA 3MB6A 3POOA 4W8EA 3NW6A 4DH7A 5HTBA 3C7QA 1AGWA 4IVDA 5FQDC 4ZOGA 5A4CA 3C0IA 2V5QA 3REPA 4DYMA 1ZZLA 3EHAA 3CTJA 3I6UA 5FDPA 4Q9SA 5B2LA 1R1WA 1IAHA 3E3BX 2Q0NA 3TWJA 4FV1A 4CQGA 3UMXA 2PUPA 1FMOE 1APME 3CR0A 3UVQA 2CN8A 3OT3A 3QUPA 4DHFA 4KRDA 4UXLA 3GC8A 3W8QA 2UZOA 3Q6UA 4BCIA 1OIYA 4HVHA 2JKMA 2WTCA 3FQEA 3UBDA 4OGRA 3EKNA 1XH9A 4IM3A 4IAZA 5A6NA 1U59A 1OECA 4QTCA 1M52A 5JKGA 2A2AA 5CAOA 3FLWA 5M55A 4NM7A 2O8YA 2VWBA 3R04A 4MXYA 4ZK5A 3UIXA 3QZFA 4E5WA 4GCJA 1XR1A 4YP8A 4RQKA 3EN4A 5AMNA 1M14A 3O8UA 4FKGA 3QHRA 4H3QA 4BHZA 4CV9A 1PMUA 4CFXA 5J79A 4G3FA 3GUBA 2ONLA 3MY0A 3M11A 3P23A 4IC7A 4PL3A 2GNJA 2VTNA 4O7YA 5AP4A 2JIIA 2OF2A 2PMNX 3NCZA 4G3CA 4G9RA 4TYGA 3RPYA 4DEAA 2XZSA 4DA5A 2PL0A 4MF1A 5HI2A 3QYZA 3UGCA 2WELA 2Z7LA 3DAJA 4IJ9A 4EOIA 3IOKA 4FEXA 3QZHA 3OC1A 5AM7A 1M7QA 3MN3A 3GGFA 5AR8A 4QP4A 5ACBC 3R7VA 4BDAA 3IONA 5HTIA 3F88A 2XA4A 3R7IA 5H9BA 2VWXA 3KN6A 3QTIA 2OWBA 4ENYA 2EXMA 2ZMDA 4GU9A 4B8MA 3CKWA 3PSBA 2UZVA 3HMOA 4XV1A 4BIEA 1XWSA 3Q6WA 3TNIA 3A61A 1K2PA 3ZFXA 3RJCA 3GQLA 4Y95A 4A4LA 5IEVA 3K5UA 5EM6A 2BIKB 2CLXA 2Z7RA 3OTUA 3L8VA 4FG9A 5E8WA 4FKIA 1FINA 4QQJA 2X8EA 5C03A 5A14A 5LMBA 3QRJA 3COHA 2WMXA 3QYWA 4JDIA 4OTQA 3RPVA 3F2NA 4BGQA 3U87A 3LXLA 3PVGA 3IECA 1YI4A 4UZHA 5FM3A 5CU2A 2UZLA 4FV2A 1E1XA 4ALWA 3ORZA 3I6WA 4PTGA 3QLFA 3D5WA 3EB0A 2XS0A 3E7OA 5KBQA 2BZIB 5J1WA 5AAFA 4IVBA 2FUMA 3AOXA 4QOXA 3UJGA 3ZLXA 3MIYA 4K8AA 4YO6A 4MBJA 2I0VA 4ACCA 4FKRA 4XOYA 2OJGA 4MD7E 3CE3A 5KMOA 3FZSA 3NMUF 4RC2A 5L2QA 4ZZNA 5JZJA 5IA2A 3QTSA 3LAUA 4AW5A 4FV4A 4KIKB 2OW3A 2WB8A 5TR6A 4L44A 2GHGA 3MTLA 3O2MA 4PQNA 4U8ZA 4X2KA 2I7QA 1H1WA 5IUIA 4A06A 2C6TA 3QRTA 4GH2A 5FTOA 4C58A 4RPVA 5JFSA 4TZRA 1MUOA 3CJFA 3R8ZA 5HICA 5G6VA 4TYJA 4JAIA 3BGQA 3W18A 1UVRA 3QTUA 3OVVA 2ITXA 3GCSA 3FYKX 3PVWA 3MY1A 4HVDA 2WMSA 3NLBA 3W2QA 1JBPE 3FQSA 5E1EA 5HVKA 5IH5A 4AX8A 5E90A 2X1NA 4ZXTA 4M13A 4RZVA 4K77A 3NIEA 4OW8A 4D9TA 4F7NA 3BEAA 5AEPA 4EJ7A 2J6MA 2W1HA 2ITZA 3OUKA 1J7LA 3BZ3A 3NAYA 1FVVA 2BKKA 2PSQA 4JBVA 4CEGA 5CNOA 5BUJA 3TDVA 4W9XA 2QOIA 1KSWA 2RIOA 2C5VA 4YHFA 2CCIA 3DKGA 3EQRA 5D7VA 3RCJA 4C59A 2YZLA 1BL6A 2CCHA 3E62A 3QQLA 3EQFA 4YLKA 3I4BA 5KMMA 3NVMB 2C6KA 4O91A 2GQRA 3P79A 4XHKB 3DT1A 4KS7A 4FTQA 3UOHA 3KEXA 1XH4A 5H8BA 4LRJA 3DCVA 3QCYA 4UXQA 3TV6A 3NPCA 3PJ2A 1SZMA 4PX6A 2ZV8A 3C0GA 3TM0A 4AZVA 3BQCA 5F4NA 1SNXA 3FV8A 4MWIA 2JC6A 2OO8X 5FEQA 5EQEA 3TL8A 4U43A 3W2CA 1EH4A 4IDVA 2B9FA 5KMLA 4QMZA 1XO2B 4F1MA 4XJ0A 4O0SA 2BAJA 4DITA 1Q61A 2ZV9A 4G3DA 5AFVA 4DEEA 2UZBA 2J90A 1DI8A 3MA6A 4ZZMA 4PDYA 1GIJA 3KULB 3D0EA 2QOHA 1BX6A 3FMMA 4JAJA 4FSTA 3D83A 3UP7A 2ZV2A 3E64A 4M69A 1T45A 5K4JA 3UIMA 2UW9A 3ID6C 2JFLA 4II5A 4IAKA 2ITWA 4RVTA 4G5PA 3FZPA 2BAQA 2PUNA 4MXCA 3PPJA 4OTDA 1JWHA 2BKZA 4LUDA 5CAVA 1JKSA 5DVRA 2R3KA 3ZUUA 4AZTA 5HCYA 5AP6A 3ZONA 4CVAA 4IAAA 2C68A 5D41A 4A7CA 2YAKA 1YHVA 2OZAB 3GEQA 5FTGA 1JKLA 1GZOA 1H28A 2JDOA 5C01A 1UU3A 2YCQA 3ULZA 4CTCA 2XKDA 3PA3A 4WSQA 4RIWA 1LP4A 5DGZA 3OY1A 3BYSA 4FV9A 3PPZA 5FUTA 3ZC6A 2NO3A 4OUCA 3E8EA 3PWYA 3Q04A 3Q52A 3BRBA 4JDJA 4JX7A 4Z7GA 5HZNA 2QG7A 3VS4A 5J5SA 4YPDA 2EU9A 5AUYA 4J8MA 3BU5A 2WOTA 3FBVA 3TN8A 3UNKA 1XJDA 2GS7A 3LFEA 4BCMA 1H1QA 2W9ZB 5JT2A 2WTKB 4PF4A 3PY1A 1BLXA 1RJBA 4BN1A 1Q8YA 2YM6A 2GS2A 3FSKA 2WNTA 4UYNA 3E8CA 3DLSA 4FSZA 4EONA 4PP9A 4RJ8A 5DT0A 4BR3A 5B2KA 2NRYA 2VTMA 4NSTA 5L2SA 5HGIA 3MY5A 5D10A 2VWVA 4P4CA 4C2VA 4NTTA 1OPJA 2C69A 4GT5A 5AP0A 5HCZA 5E8VA 5M4CA 3I81A 3KU2A 2IZRA 4YTCA 2BROA 4D4YA 3GC0A 2W5AA 1DI9A 4I0SA 4TWPA 3RAIA 2VWWA 4BBEA 3Q60A 3WZEA 3PRFA 2EXEA 2XIYA 3MFSA 3ZEPA 4B9DA 4PMPA 1Z5MA 4OTHA 2RG6A 2DS1A 2XKEA 2VX3A 5HEZA 3ORTA 3SXRA 1XBAA 4L52A 1B6CB 4UEUA 4AA0A 1H8FA 4EHVA 4QTEA 4XG7A 4IX4A 3EQPA 4ANQA 3PG3A 4CNHA 3TKHA 4R5YA 3F7ZA 4FSMA 3CGFA 1PYEA 3C4XA 2REIA 4C2WA 2HYYA 4DEDA 2UZNA 2VWUA 3UZPA 2VTRA 4QMYA 5AUUA 1BI8A 5L3AA 1LR4A 4XP3A 3QBNA 3ZBXA 4F7JA 2HXQA 3R7OA 4M84A 3KVXA 3I1AA 4PTEA 4WUAA 3KA0A 3VQHA 3PXQA 3OEFX 4NM0A 5JN2A 5CSPA 2R3QA 2DQ7X 1QPCA 2ITUA 2I1MA 3LCDA 4O0WA 1I09A 4M97A 1OL1A 3KMUA 4S30A 5ACKA 4OTPA 3WF5A 4CT1A 2R3FA 3RAWA 4WOVA 2CGUA 2JKKA 2DWBA 2QOCA 2IVTA 2BZKB 2OFVA 4W4YA 4I5PA 2WTIA 3VVHA 1UU7A 3ELJA 3ZXTA 4ARKA 4V0GA 4PMSA 4EORA 5KMKA 3R22A 4KABA 3C4FA 1ZYLA 2CKOA 3QZIA 4RVLA 3RP9A 3UDBA 4DGLC 4N4SA 4MVFA 1HCKA 5KX8A 1WFCA 5LJJA 3NWWA 3P5KA 4M68A 4FSRA 3IGGA 5CSVA 5K4IA 3PJ1A 4U44A 4CRSA 2PULA 2HK5A 5DHJA 1GY3A 4DLIA 4YJQA 2WO6A 2BHEA 4C57A 3QTWA 2X4ZA 4XUFA 4QQCA 4AFEA 2WTWA 2OICA 2C47A 3BE9A 2RFDA 2XK9A 4FBXA 4FT0A 4WIHA 3ZMMA 5AAGA 4ZAUA 4I0RA 5CF8A 3QL8A 1IA9A 2DUVA 2E9NA 4XG8A 3EYHA 2BTSA 3VRYA 1WCCA 5CEPA 3QWKA 2QODA 3JY9A 1H26A 2YERA 4IE9A 5AX9A 2DYLA 3QWJA 4CG8A 3FMKA 4RFYA 5K0KA 3FEGA 3PXRA 1ZOGA 2JLDA 3EQCA 5CU0A 4EOSA 1JKTA 1YHWA 3A7FA 2JBPA 1PXKA 2C3IB 4LI5A 5I4NA 4YC8A 4J1RA 3BHUA 4FG8A 1G5SA 4ANBA 4BGGA 4DF3A 2WQBA 5E8UA 1PJKA 4NW6A 4L46A 1O6YA 5CEMA 1Y6AA 5L6OA 5E7RA 3B8QA 4UY9A 2R0IA 5LWMA 2PE0A 3UC4A 3KVWA 2XYUA 3ZZEA 4ASZA 5EKNA 4XG3A 5DR2A 3KQ7A 4ZS0A 4B8LA 2BRGA 3NCGA 3Q9XA 2JDVA 3D2IA 3TNHA 1MP8A 4MBLA 2QOOA 4E6QA 4KIKA 4HYSA 4N0SA 5D7AA 4DH8A 4UN0C 2FYSA 2LAVA 3SQQA 1FMKA 4RA4A 2V7AA 3IW5A 3TUCA 2OIDA 4FKQA 3NR9A 3LM0A 1NY3A 4I6BA 4FE2A 4P5ZA 2ITVA 1BKXA 3FMHA 5IISA 3KRLA 3MYGA 2QLUA 3UG1A 4AWIA 1OKWA 4AFJA 3HRFA 4CLIA 3SOCA 3ZFYA 4JQEA 3A99A 2ACXA 3OG7A 3ZO4A 4RC4A 5C4KA 4ANMA 4YC6A 2XRUA 3BU3A 3QRUA 2NRUA 3DNEA 3VS5A 5DG5A 4OAUC 3KRWA 4YHTA 3ATTA 5IUHA 4IW0A 3MH2A 2IW9A 2XP2A 1WAKA 5DRBA 2RFSA 4OTRA 4FGRA 3TDWA 3THBA 3QTXA 3PYYA 3VUTA 2XNPA 2W4JA 4ID7A 2QKWB 3LFDA 3SV0A 4GYIA 3H0ZA 2QQ7A 5IA1A 1UV5A 3DOGA 2CNVA 5DOSA 3BKBA 3FL4A 1WBNA 4G6LA 3SXFA 4ZY4A 4EOOA 2R3JA 4FV8A 4FVPA 3ZO1A 2YEXA 2HCKA 1M17A 4J52A 1ZMVA 4UV0A 3RAHA 1NVQA 2WPAA 3PXZA 4FKSA 4O6EA 4KSPA 5AR2A 4HYIA 3VUMA 1OVEA 2OH0E 2ZM1A 4EQCA 4YTFA 4ZLYA 4ZJVA 2G9XA 1SMHA 2OJ9A 2X8IA 3MI9A 3CY3A 2C6EA 5DIAA 2J51A 3E92A 3ZM4A 2W1ZA 2JKOA 3MS9A 3NRMA 3LHJA 4RT7A 3BHVA 3WYXA 4D0XA 4F9AA 3AC4A 4H3BA 4FTUA 1W8CA 3QRIA 4QMLA 2PZPA 4XBRA 5D12A 1FGIA 1PHKA 4WRGA 3N4TA 1TQPA 3OTVA 2X2LA 4HVGA 2Y4IB 4BY9E 4BL1A 3IDPA 3VNTA 1YXVA 4F65A 5I9ZA 4YJTA 3F3VA 2X7FA 4RWKA 3D94A 4PPCA 3U4UA 4F9BA 2YABA 4JRNA 5HIEA 3VBWA 2WQMA 4FMQA 1CTPE 2WMRA 4O21A 3UTOA 3UIBA 5M53A 3NS9A 3VUDA 2VO3A 1CKPA 4DEIA 4FK6A 3FY2A 3ZS5A 1GZKA 5DH3A 5AV0A 1KOAA 2YHVA 4DN5A 4JJRA 4X3FC 5I5ZA 1O9UA 3WZKA 4M15A 5IQAA 5FBOA 4CYIA 4YSMA 1LUFA 3BWJA 3M42A 4MD8E 4AQCA 4W9WA 1H4LA 3ZSGA 4IAIA 4L00A 4CRLA 3R7YA 1ZLTA 2C6IA 5IA5A 1OIRA 1JKKA 2BZJA 2OZAA 5LQFA 3HAMA 2QR8A 3MA3A 2XK6A 1K9AA 3MPMA 3R1NA 1WBOA 1VR2A 2JDTA 3R01A 5BVWA 4JNWA 3R8MA 2YZAA 3U6JA 3ODZX 2GNGA 5I9XA 3C0HA 1YWVA 3AC5A 4ZEGA 2BMCA 3DZOA 1WVYA 4YBJA 3TKIA 3V5QA 3LPBA 2GNLA 4TWCA 4D9UA 5H2UA 5LVLA 2C6MA 3RHXA 3BV3A 2R3NA 1R0PA 4KRCA 4D5HA 1TQIA 2UW0A 3V04A 2FA2A 4L7SA 4O6LA 2VTOA 3F9NA 3LIJA 5DPVA 2VWZA 2UV2A 4FNWA 4FT9A 5DBXA 5M44A 4FT5A 1WVWA 4XRLA 4IVCA 4E3CA 1W0XC 3LFQA 3ORNA 1FBNA 3DY7A 3KFAA 3OY3A 5FLFA 5DMZA 4U5JA 4XYFA 3DGKA 1YWNA 2VTSA 4JOAA 3ACJA 2EUFB 5CVHA 1W82A 4IQ6A 4C36A 1Q8UA 1PXOA 2GU8A 3G6GA 4GIHA 4NYEA 3KXMA 2HZ0A 4QMXA 3W2SA 4JLCA 1YXTA 3ZDIA 2FSMX 1LPUA 3PA4A 3I7CA 4F4PA 1JOWB 2C5YA 4F7SA 4FKVA 3LCOA 2LGCA 5EW9A 2B4SB 1U46A 2ITNA 4GVAA 4U6RA 3NZ0A 3OUNB 5AV2A 3AT3A 1Z9XA 5GIPE 4CCUA 2J4ZA 5AUVA 5D1JA 2O5KA 3LCTA 4PWNA 4WG3A 5TF9A 4TW9A 1WBVA 4S32A 4BICA 3KGAA 4IWQA 4ZS4A 4ZSJA 3UP2A 2QOKA 2RKUA 4RX5A 4IX3A 4QQTA 1JAMA 4LL0A 4ZLZA 3TCPA 4IBMA 5M4IA 4EK5A 4EUTA 4M12A 4R1VA 4YSJA 3OWPA 4ANLA 3S1HA 2AUHA 3NYXA 4A4XA 4JR3A 4OBQA 3C5UA 3DXNA 5ANEA 3ZFMA 5K9IA 2QHMA 2C6OA 4BGHA 5ICPA 3RMFA 1V0PA 3IW6A 4E73A 4A9YA 4P90A 4PUZA 3AC2A 4J53A 4FL2A 4QP7A 1NVRA 5EYDA 1ZYCA 2ETMA 2YJRA 3AMAA 4G17A 5DRDA 4DG2E 4YUQA 3EQIA 5DI1A 5AP1A 3ZH8A 4ASXA 3TUDA 2W5BA 1XKKA 3MB7A 4FTAA 4YJOA 3GNIB 4FTRA 3OBJA 3OS3A 2QOLA 4J95A 4A9UA 5LMAA 2VO6A 5DYJA 5EH0A 4MH7A 1ND4A 2QHNA 2XBJA 4FTTA 3VO3A 2VX0A 5ANKA 4CZUA 4EH8A 4F63A 5IDNA 2XIKA 4KSQA 2JITA 2RG5A 4F09A 4RIOA 5HLWA 2J0IA 4QMWA 3V8SA 1H0WA 3MVMA 4HVSA 3UG2A 4G16A 2YIYA 1STCE 3FDNA 2W1EA 4I5MA 3VF8A 1ZY4A 4BDIA 4C4FA 2ZMCA 5IQIA 3O7LD 4O0XA 4M8TA 1NW1A 1B38A 1ZOHA 2YDJA 4X2NA 4FOBA 4BVUA 5M4FA 1YW2A 2YA9A 4GFMA 3EH9A 2O2UA 1FQ1B 1GIIA 1NXKA 3RK9A 1PW2A 4FVQA 4DFZE 4YZMA 3T3VA 3C1XA 3CBLA 3EQDA 5CI6A 3UIUA 2CN5A 4O2PA 5AA9A 3F82A 3V5TA 4Z9LA 2R3OA 2WZJA 5BVFA 4NH1A 5ETAA 2HENA 4BCFA 5IF1A 3ZSIA 5IQHA 5HHWA 1CDKA 4IAFA 1Y91A 5AV1A 3VQUA 3DDQA 4FTCA 1CKJA 3ALOA 1DAYA 1PKDA 1U4DA 2NP8A 3FXWA 5A4EA 5L2IA 3LFFA 2R7BA 3SOAA 5GJGA 2OBJA 2W99B 3Q2MA 5EHYA 4ITHA 2Z60A 4AF3A 4HVIA 1XH7A 2AC3A 3WOWA 4DH1A 5FD2A 2QO9A 4DINA 5AAEA 5CANA 2ETKA 2GSFA 3U9CA 2PHKA 2XRWA 3AC3A 4BRXA 4CMUA 3OEZA 3QQKA 4M0ZA 4EQMA 4NW5A 5CU6A 4I94A 2OKRA 3QALE 4ZSEA 5K5XA 4FV0A 3U54A 4AU8A 5HTCA 3DBQA 5HG9A 3EFWA 1JVPP 3VW6A 4IB0A 5CQWA 5IQFA 3MH1A 3TTIA 3L8SA 3QTRA 3I5NA 4AZWA 3N51A 4KB8A 2QURA 5CI7A 3VS7A 4WA9A 3RVGA 4BDEA 2WTKC 4JI9A 4RFZA 3NYNA 1CKIA 1GOLA 3C4EA 3BELA 3I7BA 4U97A 3V8TA 4ITIA 4LRMA 3B2WA 3HECA 4KIQA 4M3QA 3WF6A 4BWPA 3DDPA 3HUCA 4HW7A 1G8AA 3PZEA 1OITA 3LVPA 4V0GB 3HP5A 3MV5A 3NSZA 4FZAB 3BGPA 5EM7A 4BI2A 4F9CA 1M2QA 2YIWA 5CF5A 3C4WA 2WTVA 3LCKA 3TNWA 4LRKA 2OK1A 3F5UA 3GCUA 3HAVA 5AX3A 4H3PA 2ITYA 5JMSA 5J9LA 3VJOA 4CFNA 5G1XA 4C33A 3HA8A 4XP2A 2QKRA 1YQJA 5HD7A 4AXAA 4GIIA 2EXCX 2UW4A 2X9EA 4QD6A 4BDBA 4F6WA 2R4BA 3DK6A 4U0IA 4R3CA 5CZIA 5EYKA 3UQGA 5C4LA 5L4QA 3IW8A 1KE9A 4D4RA 3ENMA 3IOPA 3L9PA 3OCBA 4FYOA 4JG8A 4X2GA 3R8UA 2JAMA 3EOCA 5CQUA 3ET7A 2PMLX 4IXPA 4NJDA 2GDOA 2EB3A 4W4WA 5EDPA 3PE2A 3SX9A 3QA8A 5L8KA 2WGJA 3E5AA 4TWNA 5EYMA 3I0QA 3L9MA 4UWCA 2V22A 3VULA 4JIAA 4DGGA 5CYIA 5KMJA 3SD0A 2CMWA 4KKHA 5CASA 3W8LA 1IA8A 2A4LA 2PVNA 5CSXA 4DG0E 1UNLA 4BTJA 3FXXA 3JS2A 3R8PA 1P14A 2WOUA 4LOPA 3HDNA 4FTLA 3O8TA 2J7TA 3QLGA 3HV6A 3KXHA 1Q62A 1UWJA 2V7OA 5JSMA 2NNWB 3BI6A 4BC6A 4ZSLA 3BEGA 5HG5A 4U45A 3HV5A 3FI8A 3GFEA 1RQQA 3AGLA 4BCNA 4ASDA 4DFBA 2J50A 3PLAE 4GRBA 4PRJA 1TKIA 4NWMA 3EN6A 4PMMA 4OR5A 3PJCA 1XH6A 4O27B 5DEWA 4BBMA 4CZTA 3G5DA 3ZM9A 3CPCA 1OGUA 1ZYJA 3CQWA 3ORPA 3UPXA 2O64A 5BVNA 3UZTA 2VD5A 3R1YA 4PL5A 4XX9A 5A4LA 3DKOA 4L6QA 1JSVA 2W4KA 5GHVA 5C27A 4UMRA 2X81A 3W2OA 2GMXA 2QU5A 3P78A 4FC0A 5KE0A 5JGAA 5L2WA 4ZSGA 4FKOA 4AACA 5AUTA 4X0MA 4Y72A 3FSFA 3UNJA 4JBQA 2ZYBA 3ERKA 1OKVA 2IVSA 4XLIA 4K11A 5IEXA 4LG4A 2UZDA 3SVVA 5FGKA 3BU6A 4AZSA 2CGXA 4NCTC 2PMOX 4RJ5A 2WEVA 2C0OA 4C4HA 4Z3VA 3RBWA 3A7GA 3DKCA 3LJ2A 2C1AA 2GTMA 4EOLA 3HDMA 5BUEA 2BPMA 3G2FA 3WZUA 4D55A 4E7WA 4ZTLA 4YHJA 3A4OX 4BIDA 1LEWA 5LCJA 4CTBA 5EI6A 5M57A 1H07A 1URWA 2PYWA 1WMKA 3W2PA 3FZ1A 2ITOA 2VGPA 3GT8A 4M14A 4GV1A 4Y8DA 2QONA 2F57A 1OIUA 4GFOA 4YZNA 3RNYA 4EOMA 2F2UA 4XV3A 3IPHA 4FT3A 3H10A 1YHSA 3NNXA 4I93A 4ZY6A 3QXPA 4GJ3A 2I40A 5IH6A 2YIRA 2ZB0A 2OGVA 4DGOA 3MFRA 4RX9A 3NDMA 3JVRA 4QTDA 1M2PA 4CFUA 1OM1A 5A46A 5GJFA 3R9OA 4A9SA 5H8GA 3BLQA 2XKCA 4ZJJA 2ZV7A 1IASA 4EOQA 4HPTE 1FPUA 4KWPA 2ERZE 4PL4A 3JVSA 4BTKA 4F7LA 4C37A 2QO7A 5IA0A 4C0TA 3ACKA 4E4XA 2VTLA 4X6RA 4L42A 4E6AA 2R9SA 2ESMA 2VGOA 3ZRKA 1Q5KA 5HBEA 2BFXA 3OXZA 5BVKA 4IM0A 4B4LA 4CKJA 2A1AB 3NW7A 4O7ZA 1U5RA 4O86A 1YWRA 1XBBA 4X2FA 5FEEA 5HLNA 3ZLYA 4ZY5A 1NA7A 3DB6A 4AGDA 3AG9A 3SHEA 4FSWA 2XEYA 4J98A 4U40A 3UOJA 5EFQA 2YWVA 3RGFA 3FPMA 2Y6OA 1YOMA 3AC1A 4R3RA 5DNRA 3IDBA 4DT8A 5LCKA 3E63A 3TZ7A 2ONLC 2YLEA 3V8WA 1I44A 5EK7A 2J0KA 3PUPA 4O81A 4IZ7A 3RWQA 5FRIA 5BUIA 5LVMA 3OWKA 1KE8A 4ERKA 3BLRA 4Y85A 4BHNA 3QXOA 4KAOA 4RLLA 2BRNA 3I60A 2GHLA 3EFKA 3GOKA 1FOTA 1PXMA 1PF8A 3QFVA 3ZC5A 4E5BA 4AGCA 3R2YA 5IZFA 3NYOA 5C8MA 5CNNA 3QQHA 4NKAA 4S34A 3S2PA 4I23A 4D4VA 4H1MA 4R1YA 5AV3A 1KOBA 3BYUA 2W96B 2UZWE 3L9LA 2X0GA 5C8NA 4QTBA 4AW0A 4R6VA 4YURA 3FZTA 2PVHA 3R2BA 5HNIX 3RNIA 4XS2A 1Y57A 4FICA 1ZZ2A 3FL5A 4FSQA 4L7FA 5EYCA 5I3OA 4ALVA 1ZRZA 4YR8A 3QC9A 5HU3A 3PA5A 3PXYA 5KBRA 3HV3A 3P86A 4U9AA 2YM4A 3VRZA 3LQ8A 1KE6A 3COKA 4R7BA 3QKMA 3IG7A 3LW0A 5FXSA 4PP7A 3FLQA 3EJ1A 3R9NA 4XG4A 4O7VA 3ZSHA 2Z02A 5HVYA 2W9FB 4RVKA 4YJRA 2VO7A 5CT7A 5KHWA 3B8RA 3Q4CA 5CF4A 4I5HA 1PY5A 3EFLA 3I0OA 5CWZA 5JGBA 4CT2A 2VU3A 3DFCB 3GU4A 4LQMA 2O65A 3H3CA 2WU6A 4FUXA 3KRJA 2GS6A 3VUGA 3MPAA 4TPTA 4LV8A 3COMA 3LXPA 4O7SA 4AT4A 2OG8A 2KTYA 4RIXB 2F2CB 5BYLA 3BPRA 4CYJA 4GUEA 4O0VA 1ZMUA 5EHOA 4PV0A 5HD4A 3LLAA 3ETAA 5AA8A 4O7RA 4WUNA 4JXFA 3OWJA 1XH8A 4K33A 4A4OA 4ANOA 5JFWA 1IEPA 4DCEA 4R7IA 4AN2A 4APCA 1QPDA 2HZNA 1VYZA 3H30A 4OTFA 4V01A 3WZDA 1DAWA 2X7GA 1OBDA 3GU5A 4K9YA 5EHLA 4B0GA 5JFXA 1BYGA 2R3GA 4DCAA 4BF2A 2X39A 2WXVA 4AUAA 4PPAA 3JY0A 3L9NA 1J91A 2WMBA 1A9UA 2Z7SA 3UZRA 4D0WA 3NW5A 2CKPA 5AUZA 4E6CA 4FIEA 5CY3A 3GOPA 3OD6X 2PVMA 3VUHA 1VZOA 2WMVA 4FZ6A 3QD4A 3MWUA 2Q0BA 2B0QA 3MIAA 4YZ9A 3PE1A 5HNGA 2PWLA 4QP3A 1QPEA 3G0FA 3I5ZA 1Q41A 2X2KA 5EW3A 2BCJA 5KMNA 4UZDA 5A54A 3P4KA 4FTJA 1H1SA 1W83A 2XJ0A 3L8PA 3LQ5A 2Y7JA 1S9JA 4C38A 4YMJA 5EI8A 3NGAA 2JDRA 4I22A 4A9TA 3GBZA 4E26A 4EZ3A 3FC2A 3PDTA 3ODYX 5H8EA 4H39A 1ZAOA 3P0MA 1X8BA 3EQBA 4NKSA 3VBQA 3VHEA 4KS8A 2CSNA 2YDIA 4IWOA 4WNMA 3RPOA 3VWAA 2PVRA 2R3MA 5BVOA 4BCQA 3CTQA 2PZ5A 5CVFA 1R0EA 3IGOA 3OHTA 3Q5ZA 4N6ZA 4XG9A 5CVGA 2RFEA 2SRCA 4IB5A 5FXQA 3UO6A 5I9YA 5GIOE 5CS6A 3ORLA 5HKMA 1QL6A 3F5XA 5E8SA 4N6YA 3TJDA 2HZIA 3FYJX 3GC7A 5C26A 3IO7A 4AW2A 3NVKI 2VTQA 5CSWA 2GTNA 5IH4A 3T9TA 3DBFA 3SG8A 4YLLA 5EQPA 2XH5A 4WG5A 3PPKA 3LXNA 1SYKA 4QYHA 4UMUA 5LVPA 2WEIA 2HW6A 4FEQA 4PDSA 4IH8A 2PE1A 2ITTA 4FSYA 4LUEA 4YBKA 5HO6A 4D2TA 2XNMA 2CHLA 2I0EA 2VWYA 3D14A 4K0YA 4D2RA 4EK3A 2BALA 2YM5A 3BWFA 2W06A 4FV5A 5KCVA 2XJ2A 3PIYA 3UPZA 5HX6A 3RALA 4BDFA 1G3NA 1OZ1A 2P33A 3F3WA 3FZRA 3NNVA 4FKPA 2RSVA 4AT5A 4JX3A 1UNGA 3DV3A 5ETCA 4BTMA 2P3GX 2YAAA 5CSHA 3ZO3A 5BVDA 3TV4A 5CENA 5AJQA 3RI1A 3ZOSA 4DFNA 4XG6A 4IJPA 3MVJA 4CSVA 2XCKA 4IZAA 4Y73A 3MH3A 1GNGA 1WBTA 3Q4UA 3R71A 4EHGA 3AQVA 4O1OA 4RFMA 5GNKA 2O63A 3F61A 4CKIA 2XIZA 2WIHA 5E8TA 4QP8A 4EBVA 5L6PA 1GIHA 1CMKE 4XMOA 4RIYB 4WD5A 1AD5A 1YDRE 3D15A 4HOKA 1B39A 3MVLA 5B7VA 4MX9A 4RC3A 3I79A 4DBXA 4NJ3A 3UVPA 3ANQA 3V6SA 3FKNA 4TY1A 4JQ7A 4XEYA 3S4QA 4FNZA 2FVDA 4M7IA 3QZGA 2XIXA 1YOJA 2I6LA 5TOZA 2C3KA 3IW4A 4RA5A 3V6RA 5C8KA 1H00A 3G51A 4FKJA 2HELA 4MKCA 4AOTA 3QD3A 3VS1A 3F5PA 4FIIA 5CX9A 2XNGA 2XJ1A 4F64A 4CKRA 4Q9ZA 4O84A 4OTIA 4XV9A 4DTAA 3BIZA 1O6LA 3W2RA 4A9RA 5IEYA 3UYSA 3UNZA 1JNKA 3OMVA 3VF9A 1H24A 4NU1A 4FV6A 3HL7A 4F0GA 3LMHA 4O0TA 4C4EA 3V5PA 4JVGA 3E3PA 4QMQA 2GFSA 4DEHA 3EFJA 4GMYA 4QTAA 3WIKA 4C3RA 3POZA 4D2SA 4FIFA 1Y8YA 4DG3E 2JEDA 4JG7A 4F0FA 2XB7A 4ASEA 3QKLA 4FTKA 5DE2A 3U6IA 3K5VA 1OBGA 2WAJA 1Q4LA 3HMNA 2GCDA 2G2FA 1YDTE 4MCVA 1L3RE 1SNUA 2Z8CA 4YZBA 1M2RA 3PSCA 3R7EA 3AD6A 3W16A 3TJCA 3DXPA 3R9RA 1PMEA 1W84A 3H0YA 3WF8A 5IMEA 5DFPA 3LXKA 5JZNA 2VAGA 4DFYA 3T3UA 2B9JA 5AP5A 2PMIA 3G9NA 4CLJA 3EQHA 3D2KA 1KV1A 3EWHA 3QX2A 4KBCA 4QMMA 3VN9A 3VS0A 3UC3A 5LMKA 2J9MA 2IZUA 3VIDA 3V5WA 3MGYA 5CEIA 1QPJA 2B53A 4P5QA 5K5NA 2Y6MA 2WTJA 3PTGA 3P1AA 3R1QA 3A7IA 5AM6A 4ZTQA 3SA0A 3DPKA 4U42A 2XK7A 2YACA 2F4JA 1GAGA 1Q3WA 4FKUA 2BFYA 4FOCA 4C61A 4GL9A 3CIKA 3ORXA 3SAYA 3GU8A 3HMPA 4IVAA 2C6LA 4HCTA 4AG8A 2PTKA 5L8LA 4JBOA 4GG7A 1R39A 1JPAA 3F7WA 4ZIMA 1YXSA 2F49A 2A0CX 4D1XA 2VRXA 3PRIA 4G2FA 4LL5A 2YN8A 4LFIA 4N70A 1WBPA 3CEKA 1G8SA 2QCSA 3K3JA 2JGZA 4BZDA 3NUAA 4IIRA 2WMTA 3GENA 5FBNC 2OJFE 4FV3A 4F1TA 2R2PA 2VNWA 2J2IB 4GT4A 2X8DA 3FI2A 3ORKA 3FJQE 2W7XA 3MESA 3L1SA 5EG3A 3DA6A 4S2ZA 2PVFA 5ITAA 2IN6A 3SXSA 4D5KA 3MW1A 3LJ0A 2C30A 3LFAA 2BHHA 4WBBB 3ROCA 5JQ8A 3PFQA 3ZUVA 2QVSE 5L6WL 1OIQA 2JIVA 3E7VA 4NM3A 4ZTSA 3FLNC 3MBLA 3KK8A 3BQRA 4KA3A 3SLSA 4DH3A 2UVYA 3OZ6A 4PTCA 4BCKA 4AGUA 3FMJA 5EI2A 4YO4A 4FZFB 3TUBA 4LMUA 3G9LX 5CAUA 3NAXA 1MRVA 4O1PA 1K3AA 4YZCA 1W98A 4AT3A 2WMQA 3TZ9A 2UW3A 4C3FA 4DC2A 4C4IA 3NUSA 3OCGA 4BIBA 1GZ8A 2ZDTA 3LFSA 4L3LA 3F69A 4DTKA 4GVJA 2HWOA 4RZWA 3ZRMA 5HNBA 1WVXA 4I3ZA 1H0VA 3O50A 2I0YA 2P2HA 3KC3A 3ENHA 4JG6A 4Q2AA 3TT0A 4D28A 4NK9A 4U3ZA 3SRVB 5FG8A 2WMWA 2PVJA 4NZWB 2BRBA 3E87A 2IVVA 2B9HA 2QC6A 3HMMA 5HIDA 4BBFA 4GKIA 3B2TA 5IMXA 3FQHA 4QPSA 2QOFA 3Q5IA 4XLVA 1Q99A 4FL1A 4ZJIA 2VTHA 2YDKA 5AWMA 2X6DA 5HOAA 4RBLA 2OJJA 3R30A 5AR7A 4D2WA 4FZ7A 3DU8A 4O7TA 1MQ4A 2GPHA 3EN7A 3CC6A 4EH5A 3IDCA 2VTJA 4RIXA 5E8XA 3U9NA 4O83A 4YLJA 2IG7A 4EKKA 4IC8A 5HE2A 5IG1A 5I9VA 5A4QA 4WG4A 1IG1A 4AAAA 4RVMA 3RWPA 4F1OA 3PY0A 2PE2A 1J3HA 3DB8A 3C9WA 3A8WA 5AADA 4FZDB 4EL9A 5J9ZA 4BDDA 4QNYA 4K1BA 4EYMA 2FH9A 3FLZA 4FTMA 4U3YA 2HW7A 2KULA 3FXZA 2CJMA 4YTIA 3C50A 4F99A 2XYNA 4W4XA 4AE6A 1Q8TA 3BLHA 4DFXE 4AA5A 4NL0A 2C0TA 3WE4A 3F3UA 3P08A 4DE4A 4QPAA 4FIJA 4L43A 4BFMA 3HNGA 4IFGA 3BHYA 4FV7A 3NUNA 3DKFA 4OTGA 4WBOA 3TIZA 4G1WA 4EOPA 3TNPC 3RM7A 4GG5A 4QRCA 5BVEA 3QD0A 2FB8A 3Q53A 1Q24A 4NTSA 4Z7HA 5JGDA 3A7JA 3BCEA 2BDWA 4I24A 2G15A 1REJA 5AIKA 1F3MC 5JEBA 3TACA 3PWDA 3L8XA 4XBUA 3FPQA 3ZEWA 4D1SA 4H36A 2ZM4A 4TNDA 4O7NA 3FE3A 3KRXA 3LM5A 3TV7A 2XK4A 3Q4TA 2GNFA 3QRKA 1XQZA 1OL5A 4IDTA 1NT2A 3JUHA 3PXKA 1ERKA 5ANGA 4BCOA 2XNEA 4YZDA 3RZBA 5KKRB 1W7HA 3O96A 2HAKA 3AMYA 3JPVA 2QU6A 2E9UA 2V62A 4O2ZA 5HO8A 5DEYA 5BYYA 3N9XA 3G33A 3ORIA 4QMUA 4DAWA 4TKSA 3U4WA 3VUIA 2BDFA 4UBAA 1YXXA 2R5TA 3II5A 4EQUA 3DJ6A 4BCJA 1YXUA 3V3VA 3CD3A 5ETFA 5J8IA 3R9HA 2CNUA 3ATSA 3R83A 1LEZA 3Q96A 4MXOA 3KXGA 4PNIA 3HUBA 4FA2A 1BL7A 2WMUA 2GNHA 3CKXA 3FHIA 2R64A 3UYTA 2QR7A 2W4OA 5IDPA 4O7LA 4QP1A 4DGNA 2VTPA 2F9GA 1UA2A 3CQUA 4GYGA 4KD1A 5FP5A 4C3PA 3K54A 4BKYA 5AV4A 1V1KA 5J87A 3HA6A 4EBWA 5IU2A 3D9VA 4L3PA 4FG7A 3QKKA 3N4UA 3D5UA 3PIZA 4TN6A 4QP9A 4TRLA 3ULIA 4LOQA 3DNDA 4H1JA 4CFWA 5AR4A 3QU0A 4RLKA 4U80A 5KUPA 4BDGA 4D1ZA 4GW8A 2YJSA 4MXXA 3COIA 3EYGA 4YJSA 5LWNA 5EM5A 4L3JA 4OT5A 1OL7A 4G6OA 4G9CA 4BZNA 5CU3A 4QMPA 4WNOA 2Y0AA 2YIQA 5K0XA 4W4VA 2VUWA 4FI1A 3BX5A 3Q9ZA 4HNFA 1JSUA 1GJOA 2Z2WA 4EK6A 4M66A 3EZVA 2H9VA 3MH0A 4RIYA 5GZ9A 2I0HA 3HRBA 2XNBA 5JH6A 3KB7A 5EQYA 4DEGA 3TZMA 4DT9A 3JR1A 2W17A 4UALA 4F9YA 1Z57A 4MWHA 2VNYA 2PZRA 4QT1A 3UODA 3V5JA 1VYWA 4Y5HA 5JFVA 3LCSA 3AD4A 3V01A 2QLQA 3F6XA 3DQWA 1OL2A 3EN9A 3F3TA 1P2AA 5FEDA 3FI4A 4EZ5A 3OP5A 4R77A 2WHBA 2B52A 2PUUA 4IAYA 2IWIA 4CCBA 5IQBA 4CD0A 3HP2A 4K2RA 3LJ1A 4L68A 2JIUA 4D4SA 2PY3A 4ORKA 2QG5A 4L53A 3DBCA 4NFNA 4FKWA 2BILB 4FUYA 4DEBA 5DT4A 3CY2A 4G5JA 5J7HA 4ANSA 2GNIA 4AW1A 2YISA 5M51A 4DFUA 3ZCLA 1ZYSA 4MNFA 4BWKA 2P2IA 4X3FB 4BCHA 4TXCA 3FLYA 3DJ7A 4ACMA 3QQGA 4LV5A 4ZTMA 2J0MB 4RX7A 1J7UA 4E4LA 2IZSA 3ZUTA 2PVLA 3CP9A 3KCKA 5AP3A 3O17A 5HIBA 3QC4A 3E8DA 4X7QA 4EH3A 3ZO2A 3DFAA 4EOJA 1L8TA 1REKA 1QMZA 1ZXEA 4WHZA 2HXLA 3GP0A 4ZMFA 5KZIA 4MF0A 2ZVAA 3EKKA 3QF9A 5F20A 3K2LA 5J5TA 3NUUA 4LOOA 5HORA 3KXNA 3DJ5A 4QYFA 5AP2A 4KUJA 2XUUA 4FKLA 4E5AX 4GK3A 3KY2A 4U79A 4V04A 2F7ZE 3RAKA 2OFUA 4C02A 5KMIA 5CAPA 5A9UA 3OOMA 1OPKA 4YJUA 1AQ1A 5FP6A 5T3QA 3LZBA 4KNBA 2R3LA 4HGEA 2CDZA 4I92A 2V55A 3H9OA 5ANDA 2GFCA 3FKLA 3UOKA 3WF9A 5M07A 2W1CA 3RPRA 4TTHB 3TI1A 3PSDA 2NPQA 2XM8A 2PZIA 4HPUE 4IZ5A 4MTAA 1QCFA 4QNAA 1FGKA 4MK0A 2YCFA 4B99A 4BDHA 4TWOA 4LGHA 3CCNA 3R0TA 3CJGA 5B2MA 5BPYA 1TQMA 4MYGA 1ZOEA 3KXXA 4XOZA 4JR7A 2IW8A 3JXWA 3DLZA 2YIXA 2CLQA 4I6QA 1UWHA 4XG2A 3U51A 3VBYA 5FWKK 4S33A 4PMTA 4MQ2A 4AOIA 4EEVA 1PYXA 4BKZA 2GQGA 4RJ6A 4OAVB 4B6LA 1PXNA 4TYHB 1JQHA 5A3XA 5ANOA 2ITPA 3A2CA 2W1GA 1RE8A 3DXQA 3DAKA 3KF7A 2VTTA 1V0BA 3QCQA 4FSUA 4I20A 5EKOA 3R7UA 1ZWSA 2X2MA 4USEA 2OU7A 1TVOA 2C4GA 3ZZWA 3MFTA 5HE0A 1H1PA 4G6NA 1FVTA 2R3PA 3K3IA 4XV2A 5BMMA 2A27A 3SG9A 2P4IA 2H96A 4EH4A 2UVZA 4OTWA 3TNQB 5JK3A 4FR4A 2QD9A 3VS3A 3G6HA 3R6XA 3PP1A 3RINA 5E8ZA 1H01A 2G2HA 3DS6A 3QUDA 1ATPE 4AA4A 4C4JA 4WO5A 4C7TA 4CFFA 4TL0A 3CSVA 4CFVA 3TZ8A 2E9OA 4ZSAA 4UX9A 4O0YA 4IM2A 3E93A 5GJDA 3SRVA 2XM9A 4O82A 4C62A 2YM7A 4R7HA 5F95A 3OW4A 2OF4A 4QO9A 3KMWA 1BI7A 3RKBA 1A06A 3ZLSA 2PPQA 1WBWA 3VS2A 4EOKA 1H27A 5IUGA 5J1VA 3PJ8A 2BRMA 4O96A 4H58A 5T6KA 4FK3A 1SVGA 4WNPA 3NIZA 4LGDA 4MNEB 3RTPA 1H1RA 3VC4A 3QTZA 4CZYB 4IANA 5AUWA 2VZ6A 3BBTB 4APPA 1KUTA 3ZDUA 3A4PA 3GVUA 3N4VA 2XK3A 1P4FA 4ALUA 4IB3A 1FVRA 3RK5A 3F5GA 3VS6A 3S95A 3SDJA 3R9DA 2VO0A 4UB7A 2H6DA 1JLUE 3F2AA 3U55A 3QGYA 1OL6A 3AT4A 3OOGA 3O71A 4QYEA 4F0IA 4J96A 5J9YA 3W1FA 5GINE 2WFYA 3UE4A 3VW8A 3R8LA 2XMYA 2HOGA 4AE9A 2FO0A 3RCDA 4NIFB 4MAOA 4NM5A 3A7HA 4E20A 4LYNA 4FVRA 2E9PA 4FTIA 5BX0A 4H05A 1J1CA 4B7TA 4F70A 2ITQA 1HOWA 3PJ3A 4I4EA 3TG1A 4GEOA 3TKUA 5EM8A 5LVOA 3AD5A 4ITJA 4X6QC 4E1ZA 3MSSA 4AGWA 4OBOA 4JL9A 1UKHA 2CKEA 2UZTA 2C5NA 3EL8A 4HGTA 3DAEA 3D5VA 4Z16A 4EK4A 1H25A 2ETRA 4USDA 2HY0A 2ZM3A 3C4CA 4JBPA 4R3PA 3FAAA 2G2IA 3KREA 5M06A 3LFCA 3LOKA 2QNJA 4PDPA 1KWPA 4HZSA 5LARA 5HX8A 3IW7A 4M0YA 4RWJA 3VAPA 3P7AA 4QMVA 4GT3A 4I41A 2WD1A 3RHKA 4FEVA 3R02A 2XVDA 4AZEA 3S0OA 3GCQA 5I0BA 3BYVA 2R7IA 3BBWA 3CPBA 3AC8A 5ANIA 2Y4IC 2F7EE 4TYEA 1U5QA 2YITA 4UMQA 4BB4A 4EYJA 3DTCA 4RSSA 1OI9A 5HLPA 3VBTA 4D2PA 5I9UA 2W1IA 3V5LA 4L9IA 4HNIA 2YM8A 5F1ZA 1OKYA 3DK7A 4IHPA 4ONAA 4RJ3A 3C51A 3HKOA 1XBCA 4U81A 3MTFA 3WYYA 3LQ3A 4J71A 4EKLA 3WIGA 4ACGA 4O7WA 4C35A 1Q8ZA 3BV2A 4FSNA 3A60A 4TNBA 1RW8A 4YNOA 3T9IA 3ZU7A 2PZYA 2R3IA 2W05A 4FIGA 4Y5QA 3OXIA 3GC9A 4FT7A 3IKAA 3FY0A 5IQCA 2C3JA 5CXZA 3KL8A 4KIOA 1KE5A 4FNXA 4JDHA 3U8WA 3QA0A 2BUJA 5DR9A 3VBVA 4DBNA 3S00A 2PU8A 1UKIA 3H9RA 2GHMA 4I0TA 5TKDA 2X6EA 2C6DA 3GB2A 5DN3A 2QO2A 2XCHA 3Q9WA 2UW7A 2WTDA 4RGJA 1PRYA 3P7BA 4ANNA 4Q5HA 4FTNA 4BDKA 2EB2A 4IWPA 4AN3A 4E6DA 3O0GA 4E8AA 3ZBFA 2CGWA 2CNQA 3D4QA 2VV9A 3ZYAA 4I6HA 5E92A 5CF6A 1M7NA 4EUUA 4ZZOA 4ERWA 4CFMA 4WSYA 1PMVA 4DH5A
chains in the Genus database with same CATH superfamily
4J8NA 3D7TB 3M2WA 4IWDA 4YNEA 3WBLA 2BRHA 3W55A 3MVHA 2BTRA 2VWIA 4MBIA 4CQEA 2OZOA 4MEDA 4O0RA 3HGKA 4FKTA 2VTIA 2RGPA 3QQFA 2OIBA 3TTJA 1CSNA 2J5EA 3AT2A 3M1SA 4G34A 4X21A 4IZYA 3ROYA 4EH2A 3CXWA 5HG7A 4HGSA 4MXZA 1H08A 2X4FA 2Y9QA 4RWLA 5E91A 3WARA 4GS6A 4BYJA 4CV8A 4QMNA 5J7BA 1VJYA 2C5OA 4L45A 5CXHA 1YKRA 4QP2A 4UWBA 4I5CA 4X3JA 4L01A 3W33A 4FYNA 3O7LB 5L8JA 3FUPA 3WZJA 4L67A 2P55A 4TYIA 3JYAA 2FSOX 5A6OA 1UNHA 3IK3A 1IR3A 3ZTXA 4EJNA 4F9WA 1GZNA 1W2FA 3EL7A 4ZTRA 4Z55A 3R21A 4IX5A 3PVBA 5TT7A 2FSLX 3OFMA 4KINA 3O23A 4XRJA 1IAJA 2JAVA 5AR3A 2FSTX 3NYVA 3UO4A 2YLFA 1Y6BA 3GCVA 3KK9A 3W0NA 4BWXA 1CM8A 1Y8GA 4J99A 4YJNA 2P0CA 1SM2A 4FTOA 2WU7A 4Y83A 5AR5A 5EOBA 4X3FA 3R73A 3WE8A 1PMNA 3OT8A 3PY3A 5A4TA 3MPTA 4O4EA 2B9IA 4BCGA 4EWHA 5DLSA 3DBEA 1PXJA 2EVAA 3G90X 3LFNA 2PVYA 2E9VA 3PG1A 4GUBA 5HU9A 5E9EA 4FGBA 4KKEA 4G31A 3ANRA 5I3RA 4I21A 5TO8A 3QD2B 2C0IA 2QOQA 3BHTA 5M4UA 3MJ2A 3DTWA 4FX3A 3HX4A 5JQ5A 5M09A 2R3HA 3EMGA 3Q32A 2JD5A 1V0OA 4RG0A 4M67A 2AQXA 3Q2JA 3P9JA 4IMYA 2WQNA 2UUEA 2RL5A 3F3ZA 4C34A 3BYMA 1PKGA 5AIRA 3TIYA 2XF0A 4FL3A 1S9IA 4CMOA 3ZHPC 1U54B 4GSBA 3LLTA 3R63A 4PNKA 5IQEA 3OW3A 1MQBA 3P7CA 5CEOA 4KBKA 3NNUA 2ZB1A 3WILA 3KCFA 5KHXA 5T68A 3WF7A 1HCLA 1E1VA 1O6KA 1YDSE 3EQGA 4O0UA 4GK2A 2WKMA 5GZAA 4AS0A 4HZRA 3UVRA 5KKRC 3UMWA 5DT3A 5CTPA 2UZEA 3NUYA 2XIRA 3BHHA 4FF8A 4NUSA 4EC9A 5CAQA 4YGAA 3RK7A 2VN9A 5HQ0A 5E8YA 4MXAA 3FZOA 4IADA 4G3EA 4YC3A 4TYHA 4D2VA 1YVJA 4HCUA 3R8VA 2C1BA 1PXLA 3HRCA 4QMSA 5D11A 3W0SA 1ZYDA 3RPSA 2R0UA 2H34A 3QQUA 4ACDA 3HYHA 4IFCA 4K18A 5IPJA 4DTBA 4XP0A 2GQSA 3ORMA 4F6UA 2VX1A 4AOJA 4S31A 2O0UA 3FLSA 3RZFA 4DLJA 4IB1A 4ZTHA 4YPSA 4BDCA 4YU2A 5EOLA 2BZHB 2YM3A 1XH5A 5LOHA 3SC1A 1SVHA 3R1SA 5E1SA 4HYUA 4W8DA 3D5XA 3AXWA 3PZHA 4ZTNA 1OUYA 4RRVA 2YWPA 2XKFA 3W10A 2IO6A 2IW6A 3LFBA 3GI3A 3ZRLA 3S3IA 2UW5A 3QTQA 4EH9A 4OBPA 4GK4A 4E4MA 3PLSA 4D58A 3H4JA 4R78A 5J95A 4R8QA 2J0JA 1DM2A 4CXAA 1KE7A 1OKZA 4EZ7A 4U41A 4UMTA 3RM6A 4RWIA 4RX8A 4AZFA 1T46A 5HE1A 4IACA 4JT3A 3O51A 3U6HA 2E2BA 4CMTA 5HBHA 4U7ZA 1A48A 2OI4X 5HO7A 3WI6A 2Y4PA 4GKHA 5CT0A 2HWPA 4J97A 2RFNA 2BIYA 2W1DA 2YCRA 4LMNA 4CGAA 2B55A 2ZJWA 1RDQE 3NEWA 3QAME 4MNEA 4X2JA 1JSTA 3TXOA 4EWQA 1R3CA 5AUXA 3F66A 2HY81 4KIPA 2XAOA 4JDKA 3E8NA 2F7XE 2C5XA 5FM2A 2JDSA 2ZDUA 3DBDA 5CEKA 5L2TA 3PUFC 4OT6A 3GXLA 1ZY5A 5EW8A 5K3YA 2VTAA 4PPBA 3G15A 2OH4A 3PXFA 2CGVA 2HZ4A 2UW6A 4UMPA 3D7ZA 3VHKA 3VUKA 2W0JA 5ETIA 4EHZA 3R00A 5FXRA 2B1PA 1BMKA 2UZUE 4N57A 5BYZA 5F9EA 3OCTA 4J7BA 4NIFA 4YJPA 1YOLA 3KIOC 4ENXA 2JKQA 2WQOA 2O3PA 3AMBA 3NUPA 4O38A 4P7EA 5AP7A 4ZMEA 1KV2A 3QHWA 5CALA 4EK8A 1OB3A 3KN5A 1WZYA 3KULA 2A19B 2IZTA 4ACHA 2OLCA 4USFA 3FMLA 2CPKE 1IRKA 5JRSA 5KZ0A 2JFMA 4BYIA 2J5FA 1YRPA 2XEZA 3TMOA 3R28A 3LKMA 2HIWA 3OCSA 1MRYA 4KBAA 3KMMA 2CKQA 3DZQA 3MJ1A 4FEWA 1Q3DA 4BJJA 3C13A 2WMAA 3PVUA 4BDJA 3SW7A 4PDOA 2G01A 3HEGA 2OJIA 4IX6A 4JS8A 3SGCA 3GFWA 4EH6A 1MRUA 2ERKA 4FODA 5B0XA 1UU9A 5EDQA 2OXDA 2BVAA 4WKQA 5C1QB 2R3RA 3C5IA 5LXMA 4TT7A 1OUKA 5GZ8A 4F6SA 4FIHA 4R5SA 4HJOA 2IPXA 3CTHA 3W32A 3FMDA 2WQEA 1J7IA 3FWQA 5ANJA 3FC1X 1BUHA 1OMWA 4RJ7A 4WT6A 2W1FA 5DA3A 2PK9A 2BAKA 4QPMA 5M56A 4GJ2A 3KRRA 1VEBA 1F5QA 4F08A 4I6FA 4MHAA 3NX8A 2XBAA 4RQVA 3EIDA 3W0RA 3GCPA 3Q9YA 2UVXA 3QCSA 5CEQA 2XNOA 3O8PA 4HCVA 4O22A 4E4NA 3NFGB 4AQKA 4DGMA 4AN9A 1ZARA 3QCXA 1PXPA 3NNWA 4RJ4A 1URCA 4UWYA 2AC5A 1WBSA 3MFUA 3GU7A 2FGIA 3G0EA 3OROA 4JRVA 3QUEA 4XCUA 4QP6A 4E93A 3FMNA 4BCPA 4LDTA 2C3LA 3PIXA 4G3GA 4KKGA 4QYGA 4NEUA 4EC8A 1Q8WA 5TE0A 5F94A 4OLIA 3HV7A 1P4OA 2X7OA 3HMIA 4JIKA 3CS9A 3Q3BA 1OPLA 3IS5A 2OXYA 3EZRA 5JRQA 3BE2A 1DS5A 3F2RA 5FDXA 2OXXA 3AGMA 3KF4A 4Q5EA 5H3QA 2B7AA 5I9WA 3EN5A 4GU6A 1W2CA 3ITZA 2W5HA 5EDRA 3D7TA 3CLYA 5IA4A 3E88A 5IA3A 3QGWA 1ZMWA 5BMSA 3NUXA 4HYHA 4BTFA 5CZHA 4BZOA 4UYAA 3HV4A 3FKOA 5KNJA 4PY1A 4V05A 4M69B 4GFGA 3HZTA 4A07A 5C9CA 3KXZA 4YTHA 5LVNA 4LM5A 3QX4A 2AYPA 3CQEA 3FI3A 5HG8A 5HESA 5DWRA 2XNNA 4WNKA 1XHAA 2WIPA 2X9FA 4K6ZA 5KO1A 5HE3A 2Q83A 5CU4A 3HLLA 1YI6A 3MDYA 4DFLA 2ZAZA 2Y8OA 2PVKA 5D9HA 4YJVA 5IKWA 3BL9A 3BGZA 3UOLA 5M08A 2JBOA 5E4HA 2EWAA 4I4FA 3ZXZA 3R7GA 4MD9E 1E9HA 2UW8A 1P5EA 4RIWB 1Q97A 5BQ0A 3IQ7A 3KKVA 3QQJA 2IJMA 3HVCA 5IQGA 2OIQA 3VBXA 5LMKC 4JQ8A 3C4ZA 3GQIA 2IVUA 3LMGA 4C8BA 3P5JC 1YI3A 2QOBA 2YFXA 4QYYA 4ZLOA 5BNJA 3A62A 1R78A 3DQXA 5FTQA 4Y46A 3BYOA 2BDJA 4BI0A 4P2KA 3LMIA 2RF9A 4NT4A 1SVEA 2G1TA 2B54A 4CG9A 3SW4A 4HGLA 5HBJA 4QMOA 3OWLA 2ZOQA 4EH7A 3UO5A 2PUIA 3GU6A 4QQ5A 2BR1A 3SKCA 1NVSA 2Z7QA 5CLPA 2H8HA 3Q4ZA 3UQCA 3H9FA 4EI4A 3OF0A 4MQ1A 4NCTA 5IQDA 2XK8A 4BKJA 3CGOA 4C4GA 5DR6A 1F0QA 3PP0A 5HCXA 4LGGA 3ALNA 4FNYA 4L8MA 4IEBA 4XH6A 3T8OA 4DHZA 3V51A 3VJNA 4QEBA 5HVJA 4XNEA 1J1BA 3AKLA 4RMZA 4NFMA 3LE6A 1TZDA 4FEUA 4BI1A 2QI8A 3FHRA 3A8XA 3DK3A 3OXTA 3TEIA 4EHEA 1U54A 4I1ZA 4QMTA 4ZP5A 2J0LA 1PXIA 1UU8A 2OSCA 3UQFA 3ZLWA 3FMEA 3CD8A 3OBGA 4WRSA 4AP7A 2V0DA 2YCSA 3MB6A 3POOA 4W8EA 3NW6A 4DH7A 5HTBA 3C7QA 1AGWA 4IVDA 5FQDC 4ZOGA 5A4CA 3C0IA 2V5QA 3REPA 4DYMA 1ZZLA 3EHAA 3CTJA 3I6UA 5FDPA 4Q9SA 5B2LA 1R1WA 1IAHA 3E3BX 2Q0NA 3TWJA 4FV1A 4CQGA 3UMXA 2PUPA 1FMOE 1APME 3CR0A 3UVQA 2CN8A 3OT3A 3QUPA 4DHFA 4KRDA 4UXLA 3GC8A 3W8QA 2UZOA 3Q6UA 4BCIA 1OIYA 4HVHA 2JKMA 2WTCA 3FQEA 3UBDA 4OGRA 3EKNA 1XH9A 4IM3A 4IAZA 5A6NA 1U59A 1OECA 4QTCA 1M52A 5JKGA 2A2AA 5CAOA 3FLWA 5M55A 4NM7A 2O8YA 2VWBA 3R04A 4MXYA 4ZK5A 3UIXA 3QZFA 4E5WA 4GCJA 4DDIA 1XR1A 4YP8A 4RQKA 3EN4A 5AMNA 1M14A 3O8UA 4FKGA 3QHRA 4H3QA 4BHZA 4CV9A 1PMUA 4CFXA 5J79A 4G3FA 3GUBA 2ONLA 3MY0A 3M11A 3P23A 4IC7A 4PL3A 2GNJA 2VTNA 4O7YA 5AP4A 2JIIA 2OF2A 2PMNX 3NCZA 4G3CA 4G9RA 4TYGA 3RPYA 4DEAA 2XZSA 4DA5A 2PL0A 4MF1A 5HI2A 3QYZA 3UGCA 2WELA 2Z7LA 3DAJA 4IJ9A 4EOIA 3IOKA 4FEXA 3QZHA 3OC1A 5AM7A 1M7QA 3MN3A 3GGFA 5AR8A 4QP4A 5ACBC 3R7VA 4BDAA 3IONA 5HTIA 3F88A 2XA4A 3R7IA 5H9BA 2VWXA 3KN6A 3QTIA 2OWBA 4ENYA 2EXMA 2ZMDA 4GU9A 4B8MA 3CKWA 3PSBA 2UZVA 3HMOA 4XV1A 4BIEA 1XWSA 3Q6WA 3TNIA 3A61A 1K2PA 3ZFXA 3RJCA 3GQLA 4Y95A 4A4LA 5IEVA 3K5UA 5EM6A 2BIKB 2CLXA 2Z7RA 3OTUA 3L8VA 4FG9A 5E8WA 4FKIA 1FINA 4QQJA 2X8EA 5C03A 5A14A 5LMBA 3QRJA 3COHA 2WMXA 3QYWA 4JDIA 4OTQA 3RPVA 3F2NA 4BGQA 3U87A 3LXLA 3PVGA 3IECA 1YI4A 4UZHA 5FM3A 5CU2A 2UZLA 4FV2A 1E1XA 4ALWA 3ORZA 3I6WA 4PTGA 3QLFA 3D5WA 3EB0A 2XS0A 3E7OA 5KBQA 2BZIB 5J1WA 5AAFA 4IVBA 2FUMA 3AOXA 4QOXA 3UJGA 3ZLXA 3MIYA 4K8AA 4YO6A 4MBJA 2I0VA 4ACCA 4FKRA 4XOYA 2OJGA 4MD7E 3CE3A 5KMOA 3FZSA 3NMUF 4RC2A 5L2QA 4ZZNA 5JZJA 5IA2A 3QTSA 3LAUA 4AW5A 4FV4A 4KIKB 2OW3A 2WB8A 5TR6A 4L44A 2GHGA 3MTLA 3O2MA 4PQNA 4U8ZA 4X2KA 2I7QA 1H1WA 5IUIA 4A06A 2C6TA 3QRTA 4GH2A 5FTOA 4C58A 4RPVA 5JFSA 4TZRA 1MUOA 3CJFA 3R8ZA 5HICA 5G6VA 4TYJA 4JAIA 3BGQA 3W18A 1UVRA 3QTUA 3OVVA 2ITXA 3GCSA 3FYKX 3PVWA 3MY1A 4HVDA 2WMSA 3NLBA 3W2QA 1JBPE 3FQSA 5E1EA 5HVKA 5IH5A 4AX8A 5E90A 2X1NA 4ZXTA 4M13A 4RZVA 4K77A 3NIEA 4OW8A 4D9TA 4F7NA 3BEAA 5AEPA 4EJ7A 2J6MA 2W1HA 2ITZA 3OUKA 1J7LA 3BZ3A 3NAYA 1FVVA 2BKKA 2PSQA 4JBVA 4CEGA 5CNOA 5BUJA 3TDVA 4W9XA 2QOIA 1KSWA 2RIOA 2C5VA 4YHFA 2CCIA 3DKGA 3EQRA 5D7VA 3RCJA 4C59A 2YZLA 1BL6A 2CCHA 3E62A 3QQLA 3EQFA 4YLKA 3I4BA 5KMMA 3NVMB 2C6KA 4O91A 2GQRA 3P79A 4XHKB 3DT1A 4KS7A 1W2DA 4FTQA 3UOHA 3KEXA 1XH4A 5H8BA 4LRJA 3DCVA 3QCYA 4UXQA 3TV6A 3NPCA 3PJ2A 1SZMA 4PX6A 2ZV8A 3C0GA 3TM0A 4AZVA 3BQCA 5F4NA 1SNXA 3FV8A 4MWIA 2JC6A 2OO8X 5FEQA 5EQEA 3TL8A 4U43A 3W2CA 1EH4A 4IDVA 2B9FA 5KMLA 4QMZA 1XO2B 4F1MA 4XJ0A 4O0SA 2BAJA 4DITA 1Q61A 2ZV9A 4G3DA 5AFVA 3UDSA 4DEEA 2UZBA 2J90A 1DI8A 3MA6A 4ZZMA 4PDYA 1GIJA 3KULB 3D0EA 2QOHA 1BX6A 3FMMA 4JAJA 4FSTA 3D83A 3UP7A 2ZV2A 3E64A 4M69A 1T45A 5K4JA 3UIMA 2UW9A 3ID6C 2JFLA 4II5A 4IAKA 2ITWA 4RVTA 4G5PA 3FZPA 2BAQA 2PUNA 4MXCA 3PPJA 4OTDA 1JWHA 2BKZA 4LUDA 5CAVA 2XANA 1JKSA 5DVRA 2R3KA 3ZUUA 4AZTA 5HCYA 5AP6A 3ZONA 4CVAA 4IAAA 2C68A 5D41A 4A7CA 2YAKA 1YHVA 2OZAB 3GEQA 5FTGA 1JKLA 1GZOA 1H28A 2JDOA 5C01A 1UU3A 2YCQA 3ULZA 4CTCA 2XKDA 3PA3A 4WSQA 4RIWA 1LP4A 5DGZA 3OY1A 3BYSA 4FV9A 3PPZA 5FUTA 3ZC6A 2NO3A 4OUCA 3E8EA 3PWYA 3Q04A 3Q52A 3BRBA 4JDJA 4JX7A 4Z7GA 5HZNA 2QG7A 3VS4A 5J5SA 4YPDA 2EU9A 5AUYA 4J8MA 3BU5A 2WOTA 3FBVA 3TN8A 3UNKA 1XJDA 2GS7A 3LFEA 4BCMA 1H1QA 2W9ZB 5JT2A 2WTKB 4PF4A 3PY1A 1BLXA 1RJBA 4BN1A 1Q8YA 2YM6A 2GS2A 3FSKA 2WNTA 4UYNA 3E8CA 3DLSA 4FSZA 4EONA 4PP9A 4RJ8A 5DT0A 4BR3A 5B2KA 2NRYA 2VTMA 4NSTA 5L2SA 5HGIA 3MY5A 5D10A 2VWVA 4P4CA 4C2VA 4NTTA 1OPJA 2C69A 4GT5A 5AP0A 5HCZA 5E8VA 5M4CA 3I81A 3KU2A 2IZRA 4YTCA 2BROA 4D4YA 3GC0A 2W5AA 1DI9A 4I0SA 4TWPA 3RAIA 2VWWA 4BBEA 3Q60A 3WZEA 3PRFA 2EXEA 2XIYA 3MFSA 3ZEPA 4B9DA 4PMPA 1Z5MA 4OTHA 2RG6A 2DS1A 2XKEA 2VX3A 5HEZA 3ORTA 3SXRA 1XBAA 4L52A 1B6CB 4UEUA 4AA0A 1H8FA 4EHVA 4QTEA 4XG7A 4IX4A 3EQPA 4ANQA 3PG3A 4CNHA 3TKHA 4R5YA 3F7ZA 4FSMA 3CGFA 1PYEA 3C4XA 2REIA 4C2WA 2HYYA 4DEDA 2UZNA 2VWUA 3UZPA 2VTRA 4QMYA 5AUUA 1BI8A 5L3AA 1LR4A 4XP3A 3QBNA 3ZBXA 4F7JA 2HXQA 3R7OA 4M84A 3KVXA 3I1AA 4PTEA 4WUAA 3KA0A 3VQHA 3PXQA 3OEFX 4NM0A 5JN2A 5CSPA 2R3QA 2DQ7X 1QPCA 2ITUA 2I1MA 3LCDA 4O0WA 1I09A 4M97A 1OL1A 3KMUA 4S30A 5ACKA 4OTPA 3WF5A 4CT1A 2R3FA 3RAWA 4WOVA 2CGUA 2JKKA 1G8JA 2DWBA 2QOCA 2IVTA 2BZKB 2OFVA 4W4YA 4I5PA 2WTIA 3VVHA 1UU7A 3ELJA 3ZXTA 4ARKA 4V0GA 4PMSA 4EORA 5KMKA 3R22A 4KABA 3C4FA 1ZYLA 2CKOA 3QZIA 4RVLA 3RP9A 3UDBA 4DGLC 4N4SA 4MVFA 1HCKA 5KX8A 1WFCA 5LJJA 3NWWA 3P5KA 4M68A 4FSRA 3IGGA 5CSVA 5K4IA 3PJ1A 4U44A 4CRSA 3W0PA 2PULA 2HK5A 5DHJA 1GY3A 4MUQA 4DLIA 4YJQA 2WO6A 2BHEA 4C57A 3W0OA 3QTWA 2X4ZA 4XUFA 4QQCA 4AFEA 2WTWA 2OICA 2C47A 3BE9A 2RFDA 2XK9A 4FBXA 4FT0A 4WIHA 3ZMMA 5AAGA 4ZAUA 4I0RA 5CF8A 3QL8A 1IA9A 2DUVA 2E9NA 4XG8A 3EYHA 2BTSA 3VRYA 1WCCA 5CEPA 3QWKA 2QODA 3JY9A 1H26A 2YERA 4IE9A 5AX9A 2DYLA 3QWJA 4CG8A 3FMKA 4RFYA 5K0KA 3FEGA 3PXRA 1ZOGA 2JLDA 3EQCA 5CU0A 4EOSA 1JKTA 1YHWA 3A7FA 2JBPA 1PXKA 2C3IB 4LI5A 5I4NA 4YC8A 4J1RA 3BHUA 4FG8A 1G5SA 4ANBA 4BGGA 4DF3A 2WQBA 5E8UA 1PJKA 4NW6A 4L46A 1O6YA 5CEMA 1Y6AA 5L6OA 5E7RA 3B8QA 4UY9A 2R0IA 5LWMA 2PE0A 3UC4A 3KVWA 2XYUA 3ZZEA 4ASZA 5EKNA 4XG3A 5DR2A 3KQ7A 4ZS0A 4B8LA 2BRGA 3NCGA 3Q9XA 2JDVA 3D2IA 3TNHA 1MP8A 4MBLA 2QOOA 4E6QA 4KIKA 4HYSA 4N0SA 5D7AA 4DH8A 4UN0C 2FYSA 2LAVA 3SQQA 1FMKA 4RA4A 2V7AA 3IW5A 3TUCA 2OIDA 4FKQA 3NR9A 3LM0A 1NY3A 4I6BA 4FE2A 4P5ZA 2ITVA 1BKXA 3FMHA 5IISA 3KRLA 3MYGA 2QLUA 3UG1A 4AWIA 1OKWA 4AFJA 3TYKA 3HRFA 4CLIA 3SOCA 3ZFYA 4JQEA 3A99A 2ACXA 3OG7A 3ZO4A 4RC4A 5C4KA 4ANMA 4YC6A 2XRUA 3BU3A 3QRUA 2NRUA 3DNEA 3VS5A 5DG5A 4OAUC 3KRWA 4YHTA 3ATTA 5IUHA 4IW0A 3MH2A 2IW9A 2XP2A 1WAKA 5DRBA 1OGYA 2RFSA 4OTRA 4LV7A 4O4FA 4FGRA 3TDWA 3THBA 3QTXA 3PYYA 3VUTA 2XNPA 2W4JA 4ID7A 4AXFA 2QKWB 3LFDA 3SV0A 4GYIA 3H0ZA 2QQ7A 5IA1A 1UV5A 3DOGA 2CNVA 5DOSA 3BKBA 3FL4A 1WBNA 4G6LA 3SXFA 4ZY4A 4EOOA 2R3JA 4FV8A 4FVPA 3ZO1A 2YEXA 2HCKA 1M17A 4J52A 1ZMVA 4UV0A 4AXEA 3RAHA 1NVQA 2WPAA 3PXZA 4FKSA 4O6EA 4KSPA 5AR2A 4HYIA 3VUMA 1OVEA 2OH0E 2ZM1A 4EQCA 4YTFA 4ZLYA 4ZJVA 2G9XA 1SMHA 2OJ9A 2X8IA 3MI9A 3CY3A 2C6EA 5DIAA 2J51A 3E92A 3ZM4A 2W1ZA 2JKOA 3MS9A 3NRMA 3LHJA 4RT7A 3BHVA 3WYXA 4D0XA 4F9AA 3AC4A 4H3BA 4FTUA 1W8CA 3QRIA 4QMLA 2PZPA 4XBRA 3O5AA 5D12A 1FGIA 1PHKA 4WRGA 3N4TA 1TQPA 3OTVA 2X2LA 4HVGA 2Y4IB 4BY9E 4BL1A 3IDPA 3VNTA 1YXVA 4F65A 5I9ZA 4YJTA 3F3VA 2X7FA 4RWKA 3D94A 4PPCA 3U4UA 4F9BA 2YABA 4JRNA 5HIEA 3VBWA 2WQMA 4FMQA 1CTPE 2WMRA 4O21A 3UTOA 3UIBA 5M53A 3NS9A 3VUDA 2VO3A 1CKPA 4DEIA 4FK6A 3FY2A 3ZS5A 1GZKA 5DH3A 5AV0A 1KOAA 2YHVA 4DN5A 4JJRA 4X3FC 5I5ZA 1O9UA 3WZKA 4M15A 5IQAA 5FBOA 4CYIA 4YSMA 1LUFA 3BWJA 3M42A 4MD8E 4AQCA 4W9WA 1H4LA 3ZSGA 4IAIA 4L00A 4CRLA 3R7YA 1ZLTA 2C6IA 5IA5A 1OIRA 1JKKA 2BZJA 2OZAA 5LQFA 3HAMA 2QR8A 3MA3A 2XK6A 1K9AA 3MPMA 3R1NA 1WBOA 1VR2A 2JDTA 3R01A 5BVWA 4JNWA 3R8MA 2YZAA 3U6JA 3ODZX 2GNGA 5I9XA 3C0HA 1YWVA 3AC5A 4ZEGA 2BMCA 3DZOA 1WVYA 4YBJA 3TKIA 3V5QA 3LPBA 2GNLA 4TWCA 4D9UA 5H2UA 5LVLA 2C6MA 3RHXA 3BV3A 2R3NA 1R0PA 4KRCA 4D5HA 1TQIA 2UW0A 3V04A 2FA2A 4L7SA 4O6LA 2VTOA 3F9NA 3LIJA 5DPVA 2VWZA 2UV2A 4FNWA 4FT9A 5DBXA 5M44A 4FT5A 3ML1A 1WVWA 4XRLA 4IVCA 4E3CA 1W0XC 3LFQA 3ORNA 1FBNA 3DY7A 3KFAA 3OY3A 5FLFA 5DMZA 4U5JA 4XYFA 3DGKA 4F78A 4O4DA 1YWNA 2VTSA 4JOAA 3ACJA 2EUFB 5CVHA 1W82A 4IQ6A 4C36A 2XALA 1Q8UA 1PXOA 2GU8A 3G6GA 4GIHA 4NYEA 3KXMA 2HZ0A 4QMXA 3W2SA 4JLCA 1YXTA 3ZDIA 2FSMX 1LPUA 3PA4A 3I7CA 4F4PA 1JOWB 2C5YA 4F7SA 4FKVA 3LCOA 2LGCA 5EW9A 2B4SB 1U46A 2ITNA 4GVAA 4U6RA 3NZ0A 3OUNB 5AV2A 3AT3A 1Z9XA 5GIPE 4CCUA 2J4ZA 5AUVA 5D1JA 2O5KA 3LCTA 4PWNA 4WG3A 5TF9A 2A98A 4TW9A 1WBVA 4S32A 4BICA 3KGAA 4IWQA 4ZS4A 4ZSJA 3UP2A 2QOKA 2RKUA 4RX5A 4IX3A 4QQTA 1JAMA 4LL0A 4ZLZA 3TCPA 4IBMA 5M4IA 4EK5A 1XMLA 4EUTA 4M12A 4R1VA 4YSJA 3OWPA 4ANLA 3S1HA 2AUHA 3NYXA 4A4XA 4JR3A 4OBQA 3C5UA 3DXNA 5ANEA 3ZFMA 5K9IA 2QHMA 2C6OA 4BGHA 5ICPA 3RMFA 1V0PA 3IW6A 4E73A 4A9YA 4P90A 4PUZA 3AC2A 4J53A 4FL2A 4QP7A 1NVRA 5EYDA 1ZYCA 2ETMA 2IF8A 2YJRA 3AMAA 4G17A 5DRDA 4DG2E 4YUQA 3EQIA 5DI1A 5AP1A 3ZH8A 4ASXA 4QDEA 3TUDA 2W5BA 1XKKA 3MB7A 4FTAA 4YJOA 3GNIB 4FTRA 3OBJA 3OS3A 2QOLA 4J95A 4A9UA 5LMAA 2VO6A 5DYJA 5EH0A 4MH7A 1ND4A 2QHNA 2XBJA 4FTTA 3VO3A 2VX0A 5ANKA 4CZUA 4EH8A 4F63A 5IDNA 2XIKA 4KSQA 2JITA 2RG5A 4F09A 4RIOA 5HLWA 2J0IA 4QMWA 3V8SA 1H0WA 3MVMA 4HVSA 3UG2A 4G16A 2YIYA 1STCE 3FDNA 2W1EA 4I5MA 3VF8A 1ZY4A 4BDIA 4C4FA 2ZMCA 5IQIA 3O7LD 4O0XA 4M8TA 1NW1A 1B38A 3AKKA 1ZOHA 2YDJA 4X2NA 4FOBA 4BVUA 5M4FA 1YW2A 2YA9A 4GFMA 3EH9A 2O2UA 1FQ1B 1GIIA 1NXKA 3RK9A 1PW2A 4FVQA 4DFZE 4YZMA 3T3VA 3C1XA 3CBLA 3EQDA 5CI6A 3UIUA 2CN5A 4O2PA 5AA9A 3F82A 3V5TA 4Z9LA 2R3OA 2WZJA 5BVFA 1VLRA 4NH1A 5ETAA 2HENA 4BCFA 5IF1A 3ZSIA 5IQHA 5HHWA 1CDKA 4IAFA 1Y91A 5AV1A 3VQUA 3DDQA 4FTCA 1CKJA 3ALOA 3NFFB 1DAYA 1PKDA 1U4DA