1OVEA

The structure of p38 alpha in complex with a dihydroquinolinone
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
349
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oveA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oveA01
2PMIA 1Y8YA 3E7VA 3H3CA 4FL1A 5D10A 3TNWA 3WOWA 4G9RA 4O0RA 4BDAA 3FMHA 4G3GA 3GUBA 3OCGA 4QRCA 3KVXA 4OTPA 1S9JA 1B39A 2YITA 2YM4A 3C4WA 3DK6A 4LL5A 1A06A 2VV9A 3EN6A 3LCKA 4CZUA 4NM3A 3Q32A 5BYYA 1ZYDA 3FMEA 2O5KA 3DZOA 3C4FA 4MNEA 3H0YA 3LCDA 2GPHA 2YIQA 2AC3A 1WBVA 3SHEA 5BVDA 5CU3A 4R78A 4IVBA 3NYXA 4DTAA 2C0IA 4KKGA 5JZJA 3GOPA 3R7EA 2UZOA 1H1QA 3MVMA 3HDMA 5DBXA 3QLGA 1FVTA 2OW3A 4JBOA 3KEXA 4ZTSA 3QQHA 3VUIA 3F3VA 2WQEA 1W0XC 4G16A 2JKOA 4ZOGA 4H1MA 4F65A 4ZTQA 4FEVA 5HIBA 3F88A 1WBSA 4FC0A 4C7TA 5J5TA 5CEIA 2ZDUA 4XEYA 4DEEA 4ACHA 3P9JA 2F49A 2XIYA 4CG8A 3POOA 4BZNA 3QBNA 3FDNA 3BWFA 4MKCA 1GIHA 3QALE 1JVPP 2GQSA 2BVAA 4O0XA 4QPAA 4YJRA 3QD4A 3C51A 3D14A 5FWKK 3W55A 3KA0A 4LOQA 3UP7A 4B9DA 4FTMA 5CLPA 4DFZE 2B9IA 4H3PA 3KFAA 2B0QA 1GZKA 4D2PA 2R3KA 3TZ9A 3EL7A 4AS0A 4BDJA 2RFSA 4BDBA 3L9PA 1PMEA 4CFXA 5KMIA 5JMSA 3G90X 3DNEA 1M2RA 5BVKA 3M42A 5A54A 3HRFA 5CQWA 4HVSA 5HIDA 1F5QA 3N51A 2VTRA 3WZEA 3Q6UA 4A4XA 5BYLA 3FC1X 4ZSLA 3ORIA 1H08A 4IWQA 3BU5A 1OBGA 3BU3A 4IAIA 4UMUA 3UOLA 4KIKA 1YHSA 3CJFA 4IWPA 5AV2A 5AWMA 4TYIA 5EFQA 4KSQA 1KWPA 1ZZLA 4KS7A 4EI4A 1LP4A 3I7CA 3RBWA 3EMGA 2F4JA 4X21A 5FM3A 3A8XA 3ZM9A 5FTOA 3FLNC 4L42A 3EQHA 4IIRA 3CGOA 4GKHA 4FEUA 5K3YA 4BCOA 3NGAA 4FZAB 2VWIA 2XRUA 4S31A 1L8TA 3F5GA 4PF4A 1YWNA 2XB7A 3CQEA 3FMMA 4KA3A 3TI1A 5A14A 4NK9A 4EH5A 4ZY5A 4QYGA 5KZIA 2QOKA 3W2SA 1UU9A 5EI6A 4OGRA 4DLJA 5HBJA 4IAAA 4L7FA 3A7JA 5E91A 5LQFA 1JNKA 1OM1A 3LIJA 4FKSA 3UC3A 4C3RA 3TJCA 3BLQA 4QQJA 4C02A 4R7IA 2EB3A 3ZM4A 1JQHA 3UO5A 4DF3A 5IQGA 4S33A 4FVQA 1OKWA 2UZVA 3KCFA 4U41A 4ZSGA 3L1SA 2BFXA 2UZWE 3AOXA 4JG6A 4EWHA 4DTBA 4QP9A 2XBJA 3NWWA 4CKIA 2UW4A 2BZHB 3FZOA 5L8KA 3ENMA 1BYGA 4MCVA 3QQKA 4PPAA 3OXTA 3LFDA 3R1YA 4IAKA 3Q3BA 3JVSA 3R9DA 3RINA 2RFDA 5KMNA 3ID6C 2UW9A 4A4LA 3ZEWA 3FI2A 4AT3A 2LAVA 4MBLA 3NRMA 1QPCA 3DBCA 3RK7A 4C38A 3WIGA 3EH9A 2FO0A 2VO6A 4E4XA 1SMHA 4W4WA 2QOHA 4AU8A 4AE9A 1Q5KA 3V8WA 2Z60A 3HRBA 4DGOA 3QD3A 3RPVA 4FV4A 5M4IA 3GFWA 3OOMA 3T9TA 4EZ7A 4DFLA 3FUPA 3WZDA 4BF2A 1TKIA 3MSSA 4J96A 4RWKA 5ITAA 4NYEA 5GJGA 2CKEA 4BR3A 4XG8A 4YHTA 3ZUTA 4FZ6A 4ID7A 3U6HA 2GQRA 5HZNA 3QFVA 3O2MA 4UN0C 4E6CA 4ZS4A 3PTGA 3HMOA 4I0SA 5IEVA 2F7EE 3N9XA 2VTTA 4EOOA 3UNZA 4PTEA 1U54A 2V62A 5HVYA 1ND4A 3AC1A 5CEMA 1OL6A 1JSUA 3MB6A 5HG8A 3SQQA 3F2RA 2EWAA 5IQBA 2EU9A 4QMWA 4GUEA 2VX3A 5L4QA 5JGAA 4A9TA 4K0YA 3C9WA 4O22A 2XIRA 4DG3E 3T9IA 4D4RA 3MN3A 3TKIA 1M7QA 4OW8A 2CCIA 4K8AA 3EFLA 4UWBA 5HD7A 4YPDA 4GMYA 4LV5A 4XG7A 5HI2A 1WBPA 3TIYA 3KF4A 2BHHA 3LPBA 3E62A 4U9AA 2QO9A 1YDTE 2FSTX 1CKPA 2VWYA 3OTVA 4EYJA 4EC8A 2XIKA 3WZKA 5CAUA 4RVKA 1VZOA 5HU3A 3QCXA 2CN5A 3IOKA 4AGWA 3L9MA 3PY3A 3SRVB 4UMQA 3F3ZA 2AUHA 2VWUA 5IQDA 2IVTA 4UYNA 2JDRA 2WO6A 3GC9A 2WMXA 3BGPA 1HOWA 4CFUA 3AD4A 1E1XA 3GQIA 1OITA 4M8TA 5C8KA 2C1BA 3BYSA 4FT7A 3VUHA 2QC6A 5EQYA 2Y9QA 2WD1A 2CNVA 2BUJA 3OCBA 4X0MA 3UNKA 2PVMA 4Y46A 4YGAA 4A9UA 4F9WA 2QG5A 4FEQA 1PRYA 1M14A 1FQ1B 3VWAA 5C26A 5FTGA 5IQFA 4HCVA 3ZOSA 4QMVA 4YZ9A 4XV1A 3CPBA 2IZTA 2VNWA 3AQVA 4MXCA 4EC9A 4CKJA 4LM5A 1ZYSA 2XKEA 1JBPE 4YZBA 3EN5A 5AIKA 2X1NA 4E1ZA 5CAQA 3MFRA 3SD0A 3CTQA 4AZFA 4YR8A 2W1GA 4ASDA 4I22A 3FY0A 4O0VA 3UTOA 2GHLA 2XJ1A 5I9XA 4FTRA 1KOAA 2UZLA 4M14A 4P7EA 4FEXA 3ITZA 2I7QA 5JRQA 4FT3A 2PVKA 3PVBA 3QC9A 3LLAA 3TDWA 2OO8X 2GS2A 4KSPA 4EYMA 4F9BA 3UZRA 2QHNA 4JRVA 3RZFA 3PSCA 4KIQA 2EVAA 3KRWA 3MY0A 3V5TA 3ULZA 5DR9A 4O7TA 1H00A 5HCZA 3NUAA 3GCUA 4Z7HA 5F94A 3RCDA 3HV6A 1U5QA 4AA5A 3FLSA 3QRJA 2J50A 4FK3A 1OIRA 4M67A 4NKAA 4NSTA 2GFCA 4FNWA 4QMUA 3ZXTA 4CFNA 5JGBA 4ANOA 4E6QA 1YI4A 5HTCA 4IANA 4WG5A 5J1VA 2WEIA 3O23A 5DA3A 4J71A 3PY1A 1BI8A 2C3KA 3NIEA 5LVMA 3PXFA 3NW5A 1UKIA 1R78A 2J0JA 4CXAA 5BVOA 3EFJA 2B7AA 4XG9A 5DFPA 4BI0A 3LCOA 3RP9A 4J52A 5IUHA 3QRKA 2IVVA 4FG9A 4L45A 1JKLA 4S30A 4XS2A 5ACKA 1VYWA 2ZV7A 3ORXA 5EM8A 4HCUA 4L00A 2GTMA 4BYJA 2YDJA 3KVWA 3PXKA 4FK6A 4DCAA 3UGCA 3QYZA 5FM2A 4BDFA 5HOAA 5A4LA 3II5A 1X8BA 3ATTA 3A61A 5KZ0A 2PZYA 4K9YA 3FY2A 4H36A 3ENHA 4CFMA 3R7IA 4EH8A 2F2CB 3DAKA 4PL4A 3S2PA 4U5JA 3FBVA 5AUVA 4D1XA 4FTOA 2R7IA 4IACA 5DR2A 2IVUA 3GC8A 2WXVA 3UO4A 3SG9A 3TV6A 4FTJA 3WIKA 4L7SA 3QAME 4M66A 5JFSA 4YO4A 1JSVA 3LFAA 2R3PA 2VTSA 3PYYA 2BMCA 1PXKA 3SGCA 4PQNA 4U6RA 4B99A 4EUTA 2XUUA 4FZDB 4ZAUA 3Q53A 5AMNA 4A9SA 3KF7A 2C47A 3DS6A 3IQ7A 3O7LD 4G6OA 2BIYA 3IKAA 4ACMA 4YURA 4XHKB 4PPBA 3E5AA 4I24A 4NL0A 3PPJA 3R0TA 1H25A 1XH5A 4TYGA 4QMZA 4BCFA 1ZY4A 3LM5A 3GNIB 4OBQA 3QD2B 4K18A 3DJ5A 5E8UA 4ZTNA 4TL0A 4YJUA 2BILB 3SW4A 2XJ0A 2YA9A 3TWJA 4C4GA 5G6VA 4O7LA 5A6OA 3DAEA 3ZZEA 3I1AA 4FZ7A 4Y83A 3V5PA 4GK2A 4BCNA 2UZUE 2ZM4A 2BZJA 3NCZA 3A7GA 2BHEA 4FKIA 4IM3A 4KRDA 4M3QA 2XYUA 3D4QA 4QD6A 2QU5A 4BZDA 2I0YA 5I9WA 4YPSA 4C3PA 4O7WA 4RIYB 2Z7SA 3U9CA 3GEQA 4XP0A 3ROCA 1WVWA 1IRKA 5A4CA 4I4FA 4KS8A 4JIKA 3EYGA 5JKGA 3JY0A 1UU7A 2C30A 3BQCA 4RT7A 3SXFA 4ZTMA 5ANJA 4QMYA 2R3MA 4XV2A 5HO7A 3DXPA 2VD5A 4QNYA 2W9FB 3EQBA 4DLIA 1SVGA 3WF7A 4JRNA 2YZLA 5CF6A 4X3JA 3ET7A 1T45A 2C68A 3UP2A 3LCTA 2C3LA 1CDKA 2JAMA 3JYAA 4IB5A 4NUSA 1SYKA 4FR4A 3EQGA 3TKUA 1O6YA 3NNWA 3SDJA 4HZRA 3T8OA 1K2PA 3EOCA 3F82A 2XM9A 3G9LX 3TT0A 2GS6A 4V0GA 4CLIA 4DG0E 5JH6A 5L2WA 2EXMA 4UB7A 4XP2A 3IK3A 4IMYA 2QR8A 3G2FA 5IQCA 1OUYA 5ETCA 2OLCA 2NNWB 3TL8A 3MTFA 5GJDA 3F69A 4JDHA 5BQ0A 2PE2A 2VO7A 1H07A 3HDNA 4W4VA 3ZFYA 2YWPA 2WU6A 3SRVA 2C69A 1OL2A 2NPQA 5FG8A 5A9UA 5LMKC 2XMYA 3HRCA 2EXEA 3EQPA 4K6ZA 3V01A 4FI1A 2JDOA 2PVJA 5KMKA 1MRUA 2YCQA 3O8UA 2IW6A 3TN8A 5CSXA 4PPCA 3UOKA 4HNIA 4ARKA 3CE3A 4E4MA 3D7ZA 2GNGA 1OB3A 2BAQA 4PTGA 4IH8A 5AR3A 3I60A 3IDBA 3BE9A 3WYXA 4E7WA 4OAUC 1XR1A 1YI6A 1FMOE 4WSQA 4BL1A 4O82A 3KCKA 3OOGA 2R64A 3IGGA 4FVPA 4YTFA 3OWPA 4FTUA 4Y5QA 3F6XA 4MF1A 4N70A 3F2AA 4L3PA 4UV0A 2VTHA 2YAAA 4B8MA 5K9IA 5EHLA 3PXRA 5DWRA 3CQWA 3DTWA 4KBKA 3GGFA 1LEZA 4YNOA 4FL2A 4FTQA 3R2BA 2PULA 3COHA 4ERWA 4WG4A 4D9TA 5IUIA 1E9HA 2KTYA 3NVKI 3RAIA 5CXZA 3SXRA 3KL8A 4LOOA 1R1WA 4MQ1A 1ZZ2A 5E90A 3LFBA 4I5CA 3KQ7A 4NJDA 3VBXA 4XX9A 4U40A 5J9ZA 3AMAA 2BAJA 5EQEA 3G0FA 2J7TA 3MS9A 4IC7A 4HGEA 3FZRA 4ZJJA 2OWBA 1L3RE 4HYSA 4YC8A 3W2CA 5BVNA 4LG4A 4C0TA 3ANRA 2OJ9A 1TQPA 2X2MA 1REKA 3S95A 3R28A 4DINA 2J5EA 2G15A 2NP8A 2WQMA 2YIYA 3HV5A 4M97A 2O0UA 4UY9A 4S2ZA 3EJ1A 2HY81 2QVSE 3CP9A 3FJQE 3MDYA 4FIEA 4FVRA 4CTBA 4D28A 2Y4IC 5HG7A 5CU4A 2XK3A 4I41A 3C0GA 5DMZA 4FGBA 4U3ZA 3TV4A 4DGGA 3OG7A 1BL6A 2RIOA 1G8SA 3DK7A 1Q8ZA 1REJA 4GUBA 4R77A 2G2FA 3AC5A 3FC2A 5TOZA 3QL8A 4X6QC 5JQ8A 4W8EA 3UQFA 3PE1A 4G3FA 3ZDUA 3PP0A 4RX5A 4MH7A 2A0CX 4IVAA 5HO8A 4YJPA 3P79A 3Q4UA 4IM2A 4HYIA 3V8TA 4JT3A 3PY0A 3FZSA 4HW7A 4DCEA 2WMBA 3FYJX 4AN9A 4RA5A 3A8WA 4LUEA 2QG7A 5J87A 3ULIA 5IA5A 3UYTA 3ZLYA 1W7HA 4ENXA 4QYFA 3QQJA 2PE0A 1JKKA 2IZSA 1FVRA 3LW0A 4G3DA 3GC7A 3W2QA 5GINE 3ZRKA 3G5DA 4W9WA 1VEBA 2WTIA 2UZTA 3QKMA 4DEBA 2YCSA 5IMEA 4Q9ZA 2VNYA 3OWKA 4JXFA 4YZDA 4KUJA 4XG6A 4EZ5A 2X8IA 1IR3A 5HCYA 3IO7A 4U81A 4ZY4A 4C8BA 3DDQA 5CNNA 2Y7JA 1ZOHA 1WBOA 2BZIB 2CN8A 4OR5A 3NLBA 2E2BA 1B38A 5TO8A 3K5VA 4EH9A 1AGWA 2UW0A 4RSSA 2CKPA 3BHHA 3RI1A 2J0KA 3HNGA 2WQNA 4YO6A 2CSNA 5HLNA 3LQ8A 5M57A 1LEWA 1J3HA 3CLYA 1ZY5A 4IW0A 2UW6A 3ORZA 3C4XA 4WO5A 4AW1A 3K5UA 4BTFA 1J1BA 5GJFA 4CMUA 5K5NA 4NM7A 1O6LA 4QMQA 3RPOA 3FLWA 4NJ3A 2VN9A 4FV3A 5TR6A 4GSBA 4F99A 2G1TA 3ZSIA 3RWQA 2X6EA 3G6GA 4ZLZA 3NW7A 1XH6A 4CFFA 2R4BA 4U0IA 2UW5A 4QMNA 3FKNA 4FTKA 4RIYA 3ZSGA 3FL4A 1Q4LA 5HU9A 1KUTA 3QXOA 1ZMUA 4J97A 1GJOA 3ACKA 3CJGA 4IZAA 3R1SA 1OBDA 5M44A 3R63A 3LFCA 5AP2A 5K5XA 1KOBA 3P08A 4GT3A 1Y6AA 4RIWA 5LCKA 3V5JA 3AT3A 4N4SA 3U9NA 4G2FA 3UOJA 3TNPC 1OKYA 4I5PA 4TYEA 4FT5A 4XLVA 4CCBA 4KAOA 2Z2WA 1ZAOA 4WT6A 4BZOA 2PWLA 2R3GA 4P90A 3D7TB 4PMPA 3I6WA 4YZCA 1SVEA 3QTQA 4RJ7A 3TZ8A 4IAFA 5E8YA 4O91A 2R3IA 1OVEA 2ONLA 3BPRA 3WILA 5JFVA 2ZJWA 3KK8A 3V3VA 3VS6A 3ZUUA 4BBFA 5A6NA 2PK9A 3ERKA 3PPZA 2X2KA 4R8QA 4BDGA 2V7AA 4ITIA 3MH1A 5BNJA 2Q0NA 3DY7A 4Y5HA 4E3CA 4O38A 2ITPA 1Z5MA 3IW4A 3QD0A 3W2RA 4O27B 5AUYA 4DITA 5IH5A 3VUKA 1PXPA 3RMFA 4RC2A 4B8LA 3R9OA 1ZOGA 3UVRA 4UX9A 4RWIA 2XK4A 2A19B 2OJJA 2JC6A 2PMOX 2J2IB 3FYKX 4DGLC 2OICA 4KIPA 3KRXA 4JX3A 5AP0A 2BALA 5DT4A 5HHWA 3TNHA 3KXXA 4PTCA 3GU5A 4MXYA 2R5TA 5J7BA 4EQMA 2XJ2A 3OBGA 5BVEA 3VS2A 4K1BA 5AV0A 5B7VA 4RFZA 3GU8A 4AOIA 1VR2A 4BKZA 4FKPA 5IMXA 5EK7A 2FSOX 2WTKB 2J90A 4RIXB 2PZIA 3EIDA 1KE5A 3GFEA 3CSVA 5CENA 3GBZA 2UVZA 1IG1A 1PKDA 3U55A 3PE2A 4BIEA 4KKEA 5DGZA 3W33A 4C4HA 1O6KA 2WMQA 2FH9A 3FI3A 4APPA 2NRUA 3Q2MA 2HIWA 5FGKA 3W2PA 5AX3A 1YWVA 5D9HA 2H9VA 4YBKA 1V1KA 2UZNA 3O71A 2JFLA 3EQRA 5E7RA 1U59A 2P2IA 3RAKA 4EZ3A 4PNIA 1VYZA 3G0EA 2C3JA 4IWOA 1P4FA 3VS0A 3VJNA 1JOWB 3WF6A 5KHXA 3R8MA 5AA9A 3LXNA 5CWZA 5C01A 4FSUA 4YJNA 5K0KA 1NXKA 2FSMX 3VS5A 4G31A 4XMOA 4E93A 4QQCA 4YJVA 1Q62A 3QLFA 4WBBB 3CKXA 1M2PA 2BRMA 2OKRA 5CEQA 3BE2A 3QTZA 2GNHA 4U43A 5JQ5A 5IQIA 1NY3A 2ETKA 5HESA 3TACA 4D5HA 2QOLA 2BKZA 3BIZA 5CSPA 1KE9A 3BEAA 5HE3A 3KXNA 4RBLA 4AE6A 5J9LA 2OG8A 4R7BA 3GU7A 1V0BA 4C58A 4XCUA 3AC8A 3JUHA 2X9FA 4FNZA 4F7JA 3PFQA 2OXYA 4OBPA 5C9CA 2BDJA 3COKA 3NUSA 5CALA 4O7ZA 5ACBC 4Y73A 5FTQA 1NW1A 1OMWA 5A3XA 1KE6A 3Q60A 5CVGA 1R3CA 3SLSA 4QQTA 3HX4A 3BHTA 4RVLA 4DBNA 5IEXA 3M2WA 2QHMA 3UE4A 4G6NA 3V5QA 3NZ0A 3UZPA 3Q5IA 2ITXA 5CSVA 5EDQA 3HKOA 1U4DA 3IW7A 4L3LA 2PZ5A 4L52A 4E5BA 5AEPA 5C4LA 3HMIA 5TT7A 2VTAA 3AC3A 3CEKA 4YZMA 1GZNA 2XEYA 3MFTA 4JAJA 4CV8A 4MD9E 3NUYA 2WZJA 1UU8A 5HE1A 1RJBA 1XQZA 2GNJA 3GC0A 5GNKA 3ANQA 3FKLA 3ZSHA 5HTIA 4CYJA 2RSVA 2F7XE 4RJ4A 4FIIA 4PV0A 2PPQA 3DZQA 4AW5A 5KO1A 3F5UA 3SG8A 4DN5A 4FKWA 4LYNA 2LGCA 4QP3A 3K3JA 5DT3A 2QOIA 4FG8A 2OZOA 4MBJA 5KKRC 1QPJA 3OY1A 3QWJA 3RKBA 2GMXA 3FL5A 4PRJA 4IX4A 5H8GA 4WRSA 4AXAA 4GFOA 4JJRA 4FSRA 3TTIA 2OI4X 4QT1A 2CKOA 2C5VA 2NO3A 3FSFA 5A4EA 4UYAA 3OS3A 5HLPA 3CTHA 3FXWA 5J8IA 3QQUA 5M08A 3V6RA 4FKQA 3TCPA 3ODZX 3R71A 2WIPA 2PHKA 5I9ZA 2R3RA 4EOQA 3EZVA 4YNEA 2F57A 3DBQA 4I93A 5IEYA 5IA2A 4CNHA 2WNTA 3F5XA 4M0YA 4D2WA 5DEYA 4AZVA 3A4OX 4QMTA 4R3CA 2RF9A 3EN7A 4V01A 4WSYA 3VBWA 5AAFA 3BYMA 4D1SA 3FLQA 3L8SA 5BVFA 2UVXA 2W1ZA 4QOXA 3WBLA 1RQQA 4IVDA 2IPXA 2YIRA 2HWPA 4M12A 4ZIMA 4C33A 2Y0AA 5LMKA 4B6LA 4OTHA 5E8XA 5CU2A 3PIZA 2UW8A 5AP4A 4AZSA 4Y85A 4D4YA 4Z3VA 1CKIA 4G6LA 1H1RA 1WAKA 1OL5A 2OBJA 4QP2A 1JWHA 2H8HA 1JSTA 3PG1A 4EH3A 3D7TA 4ZSEA 4ZLYA 4Q2AA 3MH3A 2P4IA 4RRVA 4IAZA 3R04A 3R1NA 4UMTA 2C6EA 2YHVA 1YKRA 5KMOA 5HBHA 2XNNA 3PXYA 3HUCA 3P86A 1PXJA 1XHAA 1H0VA 4G5JA 4AOTA 3PDTA 2OZAA 3WARA 4FT0A 3ZU7A 1P2AA 1PXIA 3NDMA 3WE4A 4EQUA 5L2SA 3QCQA 3ZXZA 4GEOA 2PYWA 4Z16A 4MXOA 1J91A 5EHYA 3AC2A 5AM6A 4L68A 4P4CA 4F0GA 1FVVA 3VULA 1DI8A 2UZEA 4IC8A 3MA6A 5IISA 5LVLA 4DEGA 4JLCA 3CY3A 4UBAA 5LWMA 2ESMA 4DC2A 4GL9A 2C5NA 4K2RA 4USDA 3IOPA 4NM0A 4UXQA 4XUFA 3D5VA 2QI8A 4ACDA 3OVVA 4CYIA 3HAMA 3NYNA 4HOKA 2BR1A 3VJOA 2C6KA 1CKJA 5FEEA 2WEVA 3QHRA 4L46A 4TY1A 4IXPA 4ASEA 3LCSA 3VAPA 4HVHA 4EHZA 1BL7A 4CVAA 2F7ZE 2G2IA 4FSQA 1FOTA 4XG3A 4AW0A 4QO9A 4RIXA 3WE8A 2BTSA 4TWNA 3UG1A 2CDZA 4JDJA 5B2KA 4IFCA 3KRJA 4FV8A 4ZSAA 3R7UA 4U7ZA 4C4FA 4Q5EA 1PXMA 3RM6A 3Q9WA 4V0GB 2BAKA 4YC3A 3V04A 1ERKA 5HVJA 2CLQA 2QNJA 4J8NA 1YI3A 4FV5A 4E6AA 2BZKB 3ORPA 4B7TA 1PMNA 4RVTA 4BKYA 2REIA 5C8MA 1YHVA 2VWVA 2CNQA 4BTJA 2UUEA 3QWKA 2R7BA 2CHLA 4EH4A 5AUZA 4DEAA 3NVMB 3UYSA 4LI5A 3G51A 1BLXA 2ITNA 5ICPA 2GFSA 2IVSA 5AUTA 5JK3A 5LCJA 1ZRZA 3QTUA 4QTAA 2YWVA 3C5UA 4RA4A 3NSZA 3A62A 3MPTA 2AYPA 3MJ1A 4DFXE 2JDTA 3MFSA 4EH7A 2OIBA 3E3PA 3U6JA 4BCKA 5ETIA 4MAOA 5DIAA 3UNJA 3TUCA 3DB8A 1KSWA 3DA6A 5EHOA 5FXRA 1NA7A 4RMZA 2C0TA 4I6FA 4BVUA 2XK8A 5F9EA 3QXPA 4ITHA 3FQEA 4IHPA 3N4UA 1Q97A 3CIKA 1OL7A 2J0IA 1URWA 2ZV9A 3R9RA 5IQHA 4W8DA 2J51A 4HZSA 3NNVA 4GCJA 5AP7A 4AN3A 3H0ZA 4IZ5A 4MQ2A 2PVLA 2Q83A 2QCSA 4O0YA 3ZLSA 4NU1A 4C2WA 1UNGA 3QZFA 4FSYA 1WBWA 4U80A 5E8ZA 4N57A 3QUEA 5EDRA 4YJSA 5CS6A 2OXDA 4AW2A 4CRSA 4YBJA 3VBTA 2PE1A 2WMRA 3KB7A 4JR7A 4F09A 3HA6A 3VS7A 3N4TA 3Q4ZA 1H0WA 3HP5A 4GRBA 2BCJA 3QCYA 4LGDA 4BC6A 2YM3A 4RC4A 4CTCA 2CMWA 2UZBA 4MWHA 3I79A 1S9IA 1LUFA 2PVYA 4FKGA 5DI1A 4BKJA 3KN6A 2NRYA 4BBEA 4F0FA 2R3NA 2YACA 3FAAA 2B9FA 3BU6A 1U5RA 1Q99A 3BYVA 3ZS5A 3DLZA 4L53A 2YJRA 2XK6A 2I40A 4OT5A 5BMMA 3U54A 1TQIA 2H34A 3KXMA 3JXWA 2WQOA 4O84A 4PL3A 3FZPA 3KRRA 4ZMEA 2XNGA 1A9UA 3F7ZA 2BPMA 3EL8A 5J79A 4A9YA 3D2KA 3KN5A 5LARA 4Z55A 1YOMA 4BCMA 4DFYA 3UQCA 2JFMA 4AT4A 2IWIA 2OGVA 5C8NA 3COIA 4D2TA 2B9JA 4FBXA 3KULB 5AV4A 4O96A 1Q8YA 3PJCA 4F9AA 3BEGA 4M68A 4EL9A 3FQSA 2WTJA 3OEZA 2R3JA 4NWMA 3FQHA 4JQEA 3KRLA 1RE8A 3GOKA 3T3UA 3BQRA 3K2LA 3LMHA 3QZIA 2OIQA 4S34A 2BRHA 2JAVA 4Y8DA 5TKDA 2XS0A 3R30A 4N0SA 4I6QA 2PTKA 4D4SA 4EORA 5KX8A 2ZDTA 5CVFA 3JPVA 4FTIA 3EB0A 2XNOA 3LXKA 3D94A 4YMJA 3BI6A 1Q8TA 3C4EA 1GZOA 4H39A 3QTSA 2WMSA 3RK5A 2QO2A 3E8EA 4F9CA 3C1XA 2ITZA 3POZA 5EW9A 4GH2A 4NTSA 2E9NA 2FVDA 2XNPA 2XK9A 4YTHA 1WFCA 4AP7A 4FUXA 1JKSA 2V22A 3PVUA 4O21A 5CF8A 2YM5A 1KE8A 3AGMA 4O7VA 4ONAA 3ZO1A 5A4QA 5L8LA 3CPCA 3B8QA 3KC3A 1XBCA 3ZLWA 4DHFA 5CAOA 1JPAA 3C4CA 5AP6A 3RVGA 3ZO3A 3HMNA 2PUNA 4JDIA 5C03A 3TKHA 4RX7A 3BLHA 5EKNA 4FNYA 3ORMA 1LR4A 3ZZWA 4D2RA 4BTMA 2VTNA 2HAKA 2JDVA 3ORTA 3TEIA 3VF8A 4YJTA 4D4VA 4MK0A 3D5XA 4EHEA 4BN1A 3LHJA 1CSNA 4EOLA 5D12A 5JRSA 1R0PA 4C57A 4DGMA 1TQMA 5FEDA 3C0IA 4RJ8A 4A7CA 2YAKA 3LZBA 4GG7A 3RALA 5CZIA 4WA9A 3SOCA 2C6DA 4IX5A 3FHRA 2A1AB 3P4KA 4I6HA 5GZAA 2XVDA 2IG7A 1Q41A 5DOSA 5E92A 3LAUA 4TWOA 4RIWB 3UIBA 5GHVA 3UO6A 2C5YA 3EKNA 3F3TA 3NAYA 3CKWA 3RJCA 1UNHA 3ZH8A 3KK9A 3QZGA 4EQCA 3OWJA 4GK4A 1Y91A 3FI4A 4AFEA 2GDOA 4IEBA 3R9HA 5AUXA 3VF9A 2OK1A 3MGYA 4HYHA 4WHZA 3LE6A 3GQLA 4RX8A 2YABA 5K0XA 5HG5A 2YZAA 4OTIA 4AF3A 2XF0A 4DFNA 4NH1A 3REPA 4F9YA 2RG5A 2WOUA 4QP1A 3GU6A 3UODA 4C61A 3E8NA 4D2SA 5CEPA 4JBVA 5LXMA 3Q6WA 4UZDA 5GZ8A 3KGAA 2ITVA 2BIKB 3OD6X 2W99B 3KKVA 4XBUA 4JVGA 5E1EA 5CAPA 5IDPA 3COMA 3OHTA 3OW4A 4L6QA 4F7NA 4ZZMA 4UMRA 1OIYA 3E92A 4HCTA 4BRXA 3R02A 4DEDA 4EOKA 4R1YA 5C4KA 2OH0E 2YDIA 3PA4A 4GG5A 3IONA 4UALA 3KREA 4PL5A 4GIHA 3IS5A 2X8DA 2I0EA 2W7XA 4I1ZA 4DT8A 4IX6A 4C62A 2VTOA 3W16A 2R2PA 4L67A 4CV9A 4NCTC 1BI7A 2P33A 4YZNA 4YSMA 5LVPA 2RFEA 4UZHA 1V0PA 3LFNA 4ALVA 4UWYA 2KULA 2YLFA 4J8MA 3HAVA 4RZVA 3QYWA 4O0UA 2ZMCA 4TTHB 2WTVA 4IFGA 2YDKA 2HELA 3E64A 2R3QA 3VO3A 4I94A 4OT6A 4PDOA 4DE4A 2QODA 3AT2A 1NVSA 4G3EA 3TNQB 3TZ7A 3DKFA 2CJMA 1OUKA 1OZ1A 3PRFA 2C6IA 2Z7RA 3DJ6A 3PZEA 4BHZA 1O9UA 2W06A 2XM8A 4AOJA 3P7CA 1PXNA 1H1PA 4WNMA 4BB4A 3MWUA 2YEXA 5KHWA 3VHEA 5A4TA 3MIYA 5HE2A 5L2QA 4GYGA 4RLLA 4EONA 2C6MA 3OTUA 3SX9A 2QOOA 2OF4A 1DAWA 4C4IA 3LQ5A 4XG4A 5KMMA 4HGLA 4FZFB 1XH8A 2W5HA 2WMTA 5DN3A 2XEZA 3AT4A 2JITA 2YISA 5ANGA 3O50A 4BCPA 3VS1A 3FMKA 3O8PA 3GT8A 3R00A 3DB6A 1Q8WA 3GCSA 5FXSA 3Q9YA 4NW5A 3WI6A 5BPYA 3TM0A 4H58A 3LXLA 3DKCA 1OPJA 3FXZA 2PUIA 1Y8GA 3FLYA 1YOLA 4QP7A 4CEGA 3QTRA 4CQGA 4F6WA 2OXXA 3AXWA 5BVWA 3SAYA 1UWJA 2JD5A 4YSJA 2B1PA 4XH6A 3HVCA 4TT7A 5J95A 4C2VA 3E3BX 2CGUA 5HQ0A 1YW2A 2IZRA 4MXXA 5FUTA 4DFBA 1VJYA 4QP6A 2WOTA 4EOSA 2GQGA 4BTKA 4BI2A 5F20A 3PVWA 4RWLA 4PDYA 2X7FA 4J53A 4RFYA 3G15A 4CKRA 3I0OA 2JIIA 3KULA 2AC5A 4HJOA 4PDPA 4JOAA 1DS5A 2H96A 4FSMA 3LJ0A 2DUVA 5EI2A 4FKLA 3V6SA 2P2HA 3I5NA 3V8SA 3EYHA 2Y4PA 3Q9ZA 4C59A 5CNOA 4FT9A 2R3FA 4I5MA 3DQXA 5M4CA 2YIXA 3DAJA 3BWJA 2PSQA 3MI9A 3VS3A 2XNMA 4RJ6A 4OTWA 4QMSA 1UU3A 2ETRA 4BI1A 4M69B 1T46A 4N6ZA 2WAJA 3AC4A 1MQ4A 5BX0A 5LVNA 3PJ8A 2UV2A 5L2IA 3MB7A 4L8MA 2R0UA 5IH4A 2UVYA 3IGOA 4IZYA 1DI9A 4HYUA 4X2FA 2C1AA 2WTDA 2XIXA 4B4LA 3BYUA 4PDSA 3E88A 3CGFA 4XLIA 3P5KA 4DG2E 3NPCA 3MY5A 4RQVA 2WIHA 2XCHA 1GAGA 2W1IA 1PMVA 1ZYLA 2OJGA 3QGWA 3BBTB 4ASXA 4DYMA 5EYKA 3W8QA 4YUQA 1UVRA 4I23A 5EH0A 3SKCA 3EQCA 1SM2A 3BYOA 3NAXA 2XYNA 3VW6A 4GW8A 2QLUA 5JEBA 5E8WA 4DAWA 3VUGA 4JQ8A 2YCFA 2E9PA 2X8EA 3EN4A 5CT0A 2ITQA 1XH9A 5CANA 3ODYX 4FTNA 3W2OA 3VNTA 4EOMA 3KMWA 4FX3A 5FEQA 4HVGA 3TDVA 1MQBA 2PVHA 4GU9A 4JNWA 5EG3A 1PKGA 4EBVA 3NNUA 3C50A 5AR8A 3V5LA 4F64A 1F3MC 2VWBA 4AT5A 4LV8A 2CKQA 1STCE 4HNFA 3Q9XA 3LLTA 4QQ5A 4X2JA 2O8YA 5D7AA 3LKMA 2HXQA 3AMYA 3OY3A 2YN8A 4JG7A 2CPKE 2YCRA 3ETAA 4O1PA 3GCPA 3DGKA 5IA3A 3GCVA 3ORLA 4BWPA 1WZYA 1ATPE 5BUJA 2ZM3A 5CXHA 2JEDA 2PZPA 5AR4A 3R7VA 3WYYA 4BGQA 5ANOA 4RLKA 3L9LA 5I4NA 3NUXA 3NS9A 3LFFA 2XKDA 3HV7A 3QRUA 3RHKA 2C6OA 4O2PA 1XBBA 2YM7A 3R6XA 1FBNA 3PWDA 3RPYA 5IA4A 1YHWA 5DHJA 3M11A 2BRGA 2Q0BA 3S00A 4UMPA 1PXLA 4W4XA 5DT0A 5FD2A 4ANNA 5IZFA 2OZAB 4FIHA 5HX6A 4UEUA 4F63A 4CD0A 4M84A 5M53A 4ZY6A 1MP8A 4MD7E 3DFAA 4Q9SA 2PY3A 3AGLA 1G3NA 3U4UA 3HMMA 4D2VA 5CZHA 2X2LA 4M13A 2EXCX 2GU8A 4DBXA 2DQ7X 4A9RA 4BDDA 2QU6A 3QA0A 4QMPA 2XNBA 1GOLA 1ZARA 2BRBA 1RW8A 2WTWA 2XKCA 4WNPA 4I0TA 3MW1A 1EH4A 2C6TA 2XIZA 3CS9A 2W96B 3PZHA 3TXOA 2JKQA 4CT2A 1FMKA 3ALOA 5HG9A 2X0GA 5IDNA 5FRIA 4AA4A 4EBWA 1BKXA 1OKVA 3NIZA 4RGJA 2FA2A 4XOZA 2J9MA 2VX0A 5IG1A 4AGCA 2GHGA 4GT5A 4KINA 3D83A 3PJ2A 4QMMA 4YC6A 4QTCA 3DPKA 3LJ2A 4ZTHA 4QTBA 4EK4A 5LJJA 4FKTA 5DH3A 2Z7QA 4DEIA 3H30A 2WQBA 3PG3A 3ZO4A 5AM7A 3HL7A 5I5ZA 2ZOQA 1PJKA 3I6UA 4NW6A 4IADA 3U51A 4QP4A 3UDBA 5KMJA 3N4VA 1V0OA 2Y4IB 4L01A 4O0SA 4O6EA 4TNDA 4QTEA 3TNIA 5B2MA 2UW7A 2QOFA 4QMLA 3PLAE 4FYOA 3ZMMA 5AADA 4FV2A 2WB8A 4H3QA 3ZTXA 5AAEA 2XCKA 3A4PA 3GU4A 2VAGA 3D15A 3R21A 4PP7A 1UV5A 4ANQA 2XRWA 4ANBA 4FV0A 4WD5A 4O83A 4XRLA 4W9XA 5JSMA 2X7GA 4ZLOA 3AG9A 3ZDIA 3LFSA 3ORKA 5H3QA 4GJ2A 3VBVA 1GIJA 3ZEPA 5K4JA 1Y6BA 5EDPA 2HXLA 3BV2A 4H3BA 4O1OA 5IPJA 2Y8OA 3P7AA 3QF9A 3C13A 3FMLA 5CAVA 3KMMA 4XV9A 3OWLA 1K9AA 3MIAA 2W4KA 2X9EA 4E4LA 1SNXA 1GIIA 3QX2A 2A2AA 3MA3A 5BYZA 2VGPA 4AGUA 4F1TA 2WGJA 3PJ1A 2W4OA 1IAJA 2G2HA 2OIDA 3A7IA 1YXSA 3O7LB 3DDPA 4FIFA 1K3AA 4O6LA 2QD9A 4F7SA 5I9UA 3OZ6A 5D7VA 4A06A 2BROA 4HGSA 4I92A 4U97A 4A4OA 3ZFMA 4F7LA 3MH2A 5IA0A 3NMUF 3UJGA 3PA3A 4X6RA 5JT2A 2G01A 1MUOA 3PRIA 1SVHA 2B55A 4K33A 4WOVA 2YERA 5KMLA 5DVRA 2OJFE 1W82A 2VX1A 4WKQA 5E8TA 4GFMA 4TKSA 2HOGA 3QHWA 3AD6A 4FYNA 4Z9LA 3UBDA 3W1FA 4BFMA 4C36A 4PX6A 2IO6A 4AAAA 2WMWA 5HICA 3HZTA 4BCQA 3VRYA 2VTJA 4ZJVA 2VWXA 5M09A 1BX6A 5FP5A 4HVDA 3GI3A 3ZHPC 4K77A 4S32A 4J99A 1WMKA 2BFYA 4F4PA 3B2WA 4JX7A 4M69A 3UIUA 5M51A 1OIQA 5DEWA 3MV5A 3OMVA 2GCDA 3OT8A 2ACXA 3HA8A 3MYGA 4MHAA 1G5SA 2ITOA 2V0DA 2X7OA 3KY2A 1YXTA 3QZHA 5EKOA 1HCLA 3FSKA 5EOBA 1PYEA 3T3VA 4GKIA 1OL1A 2EB2A 3P1AA 4IB0A 2QLQA 1XH4A 2I6LA 2PVRA 5KBQA 2ITWA 5ANEA 5LOHA 3OF0A 1UNLA 1GNGA 2QO7A 4FICA 3WF8A 1IASA 5LMAA 4LUDA 3R8ZA 4FSNA 3GB2A 3PA5A 5BUEA 5T68A 3O0GA 3TV7A 2E9VA 1YXXA 4BIBA 4EJNA 3SW7A 2HZ4A 2ZYBA 1HCKA 3GP0A 4MX9A 3ZYAA 5KNJA 1YRPA 2A4LA 2QONA 1ZMVA 4FF8A 3R2YA 2X6DA 4CZTA 4QYEA 3Q52A 4NFMA 4I0RA 5JZNA 5L6WL 4TXCA 2C6LA 1ZOEA 5GZ9A 1H01A 1ZWSA 4CLJA 4MXAA 5AR7A 1XJDA 4BCIA 3BX5A 2WMAA 3FPMA 5E8SA 4GVAA 3OBJA 2I1MA 2XZSA 1IAHA 3BKBA 1M17A 4UWCA 1WBTA 3R8VA 3F5PA 4D9UA 4EHVA 4USFA 4XV3A 3QRIA 4W4YA 2CGXA 4DA5A 4P5ZA 3ZUVA 4O0TA 1SNUA 4LMUA 2XKFA 4NIFA 4FKUA 1WCCA 5D11A 2VTIA 1YVJA 1RDQE 3R1QA 5F4NA 5AAGA 5M4UA 4B0GA 3QTWA 4AGDA 3Q04A 4BY9E 3HMPA 4GK3A 3ORNA 3QGYA 3RPSA 4FSWA 5CEOA 3ZO2A 4YTCA 5H9BA 1J1CA 4NTTA 2XNEA 1OIUA 2HWOA 4AZTA 5BUIA 4NCTA 4PY1A 3S4QA 3RGFA 3VQHA 4QMOA 3CY2A 5HKMA 4J98A 3JVRA 4TYHB 1YXUA 3HUBA 4IBMA 4F6SA 3QRTA 2PUPA 5ANDA 4GVJA 2RGPA 3U4WA 2VWWA 3OUKA 2GNFA 1QCFA 2JDSA 5FBOA 1YWRA 5C27A 4X2GA 4Y95A 5I9VA 4D55A 3F66A 1YDRE 4U79A 2P3GX 5GIOE 4OTGA 4R3PA 3I81A 5EYMA 3Q4CA 2HENA 4O7RA 4FSZA 3LVPA 1R0EA 4IDTA 3UOHA 5L6OA 4XYFA 3R83A 4CGAA 3CQUA 3QUPA 4MNFA 3QQGA 2B9HA 2WFYA 4YJOA 2GS7A 3R9NA 4ANMA 5C1QB 3H4JA 3WZJA 4YP8A 3OFMA 4WNOA 1XWSA 1URCA 3PXZA 1Q24A 5L8JA 2HY0A 2VTQA 5L6PA 5AR5A 4JBPA 2VU3A 4LQMA 4X3FC 1PMUA 2RKUA 2Z7LA 4FGRA 4TYJA 3ZRMA 2W05A 5CX9A 4DEHA 4EWQA 2FGIA 3D9VA 4RJ3A 3DFCB 4DH8A 3L8XA 3PWYA 2OJIA 3P0MA 3VN9A 1Y57A 2CCHA 4O0WA 4KD1A 4FV1A 3I4BA 4EK6A 1F0QA 4JIAA 5E9EA 3BHUA 1QL6A 2XK7A 3EQIA 4G3CA 4KB8A 4ZTRA 1FPUA 5CU6A 3RM7A 3UQGA 3FEGA 3FXXA 2JIVA 3TIZA 2I0HA 5M4FA 2JBPA 4PMSA 5F1ZA 5CYIA 3EWHA 4GIIA 2YJSA 4ANLA 4OLIA 4HPUE 2X81A 4HPTE 2VUWA 3F3WA 3EFWA 5HLWA 1W98A 2H6DA 4APCA 2PVNA 4BDHA 3WF5A 4NM5A 2JBOA 5I3RA 3VVHA 4ALWA 1Q61A 1ZMWA 4BDIA 3LMIA 2ITUA 3OP5A 4J1RA 4CG9A 4EJ7A 4FKJA 4O7NA 3ZONA 1DM2A 3ZBFA 4ORKA 3FZ1A 4PNKA 4OTRA 1NVQA 2B53A 5AX9A 4PMMA 4FA2A 5D1JA 1W83A 1W84A 2FYSA 1CMKE 3NUPA 1I09A 4NFNA 1BMKA 1JAMA 4FEWA 2QOQA 4MEDA 3F3UA 1IA8A 2W9ZB 2ZV2A 2GNIA 2PZRA 3K3IA 2X4ZA 3L9NA 5LVOA 1TVOA 3R73A 3V51A 3O96A 4V05A 3VUDA 2V5QA 2YM6A 3BV3A 5FBNC 4U8ZA 4FL3A 4IJ9A 3SVVA 4BIDA 5HTBA 3OROA 4TWCA 3UIMA 4EEVA 5BMSA 3W10A 4DH7A 4G1WA 2CGWA 4F6UA 2QOBA 3PPKA 4ZJIA 5KKRB 4PWNA 2ONLC 1PW2A 5KE0A 4AA0A 4DH1A 4DFUA 5J1WA 4ZTLA 3CC6A 5TE0A 1CM8A 5FXQA 1FGKA 1XKKA 4NKSA 2QURA 4R5SA 4FTLA 4L9IA 4FTCA 4GU6A 2C4GA 3JR1A 3FMDA 3BRBA 2FUMA 1Q8UA 4QMXA 4OBOA 3TZMA 5CSWA 2J5FA 4ZZNA 4WIHA 3G33A 4BDEA 4BCGA 1GY3A 5CF5A 4ASZA 3BGQA 2RFNA 1XH7A 2ZB1A 4WBOA 3W32A 3ZC6A 5D41A 3LXPA 3BLRA 4RC3A 5DE2A 2UZDA 2CNUA 4U3YA 4O81A 2HZIA 4PMTA 5G1XA 3RNIA 4I5HA 3K54A 4CZYB 4H05A 1B6CB 2W1HA 4RVMA 2R0IA 4WRGA 4XG2A 3RAWA 3ELJA 3FV8A 5FQDC 1J7LA 2YLEA 3A99A 4FIJA 4FOBA 1APME 2E9UA 4IAYA 3P78A 5E1SA 2C3IB 3VUMA 3P23A 3MESA 4IVCA 3OC1A 4OUCA 4XNEA 3NR9A 4CCUA 3JS2A 2R3LA 2JKMA 2P0CA 2QOCA 4DH3A 1M7NA 4D5KA 3QU0A 4FE2A 3PLSA 4R1VA 4PUZA 4LGGA 5IQAA 3KXGA 5L3AA 4G17A 5JFXA 4EKLA 3DJ7A 2Y6MA 3NUUA 4JAIA 5AV3A 3PIXA 3U8WA 2RG6A 3DU8A 3FZTA 1OPKA 3DXQA 1W8CA 2HCKA 3D5UA 3FMJA 4IZ7A 4TRLA 4Y72A 3R8UA 2W5BA 3F7WA 3E93A 5FDPA 1OPLA 5IKWA 4AQCA 4ZXTA 2I0VA 2UW3A 3S1HA 5H2UA 5AA8A 4FV9A 4MWIA 5H8BA 3MPMA 3E7OA 5FP6A 4YTIA 4RJ5A 3MVLA 3VHKA 4GT4A 4BBMA 2XA4A 1E1VA 3OT3A 5DRDA 3C4ZA 3NYVA 1JKTA 4BICA 4F1OA 3R8LA 2HW6A 4TYHA 5E8VA 1WBNA 2CGVA 4OTDA 4RQKA 5HNBA 2FB8A 3VUTA 4YJQA 2F9GA 3OCSA 5HGIA 3MVJA 3C0HA 5A46A 3OW3A 4P5QA 4X3FB 5TF9A 1Z57A 4KBAA 2HZ0A 4BGGA 3IW8A 3LOKA 4LRMA 4E26A 2OU7A 3KXHA 1KE7A 4J95A 4GS6A 4DGNA 3WF9A 3I0QA 4IQ6A 4E5AX 5DNRA 1P4OA 4LL0A 4FIGA 3KU2A 4K11A 3UIXA 2BRNA 2VTMA 3TUBA 2J6MA 4DH5A 2XP2A 3FMNA 2J0LA 3FKOA 5I0BA 2W17A 3H9RA 1IA9A 4MVFA 2F2UA 4L44A 4H1JA 4V04A 3RCJA 5FDXA 3F2NA 4EHGA 4TPTA 3IECA 5CQUA 4FMQA 5DR6A 2R3OA 4Q5HA 4ZEGA 1P5EA 2YIWA 3EFKA 1MRYA 3ALNA 4RPVA 3ZRLA 4HVIA 4KABA 3R7GA 4WNKA 3LJ1A 3VBYA 4ACGA 5HX8A 3QKLA 4JS8A 1XBAA 3H10A 3SXSA 4EUUA 3EHAA 2DYLA 4RZWA 4AACA 3MTLA 3JY9A 2DWBA 3ACJA 1KV1A 3O51A 3HECA 4KBCA 3DLSA 3F9NA 4CFVA 3GCQA 4JG8A 3CD3A 2CLXA 3ZCLA 3B8RA 3LFQA 2J0MB 3GVUA 2HK5A 3VRZA 4DTKA 2BTRA 2PUUA 4R6VA 2ERZE 3VC4A 4AN2A 2C5OA 3IW6A 3FI8A 1ZLTA 2WPAA 5AUUA 1H28A 3THBA 3PIYA 5KCVA 4FKRA 3RK9A 5DYJA 1YXVA 3MJ2A 3MBLA 4NZWB 4PP9A 2QKWB 5EM5A 4BDCA 4CQEA 5HBEA 1YOJA 3KMUA 2OF2A 3MH0A 5T3QA 4KRCA 3BELA 2Z02A 4G34A 4FUYA 3R8PA 3QQFA 4IB1A 2W5AA 4QYHA 5LMBA 5IQEA 3SOAA 2O64A 1JLUE 3QA8A 1H4LA 4GJ3A 1NVRA 4MBIA 4OTFA 4II5A 4R7HA 1GZ8A 3UMXA 5EW3A 3E87A 4I3ZA 3U87A 4JDKA 1WVYA 4USEA 4QTDA 1J7UA 3NUNA 2VTPA 4AZWA 2PU8A 2WMVA 3BCEA 4BWKA 5HNGA 5HNIX 5ANKA 3ZFXA 5AFVA 3QCSA 3IW5A 4U45A 4DT9A 3VIDA 4U42A 3E8CA 1UWHA 4F1MA 1YQJA 2R9SA 4I21A 5IH6A 2ETMA 5I9YA 4AX8A 4AUAA 4EOPA 1AD5A 1ZYCA 3QTXA 3FHIA 3GENA 4I4EA 4WUAA 5EYDA 5IUGA 3TUDA 3O17A 5CSHA 3BGZA 4C4JA 3UVPA 5CI7A 3OXIA 1M2QA 2W0JA 5AUWA 2ITTA 3A7FA 5DPVA 5I3OA 1J7IA 4JR3A 1PF8A 5HD4A 3L8VA 4GFGA 3CCNA 3QTIA 2VRXA 4I6BA 3IDPA 4JBQA 5B2LA 3UC4A 2VGOA 3WZUA 3PSBA 3BBWA 5DLSA 5KUPA 5CASA 4YLJA 4LFIA 1U46A 1NT2A 4IX3A 3VBQA 3HP2A 2VO3A 4FKVA 4AWIA 4ZSJA 1WVXA 1H27A 1UKHA 2HYYA 3HEGA 1PYXA 4M0ZA 3MPAA 4BHNA 4JQ7A 4D0XA 1A48A 5FLFA 5ANIA 4A07A 5KBRA 4ERKA 3DQWA 5HEZA 2W1DA 3KXZA 4FSTA 2C5XA 4YLLA 4AZEA 1OI9A 2IZUA 4IE9A 4TW9A 3DKGA 2O2UA 4NT4A 2G9XA 2FSLX 2WHBA 1Z9XA 4QYYA 4FOCA 5CEKA 4TNBA 2JIUA 4C3FA 4MTAA 4IM0A 2OFVA 2SRCA 4LRKA 3W8LA 1MRVA 2WMUA 2WTKC 4X7QA 2VTLA 3R7YA 5F95A 3ROYA 2B4SB 3FWQA 4LRJA 3EQFA 2IN6A 3DBDA 3U6IA 4MNEB 4YU2A 5JFWA 1XO2B 2E9OA 1AQ1A 2EUFB 3F61A 3DKOA 3QKKA 4XBRA 4QPSA 1SZMA 3PP1A 5IA1A 3EQDA 5AP3A 2BKKA 4EKKA 4L3JA 5HORA 5AJQA 4NEUA 5E4HA 4E6DA 4J7BA 2V7OA 2A27A 1PHKA 4IB3A 3RPRA 1DAYA 4ANSA 4FV7A 4RG0A 1P14A 5CF4A 3LFEA 2J4ZA 5HCXA 2XH5A 3D2IA 3H9FA 5ETFA 5GIPE 3PVGA 5IF1A 5EW8A 4FKOA 4LMNA 3QC4A 3UZTA 4OTQA 4XOYA 4JI9A 3DBFA 5T6KA 3C5IA 3DV3A 4FODA 4X2NA 3PSDA 4IWDA 5EOLA 4EH2A 4EOIA 3V5WA 5EQPA 1H8FA 3P7BA 3NYOA 4ALUA 4JL9A 2YM8A 2IJMA 3PXQA 3HV3A 3RZBA 3TTJA 3DNDA 4M15A 5M06A 5AV1A 3IPHA 2O63A 4EOJA 3DCVA 1KV2A 4KNBA 2IW8A 3PUPA 2ERKA 4X3FA 5H8EA 2IW9A 4XP3A 3UPZA 4LGHA 3A7HA 1FGIA 3NNXA 2O3PA 3D0EA 2ZV8A 3A2CA 3SC1A 4RWJA 3BHYA 4CT1A 3HV4A 5EI8A 3H9OA 4CFWA 3NCGA 3OCTA 5EYCA 3UMWA 4I20A 2W1CA 2X4FA 4QPMA 4CSVA 3Q2JA 1PY5A 1BUHA 3DOGA 3OXZA 4KIKB 4TWPA 4RFMA 5M56A 1G8AA 3FE3A 2BDWA 2ZVAA 3VW8A 3Q96A 4KWPA 2Y6OA 4YLKA 1H1SA 2PMLX 3DBEA 3FLZA 3Q4TA 3MVHA 4NIFB 4CMOA 4BCJA 4C35A 4MYGA 4HGTA 4O2ZA 5CT7A 2WTCA 4IDVA 4U44A 5AP1A 3S0OA 2QR7A 5K4IA 4BYIA 3DXNA 3NW6A 4EK3A 3FPQA 4YHJA 2ZM1A 5HO6A 3CBLA 3I5ZA 3M1SA 3BZ3A 4GYIA 3R22A 4XRJA 3W18A 2JKKA 2XBAA 2ZB0A 2YFXA 2OFUA 4RIOA 2DS1A 5HVKA 3E63A 2OSCA 2WU7A 3VQUA 5AP5A 3MY1A 4G5PA 3IDCA 4P2KA 5B0XA 5J7HA 2OH4A 4L43A 4WG3A 3HYHA 3S3IA 4E20A 5LWNA 1ZXEA 3O8TA 3CD8A 5HE0A 1H1WA 4R5YA 4TN6A 3SA0A 5L2TA 3TJDA 3UPXA 3IG7A 5CY3A 3QUDA 5CTPA 3OUNB 3G6HA 4EH6A 4O7SA 2X39A 3OEFX 3EN9A 2WKMA 4ZK5A 4ZP5A 5AR2A 3R7OA 1I44A 3GXLA 3QX4A 4O86A 3R01A 2ZMDA 1Q3DA 4BGHA 1OECA 4MD8E 4F70A 3HLLA 2HW7A 1H26A 4FTAA 4KIOA 4E8AA 4FG7A 5HIEA 2WELA 2JLDA 3TG1A 1OGUA 2RL5A 4GV1A 3ATSA 3AD5A 2QQ7A 4MXZA 1H24A 3DT1A 5JGDA 3SV0A 3ZC5A 4E4NA 4FTTA 5JN2A 1UA2A 1Q3WA 3EKKA 4KKHA 4UXLA 4XJ0A 2ZAZA 2QKRA 3UVQA 4ITJA 4YHFA 5DRBA 4BDKA 4F0IA 4D58A 4G9CA 4OAVB 4ZMFA 3CTJA 2PL0A 5CI6A 2B52A 2O65A 2W1FA 3C7QA 2HZNA 1R39A 4Z7GA 4AFJA 2V55A 3NX8A 1FINA 1M52A 2W1EA 3QQLA 3CR0A 4CMTA 5J9YA 4AG8A 3I7BA 3MFUA 2GHMA 3ZBXA 2ITYA 4D0WA 1QPDA 3RNYA 1YDSE 1OKZA 3RTPA 5DG5A 1LPUA 4FV6A 3CXWA 2C0OA 1U54B 2P55A 3PJ3A 4FNXA 5EM7A 2PVFA 4ZS0A 1ZYJA 3ZLXA 4MF0A 4ENYA 4M7IA 1QMZA 2R3HA 2B54A 3AMBA 4ZZOA 4X2KA 3RAHA 3RWPA 4D1ZA 4RX9A 3LQ3A 1QPEA 3G9NA 3RHXA 1CTPE 1IEPA 3DK3A 4BWXA 2JGZA 2W4JA 5EM6A 2BDFA 3LMGA 4C4EA 4C34A 4E5WA 4F08A 5CU0A 5J5SA 5CVHA 2GNLA 2VZ6A 3BHVA 4IJPA 4TZRA 3UG2A 4C37A 3A60A 3HGKA 2VWZA 3LM0A 4ACCA 3DTCA 4E73A 5AIRA 4BCHA 2PMNX 4EK5A 3EZRA 3L8PA 4EK8A 2GSFA 2VO0A 3D5WA 4LOPA 5M55A 5ETAA 4QNAA 5M07A 4WUNA 4O7YA 1PXOA 2Z8CA 3NEWA 4QP8A 3VS4A 3E8DA 3B2TA 3Q5ZA 4N6YA 4CRLA 5IU2A 2GTNA 4R3RA
chains in the Genus database with same CATH superfamily
2PMIA 1Y8YA 3E7VA 3H3CA 4FL1A 5D10A 3TNWA 3WOWA 4G9RA 4O0RA 4BDAA 3FMHA 4G3GA 3GUBA 3OCGA 4QRCA 3KVXA 4OTPA 1S9JA 1B39A 2YITA 2YM4A 3C4WA 3DK6A 4LL5A 1A06A 2VV9A 2X0OA 3EN6A 3LCKA 4CZUA 4NM3A 3Q32A 5BYYA 1ZYDA 3FMEA 2O5KA 3DZOA 3C4FA 4MNEA 3H0YA 3LCDA 1W2FA 2GPHA 2YIQA 2AC3A 1WBVA 3SHEA 5BVDA 5CU3A 4R78A 4IVBA 3NYXA 4MUQA 2C0IA 4KKGA 4DTAA 5JZJA 3GOPA 3R7EA 2UZOA 1H1QA 3MVMA 3HDMA 5DBXA 3QLGA 1FVTA 2OW3A 4JBOA 3KEXA 4ZTSA 3QQHA 3VUIA 1OGYA 3F3VA 2WQEA 1W0XC 4G16A 2JKOA 4ZOGA 4H1MA 4F65A 4ZTQA 4FEVA 5HIBA 3F88A 1WBSA 4FC0A 4C7TA 5J5TA 5CEIA 2ZDUA 4XEYA 4DEEA 4ACHA 3P9JA 2F49A 2XIYA 4CG8A 3POOA 4BZNA 3QBNA 3FDNA 3BWFA 4MKCA 1GIHA 3QALE 1JVPP 2GQSA 2BVAA 4O0XA 4QPAA 4YJRA 3QD4A 3C51A 3D14A 5FWKK 3W55A 3KA0A 4LOQA 3UP7A 4B9DA 4FTMA 5CLPA 4DFZE 2B9IA 4H3PA 3KFAA 2B0QA 1GZKA 4D2PA 2R3KA 3TZ9A 3EL7A 4AS0A 4BDJA 2RFSA 4BDBA 3L9PA 1PMEA 4CFXA 5KMIA 5JMSA 3G90X 3DNEA 1M2RA 5BVKA 3M42A 5A54A 3HRFA 5CQWA 4HVSA 5HIDA 1F5QA 3N51A 2VTRA 3WZEA 3Q6UA 4A4XA 5BYLA 4DDGA 3FC1X 4ZSLA 3ORIA 1H08A 4IWQA 3BU5A 1OBGA 3BU3A 4IAIA 4UMUA 3UOLA 4KIKA 1YHSA 3CJFA 4IWPA 5AV2A 5AWMA 4TYIA 5EFQA 4KSQA 1KWPA 1ZZLA 4KS7A 4EI4A 1LP4A 3I7CA 1W2CA 3RBWA 3EMGA 2F4JA 4X21A 5FM3A 3A8XA 3ZM9A 5FTOA 3FLNC 4L42A 3EQHA 4IIRA 3CGOA 4GKHA 4FEUA 5K3YA 4BCOA 3NGAA 4FZAB 2VWIA 2XRUA 4S31A 1L8TA 3F5GA 4PF4A 1YWNA 2XB7A 3CQEA 3FMMA 4KA3A 3T3VA 3TI1A 4NK9A 4EH5A 5A14A 4ZY5A 4QYGA 5KZIA 2QOKA 3W2SA 4F78A 1UU9A 5EI6A 4OGRA 4DLJA 5HBJA 4IAAA 4L7FA 3A7JA 5E91A 5LQFA 1JNKA 1OM1A 3LIJA 4FKSA 3UC3A 4C3RA 3TJCA 3BLQA 4QQJA 4C02A 4R7IA 2EB3A 3ZM4A 1JQHA 3UO5A 4DF3A 5IQGA 4S33A 4FVQA 1OKWA 2UZVA 3KCFA 4U41A 4ZSGA 3L1SA 2BFXA 2UZWE 3AOXA 4JG6A 4EWHA 4DTBA 4QP9A 2XBJA 3NWWA 4CKIA 2UW4A 2BZHB 3FZOA 5L8KA 3ENMA 1BYGA 4MCVA 3QQKA 4PPAA 3OXTA 3LFDA 3R1YA 4IAKA 3Q3BA 3JVSA 3R9DA 3RINA 2RFDA 5KMNA 3ID6C 2UW9A 4A4LA 3ZEWA 3FI2A 4AT3A 2LAVA 4MBLA 3NRMA 1QPCA 3DBCA 3RK7A 4C38A 3WIGA 3EH9A 2FO0A 2VO6A 4E4XA 1SMHA 4W4WA 2QOHA 4AU8A 4AE9A 1Q5KA 3V8WA 2Z60A 3HRBA 4DGOA 3QD3A 3RPVA 4FV4A 5M4IA 3GFWA 3OOMA 3T9TA 4EZ7A 4DFLA 3FUPA 3WZDA 4BF2A 1TKIA 3MSSA 4J96A 4RWKA 5ITAA 4NYEA 5GJGA 2CKEA 4BR3A 4XG8A 4YHTA 3ZUTA 4FZ6A 4ID7A 3U6HA 2GQRA 5HZNA 3QFVA 3O2MA 4UN0C 4E6CA 4ZS4A 3PTGA 3HMOA 4I0SA 5IEVA 2F7EE 3N9XA 2VTTA 4EOOA 3UNZA 4PTEA 1U54A 2V62A 5HVYA 1ND4A 3AC1A 5CEMA 1OL6A 1JSUA 3MB6A 5HG8A 3SQQA 3F2RA 2EWAA 5IQBA 2EU9A 4QMWA 4GUEA 2VX3A 5L4QA 5JGAA 4A9TA 4K0YA 3C9WA 4O22A 2XIRA 4DG3E 3T9IA 4D4RA 3MN3A 3TKIA 1M7QA 4OW8A 2CCIA 4K8AA 3EFLA 4UWBA 5HD7A 4YPDA 4GMYA 4LV5A 4XG7A 5HI2A 1WBPA 3TIYA 3KF4A 2BHHA 3LPBA 3E62A 4U9AA 2QO9A 1YDTE 2FSTX 1CKPA 2VWYA 3OTVA 4EYJA 4EC8A 2XIKA 3WZKA 5CAUA 4RVKA 1VZOA 5HU3A 3QCXA 2CN5A 3IOKA 4AGWA 3L9MA 3PY3A 3SRVB 4UMQA 3F3ZA 2AUHA 2VWUA 5IQDA 2IVTA 4UYNA 2JDRA 2WO6A 3GC9A 2WMXA 3BGPA 1HOWA 4CFUA 3AD4A 1E1XA 3GQIA 1OITA 4M8TA 5C8KA 2C1BA 3BYSA 4FT7A 3VUHA 2QC6A 5EQYA 2Y9QA 2WD1A 2CNVA 2BUJA 3OCBA 4X0MA 3UNKA 2PVMA 4Y46A 4YGAA 4A9UA 4F9WA 2QG5A 4FEQA 1PRYA 1M14A 1FQ1B 4O4CA 3W0SA 3VWAA 5C26A 5FTGA 5IQFA 4HCVA 3ZOSA 4QMVA 4YZ9A 4XV1A 3CPBA 2NYAA 2IZTA 2VNWA 3AQVA 4MXCA 4EC9A 4CKJA 4LM5A 1ZYSA 2XKEA 1JBPE 4YZBA 3EN5A 5AIKA 2X1NA 4E1ZA 5CAQA 3MFRA 3SD0A 3CTQA 4AZFA 4YR8A 2W1GA 4ASDA 4I22A 3W0MA 3FY0A 4O0VA 3UTOA 2GHLA 2XJ1A 5I9XA 4FTRA 1KOAA 2UZLA 4M14A 4P7EA 4FEXA 3ITZA 2I7QA 5JRQA 4FT3A 2PVKA 3PVBA 3QC9A 3LLAA 3TDWA 2OO8X 2GS2A 4KSPA 4EYMA 4F9BA 3UZRA 2QHNA 4JRVA 3RZFA 3PSCA 4KIQA 2EVAA 3KRWA 3MY0A 3V5TA 3ULZA 5DR9A 4O7TA 1H00A 5HCZA 3NUAA 3UDSA 3GCUA 4Z7HA 5F94A 3RCDA 3HV6A 1U5QA 4AA5A 3FLSA 1G8KA 3QRJA 2J50A 4FK3A 1OIRA 4M67A 4NKAA 4NSTA 2GFCA 4FNWA 4QMUA 3ZXTA 4CFNA 5JGBA 4ANOA 4E6QA 1YI4A 5HTCA 4IANA 4WG5A 5J1VA 2WEIA 3O23A 5DA3A 4J71A 3PY1A 1BI8A 2C3KA 3NIEA 5LVMA 3PXFA 3NW5A 1UKIA 1R78A 2J0JA 4CXAA 5BVOA 3EFJA 2B7AA 4XG9A 5DFPA 4BI0A 3LCOA 3RP9A 4J52A 5IUHA 3QRKA 2IVVA 4FG9A 4L45A 1JKLA 4S30A 4XS2A 5ACKA 1VYWA 2ZV7A 3ORXA 5EM8A 4HCUA 4L00A 2GTMA 4BYJA 2YDJA 3KVWA 3PXKA 4FK6A 4DCAA 3UGCA 3QYZA 5FM2A 4BDFA 5HOAA 5A4LA 3II5A 1X8BA 3ATTA 3A61A 5KZ0A 2PZYA 4K9YA 3FY2A 4H36A 3ENHA 4CFMA 3R7IA 4EH8A 2F2CB 3DAKA 4PL4A 3S2PA 4U5JA 3FBVA 5AUVA 4D1XA 4FTOA 2R7IA 4IACA 5DR2A 2IVUA 3GC8A 2WXVA 3UO4A 3SG9A 3TV6A 4FTJA 3WIKA 4L7SA 3QAME 4M66A 5JFSA 4YO4A 1JSVA 3LFAA 2R3PA 2VTSA 3PYYA 2BMCA 1PXKA 3SGCA 4PQNA 4U6RA 4B99A 4EUTA 2XUUA 4FZDB 4ZAUA 3Q53A 5AMNA 4A9SA 3KF7A 2C47A 3DS6A 3IQ7A 3O7LD 4G6OA 2BIYA 3IKAA 4ACMA 4YURA 4XHKB 4PPBA 3E5AA 4I24A 4NL0A 3PPJA 3R0TA 1H25A 1XH5A 4LDTA 4TYGA 4QMZA 4BCFA 1ZY4A 3LM5A 3GNIB 4OBQA 3QD2B 4K18A 3DJ5A 5E8UA 4ZTNA 4TL0A 4YJUA 2BILB 3SW4A 2XJ0A 2YA9A 3TWJA 4C4GA 5G6VA 4O7LA 5A6OA 3DAEA 3ZZEA 3I1AA 4FZ7A 4Y83A 3V5PA 4GK2A 4BCNA 2UZUE 2ZM4A 2BZJA 2X0QA 3NCZA 3A7GA 2BHEA 4FKIA 4IM3A 4KRDA 4M3QA 2XYUA 3D4QA 4QD6A 2QU5A 4BZDA 2I0YA 5I9WA 4YPSA 4C3PA 4O7WA 4RIYB 2Z7SA 3U9CA 3GEQA 4XP0A 3ROCA 1WVWA 3BLAA 1IRKA 5A4CA 4I4FA 4KS8A 4JIKA 3EYGA 5JKGA 3JY0A 1UU7A 2C30A 3BQCA 4RT7A 3SXFA 4ZTMA 5ANJA 4QMYA 2R3MA 4XV2A 5HO7A 3DXPA 2VD5A 4QNYA 2W9FB 3EQBA 4DLIA 1SVGA 3WF7A 4JRNA 2YZLA 5CF6A 4X3JA 3ET7A 1T45A 2C68A 3UP2A 3LCTA 2C3LA 1CDKA 2JAMA 3JYAA 4IB5A 4NUSA 1SYKA 4FR4A 3EQGA 3TKUA 1O6YA 3NNWA 3SDJA 4HZRA 3T8OA 1K2PA 3EOCA 3F82A 2XM9A 3G9LX 3TT0A 2GS6A 4V0GA 4CLIA 4DG0E 5JH6A 5L2WA 2EXMA 4UB7A 4XP2A 3IK3A 4IMYA 2QR8A 3G2FA 5IQCA 1OUYA 5ETCA 2OLCA 2NNWB 3TL8A 3MTFA 5GJDA 3F69A 4JDHA 5BQ0A 2PE2A 2VO7A 1H07A 3HDNA 4W4VA 3ZFYA 2YWPA 2WU6A 3SRVA 2C69A 1OL2A 2NPQA 5FG8A 5A9UA 5LMKC 2XMYA 3HRCA 2EXEA 3EQPA 4K6ZA 3V01A 4FI1A 2JDOA 2PVJA 5KMKA 1MRUA 2YCQA 3O8UA 2IW6A 3TN8A 5CSXA 4PPCA 3UOKA 4HNIA 4ARKA 3CE3A 4E4MA 3D7ZA 2GNGA 1OB3A 2BAQA 4PTGA 4IH8A 5AR3A 3I60A 3IDBA 3BE9A 3WYXA 4E7WA 4BFMA 4OAUC 1XR1A 1YI6A 1FMOE 4WSQA 4BL1A 4O82A 3KCKA 3OOGA 2R64A 3IGGA 4FVPA 4YTFA 3OWPA 4FTUA 4Y5QA 3F6XA 4MF1A 4N70A 3F2AA 4L3PA 4UV0A 2VTHA 2YAAA 4B8MA 5K9IA 5EHLA 3TMOA 3PXRA 5DWRA 3CQWA 3DTWA 4KBKA 3GGFA 1LEZA 4YNOA 4FL2A 4FTQA 3R2BA 4AQKA 2PULA 3COHA 4ERWA 4WG4A 4D9TA 5IUIA 1E9HA 2KTYA 3NVKI 3RAIA 5CXZA 3SXRA 3KL8A 4LOOA 1R1WA 4MQ1A 1ZZ2A 5E90A 3W0QA 3LFBA 4I5CA 3KQ7A 4NJDA 3VBXA 4XX9A 4U40A 5J9ZA 3AMAA 2BAJA 5EQEA 3G0FA 2J7TA 3MS9A 4IC7A 4HGEA 3FZRA 4ZJJA 2OWBA 1L3RE 4HYSA 4YC8A 3W2CA 5BVNA 4LG4A 4C0TA 3ANRA 2OJ9A 1TQPA 2X2MA 1REKA 3S95A 3R28A 4DINA 2J5EA 2G15A 2NP8A 2WQMA 2YIYA 3HV5A 4M97A 2O0UA 4UY9A 4S2ZA 3EJ1A 2HY81 2QVSE 3CP9A 3FJQE 3MDYA 4FIEA 4FVRA 4CTBA 4D28A 2Y4IC 5HG7A 5CU4A 2XK3A 4I41A 3C0GA 5DMZA 4FGBA 4U3ZA 3TV4A 4DGGA 3OG7A 1BL6A 2RIOA 3AKLA 1G8SA 3DK7A 1Q8ZA 1REJA 4GUBA 4R77A 2G2FA 3AC5A 3FC2A 5TOZA 3UDTA 3QL8A 4X6QC 5JQ8A 4W8EA 3UQFA 3PE1A 4G3FA 3ZDUA 3PP0A 4RX5A 4MH7A 2A0CX 4IVAA 5HO8A 4YJPA 3P79A 3Q4UA 4IM2A 4HYIA 3V8TA 4JT3A 3PY0A 3FZSA 4HW7A 4DCEA 2WMBA 3FYJX 4AN9A 4RA5A 3A8WA 4LUEA 2QG7A 5J87A 3ULIA 5IA5A 3UYTA 3ZLYA 1W7HA 4ENXA 4QYFA 3QQJA 2PE0A 1JKKA 2IZSA 1FVRA 3LW0A 4G3DA 3GC7A 3W2QA 4AXDA 3ZRKA 5GINE 3G5DA 4W9WA 1VEBA 2WTIA 2UZTA 3QKMA 4DEBA 2YCSA 5IMEA 4Q9ZA 2VNYA 3OWKA 4JXFA 4YZDA 4KUJA 4XG6A 4EZ5A 2X8IA 1IR3A 5HCYA 3IO7A 4U81A 4ZY4A 4C8BA 3DDQA 5CNNA 2Y7JA 1ZOHA 1WBOA 2BZIB 2CN8A 4OR5A 3NLBA 2E2BA 1B38A 5TO8A 3K5VA 4EH9A 1AGWA 2UW0A 4RSSA 2CKPA 3BHHA 3RI1A 2J0KA 3HNGA 2WQNA 4YO6A 2CSNA 5HLNA 3LQ8A 5M57A 1LEWA 1J3HA 3CLYA 1ZY5A 4IW0A 2UW6A 3ORZA 3C4XA 4WO5A 4AW1A 3K5UA 4BTFA 1J1BA 5GJFA 4CMUA 5K5NA 4NM7A 1O6LA 4QMQA 3RPOA 3FLWA 4NJ3A 2VN9A 4FV3A 5TR6A 4GSBA 4F99A 2G1TA 3ZSIA 3RWQA 2X6EA 3G6GA 4ZLZA 3NW7A 1XH6A 4CFFA 2R4BA 4U0IA 2UW5A 4QMNA 3FKNA 4FTKA 4RIYA 3ZSGA 3FL4A 1Q4LA 5HU9A 1KUTA 3QXOA 1ZMUA 4J97A 1GJOA 3ACKA 3CJGA 4IZAA 3R1SA 1OBDA 5M44A 3R63A 3LFCA 5AP2A 5K5XA 1KOBA 3P08A 4GT3A 1Y6AA 4RIWA 4O4EA 5LCKA 3V5JA 3AT3A 4N4SA 3U9NA 4G2FA 3UOJA 3TNPC 1OKYA 4I5PA 4TYEA 4FT5A 4XLVA 4CCBA 4KAOA 2Z2WA 1ZAOA 4WT6A 4BZOA 2PWLA 2R3GA 4P90A 3D7TB 4PMPA 3I6WA 4YZCA 1SVEA 3QTQA 4RJ7A 3TZ8A 4IAFA 5E8YA 4O91A 2R3IA 1OVEA 2ONLA 3BPRA 3WILA 5JFVA 2ZJWA 3KK8A 3V3VA 3VS6A 3ZUUA 4BBFA 5A6NA 2PK9A 3ERKA 3PPZA 2X2KA 4R8QA 4BDGA 2V7AA 4ITIA 3MH1A 5BNJA 2Q0NA 3DY7A 4Y5HA 4E3CA 4O38A 2ITPA 1Z5MA 3IW4A 3QD0A 3W2RA 4O27B 5AUYA 4DITA 5IH5A 3VUKA 1PXPA 3RMFA 4RC2A 4B8LA 3R9OA 1ZOGA 3UVRA 4UX9A 4RWIA 2XK4A 2A19B 2OJJA 2JC6A 2PMOX 2J2IB 3FYKX 4DGLC 2OICA 4KIPA 3KRXA 4JX3A 5AP0A 2BALA 5DT4A 5HHWA 3TNHA 3KXXA 4PTCA 3GU5A 4MXYA 2R5TA 5J7BA 4EQMA 4QDVA 2XJ2A 3OBGA 5BVEA 3VS2A 4K1BA 5AV0A 5B7VA 4RFZA 3GU8A 4AOIA 1VR2A 4BKZA 4FKPA 5IMXA 5EK7A 2FSOX 2WTKB 2J90A 4RIXB 2PZIA 3EIDA 1KE5A 3GFEA 3CSVA 5CENA 3GBZA 2UVZA 1IG1A 1PKDA 3U55A 3PE2A 4BIEA 4KKEA 5DGZA 3W33A 4C4HA 1O6KA 2WMQA 2FH9A 3FI3A 4APPA 2NRUA 3Q2MA 2HIWA 5FGKA 3W2PA 5AX3A 1YWVA 5D9HA 2H9VA 4YBKA 1V1KA 2UZNA 3O71A 2JFLA 3EQRA 5E7RA 1U59A 2P2IA 3RAKA 4EZ3A 4PNIA 1VYZA 3G0EA 2C3JA 4IWOA 1P4FA 3VS0A 4I6LA 3VJNA 1JOWB 3WF6A 5KHXA 3R8MA 5AA9A 3LXNA 5CWZA 5C01A 4FSUA 4YJNA 5K0KA 1NXKA 4QDEA 2FSMX 3VS5A 4G31A 4XMOA 4E93A 3W0OA 4QQCA 4YJVA 1Q62A 3QLFA 4WBBB 3CKXA 1M2PA 2BRMA 2OKRA 5CEQA 3BE2A 3QTZA 2GNHA 4U43A 5JQ5A 2XANA 5IQIA 1NY3A 2ETKA 5HESA 3TACA 4D5HA 2QOLA 2BKZA 3BIZA 5CSPA 1KE9A 3BEAA 5HE3A 3KXNA 4RBLA 4AE6A 5J9LA 2OG8A 4R7BA 3GU7A 1V0BA 4C58A 4XCUA 3AC8A 3JUHA 2X9FA 4FNZA 4F7JA 3PFQA 2OXYA 4OBPA 5C9CA 2BDJA 3COKA 3NUSA 5CALA 4O7ZA 5ACBC 4Y73A 5FTQA 1NW1A 1OMWA 5A3XA 1KE6A 3Q60A 5CVGA 1R3CA 3SLSA 4QQTA 3HX4A 3BHTA 4RVLA 4DBNA 5IEXA 3M2WA 2QHMA 3UE4A 4G6NA 3V5QA 3NZ0A 3UZPA 3Q5IA 2ITXA 4O4FA 5CSVA 5EDQA 3HKOA 1U4DA 3IW7A 4L3LA 2PZ5A 4L52A 4E5BA 5AEPA 5C4LA 3HMIA 5TT7A 2VTAA 3AC3A 3CEKA 4YZMA 1GZNA 2XEYA 3MFTA 4JAJA 4CV8A 4MD9E 3NUYA 2WZJA 1UU8A 5HE1A 1RJBA 1XQZA 2GNJA 3GC0A 5GNKA 3ANQA 3FKLA 3ZSHA 5HTIA 4CYJA 2RSVA 2F7XE 4RJ4A 4FIIA 4PV0A 2PPQA 3DZQA 4AW5A 5KO1A 3F5UA 3SG8A 4DN5A 4FKWA 4LYNA 2LGCA 4QP3A 3K3JA 5DT3A 2QOIA 4FG8A 2OZOA 4MBJA 5KKRC 1QPJA 3OY1A 3QWJA 3RKBA 2GMXA 3FL5A 4PRJA 4IX4A 5H8GA 4WRSA 4AXAA 4GFOA 4JJRA 4FSRA 3TTIA 2OI4X 4QT1A 2CKOA 2C5VA 2NO3A 3FSFA 5A4EA 4UYAA 3OS3A 5HLPA 3CTHA 3FXWA 5J8IA 3QQUA 5M08A 3V6RA 4FKQA 3TCPA 3ODZX 3R71A 2WIPA 2PHKA 5I9ZA 2R3RA 4EOQA 3EZVA 4YNEA 2F57A 3DBQA 4I93A 5IEYA 5IA2A 4CNHA 2WNTA 3F5XA 4M0YA 4D2WA 5DEYA 4AZVA 3A4OX 4QMTA 4R3CA 2RF9A 3EN7A 4V01A 4WSYA 3VBWA 5AAFA 3BYMA 4D1SA 3FLQA 3L8SA 5BVFA 2UVXA 2W1ZA 4QOXA 3WBLA 1RQQA 4IVDA 2IPXA 2YIRA 2HWPA 4M12A 4ZIMA 4C33A 2Y0AA 5LMKA 4B6LA 4OTHA 5E8XA 5CU2A 3PIZA 2UW8A 5AP4A 4AZSA 4Y85A 4D4YA 4Z3VA 1CKIA 4G6LA 1H1RA 1WAKA 1OL5A 2OBJA 4QP2A 1JWHA 2H8HA 1JSTA 3PG1A 4EH3A 3D7TA 4ZSEA 4ZLYA 4Q2AA 3MH3A 2P4IA 4RRVA 4IAZA 3R04A 3R1NA 4UMTA 2C6EA 2YHVA 1YKRA 5KMOA 5HBHA 2XNNA 3PXYA 3HUCA 3P86A 1PXJA 1XHAA 1H0VA 4G5JA 4AOTA 3PDTA 2OZAA 3WARA 4FT0A 3ZU7A 1P2AA 1PXIA 3NDMA 3WE4A 4EQUA 5L2SA 3QCQA 3ZXZA 4GEOA 2PYWA 4Z16A 4MXOA 1J91A 5EHYA 3AC2A 5AM6A 4L68A 4P4CA 4F0GA 1FVVA 3VULA 1DI8A 2UZEA 4IC8A 3MA6A 5IISA 5LVLA 4DEGA 4JLCA 3CY3A 4UBAA 5LWMA 2ESMA 4DC2A 4FRFA 4GL9A 2C5NA 4K2RA 4USDA 3IOPA 4NM0A 4UXQA 4XUFA 3D5VA 2QI8A 4ACDA 3OVVA 4CYIA 3HAMA 3NYNA 4HOKA 2BR1A 3VJOA 2C6KA 1CKJA 5FEEA 2WEVA 3QHRA 4L46A 4TY1A 4IXPA 4ASEA 3LCSA 3VAPA 5BV3A 4HVHA 4EHZA 1BL7A 4CVAA 2F7ZE 2G2IA 4FSQA 1FOTA 4XG3A 4AW0A 4QO9A 4RIXA 3WE8A 2BTSA 4TWNA 3UG1A 2CDZA 4JDJA 5B2KA 4IFCA 3KRJA 4FV8A 4ZSAA 3R7UA 4U7ZA 4C4FA 4Q5EA 1PXMA 3RM6A 3Q9WA 4V0GB 2BAKA 4YC3A 3V04A 1ERKA 5HVJA 2CLQA 2QNJA 4J8NA 1YI3A 4FV5A 4E6AA 2BZKB 3PUFC 3ORPA 4B7TA 1PMNA 4RVTA 4BKYA 2REIA 3W0RA 5C8MA 1YHVA 2VWVA 2CNQA 4BTJA 2UUEA 3QWKA 2R7BA 2CHLA 4EH4A 5AUZA 4DEAA 3NVMB 3UYSA 4LI5A 3G51A 1BLXA 2ITNA 5ICPA 2GFSA 2IVSA 5AUTA 5JK3A 5LCJA 1ZRZA 3QTUA 4QTAA 2YWVA 3C5UA 4RA4A 3NSZA 3A62A 3MPTA 2AYPA 3MJ1A 4DFXE 2JDTA 3MFSA 4EH7A 2OIBA 3E3PA 3U6JA 4BCKA 5ETIA 4MAOA 5DIAA 3UNJA 3TUCA 3DB8A 1KSWA 3DA6A 5EHOA 5FXRA 1NA7A 4RMZA 2C0TA 4I6FA 4BVUA 2XK8A 5F9EA 3QXPA 4ITHA 3FQEA 4IHPA 3N4UA 1Q97A 3CIKA 3PFYA 1OL7A 2J0IA 1URWA 2ZV9A 3R9RA 5IQHA 4W8DA 2J51A 4HZSA 3NNVA 4GCJA 5AP7A 4AN3A 3H0ZA 4IZ5A 4MQ2A 2PVLA 2Q83A 2QCSA 4O0YA 3ZLSA 4NU1A 4C2WA 1UNGA 3QZFA 4FSYA 1WBWA 4U80A 5E8ZA 4N57A 3QUEA 5EDRA 4YJSA 5CS6A 2OXDA 4AW2A 3AKJA 4CRSA 2IF8A 4YBJA 3VBTA 2PE1A 2WMRA 3KB7A 4JR7A 4F09A 3HA6A 3VS7A 3N4TA 3Q4ZA 1H0WA 4AXFA 3HP5A 4GRBA 2BCJA 3QCYA 4LGDA 4BC6A 2YM3A 4RC4A 4CTCA 3W0PA 2CMWA 2UZBA 4MWHA 3I79A 1S9IA 1LUFA 2PVYA 4FKGA 5DI1A 4BKJA 3KN6A 2NRYA 4BBEA 4F0FA 2R3NA 2YACA 3FAAA 2B9FA 3BU6A 1U5RA 1Q99A 3BYVA 3ZS5A 3DLZA 4L53A 2YJRA 2XK6A 2I40A 4OT5A 5BMMA 3U54A 1TQIA 2H34A 3KXMA 3JXWA 2WQOA 4O84A 4PL3A 3FZPA 3KRRA 4ZMEA 2XNGA 1A9UA 3F7ZA 2BPMA 3EL8A 5J79A 4A9YA 3D2KA 3KN5A 5LARA 4Z55A 1YOMA 4BCMA 4DFYA 3UQCA 2JFMA 4AT4A 2IWIA 2OGVA 5C8NA 3COIA 4D2TA 2B9JA 4FBXA 3KULB 5AV4A 4O96A 1Q8YA 3PJCA 4F9AA 3BL7A 3BEGA 4M68A 4EL9A 3FQSA 2WTJA 3OEZA 2R3JA 4NWMA 3FQHA 4JQEA 3KRLA 1RE8A 3GOKA 3T3UA 3BQRA 3K2LA 3LMHA 3QZIA 2OIQA 4S34A 2BRHA 2JAVA 4Y8DA 5TKDA 2XS0A 3R30A 4N0SA 4I6QA 2PTKA 4D4SA 4EORA 5KX8A 2ZDTA 5CVFA 3JPVA 4FTIA 3EB0A 2XNOA 3LXKA 3D94A 4YMJA 3BI6A 1Q8TA 3C4EA 1GZOA 4H39A 3QTSA 2WMSA 3RK5A 2QO2A 3E8EA 4F9CA 3C1XA 2ITZA 3POZA 5EW9A 4GH2A 4NTSA 2E9NA 2FVDA 2XNPA 2XK9A 4YTHA 1WFCA 4AP7A 4FUXA 1JKSA 2V22A 3PVUA 4O21A 5CF8A 2YM5A 1KE8A 3AGMA 4O7VA 4ONAA 3ZO1A 5A4QA 5L8LA 3CPCA 3B8QA 3KC3A 1XBCA 3ZLWA 3TYKA 4DHFA 5CAOA 1JPAA 3C4CA 5AP6A 3RVGA 3ZO3A 3HMNA 2PUNA 4JDIA 5C03A 3TKHA 4RX7A 3BLHA 5EKNA 4FNYA 3ORMA 1LR4A 3ZZWA 4D2RA 4BTMA 2VTNA 2HAKA 2JDVA 3ORTA 3TEIA 3VF8A 4YJTA 4D4VA 3W0NA 4MK0A 3D5XA 4EHEA 4BN1A 3LHJA 1CSNA 4EOLA 5D12A 5JRSA 1R0PA 4C57A 4DGMA 1TQMA 5FEDA 3C0IA 4RJ8A 4A7CA 2YAKA 3LZBA 4GG7A 3RALA 5CZIA 4WA9A 3SOCA 2C6DA 4IX5A 3FHRA 2A1AB 3P4KA 4I6HA 5GZAA 2XVDA 2IG7A 1Q41A 5DOSA 5E92A 3LAUA 4TWOA 4RIWB