1OVEA

The structure of p38 alpha in complex with a dihydroquinolinone
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
349
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oveA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oveA01
1CM8A 4UWBA 3QYZA 3I0QA 5C9CA 4G6LA 4IM3A 3S4QA 5CEKA 3BYVA 1CMKE 2XYUA 5DOSA 3KRXA 2QD9A 2PMOX 4FV4A 2C1AA 5EKNA 3TUCA 3UVQA 5HQ0A 3PP1A 5AUWA 4YJUA 3WBLA 4L43A 4FTTA 3B2TA 5HCZA 4O84A 3BQRA 3VS2A 3ZHPC 2WD1A 5M4CA 5L8JA 3EN4A 4G34A 1P14A 1PMVA 4FEXA 1M2PA 5CEMA 2WMBA 3O8UA 4BN1A 4XUFA 5TKDA 4HNFA 3RP9A 4BGGA 3MN3A 5LCJA 3BLHA 4PL3A 5FTGA 4BKJA 3R7YA 3R9DA 2XIXA 4BTJA 2XEZA 3OTVA 4F7LA 3TNQB 3NCZA 4QQ5A 4AT4A 4QMUA 3BE9A 3ZO3A 1MQBA 3MVHA 3ULZA 4RX5A 4CTBA 4HJOA 5CS6A 3RPRA 4X6RA 4TZRA 5DFPA 3VW6A 1CKIA 1QPJA 3MH1A 3OS3A 3WOWA 2EWAA 3UOJA 3GGFA 5DG5A 3SXSA 4EOOA 3I7CA 3KRJA 1BKXA 2PVRA 2DQ7X 4N57A 4AN3A 4FTUA 4FZ6A 4ERWA 2YCSA 3EOCA 4Y5QA 5JGBA 5KBQA 4CG9A 3AD4A 4JIAA 2QOQA 2HY81 3BV2A 3O71A 5DRBA 4F6UA 5KKRB 2EB2A 1B39A 3ALOA 2UVZA 4QTBA 2QI8A 5K3YA 3TTIA 4C02A 3RPOA 1ZZLA 3IS5A 4TYJA 2J2IB 3C5IA 2JAVA 1LPUA 5G6VA 2P55A 4X2GA 3U4UA 4Z9LA 2WTCA 4BCKA 3UYSA 4EHEA 3DFCB 4B8LA 3EFLA 5KMNA 3OUKA 3UZTA 5AAGA 3NVKI 2IO6A 1U46A 5KE0A 2OF2A 3OXTA 3PIXA 3KL8A 4LV5A 4R3CA 4FA2A 1OPJA 5L2SA 4XS2A 3FKNA 4OTDA 4PMSA 5C26A 1TQPA 4EBWA 3G6GA 4Y95A 3SQQA 3VUGA 4O7WA 1IASA 3HKOA 4L67A 3VIDA 2YAAA 4HYSA 3RBWA 3LCOA 5EQYA 2WMTA 1Q8YA 2C6IA 3PE1A 3U54A 1JSVA 4H36A 4LRMA 3MVMA 4FKWA 4TNDA 5HO8A 4D2SA 3IW7A 4JQ8A 4CSVA 4RZVA 4H3PA 4CLIA 3N4TA 3ZTXA 1OGUA 2A1AB 2W06A 4C58A 3F7WA 5J9ZA 3BYMA 5IQBA 4DT9A 4UB7A 2VTNA 2X9FA 4QMLA 4ZZNA 4G6OA 5HEZA 3UMWA 5FD2A 4EBVA 5I9UA 3IECA 4EK4A 3MA6A 1REJA 3QLFA 4MVFA 4S31A 4BTMA 4DC2A 5LVOA 1R3CA 2WQNA 3ZEWA 3MB7A 1FPUA 1VYZA 4D2TA 4FT3A 3OOMA 5I9VA 3PXQA 2WKMA 4MBLA 3FI8A 3KF7A 1FMOE 1EH4A 2C3JA 2GNJA 4I0RA 4N6ZA 4YJTA 4A9UA 4D5KA 2HW6A 2R7BA 3MWUA 3QCQA 4HPTE 1YWVA 1H0VA 2I0YA 2JKOA 3KRRA 4KNBA 1RJBA 4KS8A 1Z57A 1UU3A 4BBMA 3KCFA 3OD6X 1YOMA 2PSQA 2WQOA 4NW6A 1YDTE 4FKSA 5K0XA 4NM5A 1MQ4A 2ZOQA 4CGAA 3NYXA 3GXLA 3MPMA 1WBPA 2WPAA 1DI8A 4W4VA 4WUNA 3RGFA 5J1WA 1YI6A 1YI4A 2OH0E 3D2KA 4FL2A 3TNWA 5JK3A 2JIVA 2BHHA 5ANEA 2IPXA 3ZS5A 4K8AA 2GTMA 4KINA 3IW5A 4IVBA 4QMTA 3C4ZA 3WZKA 3DKGA 5E8VA 5A4QA 2I1MA 3PVBA 4DTAA 4G2FA 2R5TA 3MFTA 4RJ4A 3FQSA 3FY2A 3LM5A 4BTFA 3VBXA 5C4LA 4ZY4A 5F9EA 1XH5A 4NUSA 2RSVA 3RK5A 3HUBA 1H1QA 2EUFB 4MF0A 4NFNA 1OL1A 3ZXTA 5IEXA 4G31A 4NJ3A 2RFNA 4AT3A 4D4YA 5IA3A 2ZB1A 2LGCA 2QNJA 3P1AA 4Z55A 3HV3A 3NDMA 2XJ1A 4MAOA 4WT6A 4EH6A 5A4CA 1ND4A 4YZBA 5EOLA 5M4IA 1NVRA 4JS8A 2R0IA 3HMOA 4O7LA 5E8XA 4FOBA 4QMWA 3THBA 3V5JA 4M3QA 4RLKA 4D58A 2Y7JA 3BV3A 2UZVA 3Q6WA 2CSNA 2ZV9A 3FL5A 4TTHB 4JAJA 4JQEA 3TG1A 2GNLA 4DITA 2UZOA 1XWSA 3ERKA 4RT7A 1ZZ2A 1GIIA 4HCUA 4QO9A 4QMXA 3R1YA 4L9IA 5EYMA 3I60A 4U3ZA 1QMZA 3U87A 3DQXA 3UG2A 1L8TA 3K5UA 3NNVA 3RJCA 1SM2A 4YJSA 2CN5A 2QOHA 4KSPA 4BBFA 3EFWA 3L9NA 3VW8A 1JPAA 2Y6MA 5FGKA 3G15A 3MFUA 4UMQA 3FLZA 3BLQA 1GZ8A 3OP5A 2XCHA 3C4FA 4II5A 2X6EA 4M67A 5TE0A 1JNKA 2JIUA 4ACHA 2QO9A 2VTTA 4FL1A 4AG8A 5M4UA 1J1BA 3EFKA 3GCVA 3ZH8A 4DGGA 5LWNA 3Q4ZA 4L3LA 5HLNA 3D94A 3P7BA 3Q2JA 5DEYA 1PXKA 2YIYA 3IQ7A 3U8WA 2XIZA 4I94A 5IZFA 5KBRA 5AFVA 3OOGA 1JLUE 4XV9A 3TZ8A 3IW8A 3FBVA 3WZJA 4IANA 3Q4TA 2W17A 3ZONA 4CV8A 4O7YA 4M97A 3PPZA 5EM8A 2UZNA 4V0GB 4N70A 3RPSA 5B2LA 1KOAA 1UU9A 2F7XE 2PTKA 3FPQA 4MWIA 3BHUA 2R3LA 3OWLA 1E1VA 3GI3A 2J0LA 3DTWA 3DJ7A 1OBGA 4M13A 3GU8A 4FTRA 4GVAA 3UG1A 2ITZA 3V6RA 3VUKA 4EOPA 5BUEA 2ZMDA 2J9MA 3DB6A 1CTPE 5L3AA 3OCSA 4IB3A 3SOAA 5LVNA 3FUPA 5C8KA 2WQEA 4E20A 4QYHA 1H4LA 3OZ6A 3RNIA 2QR8A 5JRQA 4H05A 1F3MC 3E92A 4ID7A 3LLTA 2ZM1A 4DFYA 4IADA 5AP6A 3TWJA 4R7IA 2OFUA 3R9HA 3UO5A 3AC5A 2XP2A 3AOXA 4QD6A 3TNPC 4IB0A 4X7QA 4G3FA 3SC1A 2HOGA 2V7OA 4QTAA 4ASDA 3ZFXA 5L4QA 4YTHA 1PXLA 3BEGA 3LZBA 5KMLA 4AF3A 4CFFA 4A4LA 1Q97A 2I7QA 1BI8A 2OXDA 3ET7A 4XP0A 2IW8A 5L8KA 2WIHA 3QRKA 4MQ2A 3SW4A 4BBEA 4ZLOA 4KBCA 3LJ0A 4W4WA 2R3JA 5IISA 4Q9SA 4AZSA 4FIEA 3QQGA 5HIEA 4O86A 4OGRA 5H2UA 3LFQA 2X0GA 4RVKA 2ZV2A 3M42A 5M44A 3UODA 4IAYA 2YAKA 2VWVA 3EIDA 3AMBA 4W9WA 4YP8A 4BDAA 4CCBA 1YXUA 2XF0A 4ANOA 2G01A 2I0HA 3QQKA 4FKTA 4N4SA 3BWFA 3QHRA 4PQNA 4CKJA 2J5FA 1OKWA 4IDVA 1AD5A 3TNIA 2OO8X 4FKPA 4LFIA 3VUIA 4ANQA 3Q4UA 2ZB0A 3MJ1A 4I24A 4I4FA 4QMPA 4FTKA 4ITJA 3IOPA 4DG2E 4J53A 5HESA 3RK9A 2OSCA 4RFYA 3K5VA 4XX9A 4CMUA 4CV9A 4D9UA 4F9BA 3QKLA 3VS0A 4JRVA 4BCHA 4KBKA 5A46A 4E1ZA 3QRJA 1F5QA 4QMZA 3FXWA 3LAUA 4C4HA 4FTQA 4YUQA 4GW8A 4MH7A 3W32A 3VUTA 1H26A 2VTQA 3FY0A 4G5PA 3HMMA 2XEYA 4KS7A 4YHFA 1ZLTA 4K1BA 4RLLA 4XG9A 4EKLA 5AV0A 5KHWA 3FI4A 3IGGA 5CQUA 5KNJA 2H8HA 3IW4A 4RZWA 4AUAA 4UN0C 4FG9A 3HDNA 4XG2A 4D1ZA 4U9AA 3KKVA 4MXOA 2XRWA 2Z8CA 3KXHA 3Q3BA 4MBIA 4MTAA 4PUZA 3LXLA 4RX7A 3RALA 3PXRA 2PK9A 4ACCA 3MFSA 3CGOA 2WTWA 4ACGA 4ACDA 4MF1A 4EJNA 3C13A 2PVYA 4YZ9A 1Q24A 3DNDA 2A27A 2QOOA 5BMMA 3RK7A 4F0IA 4FUYA 4IWPA 3LHJA 1UV5A 3UBDA 3PSCA 4BCFA 3R28A 4GKHA 3NYOA 4IWDA 3EQCA 1WBSA 2XNPA 4FK3A 5LWMA 5JZJA 2UW0A 2B54A 3HMPA 4EONA 1QPEA 1U54B 4IE9A 4IJPA 3EHAA 3QUDA 4FT0A 5HIBA 4G3DA 3BPRA 4GV1A 2R3RA 2QU5A 2YERA 3W1FA 5KMIA 2X2LA 3PZHA 5HG9A 1ZOEA 4BCNA 4GK4A 4RIWA 2I40A 2YJSA 4QTCA 3FSKA 4TYIA 4ZY5A 1OL2A 3TM0A 4EWQA 2GNGA 5KMKA 4TN6A 3NW7A 1QL6A 2O2UA 3KU2A 4ZK5A 3WF6A 4HYUA 1IRKA 3FMEA 3H4JA 5AV2A 1R0EA 4HVGA 2UW8A 1W8CA 3L8SA 4JG6A 4PL4A 2HZNA 3C4WA 3P86A 4ZS0A 3LXPA 4FKGA 4IC7A 4OR5A 3UO6A 5ICPA 3P79A 3EJ1A 5JQ5A 2P33A 4HZSA 4BWXA 4G6NA 5JT2A 2RKUA 1Z5MA 3QGWA 2JKKA 3A7JA 4NH1A 3HAVA 5AUXA 3RCDA 2PZPA 1OI9A 2FA2A 3PPKA 5M4FA 1PRYA 4JG7A 2VGPA 1Q3DA 4RWJA 3NAYA 2HXQA 2W1DA 5FEEA 2PL0A 5L8LA 2A19B 4FIIA 4BY9E 3TIZA 5T6KA 2ITVA 3C1XA 5AAEA 3CS9A 2GHLA 3VULA 3A4OX 5HTCA 4O7SA 4BCMA 4M14A 3TIYA 4HGSA 2BKZA 4X2KA 3KREA 2RIOA 2P2IA 3R7IA 3AGMA 2ZJWA 3BKBA 3FMLA 4RMZA 3EH9A 1M7QA 1STCE 1XBBA 2UW9A 5B2KA 3VRZA 4PTGA 2R3MA 4ENXA 4C3FA 5H8BA 4F1TA 2BR1A 4KB8A 2XNNA 3NUUA 3TTJA 3IKAA 5AR5A 2PZ5A 4IJ9A 4AA0A 3LFAA 2G2HA 3COHA 3H9FA 3M2WA 1MRVA 4ASXA 1YWNA 2YACA 3GOPA 1PHKA 4C35A 4LM5A 4EYJA 2XYNA 3L1SA 2CCIA 2UW6A 3GC0A 5ITAA 1G8SA 2YWVA 4O82A 4ANMA 4R7HA 1KUTA 4GIIA 5DHJA 3PJ1A 3GQIA 3KN6A 1T46A 3G51A 3AC8A 3PJCA 2C6MA 4QQCA 3VS6A 2XIYA 3BU3A 3TKIA 3IDCA 3UOHA 4CT1A 5J79A 5BUIA 3N4VA 4DLJA 4JOAA 3MI9A 3EL7A 3NUNA 2H9VA 2VTIA 4KBAA 5ETFA 5AIKA 4KIKB 5A4TA 3QC4A 4U5JA 5BYZA 4V0GA 3IG7A 1OMWA 4EOIA 4XV2A 1ZOHA 2W5BA 3DY7A 5CQWA 4F99A 2W1IA 3F2RA 5CF5A 3HRFA 5AJQA 3NUAA 1OVEA 4GG7A 2XNOA 1IG1A 5HU3A 2PHKA 3FKLA 3NIZA 2EXMA 5IMEA 2CKEA 2IN6A 2BZHB 3DNEA 4LOOA 1E1XA 1GNGA 5E91A 4MQ1A 2VWWA 4IEBA 4C38A 2WO6A 5HICA 3QYWA 3ZUUA 5LVPA 2JFMA 4X2FA 3FAAA 3P0MA 4BDIA 5IH5A 4JDJA 4F09A 2JDTA 2R3IA 3L8XA 2FSOX 2YM7A 4DEEA 3QD2B 4E4NA 3COMA 5C4KA 4O22A 3HP2A 3NNUA 2OIQA 4OTWA 2YM8A 4F1MA 4O0SA 3SHEA 4CKRA 1NA7A 4I41A 4IAFA 5CI6A 2NNWB 3K3JA 3R1SA 3D5WA 4TWCA 5M08A 1R39A 3MVJA 5J8IA 2OJGA 2ITPA 5DYJA 2HXLA 1SVHA 3FSFA 3TZMA 4E7WA 2Y4IB 3PY1A 5DRDA 4AE9A 5CZIA 2C69A 4JX3A 1ZY4A 4I1ZA 3C0IA 3H9RA 5CSHA 3W2CA 4KWPA 4YMJA 5EQPA 1KOBA 3RPVA 4AN2A 4BR3A 3LCKA 2BIKB 2XKDA 2W5HA 2WFYA 4FC0A 5T3QA 3TKUA 5M51A 1YHVA 1QPCA 3OT3A 2R0UA 5A6NA 4RVMA 5FM3A 2HAKA 2PZIA 1PW2A 2QLUA 5FTQA 3A99A 5CU2A 3GC7A 4CYIA 4EH2A 5HO7A 5FRIA 3BQCA 2XVDA 4X2JA 4YJQA 4AOTA 4FGRA 4HYIA 3GQLA 5E1EA 3R8ZA 2BZKB 2XNMA 5CXZA 2CNVA 5HI2A 4Q5EA 5E8WA 4PRJA 4S2ZA 5E7RA 3PSDA 3PWDA 4I6BA 4BICA 4FV5A 4JQ7A 4G9CA 4JVGA 3E8EA 2OLCA 5ACKA 4XG7A 3CTHA 3CKWA 5ANJA 4C0TA 5AV4A 2ZDTA 2GQGA 3DB8A 2FGIA 2HW7A 3OCTA 3ZDUA 4IX6A 4R78A 2E9VA 4MD8E 4K6ZA 4NKSA 4P2KA 5EOBA 3PXFA 3D4QA 3QQLA 3E8CA 3DGKA 4NEUA 3OTUA 3GT8A 2GFSA 4N6YA 1P4FA 3SXFA 3KMWA 5HTBA 2J7TA 2JKQA 1YXSA 4K18A 3FMHA 3VQHA 4ANLA 4CZTA 4Z7GA 1JAMA 5KMOA 3W2OA 4ZSGA 4BYIA 4AW1A 4L52A 2B55A 4YC8A 4BZOA 5GJDA 5HLWA 5HX6A 4L7SA 4ZTSA 2XKFA 4JL9A 4ZJIA 2V7AA 4QT1A 1KE5A 2WB8A 3HP5A 3KK8A 3KXGA 5CSVA 3VBQA 4M8TA 3D7TB 4AP7A 4YZDA 2C0IA 2VRXA 2OW3A 5GIPE 3QUPA 4PDSA 4FV3A 5LMKC 2HENA 4JBOA 4TYGA 3LMHA 4ZSEA 3NW5A 4ZLZA 4IACA 4XJ0A 3OW4A 3L8VA 2W1ZA 4AGUA 4FSYA 4FKQA 3Q2MA 1CKPA 1FVTA 4RJ8A 5AM7A 4G3EA 3OWPA 4XCUA 3ITZA 2XIKA 4UXQA 4CQGA 3DLZA 3PJ2A 1PYEA 4OT6A 5IEVA 3ZCLA 4YBKA 2W1EA 3PUPA 4ASZA 1LP4A 3TT0A 3U6JA 4QPAA 2YIQA 5L2WA 5AP4A 3TCPA 5F4NA 3ORTA 4ORKA 3KULA 4O0TA 3E3PA 4G16A 5AA9A 3DJ6A 3LFFA 2BTSA 2PE1A 1IEPA 3S1HA 2QO7A 4CZUA 2XJ0A 3W8LA 4IB5A 4ZJJA 5K4IA 4FIJA 4ENYA 3ORZA 5HTIA 4UYNA 4DFNA 4QYEA 3SRVB 3QQUA 5AP3A 3ZYAA 2IVTA 5IQEA 3MB6A 4GKIA 2R3NA 3G2FA 1M52A 4JI9A 5ANIA 2QKWB 2Z7LA 2GS7A 4O2ZA 3EQGA 4O7ZA 1K9AA 5DEWA 5AUUA 4JG8A 5IA0A 3NCGA 3RI1A 4AGDA 2BKKA 3EFJA 3UMXA 2WMSA 4UALA 4WNOA 3ROYA 4Y83A 4KRDA 5KZIA 4BI2A 5BYYA 2UV2A 4YTFA 5D9HA 4JBVA 2VNYA 4QQJA 4JBPA 3F61A 2I6LA 3CLYA 4JDHA 5AP2A 2WTKC 5BVKA 4AZVA 3KRWA 1SYKA 3SX9A 4P90A 2QOLA 3VF8A 3W2QA 3S0OA 3EMGA 3CC6A 4CG8A 1LEZA 4P5QA 2IZSA 3COKA 3KQ7A 4U79A 5KKRC 4EK8A 5IU2A 3F2NA 2X7FA 2FYSA 1IA8A 3FZOA 3ULIA 4F9YA 5J9LA 3I6WA 4FSMA 3RAWA 3BHVA 3L9PA 5DT3A 4DTBA 4BDKA 4EH8A 1V1KA 4XG4A 2IVVA 2W1FA 4GIHA 4HZRA 4IX3A 4NIFA 4IZ7A 3DDPA 2QODA 5DGZA 5EW8A 4OT5A 4S32A 1Y91A 3TZ9A 5E8SA 4BKZA 4E6CA 2NO3A 4U81A 5BPYA 4IHPA 3ANQA 5A3XA 4RGJA 2REIA 3UIUA 3U9CA 2X2MA 4IQ6A 2UUEA 2H34A 5K4JA 5JGAA 3MTFA 5E8ZA 3F9NA 3D83A 1JKKA 1RE8A 3P9JA 2WOUA 2YFXA 4L6QA 2JIIA 3PY3A 5I5ZA 4KKEA 4U80A 4J96A 4JLCA 2DS1A 3JYAA 4D28A 4ANNA 5A9UA 5L6OA 1PYXA 2WTJA 4DG0E 4QMQA 4QPMA 5CSPA 4MXXA 4BIEA 3QZFA 3TNHA 3VF9A 3E87A 5HU9A 1MUOA 2E9OA 3F3WA 4FSRA 5DBXA 3ID6C 1NT2A 2Z02A 5KO1A 2VTLA 2F49A 2R3GA 4FK6A 3NW6A 4RJ5A 5EYKA 3R02A 4KIPA 2GTNA 3ZZEA 5EHOA 5EI8A 2QOKA 4MNEB 4FEQA 4ZMEA 4U45A 2CNUA 2ITWA 2H6DA 4J8NA 4DEIA 5D7AA 3A62A 3D0EA 4NM3A 4EK6A 3PG3A 2CKPA 1AQ1A 2RG6A 2YITA 3D5VA 3DK3A 3I79A 4FNZA 4RC4A 5JZNA 4QMNA 4Z16A 2XJ2A 4RPVA 4DEAA 4FEUA 5JQ8A 2HELA 2ETRA 2XS0A 4PX6A 4USDA 4NFMA 4BRXA 1HCLA 4QMMA 4RC2A 4EOLA 3V5WA 5CEQA 1DI9A 2WMWA 3AGLA 3R6XA 3UOLA 4I93A 4OTFA 2O8YA 5HNBA 3G33A 2ZMCA 1UWHA 1LEWA 2X1NA 1H1WA 3A2CA 1O6YA 2X81A 3ENMA 3B8RA 4NCTA 2G1TA 4WNPA 4JJRA 3U51A 3C0HA 3UIBA 2W0JA 1WFCA 4PF4A 4E5BA 4ANBA 4BDFA 4M69A 2GCDA 2OBJA 3L9MA 4JT3A 3QFVA 2OICA 2YJRA 3CPCA 1BI7A 3RAHA 2QG7A 4WBOA 2Y4PA 2ZM4A 4AA5A 4QP4A 4QMYA 2WELA 3FZTA 3VRYA 4E8AA 4NL0A 5GJGA 4EOSA 3IPHA 4BDBA 5BMSA 4C2VA 2W96B 2PPQA 4CFNA 2BRBA 4FYOA 3W2RA 4UMRA 1ZYLA 3KGAA 5GZAA 5L6WL 3WYXA 4BCJA 5IKWA 1WZYA 5JMSA 4OTPA 1ZAOA 3MIAA 4B0GA 2OF4A 4LL0A 2QCSA 4L53A 3UC3A 4M15A 4D4SA 4ZSJA 4FODA 4I92A 4FSTA 4LQMA 4KRCA 5ANGA 3A7IA 2UW3A 1LUFA 1R0PA 1Q8ZA 1Y57A 1YOJA 3IDBA 4O27B 3RVGA 3QF9A 4TYHB 2X8EA 5TOZA 2PVNA 3ZLXA 3QD4A 5I0BA 2NP8A 4LG4A 4PPBA 1IA9A 2DUVA 1XH6A 4TL0A 1BL6A 1VYWA 2JDRA 5JH6A 4RJ7A 3DU8A 4XV1A 4APCA 5EDQA 3GOKA 2HY0A 3BGZA 5HVKA 4E4XA 3H30A 3FXZA 3EQFA 3OWKA 5ANOA 5GHVA 3QTWA 4LGGA 3UDBA 2P2HA 3R1NA 1ATPE 3ZM9A 3QTSA 4FEWA 2P0CA 2WMXA 4TRLA 4I23A 3ZO1A 3V01A 4GG5A 3D7TA 2R3HA 1KE7A 3G9NA 3MSSA 3V8TA 4NK9A 4R7BA 1Q8TA 5FP6A 1UWJA 2Z7RA 2WQMA 2GS2A 3E5AA 4HCVA 4GFMA 4IX4A 2QU6A 2ITQA 5FLFA 2YCQA 3V5TA 3VS1A 4Y8DA 1PXPA 5BVWA 4APPA 3NYNA 3UQGA 4IDTA 2YIWA 3FHIA 3QZGA 1B38A 3R04A 5IA5A 3QKMA 3D9VA 5AP5A 3F3VA 3HYHA 3BU6A 3OG7A 4GT3A 2Z7QA 2LAVA 4GMYA 1FGKA 3HA6A 4YJNA 2VUWA 1AGWA 1U4DA 4BWKA 1W83A 3ODYX 5JFSA 3SD0A 2X39A 3TUBA 2XK8A 2GNHA 4BHNA 4O83A 4DYMA 1TVOA 2OKRA 2VX0A 2A0CX 4IZ5A 4BHZA 4EHVA 2A4LA 4ALWA 3DK7A 2HYYA 2JC6A 2YDKA 3S3IA 4W4YA 3UNZA 4IZAA 2JAMA 1M14A 5IQFA 4FZAB 4UMUA 4JXFA 4O1OA 3IGOA 5FWKK 1M17A 3RNYA 4D1SA 4EC8A 2XK7A 4RIYA 2YN8A 5AIRA 1I09A 3EB0A 1K2PA 5DWRA 5IA1A 3GNIB 4BDGA 3TV6A 3LFBA 2XBAA 5BYLA 2EU9A 2R9SA 2XNEA 2ZDUA 5CAVA 3DAEA 3I7BA 3HZTA 4G3GA 5CEIA 3TV4A 4BCQA 4YSMA 5FUTA 5DIAA 4QNAA 2BZIB 4L3JA 3EYHA 5L2TA 2GQSA 3V3VA 4GYGA 4DAWA 3R8PA 2PYWA 5AADA 1J7IA 3CEKA 3C5UA 2ITTA 4FSUA 4AFEA 2HCKA 4BCIA 4PPAA 4X3JA 3JVRA 3QBNA 2C5OA 2BPMA 4YC3A 3SG8A 5E4HA 2BRHA 2FSTX 4A7CA 1A06A 3SOCA 5JFXA 3CY3A 5KMMA 4EK3A 4TYEA 2XIRA 2YIXA 4LMNA 2Y6OA 4QP3A 3R1QA 4FV9A 3G0EA 4TWOA 4A4OA 5G1XA 2B52A 3QC9A 4BVUA 1SNXA 4WNKA 3PXKA 3O8PA 3FLQA 1V0BA 4QMOA 2OJIA 2WU7A 4GYIA 4AOIA 4E5AX 2RG5A 2CKOA 2J0KA 1U59A 4FSWA 2JDOA 3CQUA 2F2CB 3FZ1A 4I5MA 4YHTA 4ZTLA 5AUYA 5JEBA 4RX8A 5FDPA 3ZO4A 5J5SA 4JIKA 1GOLA 3A7HA 3R7OA 1OZ1A 2HZ4A 5I9WA 3QTRA 3VWAA 3O7LB 5DPVA 2ZV8A 4IXPA 1YHWA 2VTAA 3II5A 4XG6A 2YDIA 3QTUA 3ELJA 4PDPA 4YNEA 4BZDA 3FC1X 2H96A 4O96A 3UNJA 4DEDA 4RFZA 4J99A 4IVCA 5DT0A 4HGLA 3WF7A 4RWIA 2W99B 2B1PA 3K3IA 4X0MA 4DFLA 5A4EA 3TI1A 5M07A 4GK2A 3CIKA 5KUPA 4ZTNA 2XNGA 2WHBA 4NJDA 3CQEA 4O0UA 3NUSA 5EK7A 4WRSA 3F66A 2P3GX 3NS9A 3CBLA 4FNWA 5F20A 3UVRA 3UYTA 4DINA 2CN8A 1J7LA 4X3FB 2XKEA 3NUXA 3DCVA 3H3CA 4PNIA 5AM6A 3R83A 5J7BA 3RWQA 4EWHA 4OTGA 2OFVA 3ZBXA 2J6MA 1FOTA 2PVMA 5D10A 3BEAA 3MFRA 5F1ZA 2Y9QA 2V62A 4MNEA 1PXJA 2F9GA 3Q9WA 1PMUA 3SA0A 3UP7A 3NLBA 1JQHA 2W1CA 3EQRA 3QTIA 3R30A 4IFGA 4CFMA 1OKZA 1X8BA 2XBJA 4FOCA 3VQUA 5EI6A 3BYSA 2PE2A 3F6XA 4MEDA 5DLSA 1UNHA 2W9ZB 4NWMA 1XHAA 1TQIA 4FT5A 5IQGA 3ZEPA 3R63A 3R9RA 2UZWE 4O7NA 3OFMA 1MRUA 1YDSE 3MPAA 2VTHA 3C0GA 3MH0A 4EKKA 4XH6A 2WMAA 2IW9A 3QX2A 1ZYSA 4ZY6A 3KFAA 3BRBA 3SKCA 4RRVA 3C9WA 2QC6A 2RFSA 3LXKA 3DA6A 2BRMA 3F3TA 2VTMA 3IW6A 2ITYA 1UA2A 4JDIA 5EDPA 2Y8OA 3VS3A 4NTSA 3DK6A 5ETCA 3RAKA 2OWBA 4FKRA 3K2LA 1ZWSA 2QQ7A 4PDYA 4AOJA 4FVQA 1U5QA 4XG8A 4MBJA 4AW2A 4BCGA 3RINA 2UZDA 3CJFA 3FXXA 5CX9A 2PVKA 4ZTRA 3W18A 3FI3A 4FTOA 4RVLA 4C4GA 5D12A 2B0QA 5D1JA 2Y0AA 2YWPA 2Q83A 4UX9A 1YDRE 4BI0A 4DE4A 4BGHA 4F4PA 4USFA 4J97A 3B8QA 1GAGA 5CSXA 4HVDA 2V0DA 3VUMA 4FUXA 3LVPA 1J91A 5KCVA 4OBQA 5CAQA 3L8PA 4R5SA 4O2PA 3GUBA 4ALUA 5L2IA 3ZO2A 4F9CA 2OIBA 5ETAA 2C0OA 2ZVAA 4I4EA 4GUBA 5DI1A 3F3ZA 3RZBA 4TYHA 2BMCA 3SLSA 3AT2A 2BROA 3CR0A 5AV1A 2CLQA 3TN8A 2IG7A 3JR1A 1XR1A 4BIBA 5HG7A 3I5NA 4EH9A 5L6PA 4UWCA 3T8OA 4Z7HA 4PPCA 3PLSA 4Q9ZA 1L3RE 2GHGA 2RFEA 3EQBA 3PYYA 5CNNA 3R0TA 5FBOA 4C4EA 4E6AA 2IJMA 1WBTA 5IQAA 2JFLA 3EQPA 4DLIA 4FVRA 3Q6UA 3A8WA 4GJ2A 4XG3A 4F08A 3OY1A 3HV4A 1WBOA 5CT7A 2I0EA 3OVVA 3ZSHA 4FSQA 3GFEA 3FLSA 2R3KA 4GK3A 4TWPA 4I6FA 2C6EA 2W4KA 1W84A 4IIRA 3V8WA 3WI6A 4QTDA 3ZRLA 4EQMA 5IA2A 3HECA 3UE4A 3KXNA 4LRKA 2QVSE 4A06A 1PKDA 2DWBA 2ZAZA 3EYGA 5J87A 1OIYA 3NNXA 3UGCA 5A6OA 2RL5A 3MW1A 5M55A 4ZP5A 4C3PA 3A4PA 2YISA 4PP9A 3SG9A 1XQZA 4FF8A 4O21A 4QRCA 4HGTA 3ODZX 2W1GA 5C8NA 3R2YA 4GS6A 4KKHA 5FM2A 2XUUA 5CF4A 3ZSGA 2ETMA 4O6EA 4AXAA 3BGQA 3TJDA 2PUUA 3C7QA 4HGEA 2ZM3A 4B99A 4A9YA 1Y8YA 3MBLA 1WVYA 5CANA 4BC6A 5CU0A 2UW4A 4IAAA 4XYFA 2CKQA 3AT3A 3CTQA 4YR8A 1YXTA 3MA3A 3QTZA 3VS5A 5DE2A 3LCSA 1F0QA 5AR4A 5E90A 5AV3A 3D2IA 3VN9A 1GZKA 5I3OA 4PTEA 2E2BA 4QYGA 1IAJA 4D2WA 4C36A 1W82A 3AC4A 3HV7A 3OEZA 4FTLA 3CD8A 3T3UA 5BX0A 4IVDA 4F64A 5JSMA 3E3BX 3OXZA 4QMVA 2UVXA 1R78A 4Y46A 2PVHA 3UZPA 2X4ZA 1WBNA 1JSTA 2QURA 3R8LA 5BVOA 3WYYA 5H3QA 3WE8A 2VWIA 3NWWA 3VJOA 2IZUA 1XH7A 5HG8A 4FV2A 4UY9A 2EXEA 5HO6A 3S95A 4M12A 4WUAA 3ZDIA 2NPQA 2VTJA 4DFZE 4LMUA 2CHLA 5ANDA 3QQFA 4RA5A 2GDOA 4UBAA 3RAIA 5J1VA 4DFUA 3R2BA 2YCFA 2YHVA 4C57A 1YRPA 1M7NA 1OUYA 2C5VA 3EN6A 4OBOA 3WF9A 4EH5A 2QLQA 4OTIA 3LKMA 3DOGA 4A9SA 3W10A 3DZQA 1JBPE 2GNIA 3WF5A 3TXOA 1ZMWA 3LOKA 3R7UA 2XK9A 3LFCA 1PY5A 4NCTC 3FMNA 2PU8A 4K2RA 4JNWA 4RJ6A 4FKVA 4LI5A 4AGWA 4XBUA 2VWXA 4MXAA 4UYAA 5CU6A 3PP0A 2OGVA 4AW5A 3F2AA 1Q4LA 2XRUA 3KRLA 4J52A 4RX9A 4J95A 4Y5HA 3BE2A 3E8DA 4MK0A 3ROCA 3F5XA 1VEBA 4ZMFA 1Q62A 2DYLA 4TKSA 2W4JA 5HOAA 1RDQE 3FLWA 5B0XA 3KN5A 2OIDA 2UZEA 5C01A 4X21A 1NVSA 3DZOA 4J71A 3D14A 1OBDA 3DQWA 3U55A 3GCSA 1OUKA 4AGCA 5JFWA 1SMHA 4IZYA 3PA5A 3PVWA 4W4XA 3N9XA 3RCJA 3Q53A 4W8DA 1BUHA 3ZLYA 3KA0A 4IH8A 3MY5A 1HOWA 2OI4X 4U40A 3DKOA 3FV8A 1B6CB 4CRLA 3GC8A 4NM7A 4X3FA 3QCYA 4NZWB 3UIMA 3C4CA 4CFVA 5CAOA 2UZUE 4L00A 4FEVA 4QP2A 3O0GA 2CLXA 2GFCA 1KV2A 4WG3A 4C34A 4EQCA 4ZS4A 3LIJA 3DBCA 2NRUA 4WD5A 2BFXA 3R7EA 3BLRA 3GU6A 1YI3A 2VWBA 5JRSA 3QX4A 2WEIA 4NM0A 2HWPA 2YCRA 4RBLA 4YTIA 3WIKA 5JN2A 4RG0A 5LVMA 3R8MA 3TJCA 4PTCA 2WTVA 3AC1A 3CE3A 2PUIA 3NYVA 3FLYA 2YLFA 4E5WA 4DH3A 3MYGA 3KXXA 4O0YA 1S9IA 4QOXA 3DXPA 4RIXB 2QONA 3POZA 2AYPA 3Q52A 4GT4A 5FXSA 3UQCA 4K33A 4EOJA 4DTKA 2R3PA 1R1WA 3HMNA 4HPUE 4R3PA 4QNYA 2ONLA 4EZ7A 5EQEA 3ZUTA 4EUTA 2XCKA 4JX7A 4O0RA 1FINA 4O81A 2IZRA 3COIA 4PMMA 4C4FA 3EN7A 4QPSA 5BNJA 3I5ZA 2PZYA 1PXIA 1ZY5A 5CNOA 3H10A 2IVSA 3OC1A 3QWKA 5DVRA 5IDNA 3BI6A 1Q8WA 4FNXA 3WARA 5M56A 3I81A 1YHSA 3ZC6A 2YZAA 3IONA 1APME 3RM7A 4C33A 2R64A 2J0MB 4DN5A 5BVFA 4ZJVA 1XH4A 4WHZA 4QYYA 3QU0A 2Z60A 4F0GA 3GC9A 1Q61A 5CLPA 4YLLA 3ZFMA 4ACMA 2XKCA 2X2KA 3D15A 2YEXA 5EM7A 4QYFA 2BDFA 5LJJA 3WZDA 3O17A 1WBVA 3O50A 3VO3A 4DBNA 3QALE 1GZNA 1ZXEA 2C6KA 2R3OA 4MX9A 1GIHA 2VTPA 1U54A 3QZHA 3E8NA 4UEUA 4ZIMA 4U3YA 2AC5A 4DH7A 4M0ZA 2BDJA 3BHHA 4NU1A 2OJ9A 5GNKA 4EC9A 3HL7A 5IQHA 5LARA 3V04A 3ORKA 4YLKA 4RA4A 2BAJA 1SZMA 5AEPA 3UZRA 3I1AA 4DH5A 1ZOGA 4AA4A 3WF8A 4FE2A 1YOLA 1BLXA 4G1WA 3V5PA 4I5HA 2UW7A 1PKGA 2GNFA 3Q04A 1PXMA 2C6LA 3TDVA 3MIYA 5GZ8A 3ATTA 4G17A 1NW1A 3WE4A 3GCQA 1JSUA 3LJ2A 4G3CA 3QA8A 3HUCA 3R7GA 4ZTMA 3AD6A 3ZZWA 2W7XA 1G3NA 4BZNA 2OH4A 4X2NA 2BIYA 2B9FA 2WEVA 1KE6A 4CMOA 5AP1A 3DKFA 5I9XA 2UW5A 3DAKA 3ORIA 4B7TA 3UQFA 4OAUC 4ANSA 3VUDA 5HE0A 3KVXA 2GS6A 3PRFA 4M7IA 2VX1A 4TT7A 1PJKA 3GBZA 4UXLA 5I4NA 3F5UA 5J9YA 4IFCA 1XO2B 3KEXA 4RIOA 3MV5A 3VBTA 2BALA 5HHWA 4ZEGA 4E26A 5HE2A 4IVAA 4FV1A 2VAGA 1UVRA 3O96A 5LVLA 3UC4A 4DG3E 3VS7A 1QCFA 2XM8A 3M11A 3V8SA 3EKKA 5CF6A 4TWNA 4F7NA 5E92A 2HK5A 5CY3A 4A4XA 2C3IB 5IQDA 4HNIA 5M57A 1YW2A 2XM9A 5HNGA 4C59A 4E4MA 1ZMVA 5JKGA 4B9DA 3GP0A 4MWHA 5HBHA 3QLGA 4RC3A 2J90A 3PFQA 1A48A 3LQ3A 4LOPA 2BCJA 3CTJA 3BX5A 3HRCA 3QGYA 3GENA 4GCJA 1OIQA 1WVXA 3R9NA 3NEWA 5FBNC 2ACXA 3F5GA 3LQ8A 2SRCA 3H0ZA 3UPZA 2BVAA 3U6HA 4H3BA 5AX3A 1ZYCA 3K54A 4MHAA 1H8FA 3DBEA 5AX9A 5CWZA 3GU4A 2KULA 1OPKA 2OJJA 2YM6A 2O64A 3MDYA 3DDQA 1YXXA 2FSLX 4HCTA 2IZTA 4R3RA 4XV3A 4F6WA 2QG5A 3REPA 1OPLA 3FHRA 4CNHA 3KCKA 1DM2A 2UVYA 4AQCA 3E93A 3R9OA 2WXVA 3FPMA 4DGMA 4U0IA 5IUGA 4QP9A 3PVUA 3RKBA 1YWRA 3W55A 3RHXA 1TKIA 4BIDA 1XBCA 3UP2A 3ATSA 4E93A 4F7JA 2BZJA 1H28A 1FQ1B 1H07A 2QOBA 3FJQE 4MXZA 4EH7A 4KIKA 3SXRA 4DEBA 2CGWA 4CYJA 4DCEA 4UMPA 2OK1A 5C1QB 4OW8A 2PY3A 1ZRZA 3HA8A 4BDHA 3LPBA 4HVIA 1J3HA 3OWJA 4GRBA 2VX3A 4I0SA 3P23A 5BVEA 3UOKA 1Y6AA 5HGIA 2V22A 4NSTA 3SDJA 2WTKB 2O5KA 4Y72A 3PLAE 4JDKA 3ZM4A 3EQIA 4NT4A 1P4OA 3DTCA 4WSQA 2PE0A 3JS2A 4YZMA 3V51A 3BWJA 4MKCA 2YDJA 3FZSA 3GB2A 3AQVA 4U43A 3ACJA 4TPTA 1MP8A 3FMMA 4DFXE 4MNFA 2I0VA 3P08A 4YPDA 4I6QA 4TXCA 4KD1A 4LOQA 3UVPA 4EH3A 4FT9A 5LOHA 4EYMA 3I0OA 3EQDA 1GZOA 3OY3A 2CCHA 4W9XA 4EEVA 3F3UA 3I4BA 5AA8A 2RF9A 2QOCA 4KSQA 2HWOA 2QOFA 3BYOA 5CEOA 5LQFA 1W7HA 2OXXA 4BKYA 2IVUA 4L42A 5FG8A 3FYKX 4ZSAA 3OROA 4CXAA 2QKRA 4DEHA 3MJ2A 3GU7A 4I20A 5J5TA 5IUHA 4JR3A 2CGVA 3KXZA 5IQIA 5H9BA 3NMUF 1KE9A 3R22A 4FVPA 4DEGA 3ENHA 4CFWA 3TZ7A 3PJ3A 5K5NA 2J4ZA 3ORNA 5E9EA 5CAUA 3D5UA 3A7FA 2ETKA 4KKGA 4WBBB 4XHKB 3N4UA 5CASA 1FBNA 1FVRA 4EUUA 4FSNA 3FMKA 3S2PA 3MESA 3GCUA 3Q9XA 3UPXA 2IW6A 2WGJA 4KA3A 2BRNA 1REKA 5FEDA 1V0OA 4FT7A 2VU3A 4F0FA 5HBJA 2XB7A 4ZTQA 1CSNA 4F9AA 3DS6A 5LXMA 4RIXA 4J8MA 3PWYA 1OM1A 5AR3A 5AUZA 4DH8A 3ZU7A 4L46A 5FTOA 3S00A 4ASEA 1ZARA 5FP5A 2C5XA 5TR6A 5DMZA 4FR4A 5HE1A 4AW0A 2GHMA 2X7GA 3QHWA 4DHFA 2BAKA 3HAMA 3PTGA 3FDNA 2BDWA 1J1CA 1YVJA 2ESMA 3LW0A 4HOKA 5TF9A 4BWPA 3A7GA 4WA9A 2FUMA 4PP7A 4C7TA 4L45A 3EQHA 1JKSA 4R8QA 3CJGA 4FNYA 4LUEA 3ZXZA 2FVDA 2C1BA 3CP9A 4WRGA 5HD7A 4FTJA 2GQRA 4D5HA 4RVTA 4OAVB 3LCDA 3VC4A 5DN3A 4WO5A 4CFUA 4QP8A 3W33A 2GMXA 4QP6A 4RIWB 1XH9A 4QQTA 4EI4A 2PMIA 3ANRA 4O0WA 3QXOA 4U41A 4C8BA 4USEA 3GVUA 5CVGA 3T9IA 4F6SA 3OBJA 5AWMA 3GCPA 1UKIA 4EK5A 4ITIA 4ZSLA 4PMPA 2RGPA 3O23A 4GUEA 1H25A 3PG1A 4IBMA 3VHKA 5I3RA 4WIHA 1ZYDA 2ZV7A 3PXYA 3QD3A 4FTAA 3CXWA 3OEFX 4FZ7A 4IAZA 3CCNA 5HBEA 3CPBA 4EORA 1UU7A 2BRGA 2C30A 2EVAA 4G5JA 4DCAA 3HX4A 3OMVA 4IWOA 4FG8A 3EZRA 4FV8A 3I6UA 4R1YA 3HGKA 2R7IA 4PWNA 1LR4A 2ZYBA 2XMYA 2O3PA 3KK9A 4BYJA 1YQJA 3QL8A 4AWIA 4E3CA 4B6LA 3EKNA 2OZAB 5L2QA 1HCKA 5IH6A 2C4GA 1Q41A 4K77A 4ZTHA 3RMFA 3BHYA 3VBYA 4YO4A 4HYHA 1RW8A 4B4LA 4FMQA 5LMAA 2B7AA 4O7TA 4W8EA 2VO6A 2KTYA 2QOIA 5HORA 5EM5A 4C4IA 2FSMX 2VGOA 3SRVA 5AR7A 5IA4A 3DBDA 2R3QA 1Y6BA 4V04A 4X6QC 2X6DA 4E6QA 1CDKA 3OBGA 1SVGA 4I3ZA 1TQMA 4FZFB 2F4JA 3ORXA 3V6SA 1KWPA 2PMNX 3PZEA 5IMXA 4G9RA 3B2WA 2NRYA 4I21A 4FTCA 5J95A 4EQUA 3FEGA 5A14A 2XA4A 1WCCA 1G5SA 2RFDA 3D5XA 3FLNC 2J0IA 5FXQA 3VBVA 3HEGA 3ACKA 4UMTA 4S33A 2WAJA 1FMKA 2C6TA 3AXWA 4YBJA 1PF8A 4C4JA 1W98A 5LMKA 4U44A 3NUYA 3KC3A 5H8EA 2CGXA 5HKMA 4P5ZA 5T68A 1Q99A 2PWLA 3QWJA 4I5CA 4XP3A 4GU9A 4QP7A 5AP7A 2WQBA 4O0VA 5K0KA 3R7VA 3PVGA 1OKVA 5EDRA 3GFWA 4M84A 2X4FA 4D4VA 4FIGA 5BVDA 5CALA 3AT4A 2XZSA 3QTQA 4AU8A 4YZNA 4CTCA 5BUJA 5CF8A 4H1MA 2GPHA 2A2AA 4O0XA 3FI2A 3G5DA 3Q9ZA 4FIFA 4TW9A 3PXZA 4AZWA 1PXNA 3W2SA 4X3FC 2VWZA 3QCXA 3VUHA 3OXIA 3TL8A 4EHGA 2JD5A 5CVFA 4R5YA 5AR8A 5JFVA 3AMYA 5C27A 1GY3A 1H1PA 3FQHA 5IUIA 2GSFA 2CJMA 1O6LA 4ZXTA 2J50A 2B4SB 3MPTA 4RQKA 4Y85A 5CSWA 4B8MA 4DGOA 3BBTB 5E8UA 3CGFA 4XP2A 3MY0A 3R73A 4XLVA 3P4KA 2R4BA 4A07A 1OIRA 3FWQA 3ORMA 3QRUA 4XLIA 5GJFA 3NRMA 3SAYA 5FXRA 4CMTA 1OECA 1Z9XA 4YHJA 4WG5A 2O0UA 4PNKA 3RTPA 4RQVA 1H01A 2XK6A 3E88A 4NTTA 2JITA 1IAHA 4FG7A 4M66A 2W9FB 4UZHA 4WG4A 4D0XA 5GIOE 4DA5A 1URCA 2ONLC 2BFYA 2BUJA 4R1VA 5BQ0A 3DXNA 3PSBA 3FMDA 3WZUA 4FGBA 5CAPA 2WMQA 3KMMA 4N0SA 4TNBA 4YO6A 2E9NA 3RPYA 2CMWA 1YKRA 1I44A 4H58A 2C68A 4RWLA 4L7FA 4XRJA 3EL8A 3LMGA 4V05A 1BYGA 3MS9A 4CQEA 3QZIA 4FBXA 4L01A 4ZAUA 4EZ3A 4GL9A 4J1RA 3IDPA 3G90X 3UIXA 1VR2A 2JBPA 4D0WA 2AC3A 2G2IA 1PMEA 4YJVA 4F65A 5CEPA 5TO8A 3DFAA 4TY1A 5K9IA 3H0YA 1IR3A 4KIQA 2C0TA 4LGDA 4GU6A 4BDCA 3RHKA 2X8DA 4O91A 3MH2A 2B9IA 1H0WA 3JY9A 5IF1A 1G8AA 4O7VA 2O63A 1RQQA 3SV0A 4OLIA 5EYDA 4ZOGA 1J7UA 4L44A 2B9JA 4FX3A 4QTEA 4PMTA 4D4RA 4MXYA 4IAKA 3AMAA 3R01A 2WTIA 2VTSA 4YLJA 1ZYJA 5DH3A 3NIEA 3OCGA 4CCUA 4FICA 1UU8A 1UNGA 5DR2A 1K3AA 5DNRA 5KX8A 1A9UA 2WNTA 4YURA 4D1XA 3UNKA 4CT2A 5CI7A 2YM3A 3C50A 2C6DA 1Q3WA 5CZHA 3ZFYA 3TEIA 5M53A 2VZ6A 3DV3A 5AP0A 3RZFA 5IQCA 4V01A 5M09A 5AMNA 3UJGA 1H24A 4F1OA 2P4IA 5EW3A 1MRYA 5CXHA 4YNOA 5B2MA 5CU3A 4FTNA 1JKTA 3Q32A 1XBAA 2E9UA 3MVLA 4AACA 3Q96A 4CFXA 1E9HA 1URWA 3LFNA 3FZRA 4P4CA 1H08A 1O9UA 3ZLSA 4EL9A 2YABA 4BGQA 5K5XA 4UZDA 3DXQA 1DS5A 2C6OA 2WIPA 4GVJA 4U42A 4MYGA 1W0XC 4D9TA 5H8GA 1Q8UA 3G0FA 3PRIA 2F7EE 4OTHA 2PVLA 3P78A 5GZ9A 2C47A 4IW0A 3DKCA 4H3QA 4BCPA 2ITUA 2QO2A 1DAYA 4OUCA 2JKMA 3JVSA 4J98A 4Y73A 3ZMMA 3A61A 5D11A 3LLAA 4IC8A 5HD4A 5HCYA 2JEDA 3E7VA 3MGYA 3DPKA 2WU6A 1DAWA 5F95A 4L8MA 3KVWA 4JAIA 3PIYA 3LXNA 4XMOA 4NYEA 3L9LA 4WOVA 4CVAA 2UZBA 4FTIA 2Q0NA 2VO7A 5AUTA 2WOTA 3FYJX 4C3RA 1UNLA 2B9HA 2ITXA 1Y8GA 3ORLA 3ETAA 3AG9A 2BAQA 3M1SA 3FL4A 4QMSA 1SVEA 4YZCA 5I9YA 4GSBA 1JVPP 3JUHA 5EFQA 3HRBA 1H1RA 5BVNA 2X9EA 3POOA 4GT5A 5D41A 4KIOA 3O2MA 4ZZMA 3LFEA 3VS4A 4LRJA 4ONAA 3PDTA 4GH2A 2W5AA 3KULB 3CSVA 3PE2A 3F69A 2PUNA 3LFDA 3TUDA 2HZIA 3CQWA 5FQDC 3MY1A 3LCTA 5E8TA 4K9YA 5E1SA 4BL1A 3T9TA 2Q0BA 5HVJA 2C5YA 3VVHA 2XH5A 3C4EA 3TDWA 4YJOA 3LMIA 4NKAA 5GINE 2VD5A 3PIZA 5ANKA 2OXYA 4KABA 5EM6A 3DT1A 1H00A 3R71A 5AAFA 4O1PA 4IAIA 4FI1A 4U7ZA 1M2RA 2C3KA 2OZAA 4U6RA 1VJYA 3OUNB 2OJFE 1JOWB 3ZRMA 3P5KA 1NVQA 4FIHA 1U5RA 5EHYA 4U8ZA 4PY1A 3FKOA 5CYIA 3GEQA 3E63A 3EWHA 3G6HA 4AFJA 5EI2A 4J7BA 1OIUA 4RSSA 4I5PA 4OTRA 1VZOA 4I22A 3QXPA 2YM5A 3C4XA 3HVCA 3C51A 2V5QA 2VTOA 5DR9A 4FYNA 2ERZE 3OHTA 3TACA 1CKJA 4H1JA 4DFBA 2JDVA 2PULA 3DLSA 4PL5A 2W05A 5AUVA 4D2VA 4IX5A 3JXWA 2F7ZE 1SNUA 4AZEA 4MD9E 4ZZOA 3DAJA 1WVWA 2EB3A 3HV6A 3OT8A 4FKIA 4FL3A 4MD7E 4QP1A 4A9RA 4R77A 2CGUA 3WZEA 2VWUA 2Z7SA 3BELA 3FE3A 5FEQA 3RWPA 5HNIX 2GU8A 5FDXA 4ARKA 4ITHA 3QUEA 4GFGA 5CENA 4CRSA 4O6LA 4NIFB 4EOMA 3QTXA 3WIGA 4FV0A 1P2AA 4AS0A 4WSYA 4DT8A 1NXKA 1XKKA 3NR9A 4MXCA 3LE6A 4PV0A 3CY2A 4XNEA 3W8QA 2F57A 2J51A 5TT7A 2WMVA 5ACBC 3QQHA 3V5QA 5HIDA 4BFMA 2CDZA 2OU7A 4AE6A 5CT0A 4GJ3A 5E8YA 2YM4A 1T45A 2Y4IC 4UWYA 5KZ0A 4BDDA 4DGNA 2C3LA 4CZYB 4DBXA 3DBFA 2G2FA 4R6VA 3MTLA 1V0PA 4XBRA 3SVVA 2HZ0A 3EZVA 2YLEA 4MCVA 2VV9A 3BZ3A 1NY3A 1KV1A 3Q5ZA 4XRLA 2VNWA 3SGCA 3A60A 2BHEA 1OL7A 3F7ZA 3NUPA 4RFMA 3QA0A 4XOYA 3ZLWA 5IDPA 3P7AA 4A9TA 1WAKA 4EOQA 1ERKA 5I9ZA 3EN9A 4LL5A 4EH4A 4OBPA 3ZBFA 3QQJA 2WTDA 3A8XA 2E9PA 3HV5A 1JWHA 3U6IA 5ETIA 2YZLA 2Z2WA 4DGLC 1GIJA 3DJ5A 3MH3A 3NNWA 4D55A 3LM0A 3VBWA 4YJRA 2VTRA 4CLJA 4LUDA 3OW3A 4S30A 5CTPA 1QPDA 4L68A 4BB4A 4D2RA 3BBWA 3O51A 4K0YA 1OL5A 2ITOA 3T3VA 3OCBA 3PA4A 4XEYA 4KUJA 4AZFA 4FZDB 5EYCA 2QR7A 4XOZA 3W16A 4OTQA 4YPSA 3QAME 3GU5A 3NPCA 4YSJA 3FMJA 5AR2A 4F63A 4IB1A 3ALNA 3IK3A 4IM0A 2W4OA 3QD0A 4GFOA 4HVHA 3BCEA 4LGHA 5IEYA 3PY0A 1OKYA 1FGIA 4IWQA 2QHNA 3P7CA 4PDOA 2UZTA 5DR6A 3NSZA 4FKLA 3DBQA 3R00A 4GEOA 1KE8A 1S9JA 3VAPA 1BMKA 2PZRA 3F82A 3H9OA 3KXMA 3O8TA 3Q4CA 3Q5IA 3LFSA 5EKOA 5LCKA 3G9LX 1H27A 5LMBA 2WZJA 4JBQA 3IO7A 4S34A 5DT4A 4Q2AA 5IH4A 3U4WA 3CKXA 2VO3A 4AN9A 3HNGA 4M69B 5J7HA 3IOKA 4AAAA 1XH8A 1H1SA 3BGPA 4Z3VA 1GJOA 4P7EA 5HLPA 3BHTA 5HX8A 2VO0A 3QCSA 2VWYA 4AX8A 5CU4A 3ZSIA 1FVVA 3AC2A 4BDJA 3KY2A 1PMNA 3NGAA 4KAOA 2JGZA 4BCOA 3W2PA 2QHMA 4RJ3A 4ALVA 2HIWA 2G15A 3HLLA 4E6DA 3CD3A 1BX6A 4YC6A 2PMLX 3Q9YA 5HVYA 3UO4A 4ZLYA 4Q5HA 3SW7A 1WBWA 2WMRA 4HW7A 4YJPA 2WMUA 4FKUA 3R8VA 2OZOA 3BIZA 5HZNA 2FO0A 3PA3A 3NAXA 4M0YA 2UZLA 2JLDA 4YTCA 2J0JA 1ZMUA 1PXOA 4H39A 4BDEA 4ERKA 2YIRA 3ORPA 2AUHA 4F9WA 2PVFA 3FC2A 2R2PA 4I6HA 4E73A 1Q5KA 3NZ0A 3EN5A 3FQEA 4EZ5A 3KMUA 3QKKA 3QRIA 2FB8A 3VNTA 3RM6A 3PPJA 4UV0A 4JRNA 5A54A 4CD0A 5EW9A 3AC3A 4WNMA 2OG8A 4BI1A 2W1HA 1O6KA 4O38A 4IM2A 3VHEA 4DH1A 3R21A 4EOKA 5IG1A 4AT5A 4DF3A 3FZPA 5CVHA 4FKOA 4FKJA 3HMIA 1OL6A 4C61A 4LV8A 3F88A 4BF2A 5M06A 2F2UA 4O7RA 3F5PA 2IWIA 2B53A 3JPVA 4D2PA 2EXCX 4YU2A 2YA9A 1M2QA 3JY0A 3LQ5A 1JKLA 2ERKA 2XK3A 4FTMA 3AD5A 4WKQA 5DA3A 5EHLA 3U9NA 5HG5A 4CKIA 3D7ZA 4L3PA 4U97A 5IPJA 4JR7A 5KMJA 3ZOSA 2BTRA 3LJ1A 3O7LD 3KB7A 3E64A 3R8UA 3TV7A 4K11A 4C2WA 2XNBA 2C5NA 2VN9A 3QRTA 1P5EA 3V5LA 2JDSA 4FV6A 3Q60A 2V55A 3NX8A 3E62A 3WILA 4HVSA 3KF4A 2PVJA 1OITA 4F7SA 3N51A 5C03A 2J5EA 3BYUA 3OF0A 5EG3A 5HCXA 5F94A 3NVMB 4M68A 3HDMA 4BTKA 5KHXA 4NW5A 4AZTA 2PUPA 2ITNA 4YGAA 1BL7A 1UKHA 1XJDA 3PJ8A 3VJNA 5C8MA 1WMKA 2CPKE 3ZC5A 3ZUVA 3TKHA 2BILB 4LYNA 4F70A 2XK4A 2X8IA 4FSZA 4CEGA 2FH9A 2JBOA 1YXVA 2O65A 4EJ7A 5JGDA 4C62A 3E7OA 4EHZA 1OB3A 4RIYB 5HE3A 3ZRKA 5B7VA 1KSWA 3BU5A 4FV7A 4RWKA 2G9XA 3UTOA 4IMYA 2X7OA 5EH0A 4E4LA 4C37A 5A4LA 5D7VA 4I0TA 2R3FA 2CNQA
chains in the Genus database with same CATH superfamily
1CM8A 4UWBA 3QYZA 3I0QA 5C9CA 4G6LA 4IM3A 3S4QA 5CEKA 3BYVA 1CMKE 2XYUA 5DOSA 3KRXA 2QD9A 2PMOX 4FV4A 2C1AA 5EKNA 3TUCA 3UVQA 5HQ0A 3PP1A 5AUWA 4YJUA 3WBLA 4L43A 4FTTA 3B2TA 5HCZA 4O84A 3BQRA 3VS2A 3ZHPC 2WD1A 5M4CA 5L8JA 3EN4A 4G34A 1P14A 1PMVA 4FEXA 1M2PA 5CEMA 2WMBA 3O8UA 4BN1A 4XUFA 5TKDA 4HNFA 3RP9A 4BGGA 3MN3A 5LCJA 3BLHA 4PL3A 5FTGA 4BKJA 3R7YA 3R9DA 2XIXA 4BTJA 2XEZA 3OTVA 4F7LA 3TNQB 3NCZA 4QQ5A 4AT4A 4QMUA 3BE9A 3ZO3A 1MQBA 3MVHA 3ULZA 4RX5A 4CTBA 4HJOA 5CS6A 3RPRA 4X6RA 4TZRA 5DFPA 3VW6A 1CKIA 1QPJA 3MH1A 3OS3A 3WOWA 2EWAA 3UOJA 3GGFA 5DG5A 3SXSA 4EOOA 3I7CA 3KRJA 1BKXA 2PVRA 2DQ7X 4N57A 4AN3A 4FTUA 4FZ6A 4ERWA 2YCSA 3EOCA 4Y5QA 5JGBA 5KBQA 4CG9A 3AD4A 4JIAA 2QOQA 2HY81 3BV2A 3O71A 5DRBA 4F6UA 5KKRB 2EB2A 1B39A 3ALOA 2UVZA 4QTBA 2QI8A 5K3YA 3TTIA 4C02A 3RPOA 1ZZLA 3IS5A 4TYJA 2J2IB 3C5IA 2JAVA 1LPUA 5G6VA 2P55A 4X2GA 3U4UA 4Z9LA 2WTCA 4BCKA 3UYSA 4EHEA 3DFCB 4B8LA 3EFLA 5KMNA 3OUKA 3UZTA 5AAGA 3NVKI 2IO6A 1U46A 5KE0A 2OF2A 3OXTA 3PIXA 3KL8A 4LV5A 4R3CA 4FA2A 1OPJA 5L2SA 4XS2A 3FKNA 4OTDA 4PMSA 5C26A 1TQPA 4EBWA 3G6GA 4Y95A 3SQQA 3VUGA 3AKJA 1IASA 4O7WA 3HKOA 4L67A 3VIDA 2YAAA 4HYSA 3RBWA 3LCOA 5EQYA 2WMTA 1Q8YA 2C6IA 3PE1A 4FJVA 1JSVA 4H36A 4LRMA 3U54A 3MVMA 4FKWA 4TNDA 5HO8A 4D2SA 3IW7A 4JQ8A 4CSVA 4RZVA 4H3PA 4CLIA 3N4TA 3ZTXA 1OGUA 2A1AB 2W06A 4C58A 3F7WA 5J9ZA 3BYMA 5IQBA 4DT9A 4UB7A 2VTNA 2X9FA 4QMLA 4ZZNA 4G6OA 4DHZA 5HEZA 3UMWA 5FD2A 4EBVA 5I9UA 3IECA 4EK4A 3MA6A 1REJA 3QLFA 4MVFA 4S31A 4BTMA 4DC2A 5LVOA 3PUFC 1R3CA 2WQNA 3ZEWA 3MB7A 1FPUA 1VYZA 4D2TA 4FT3A 3OOMA 5I9VA 3PXQA 2WKMA 4MBLA 3FI8A 3KF7A 1FMOE 1EH4A 2C3JA 2GNJA 4I0RA 4N6ZA 4YJTA 4A9UA 4D5KA 2HW6A 2R7BA 3MWUA 3QCQA 4HPTE 1YWVA 1H0VA 2I0YA 2JKOA 3KRRA 4KNBA 1RJBA 4KS8A 1Z57A 1UU3A 4BBMA 3KCFA 3OD6X 1YOMA 2PSQA 2WQOA 4NW6A 1YDTE 4FKSA 5K0XA 4NM5A 1MQ4A 2ZOQA 4CGAA 3NYXA 3GXLA 3MPMA 1WBPA 2WPAA 1DI8A 4W4VA 4WUNA 3RGFA 5J1WA 1YI6A 1YI4A 2OH0E 3D2KA 4FL2A 3TNWA 5JK3A 2AQXA 2JIVA 2BHHA 5ANEA 2IPXA 3ZS5A 4K8AA 1XMMA 2GTMA 4KINA 3IW5A 4IVBA 4QMTA 3C4ZA 3WZKA 3DKGA 5E8VA 5A4QA 2I1MA 3PVBA 4DTAA 4G2FA 2R5TA 3MFTA 4RJ4A 3FQSA 3FY2A 3LM5A 4DDIA 4BTFA 3VBXA 5C4LA 4ZY4A 5F9EA 1XH5A 4NUSA 2RSVA 4JMQA 3RK5A 3HUBA 1H1QA 2EUFB 4MF0A 4NFNA 1OL1A 3ZXTA 5IEXA 4G31A 4NJ3A 2RFNA 4AT3A 4D4YA 5IA3A 2ZB1A 2LGCA 2QNJA 3P1AA 4Z55A 3HV3A 3NDMA 2XJ1A 4MAOA 4WT6A 4EH6A 5A4CA 1ND4A 4YZBA 5EOLA 5M4IA 1NVRA 4JS8A 2R0IA 3HMOA 4O7LA 5E8XA 4FOBA 4QMWA 3THBA 3V5JA 4M3QA 4RLKA 4D58A 2Y7JA 3BV3A 2UZVA 3Q6WA 2CSNA 2ZV9A 3FL5A 4TTHB 4JAJA 4JQEA 3TG1A 2GNLA 4DITA 2UZOA 1XWSA 3ERKA 4RT7A 1ZZ2A 1GIIA 4HCUA 4QO9A 4QMXA 3R1YA 4L9IA 5EYMA 3I60A 4U3ZA 1QMZA 3U87A 3DQXA 3UG2A 1L8TA 3K5UA 3NNVA 3RJCA 1SM2A 4YJSA 2CN5A 2QOHA 4KSPA 4BBFA 3EFWA 3L9NA 3VW8A 1JPAA 4DHJA 2Y6MA 5FGKA 3G15A 3MFUA 4UMQA 3FLZA 3BLQA 1GZ8A 3OP5A 2XCHA 3C4FA 4II5A 2X6EA 4M67A 5TE0A 1JNKA 2JIUA 4ACHA 2QO9A 2VTTA 4FL1A 4AG8A 5M4UA 1J1BA 3EFKA 3GCVA 3ZH8A 4DGGA 5LWNA 3Q4ZA 4L3LA 5HLNA 3D94A 3P7BA 3Q2JA 5DEYA 1PXKA 2YIYA 3IQ7A 3U8WA 2XIZA 4I94A 5IZFA 5KBRA 5AFVA 3OOGA 1JLUE 4XV9A 3TZ8A 3IW8A 3FBVA 3WZJA 4IANA 3Q4TA 2W17A 3ZONA 4CV8A 4O7YA 4M97A 3PPZA 5EM8A 2UZNA 4V0GB 4N70A 3RPSA 5B2LA 1KOAA 1UU9A 2F7XE 2PTKA 3FPQA 4MWIA 3BHUA 2R3LA 3OWLA 1E1VA 3GI3A 2J0LA 3DTWA 3DJ7A 1OBGA 4M13A 3GU8A 4FTRA 4GVAA 3UG1A 2ITZA 3V6RA 3VUKA 4EOPA 5BUEA 2ZMDA 2J9MA 3DB6A 1CTPE 5L3AA 3OCSA 4IB3A 3SOAA 5LVNA 3FUPA 5C8KA 2WQEA 4E20A 4QYHA 1H4LA 3OZ6A 3RNIA 2QR8A 5JRQA 4H05A 1F3MC 3E92A 4ID7A 3LLTA 2ZM1A 4DFYA 4IADA 5AP6A 3TWJA 4R7IA 2OFUA 3R9HA 3UO5A 3AC5A 2XP2A 3AOXA 4QD6A 3TNPC 4IB0A 4X7QA 4G3FA 3SC1A 2HOGA 2V7OA 4QTAA 4ASDA 3ZFXA 5L4QA 4YTHA 1PXLA 3BEGA 3LZBA 3W0RA 5KMLA 4AF3A 4CFFA 4A4LA 1Q97A 2I7QA 1BI8A 2OXDA 3ET7A 4XP0A 2IW8A 5L8KA 2WIHA 3QRKA 4MQ2A 3SW4A 4BBEA 4ZLOA 4KBCA 3LJ0A 4W4WA 2R3JA 5IISA 4Q9SA 4AZSA 4FIEA 3QQGA 5HIEA 4O86A 4OGRA 5H2UA 3LFQA 2X0GA 4RVKA 2ZV2A 3M42A 5M44A 3UODA 4IAYA 2YAKA 2VWVA 3EIDA 3AMBA 4W9WA 4YP8A 4BDAA 4CCBA 1YXUA 2XF0A 4ANOA 2G01A 2I0HA 3QQKA 4FKTA 4N4SA 3BWFA 3QHRA 4PQNA 4CKJA 2J5FA 1OKWA 4IDVA 1AD5A 3TNIA 2OO8X 4FKPA 4LFIA 3VUIA 4ANQA 3Q4UA 2ZB0A 3MJ1A 4I24A 4I4FA 4QMPA 4FTKA 4ITJA 3IOPA 4DG2E 4J53A 5HESA 3RK9A 2OSCA 4RFYA 3K5VA 4XX9A 4CMUA 4CV9A 4D9UA 4F9BA 3QKLA 3VS0A 4JRVA 4BCHA 4KBKA 5A46A 4E1ZA 3QRJA 1F5QA 4QMZA 3FXWA 1ST0A 3LAUA 4C4HA 4FTQA 4YUQA 4GW8A 4MH7A 3W32A 3VUTA 1H26A 2VTQA 3FY0A 4G5PA 3HMMA 2XEYA 4KS7A 4YHFA 1ZLTA 4K1BA 4RLLA 4XG9A 4EKLA 5AV0A 5KHWA 3FI4A 3IGGA 5CQUA 5KNJA 2H8HA 3IW4A 4RZWA 4AUAA 4UN0C 4FG9A 3HDNA 4XG2A 4D1ZA 4U9AA 3KKVA 4MXOA 2XRWA 2Z8CA 3KXHA 3Q3BA 4MBIA 4MTAA 4PUZA 3LXLA 4RX7A 3RALA 3PXRA 2PK9A 4ACCA 3MFSA 3CGOA 2WTWA 4ACGA 4ACDA 4MF1A 4EJNA 3C13A 2PVYA 4YZ9A 1Q24A 3DNDA 2A27A 2QOOA 5BMMA 3RK7A 4F0IA 4FUYA 4IWPA 3LHJA 1UV5A 3UBDA 3PSCA 4BCFA 3R28A 4GKHA 3NYOA 4IWDA 3EQCA 1WBSA 2XNPA 4FK3A 5LWMA 5JZJA 2UW0A 2B54A 3HMPA 4EONA 1QPEA 1U54B 4IE9A 4IJPA 3EHAA 3QUDA 4FT0A 5HIBA 4G3DA 3BPRA 4GV1A 2R3RA 2QU5A 2YERA 3W1FA 5KMIA 2X2LA 3PZHA 5HG9A 1ZOEA 4BCNA 4GK4A 4RIWA 2I40A 2YJSA 4QTCA 3FSKA 4TYIA 4ZY5A 1OL2A 3TM0A 4EWQA 2GNGA 5KMKA 4TN6A 3NW7A 1QL6A 2O2UA 3KU2A 4ZK5A 3WF6A 4HYUA 1IRKA 3FMEA 3H4JA 5AV2A 1R0EA 4HVGA 2UW8A 1W8CA 3L8SA 4JG6A 4PL4A 2HZNA 3C4WA 3P86A 3TYKA 4ZS0A 3LXPA 4FKGA 4IC7A 4OR5A 3UO6A 5ICPA 3P79A 3EJ1A 5JQ5A 2P33A 4HZSA 4BWXA 4G6NA 5JT2A 2RKUA 1Z5MA 3QGWA 2JKKA 3A7JA 4NH1A 3HAVA 5AUXA 3RCDA 2PZPA 1OI9A 2FA2A 3PPKA 5M4FA 1PRYA 4JG7A 2VGPA 1Q3DA 4RWJA 3NAYA 2HXQA 2W1DA 5FEEA 2PL0A 5L8LA 2A19B 4FIIA 4BY9E 3TIZA 5T6KA 2ITVA 3C1XA 5AAEA 3CS9A 2GHLA 3VULA 3A4OX 5HTCA 4O7SA 4BCMA 4M14A 3TIYA 4HGSA 2BKZA 4X2KA 3KREA 2RIOA 2P2IA 3R7IA 3AGMA 2ZJWA 3BKBA 3FMLA 4RMZA 3EH9A 1M7QA 1STCE 1XBBA 2UW9A 5B2KA 3VRZA 4PTGA 2R3MA 4ENXA 4C3FA 5H8BA 4F1TA 2BR1A 4KB8A 2XNNA 3NUUA 3TTJA 3IKAA 5AR5A 2PZ5A 4IJ9A 4AA0A 3LFAA 2G2HA 3COHA 3H9FA 3M2WA 1MRVA 4ASXA 1YWNA 2YACA 3GOPA 1PHKA 4C35A 4LM5A 4EYJA 2XYNA 3L1SA 2CCIA 2UW6A 3GC0A 5ITAA 1G8SA 2YWVA 4O82A 4ANMA 4R7HA 1KUTA 4GIIA 5DHJA 3PJ1A 3GQIA 3KN6A 1T46A 3G51A 3AC8A 3PJCA 2C6MA 4QQCA 3VS6A 2XIYA 3BU3A 3TKIA 3IDCA 3UOHA 4CT1A 5J79A 5BUIA 3N4VA 4DLJA 4JOAA 3MI9A 3EL7A 3NUNA 2H9VA 2VTIA 4KBAA 5ETFA 5AIKA 4KIKB 5A4TA 3QC4A 4U5JA 5BYZA 4V0GA 3IG7A 1OMWA 4EOIA 4XV2A 1ZOHA 2W5BA 3DY7A 5CQWA 4F99A 2W1IA 3F2RA 5CF5A 3HRFA 5AJQA 3NUAA 1OVEA 4GG7A 2XNOA 1IG1A 5HU3A 2PHKA 3FKLA 3NIZA 2EXMA 5IMEA 2CKEA 2IN6A 2BZHB 3DNEA 4LOOA 1E1XA 1GNGA 5E91A 4MQ1A 2VWWA 1VLRA 4IEBA 4C38A 2WO6A 5HICA 3QYWA 3ZUUA 5LVPA 2JFMA 4X2FA 3FAAA 3P0MA 4BDIA 5IH5A 4JDJA 4F09A 2JDTA 2R3IA 3L8XA 2FSOX 2YM7A 4DEEA 3QD2B 4E4NA 3COMA 5C4KA 4O22A 3HP2A 3NNUA 2OIQA 4OTWA 2YM8A 4F1MA 4O0SA 3SHEA 4CKRA 1NA7A 4I41A 4IAFA 5CI6A 2NNWB 3K3JA 3R1SA 3D5WA 4TWCA 5M08A 1R39A 3MVJA 5J8IA 2OJGA 2ITPA 5DYJA 2HXLA 1SVHA 3FSFA 3TZMA 4E7WA 2Y4IB 3PY1A 5DRDA 4AE9A 5CZIA 2C69A 4JX3A 1ZY4A 4I1ZA 3C0IA 3H9RA 5CSHA 3W2CA 4KWPA 4YMJA 4QDVA 5EQPA 1KOBA 3RPVA 4AN2A 4BR3A 3LCKA 2BIKB 2XKDA 2W5HA 2WFYA 4FC0A 5T3QA 3TKUA 5M51A 1YHVA 1QPCA 3OT3A 2R0UA 5A6NA 4RVMA 5FM3A 2HAKA 2PZIA 1PW2A 2QLUA 5FTQA 3A99A 5CU2A 3GC7A 4CYIA 4EH2A 5HO7A 5FRIA 3BQCA 3TMOA 2XVDA 4X2JA 4YJQA 4AOTA 4FGRA 4HYIA 3GQLA 5E1EA 3R8ZA 2BZKB 2XNMA 5CXZA 2CNVA 5HI2A 4Q5EA 5E8WA 4PRJA 4S2ZA 5E7RA 3PSDA 3PWDA 4I6BA 4BICA 4FV5A 4JQ7A 4G9CA 4JVGA 3E8EA 2OLCA 5ACKA 4XG7A 3CTHA 3CKWA 5ANJA 4C0TA 5AV4A 2ZDTA 2GQGA 4AXCA 3DB8A 2FGIA 2HW7A 3OCTA 3ZDUA 4IX6A 4R78A 2E9VA 4MD8E 4K6ZA 4NKSA 4P2KA 5EOBA 3PXFA 3D4QA 3QQLA 3E8CA 3DGKA 4NEUA 3OTUA 3GT8A 2GFSA 4N6YA 1P4FA 3SXFA 3KMWA 5HTBA 2J7TA 2JKQA 1YXSA 4K18A 3FMHA 3VQHA 4ANLA 4CZTA 4Z7GA 1JAMA 5KMOA 3W2OA 4ZSGA 4BYIA 4AW1A 4L52A 2B55A 4YC8A 4BZOA 5GJDA 5HLWA 5HX6A 4L7SA 4ZTSA 2XKFA 4JL9A 4ZJIA 2V7AA 4QT1A 1KE5A 2WB8A 3HP5A 3KK8A 3KXGA 4FRFA 5CSVA 3VBQA 3O5AA 4M8TA 3D7TB 4AP7A 4YZDA 2C0IA 2VRXA 2OW3A 5GIPE 3QUPA 4PDSA 4FV3A 5LMKC 2HENA 4JBOA 4TYGA 3LMHA 4ZSEA 3NW5A 4ZLZA 4IACA 4XJ0A 3OW4A 3L8VA 2W1ZA 4AGUA 4FSYA 4FKQA 3Q2MA 1CKPA 1FVTA 4RJ8A 5AM7A 4G3EA 3OWPA 4XCUA 3ITZA 2XIKA 4UXQA 4CQGA 3DLZA 3PJ2A 1PYEA 4OT6A 5IEVA 3ZCLA 4YBKA 2W1EA 3PUPA 4ASZA 1LP4A 3TT0A 3U6JA 4QPAA 2YIQA 5L2WA 5AP4A 3TCPA 5F4NA 3ORTA 4ORKA 3KULA 4O0TA 3E3PA 4G16A 5AA9A 1W2FA 3DJ6A 3LFFA 2BTSA 2PE1A 1IEPA 3S1HA 2QO7A 4CZUA 2XJ0A 3W8LA 4IB5A 4ZJJA 5K4IA 4FIJA 4ENYA 3ORZA 5HTIA 4UYNA 4DFNA 4QYEA 3SRVB 3QQUA 5AP3A 3ZYAA 2IVTA 5IQEA 3MB6A 4GKIA 2R3NA 3G2FA 1M52A 4JI9A 5ANIA 2QKWB 2Z7LA 2GS7A 4O2ZA 3EQGA 4O7ZA 1K9AA 5DEWA 5AUUA 4JG8A 5IA0A 3NCGA 3RI1A 4AGDA 2BKKA 3EFJA 3UMXA 2WMSA 4UALA 4WNOA 3ROYA 4Y83A 4KRDA 5KZIA 4BI2A 3W0QA 5BYYA 2UV2A 4YTFA 5D9HA 4JBVA 2VNYA 4QQJA 4JBPA 3F61A 2I6LA 3CLYA 4JDHA 5AP2A 2WTKC 5BVKA 4AZVA 3KRWA 1SYKA 3SX9A 4P90A 2QOLA 3VF8A 3W2QA 3S0OA 3EMGA 3CC6A 4CG8A 1LEZA 4P5QA 2IZSA 3COKA 3KQ7A 4U79A 5KKRC 4EK8A 5IU2A 3F2NA 2X7FA 2FYSA 1IA8A 3FZOA 3ULIA 4F9YA 5J9LA 3I6WA 4FSMA 3RAWA 3BHVA 3L9PA 5DT3A 4DTBA 4BDKA 4EH8A 1V1KA 4XG4A 2IVVA 2W1FA 4GIHA 4HZRA 4IX3A 4NIFA 4IZ7A 3DDPA 2QODA 5DGZA 5EW8A 4OT5A 4S32A 1Y91A 3TZ9A 5E8SA 4BKZA 4E6CA 2NO3A 4U81A 5BPYA 4IHPA 3ANQA 5A3XA 4RGJA 2REIA 3UIUA 3U9CA 2X2MA 4IQ6A 2UUEA 2H34A 5K4JA 5JGAA 3MTFA 5E8ZA 3F9NA 3D83A 1JKKA 3UDTA 1RE8A 3P9JA 2WOUA 2YFXA 4L6QA 2JIIA 3PY3A 5I5ZA 4KKEA 4U80A 4J96A 4JLCA 2DS1A 3JYAA 4D28A 4ANNA 5A9UA 5L6OA 1PYXA 2WTJA 4DG0E 4QMQA 4QPMA 5CSPA 4MXXA 4BIEA 3QZFA 3TNHA 3VF9A 3E87A 5HU9A 1MUOA 2E9OA 3F3WA 4FSRA 5DBXA 3ID6C 1NT2A 2Z02A 5KO1A 2VTLA 2F49A 2R3GA 4FK6A 3NW6A 4RJ5A 5EYKA 3R02A 4KIPA 4F78A 2GTNA 3ZZEA 5EHOA 5EI8A 2QOKA 1TFFA 4MNEB 4FEQA 4ZMEA 4U45A 2CNUA 2ITWA 1XMLA 2H6DA 4J8NA 4DEIA 5D7AA 3A62A 3D0EA 4NM3A 4EK6A 3PG3A 2CKPA 1AQ1A 2RG6A 2YITA 3D5VA 3DK3A 3I79A 4FNZA 4RC4A 5JZNA 4QMNA 4Z16A 2XJ2A 4RPVA 4DEAA 4FEUA 5JQ8A 2HELA 2ETRA 2XS0A 4PX6A 4USDA 4NFMA 4BRXA 1HCLA 4QMMA 4RC2A 4EOLA 3V5WA 5CEQA 1DI9A 2WMWA 3AGLA 3R6XA 3UOLA 4I93A 4OTFA 2O8YA 5HNBA 3G33A 2ZMCA 1UWHA 1LEWA 2X1NA 1H1WA 3A2CA 1O6YA 2X81A 3ENMA 3B8RA 4NCTA 2G1TA 4WNPA 4JJRA 3U51A 3C0HA 3UIBA 2W0JA 4AAYA 1WFCA 4PF4A 4E5BA 4ANBA 4AXFA 4BDFA 4M69A 2GCDA 2OBJA 3L9MA 4JT3A 3QFVA 2OICA 2YJRA 3CPCA 1BI7A 3RAHA 2QG7A 4WBOA 2Y4PA 2ZM4A 4AA5A 4QP4A 4QMYA 2WELA 3FZTA 3VRYA 4E8AA 4NL0A 5GJGA 4EOSA 3IPHA 4BDBA 5BMSA 4C2VA 2W96B 2PPQA 4CFNA 2BRBA 4FYOA 3W2RA 4UMRA 1ZYLA 3KGAA 5GZAA 5L6WL 3WYXA 4BCJA 5IKWA 1WZYA 5JMSA 4OTPA 3AKLA 1ZAOA 3MIAA 4B0GA 1W2CA 2OF4A 4LL0A 2QCSA 4L53A 3UC3A 4M15A 4D4SA 4ZSJA 4FODA 4I92A 4FSTA 4LQMA 4KRCA 5ANGA 3A7IA 2UW3A 1LUFA 1R0PA 1Q8ZA 1Y57A 1YOJA 3IDBA 4O27B 3RVGA 3QF9A 4TYHB 2X8EA 5TOZA 2PVNA 3ZLXA 3QD4A 5I0BA 2NP8A 4LG4A 4PPBA 1IA9A 2DUVA 1XH6A 4TL0A 1BL6A 1VYWA 2JDRA 5JH6A 4RJ7A 3DU8A 4XV1A 4APCA 5EDQA 3GOKA 2HY0A 3BGZA 5HVKA 4E4XA 3H30A 3FXZA 3EQFA 3OWKA 5ANOA 5GHVA 4BJJB 3QTWA 4LGGA 3UDBA 2P2HA 3R1NA 1ATPE 3ZM9A 3QTSA 4FEWA 2P0CA 2WMXA 4TRLA 4I23A 3ZO1A 2AEGA 3V01A 4GG5A 3D7TA 2R3HA 1KE7A 3G9NA 3MSSA 3V8TA 4NK9A 4R7BA 1Q8TA 5FP6A 1UWJA 2Z7RA 2WQMA 2GS2A 3E5AA 4HCVA 4GFMA 4IX4A 2QU6A 2ITQA 5FLFA 2YCQA 3V5TA 3VS1A 4Y8DA 1PXPA 5BVWA 4APPA 3NYNA 3UQGA 4IDTA 3AKKA 2YIWA 3FHIA 3QZGA 1B38A 3R04A 5IA5A 3QKMA 3D9VA 5AP5A 4QDEA 3F3VA 3HYHA 3BU6A 3OG7A 4GT3A 2Z7QA 2LAVA 4GMYA 1FGKA 3HA6A 4YJNA 2VUWA 1AGWA 1U4DA 4BWKA 1W83A 2X0PA 3ODYX 5JFSA 3SD0A 2X39A 3TUBA 2XK8A 2GNHA 4BHNA 4O83A 4DYMA 1TVOA 2OKRA 2VX0A 2A0CX 4IZ5A 4BHZA 4EHVA 2A4LA 4ALWA 3DK7A 2HYYA 2JC6A 2YDKA 3S3IA 4W4YA 3UNZA 4IZAA 2JAMA 4O4EA 1M14A 5IQFA 4FZAB 4UMUA 4JXFA 4O1OA 3IGOA 5FWKK 1M17A 3RNYA 4D1SA 4EC8A 2XK7A 4RIYA 2YN8A 5AIRA 1I09A 3EB0A 1K2PA 5DWRA 5IA1A 3GNIB 4BDGA 3TV6A 3LFBA 2XARA 2XBAA 5BYLA 2EU9A 3ML1A 2R9SA 2XNEA 2ZDUA 5CAVA 3DAEA 3I7BA 3HZTA 4G3GA 5CEIA 3TV4A 4BCQA 4YSMA 5FUTA 5DIAA 4QNAA 2BZIB 4L3JA 3EYHA 5L2TA 2GQSA 3V3VA 4GYGA 4DAWA 3R8PA 2PYWA 5AADA 1J7IA 3CEKA 3C5UA 2ITTA 4FSUA 4AFEA 2HCKA 4BCIA 4PPAA 4X3JA 3JVRA 3QBNA 2C5OA 2BPMA 4YC3A 3SG8A 5E4HA 2BRHA 2FSTX 4A7CA 1A06A 3SOCA 5JFXA 3CY3A 5KMMA 4EK3A 4TYEA 2XIRA 2YIXA 4LMNA 2Y6OA 4QP3A 3R1QA 4FV9A 3G0EA 4TWOA 4A4OA 5G1XA 2B52A 3QC9A 4BVUA 1SNXA 4WNKA 3PXKA 3O8PA 3FLQA 1V0BA 4QMOA 2OJIA 2WU7A 4GYIA 4AOIA 4E5AX 2RG5A 2CKOA 2J0KA 1U59A 4FSWA 2JDOA 3CQUA 2F2CB 3FZ1A 4I5MA 4YHTA 4ZTLA 5AUYA 5JEBA 4RX8A 5FDPA 3ZO4A 5J5SA 4JIKA 1GOLA 3A7HA 3R7OA 1OZ1A 2HZ4A 5I9WA 3QTRA 3VWAA 3O7LB 5DPVA 2ZV8A 4IXPA 1YHWA 2VTAA 3II5A 4XG6A 2YDIA 3QTUA 3ELJA 4PDPA 4YNEA 4BZDA 3FC1X 2H96A 4O96A 3UNJA 4DEDA 4RFZA 4J99A 4IVCA 5DT0A 4HGLA 3WF7A 4RWIA 2W99B 2B1PA 3K3IA 4X0MA 4DFLA 5A4EA 3TI1A 5M07A 4GK2A 3CIKA 2X0OA 5KUPA 4ZTNA 2XNGA 2WHBA 4NJDA 3CQEA 4O0UA 3NUSA 5EK7A 4WRSA 3F66A 2P3GX 3NS9A 3CBLA 4FNWA 5F20A 3UVRA 3UYTA 4DINA 2CN8A 1J7LA 4X3FB 2XKEA 3NUXA 3DCVA 3H3CA 4PNIA 5AM6A 3R83A 5J7BA 3RWQA 4EWHA 4OTGA 2OFVA 3ZBXA 2J6MA 1FOTA 2PVMA 5D10A 3BEAA 3MFRA 5F1ZA 2Y9QA 2V62A 4MNEA 1PXJA 2F9GA 3Q9WA 1PMUA 3SA0A 3UP7A 3NLBA 1JQHA 2W1CA 3EQRA 3QTIA 3R30A 4IFGA 4CFMA 1OKZA 1X8BA 2XBJA 4FOCA 3VQUA 5EI6A 3BYSA 2PE2A 3F6XA 4MEDA 5DLSA 1UNHA 2W9ZB 4NWMA 1XHAA 1TQIA 4FT5A 5IQGA 3ZEPA 3R63A 3R9RA 2UZWE 4O7NA 3OFMA 1MRUA 1YDSE 3MPAA 2VTHA 3C0GA 3MH0A 4EKKA 4XH6A 2WMAA 2IW9A 3QX2A 1ZYSA 4ZY6A 3KFAA 4DHIB 3BRBA 3SKCA 4RRVA 3C9WA 2QC6A 2RFSA 3LXKA 3DA6A 2BRMA 3F3TA 2VTMA 3IW6A 2ITYA 1UA2A 4JDIA 5EDPA 2Y8OA 3VS3A 4NTSA 3DK6A 5ETCA 3RAKA 2OWBA 4FKRA 3K2LA 1ZWSA 2QQ7A 4PDYA 4AOJA 4FVQA 1U5QA 4XG8A 4MBJA 4AW2A 4BCGA 3RINA 2UZDA 3CJFA 3FXXA 5CX9A 2PVKA 4ZTRA 3W18A 3FI3A 4FTOA 4RVLA 4C4GA 5D12A 2B0QA 5D1JA 2Y0AA 2YWPA 2Q83A 4UX9A 1YDRE 4BI0A 4DE4A 4BGHA 2X0QA 4F4PA 4USFA 2IF8A 4J97A 3B8QA 1GAGA 5CSXA 4HVDA 2V0DA 3VUMA 4FUXA 3LVPA 1J91A 5KCVA 4OBQA 5CAQA 3L8PA 4R5SA 4O2PA 3GUBA 4ALUA