1OVEA

The structure of p38 alpha in complex with a dihydroquinolinone
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
349
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 349
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oveA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oveA01
3G6GA 4IFGA 4YSMA 5JFVA 5LWNA 2XBAA 3KRWA 3NIEA 4ZZMA 4O7VA 3ORPA 3BGPA 3SW7A 4LUDA 4M68A 2VWWA 4YJSA 2XEYA 2ITPA 4CMOA 5CENA 1EH4A 1UVRA 2Z7SA 4EH8A 4Q2AA 1WVXA 2YIXA 5KMJA 2XK8A 5JN2A 3UO5A 1DS5A 3D5VA 4HOKA 3F3ZA 3NYNA 3QQKA 4ACCA 2WMAA 4X2GA 5DRBA 2QNJA 4RZWA 3AC8A 2C6LA 2YM4A 2W06A 4IADA 2Z7QA 3EN5A 5TT7A 2QG7A 3QBNA 4L8MA 2XNPA 3QTRA 3UP2A 4FEUA 2C5YA 3B8QA 1SVHA 3KXHA 3PVWA 5B2MA 5EG3A 5CF6A 1NVQA 4JS8A 4BDHA 2W5AA 4FKLA 3KEXA 4TYIA 2XK4A 4UZDA 1YXXA 1OM1A 4ENYA 3PJ1A 4O7WA 5ITAA 2HW6A 1Q8WA 4ZSJA 3MBLA 2GPHA 1W7HA 2UZEA 5IPJA 3TV4A 2PK9A 3NYVA 4NT4A 4A4LA 1JSVA 5GNKA 4I6HA 1KOAA 1H25A 3LW0A 5J9LA 3P78A 4PWNA 1H07A 3C0GA 5IQGA 4YO4A 2G2IA 4MEDA 3UQGA 4HVSA 2PVMA 3KXNA 5TO8A 4S33A 5AMNA 4ASDA 3O50A 4C8BA 1OBGA 2PVHA 3VS0A 3NR9A 3BIZA 2O2UA 5KMOA 4HVIA 4IACA 2W1GA 3MV5A 2OXXA 1W98A 1SM2A 3CD3A 3HZTA 4OTIA 4RVMA 4BHNA 4FSQA 4F1TA 5J79A 1YXSA 4CEGA 2JDRA 2X6EA 4CFMA 1Y8GA 4QMLA 3RZFA 4EI4A 4YTCA 3D0EA 4BBMA 3FI3A 3RK7A 1H28A 4GK2A 2ITVA 3HV7A 3ZLWA 3LMIA 3PWDA 3OY3A 3RI1A 4L7FA 2CLXA 3F3VA 3DQXA 4F1OA 5BMSA 3NIZA 3BE9A 3KY2A 4ACGA 2V55A 3CQWA 3C9WA 4DFYA 1M52A 4BDGA 4OAUC 4HZSA 4NM7A 1PXPA 2FSOX 3NAXA 3QRJA 5CVHA 3K3IA 5F1ZA 4M8TA 5HOAA 3U6JA 2C3LA 2HWOA 3LM5A 4NJ3A 2JKKA 4UZHA 3NRMA 4C38A 2UZOA 3IQ7A 3MFRA 3ZTXA 4BIEA 4CNHA 3DOGA 4JXFA 4AOIA 2VO0A 1IAHA 3AT3A 3QKKA 3FZTA 4TZRA 1CM8A 4FGRA 3W2PA 2CGXA 3QC4A 2J51A 2V7AA 2YACA 2XP2A 2J50A 3D7ZA 4RX8A 4Z7GA 2X7OA 4C02A 4GYIA 1PXNA 2I6LA 3DBFA 5ANGA 3SKCA 4EC9A 3EB0A 4HGEA 4XV1A 2C4GA 4U7ZA 3R8UA 3ACKA 5D7VA 3NWWA 4QMPA 2W99B 2C6EA 3HV4A 2W5HA 4BB4A 3CGFA 4KD1A 3LXPA 4E7WA 2CKOA 5DMZA 1OIYA 4EK3A 4AT3A 4GIHA 5A4QA 2BZIB 2WKMA 2GS6A 5E4HA 4TYEA 3R7GA 5A4TA 4KKHA 3HLLA 5D11A 1PF8A 3W8LA 5AADA 4JG6A 4ALWA 2OJGA 3TV7A 3SW4A 1F0QA 3PUPA 4OTHA 3GU7A 3U55A 2BIKB 3LFDA 4QP7A 3CSVA 1O6KA 1ZY4A 2O5KA 3AD4A 3KCKA 4UV0A 3TJCA 1CKPA 2GDOA 3V5QA 4BCJA 2YITA 3O17A 5JGAA 1I44A 4JR3A 4S31A 4DTKA 5AUXA 5CAUA 1UWJA 4HCTA 1NW1A 4KWPA 5DHJA 4PP7A 4CG8A 5HLWA 4O2ZA 4F63A 3GC9A 4LOPA 4HCUA 5I9ZA 5A14A 3Q60A 3QD0A 1A06A 2WMTA 1H4LA 3L9NA 2XK9A 3CIKA 3KGAA 2W0JA 4G3GA 3VF8A 4FKSA 4RG0A 4NU1A 4ENXA 1OZ1A 2ZV7A 2QOBA 4NJDA 4E6QA 5HE0A 3A8WA 2BAJA 5BX0A 3KRJA 4FTMA 1OIUA 2ERZE 1APME 3DGKA 5EI8A 4X3FC 4OLIA 5F94A 2QOKA 4EOJA 5LQFA 1V0BA 4L52A 2JDOA 4RX9A 2BFXA 3MPMA 5GHVA 2BKZA 3HP5A 1YHWA 2VX3A 5B2LA 4IBMA 3I1AA 3KULA 3R7YA 1YWVA 2NRYA 4U45A 4OGRA 5CVFA 3DU8A 1ZAOA 5CSXA 3VAPA 1CMKE 1VEBA 3BRBA 3FQHA 4LI5A 4B4LA 3PIYA 5HO6A 1RJBA 2EB3A 4MWIA 4EH9A 2VWUA 3EYGA 3E8CA 3QYWA 2PVLA 4EBVA 1JOWB 3Q9ZA 5E90A 1U5RA 4IM0A 3U54A 3ZH8A 3TXOA 3A7GA 5FXQA 5KMNA 1H1SA 3JS2A 2IJMA 3DLSA 3KRLA 3Q53A 4QD6A 3R7EA 3R1NA 4PPAA 5IA5A 3V04A 2YJRA 4Y72A 4D28A 1Q3WA 2QVSE 4JAIA 4RWJA 1W84A 3A7FA 3QLFA 4CZUA 4EHEA 3SGCA 4Y73A 4RZVA 2GNHA 5FRIA 4ANNA 4AW5A 3UNKA 3P1AA 1K3AA 1PJKA 3QA8A 5TR6A 4BYJA 3JVRA 4EHGA 2PUNA 1JKLA 2J2IB 2E9UA 2QLQA 5HICA 4BGHA 3COIA 5DIAA 2QHMA 5CT0A 5HCYA 3NVMB 2OGVA 3EQHA 3UMWA 4J99A 3VUHA 4WKQA 3ORIA 4L3JA 3ROCA 3QRTA 2QI8A 5KKRB 2F7ZE 1DI8A 4X2FA 5BVDA 3WI6A 5EM7A 3PXYA 4MQ2A 4R6VA 5EYMA 5L6OA 4MKCA 2YFXA 5HU9A 3DBEA 5B2KA 3HRCA 2X2MA 4J8NA 3IONA 3RTPA 4AA0A 3A7IA 5L4QA 5M57A 2IWIA 4EYMA 4EQUA 5DN3A 3HGKA 4RT7A 2IZUA 3T3UA 1FVVA 3L8PA 5CQWA 2IVTA 4QQJA 3PZEA 2BAQA 2PZRA 2XNEA 4DTBA 2UZUE 4BBEA 4RWIA 3PXKA 3VULA 2I40A 4KUJA 2QO2A 2YDIA 2VTMA 4IZ5A 4L43A 4BCQA 4FT9A 4KNBA 5AV1A 2A27A 3DBCA 2WD1A 2EB2A 5K0XA 4O81A 2FB8A 3QQLA 3HDNA 1R1WA 4AE9A 3LXLA 4J97A 2BRNA 4UY9A 3UG2A 3VWAA 4DBXA 4FZAB 2JLDA 4F64A 4PDPA 1ZYJA 1PW2A 4KB8A 4ZLYA 4E4LA 2ZOQA 3ZDUA 2ZDUA 4GK4A 5I3OA 1YKRA 4FZ7A 2IN6A 4FV9A 2E9OA 2ONLC 2G15A 4FSNA 4CMTA 4XYFA 1P5EA 4JX3A 5A9UA 3UO6A 2R4BA 3VS7A 4X2JA 3P7CA 3O51A 3BV3A 3ELJA 4O38A 4X0MA 2OIQA 3LXKA 3FZOA 4BCPA 5AUYA 3QCSA 4M0ZA 1XH5A 2P33A 2W9ZB 2ZV8A 5EHLA 4CKJA 3E7VA 3LFBA 4X6QC 3DKCA 4FV1A 3DJ7A 3MA6A 5M09A 3PSCA 4NZWB 3CQEA 3BHYA 3GC0A 4H1MA 3BQCA 2CSNA 3BU6A 4HYIA 3GU6A 5H2UA 4AW2A 3U4WA 4FKTA 2UZDA 2JAVA 4AA4A 5CU2A 4YBJA 4AW0A 3R1YA 5CEOA 2PTKA 4JAJA 1M2RA 3ULIA 2WEVA 4I20A 4B6LA 4BDJA 5GIPE 2YIWA 3A61A 4QMOA 5LWMA 2B4SB 4QYYA 4L67A 4S2ZA 3AOXA 4K18A 4EOMA 3QQJA 4WNOA 3WARA 3OP5A 2XIKA 1GJOA 4IJ9A 4U79A 2J4ZA 4YPDA 4BDEA 3ZBFA 3VBVA 4F99A 1XJDA 4I22A 4LL0A 2VTIA 3DKFA 3KRXA 2WQMA 3OCBA 4BIDA 1P2AA 3LFQA 4CVAA 4KKGA 5CSWA 4F9CA 3EQRA 5I9XA 1NVRA 3OCSA 1CTPE 2WMSA 4GL9A 3PE1A 3D4QA 5EQEA 2QG5A 3D5UA 3ZXTA 5AM6A 3WF5A 2PVFA 1AD5A 1OIQA 3KVWA 2R3IA 3DPKA 2GNFA 3MA3A 5GJGA 3G90X 4GJ2A 3BWJA 3DAKA 1U46A 4EZ7A 2AYPA 2YCFA 2VNYA 2C6MA 3R0TA 2QLUA 2C1AA 4TW9A 1BYGA 3MH3A 4I5CA 3LJ1A 4UX9A 3LCTA 4PDYA 4IB3A 4FYOA 4IX5A 3MH2A 4AN2A 4E5BA 1YQJA 2ETKA 3H4JA 3V8SA 5DT3A 3QGWA 4O7SA 4D58A 4TKSA 5B0XA 3GI3A 4KIQA 4PQNA 4XBRA 3DB8A 3I5NA 5AM7A 4Z3VA 3CJFA 4DGMA 4FIEA 4N6ZA 4FKIA 3QA0A 5EOLA 3KULB 3QKLA 3ID6C 4H39A 4ZJJA 4DLJA 3WZDA 3C50A 4AGCA 3C1XA 2YDKA 3QF9A 4F0FA 5IQIA 4RJ4A 4ZP5A 3TZ8A 4ALUA 3ZO4A 4C4JA 5IA3A 2GHLA 3CC6A 4Q5EA 5EQYA 5F9EA 5DH3A 1YDRE 3UPZA 1Q5KA 5AP7A 4D0WA 3AGMA 5HHWA 3W16A 3UOHA 4AU8A 1KV1A 2BRGA 3DZOA 4YJRA 4NM3A 1U54A 5FTOA 5HE3A 2QKRA 4FL3A 5A3XA 5BPYA 3FKLA 5CAQA 3TUDA 1FGKA 2AC5A 3PTGA 5DGZA 2J0LA 3ZBXA 2X2LA 3F61A 3KA0A 4APCA 3KN5A 3E8EA 5CZHA 2J0IA 4I41A 2HAKA 2GNIA 2IO6A 1JKTA 3F3WA 5AV3A 5IA1A 5CI6A 3ACJA 1VYWA 3IKAA 3QRIA 3UMXA 1OPKA 2R3OA 2ZVAA 3JR1A 4JVGA 4EH6A 1R0PA 4D9UA 4ZLOA 4IAAA 2E2BA 4JQEA 1NT2A 5JEBA 3FMLA 2R3NA 4JNWA 3I7CA 3JPVA 5ETCA 3E92A 2H34A 2OXDA 4Y95A 2HCKA 5E91A 3PXQA 3R00A 5JSMA 2WQEA 4M84A 1ZMVA 2NRUA 4YNOA 4GW8A 4AFEA 1WBNA 3WIKA 1GIJA 2VO3A 2WU7A 3CLYA 3QTUA 4MVFA 4PUZA 5EW8A 4TNDA 5FEEA 4GFGA 3BI6A 2GNGA 2WGJA 4IWDA 4OW8A 3R8MA 5C4LA 4HYSA 1UKHA 3RPSA 3VW8A 3FPQA 5HCXA 2FGIA 2R3KA 4DT9A 5CSPA 3PJ8A 4YLJA 4QMVA 3C4FA 2GFSA 3A99A 3E3BX 2XA4A 3C51A 2BZHB 4FYNA 2UUEA 3BHHA 1X8BA 4DFBA 2BRBA 4KBKA 3D7TA 3KXZA 5HKMA 4G34A 2HK5A 3REPA 1YOMA 2PZYA 4KRCA 4ZLZA 3TG1A 4CTBA 3MI9A 2PWLA 3V5PA 3VUMA 4S32A 2A4LA 3JY9A 4UEUA 4WRGA 4FK6A 4QMZA 3W2SA 2R3FA 1IRKA 3TV6A 3OY1A 3SV0A 4A9UA 3GGFA 4NSTA 2ETMA 3FZRA 4RQKA 3WZEA 3ORNA 4XS2A 3VNTA 4O0RA 5HCZA 3QQUA 3PA5A 4USDA 4F4PA 4I21A 4DH7A 5CZIA 2GTMA 1ZYDA 1U5QA 2W1ZA 2JD5A 3W18A 4HJOA 4AXAA 3QD4A 4AZVA 4CT1A 3FMEA 4I5MA 5HE1A 1G8AA 1MRVA 2OF4A 2QOHA 1FVTA 3DK6A 4FVQA 4XG4A 3CY2A 2HELA 3M11A 1H0WA 2XKFA 2RIOA 3VQUA 5M4IA 4CRLA 1YHSA 4KIKA 3AC5A 1Q24A 2WTWA 4IZYA 3KXXA 1QPDA 2QO7A 5HLPA 3GU8A 1OI9A 2GNJA 4IAYA 1ATPE 2BDFA 3G2FA 4KSQA 2GCDA 4R8QA 5AP0A 1MP8A 4IXPA 4BC6A 2J90A 3CPBA 5CF5A 1OVEA 3FEGA 2CKPA 4NW5A 3ENHA 4Z7HA 4RFYA 3FLYA 5BVNA 3OXZA 3UJGA 3HAMA 2VWXA 3OHTA 4GT5A 2BRHA 2NPQA 3OROA 5DG5A 2J0KA 3HA6A 3K54A 4I6FA 4X3FA 4OAVB 3EQIA 5FD2A 5M4UA 1L3RE 3R01A 2AC3A 1Y91A 1ZMUA 2HZNA 3AD5A 3DB6A 4YTIA 5DFPA 4DTAA 4DEIA 3BPRA 5T3QA 3LKMA 4RFMA 4YZNA 2WFYA 4E4NA 4FTUA 1ZYLA 2R2PA 2WMBA 2Y0AA 2YHVA 4V0GB 3HA8A 5DR9A 3BHTA 4FSTA 4XHKB 3OWPA 3Q52A 3QUEA 5M53A 5ANKA 5IDPA 1W0XC 5K5NA 3FSFA 3PPJA 3ZFMA 3VUKA 1S9JA 2FSLX 2REIA 3UVRA 1VYZA 3IS5A 5A4CA 4H1JA 4HGSA 1H00A 4XRLA 2C0OA 5BVWA 2F57A 2QC6A 1HOWA 4BZNA 3LLTA 3QALE 2WZJA 5EHOA 4G6LA 3DNDA 2Q0NA 2W96B 3P9JA 2CPKE 5I9WA 2DWBA 3HRBA 5IG1A 4UWBA 2YIQA 3O7LD 3TEIA 4TWNA 3H3CA 1KE9A 4IC7A 1H08A 2Y6MA 2RG6A 3KVXA 4RJ3A 4IDTA 4RC3A 4V05A 4C4GA 1H1PA 3O96A 5M08A 2WOUA 3RPVA 3BLQA 4I6QA 3E87A 4DC2A 2F4JA 1FPUA 2XJ0A 3KMWA 4I5PA 5LVNA 3R9DA 2ZAZA 5FTQA 2VTNA 2JAMA 2C5XA 3D15A 2VWBA 2UW9A 5KMLA 3VF9A 4A9SA 1IASA 4YMJA 1PXJA 2C6OA 2VX0A 1NXKA 4G2FA 5BYZA 4CFNA 4FTJA 1MQ4A 1XBCA 3LM0A 4MBLA 4CQGA 4EHVA 5LMBA 3UO4A 4HW7A 4DHFA 3MTFA 4BTKA 4DCAA 2ZB1A 4M69A 5F4NA 5AWMA 2DYLA 3ZO2A 5CEPA 5CQUA 3QRUA 3HMOA 3SOCA 3NUXA 2ZJWA 2W7XA 3CP9A 4FZFB 4NIFA 3IW7A 4PPCA 1T45A 4XX9A 5HESA 3V5LA 3I6WA 5B7VA 4ZSLA 1WFCA 5HEZA 5I0BA 2HZIA 3OT8A 4U44A 3SG9A 4D4YA 3OEFX 1U54B 4B7TA 4YGAA 5CNNA 3COHA 3BGZA 3U51A 1Z9XA 2VTAA 1SNXA 4WD5A 5J1WA 3O2MA 5EKOA 3QZGA 4XG6A 4XP3A 3EQDA 4LM5A 1GAGA 5FWKK 3BHVA 3V5TA 1OGUA 2GSFA 4QMNA 4N57A 4I4FA 3NUYA 3E64A 5JFSA 2KTYA 4I92A 2X39A 2G1TA 2ONLA 3D2KA 5LMKC 3I5ZA 3I6UA 3MY5A 3UODA 3ZHPC 4BCMA 5AR7A 3GOPA 2X7FA 2XRUA 4PPBA 5CU6A 2R0IA 4FKVA 5HTIA 5L8KA 5FM2A 4ZSEA 2JGZA 2JIVA 4FNYA 5L3AA 4X6RA 5IUHA 2CNQA 3Q4CA 4G6OA 3WF8A 1GZ8A 4PMMA 3GCUA 4YURA 4C61A 3IW6A 2IW9A 5TF9A 3R9OA 5C01A 3F5GA 5CEQA 3ULZA 3VRYA 4A9YA 3LFAA 2FYSA 2VV9A 3AQVA 4ZIMA 4ANBA 5HVKA 3FL5A 3W55A 4BVUA 4IANA 3D7TB 2RFSA 4WG3A 4DYMA 4KSPA 4TYGA 2XYNA 4MNEA 3Q9YA 4U0IA 4W4XA 3PLAE 3FYKX 1LR4A 1XQZA 4W4YA 5E8VA 3GUBA 5HVJA 4ALVA 4RX5A 4FL2A 2PMNX 2UVXA 2UZVA 5HTCA 4ZS4A 4BCHA 4WNKA 3TNPC 5ANJA 2XM8A 4DFXE 3PYYA 2X1NA 4FKGA 1V1KA 3CQUA 2XUUA 4J95A 4YZCA 4ZTSA 5CF4A 2WHBA 2WU6A 4NWMA 3LCSA 2XF0A 1H1RA 3UTOA 2QR7A 4BICA 4G3FA 5BUIA 3ZZWA 2C5NA 3N4VA 3G33A 4CCBA 4KIKB 3E93A 3W2RA 3RAHA 4EORA 3IPHA 4C4HA 4EH4A 2VNWA 4QQ5A 5D41A 3DXQA 4FSZA 4O22A 4ASXA 4O7RA 1WVYA 4FVPA 5AJQA 1H1WA 1KUTA 4UWCA 3QHWA 1OBDA 3EH9A 4LV8A 3TN8A 4MBIA 3F9NA 4N6YA 2BDWA 2JC6A 2WPAA 5IQBA 3ALOA 2C30A 1PMNA 1FVRA 3FZSA 3ZEPA 5HNGA 2H9VA 4X3FB 3W32A 2ERKA 4ASEA 4EOSA 1M14A 4U41A 2ITOA 3CTQA 4PL4A 2VTJA 5CU3A 4QPMA 2YEXA 3ORLA 3MFUA 1YDSE 2BIYA 1P14A 4OT5A 3L9LA 2W1EA 5AR2A 5FUTA 2PZPA 2W1IA 4YP8A 4ACHA 3BHUA 1ZMWA 2WB8A 4FV3A 3VQHA 3HUCA 2J9MA 1Z5MA 3NW6A 3AMBA 4XMOA 1GZNA 2UW3A 4Y83A 4C62A 3FL4A 3OBJA 3WBLA 4WHZA 2RG5A 3PRFA 4C35A 5KMMA 4RSSA 1FQ1B 4V04A 5GJFA 4WRSA 2OG8A 4CKIA 4D55A 3O7LB 3VS1A 1RDQE 5FBNC 3Q4TA 1J91A 4ID7A 4F6WA 1PXIA 3RJCA 5KBQA 2Y4PA 3I7BA 3PSDA 1XR1A 1J7IA 4O7ZA 4FSRA 4EK4A 3NEWA 5LVMA 4R3CA 3FKNA 3PA3A 2DS1A 1H0VA 4K6ZA 3QHRA 3BE2A 4FIHA 4QO9A 4YJQA 2QOIA 3OUKA 2J5EA 4RC2A 4QP9A 4EZ3A 1Q62A 4O0TA 4FTAA 4ITIA 4C37A 5M4CA 3R73A 3WYXA 4A7CA 5JGDA 5HO8A 1ZLTA 4I0RA 2GQSA 2FA2A 1G5SA 1JBPE 4PMSA 1JAMA 3BBWA 2O64A 4IFCA 4XH6A 2XIRA 2JIIA 5TE0A 4BFMA 4EBWA 3ZFXA 3GQIA 4J96A 4GV1A 4M69B 5LVOA 1BI7A 2ESMA 2WELA 1GNGA 1QMZA 3P08A 5EI2A 4CLJA 2QOCA 2W4OA 4BDBA 4YHTA 3ZLXA 2OIBA 4FKQA 4BWXA 3LJ0A 2X81A 4BTMA 5HIEA 2CCIA 4NIFB 3V01A 4L44A 4MD7E 2OXYA 5EM6A 4XV2A 2C5VA 2E9PA 4RIYA 5IQHA 1KE7A 4PTCA 2B9JA 2X9FA 4TRLA 4JX7A 4WG5A 4DEAA 3UDBA 2NNWB 4DF3A 3HDMA 3ZXZA 2XKEA 4MHAA 4OUCA 1H27A 1PHKA 4K33A 3TNWA 4CTCA 3OS3A 4A9RA 3NNUA 4W8DA 1W8CA 3MYGA 1PMUA 3DBDA 4BCGA 4C58A 3H9RA 4D2WA 1YRPA 4GUEA 1ZARA 4TYJA 5M07A 2ITNA 4AG8A 1RE8A 4DLIA 4ZSAA 2C6IA 2QR8A 3FQEA 4Y5HA 3RWQA 5K3YA 5L2SA 3BU3A 5F20A 1IG1A 3LQ8A 5AA8A 1V0OA 2UZLA 4HYUA 3TUBA 2VTTA 3KXGA 3MW1A 1UNLA 3OMVA 5EDPA 3HKOA 3VHKA 2CN5A 4EQCA 1F3MC 1Q99A 2LGCA 4A4OA 2PPQA 4O7YA 3FHIA 3V6SA 4PDOA 1KSWA 4HVGA 1A9UA 5KMKA 3CKWA 4FTNA 1LUFA 3K3JA 4U3ZA 4QMMA 5GJDA 3ZUUA 5HBEA 5I3RA 3QCQA 3PY0A 4Z55A 2PVJA 4Y8DA 2I1MA 4U9AA 4R77A 4FK3A 4MAOA 5LXMA 4IB5A 3KN6A 2PUUA 4TWOA 5E8ZA 4DA5A 1XO2B 5HGIA 2XMYA 2OSCA 3QX2A 4YO6A 3NUPA 4YJPA 1UU9A 3GCVA 3QGYA 3SQQA 4EK6A 4FKRA 4HZRA 5ETIA 5CEKA 2XKDA 5EDQA 3P23A 4MNEB 4DH1A 4FIIA 4I0TA 2PYWA 3P4KA 2QOFA 1H24A 3UIXA 3E8DA 4G3CA 3SC1A 2VGPA 3NSZA 2VO6A 2Y4IC 5DOSA 4F6UA 2JDSA 2X4ZA 4DCEA 3F69A 1ZRZA 3N4TA 5H8EA 4L6QA 1REKA 2W05A 2EWAA 4C34A 3NAYA 1PKGA 4RMZA 3SHEA 3DJ5A 2B0QA 3DXPA 3F2AA 3A8XA 3VJNA 3FC2A 3LPBA 4D2RA 2QOLA 4WO5A 1YDTE 4QTBA 3GU5A 1IA9A 3MIYA 4MF0A 3QUPA 3ZLYA 4XG7A 5AUZA 4HNIA 3GU4A 3MPAA 4XRJA 5BQ0A 5BYLA 1JSTA 3PRIA 1UNHA 4BCOA 2X0GA 3TJDA 3OOMA 4AWIA 2A2AA 3V5JA 1YXUA 4FL1A 4H3QA 4L46A 5AIRA 5ANIA 3DZQA 3LQ3A 4WNMA 4RA4A 3BV2A 3E88A 2QU6A 1U4DA 2YLFA 3BELA 2BR1A 3LXNA 4FSUA 2BVAA 5E8TA 5ETAA 1R0EA 1P4FA 3HX4A 3VBYA 3OZ6A 3POOA 4K8AA 3VW6A 3NLBA 4DE4A 4WA9A 3UOJA 3MS9A 5BVKA 4R78A 1OB3A 3B8RA 1WBTA 3MVLA 2GTNA 1BL6A 4OTRA 2IG7A 3JY0A 1KE8A 2R9SA 3WZKA 4DINA 3TM0A 3I0OA 4RX7A 2BHHA 5LCKA 4BCFA 4I5HA 4C0TA 2CNUA 4UWYA 3RPYA 4QMXA 5JFWA 2J7TA 3Q9XA 3L9MA 4K2RA 5T6KA 2Z02A 5M56A 4FT7A 4QYFA 3EFKA 1ZOEA 4PNIA 5M4FA 3FQSA 4M66A 4DAWA 4F0IA 4CKRA 2VRXA 3CR0A 1OUYA 4EJNA 3UIUA 4EOIA 3QQHA 4BCNA 4D4RA 4F7NA 2IPXA 2PMOX 5HIBA 5J1VA 3TKUA 3UZTA 1CKJA 3R8LA 5CXHA 4O2PA 2VTQA 3E63A 2ACXA 2BFYA 4UALA 3KKVA 1PYXA 5JFXA 3N51A 4JLCA 4LUEA 2WAJA 1O6YA 4MK0A 4DH5A 4R1VA 3UVQA 1TQMA 3MVMA 5AX9A 3QL8A 3VRZA 2FO0A 3WF9A 4BWKA 5KCVA 3UYSA 2DUVA 2OJ9A 4JBOA 4U43A 3M1SA 3I81A 4AZEA 3FAAA 1TVOA 2PSQA 4XP0A 1URCA 4U6RA 4YZBA 4NEUA 1Y6AA 1QPEA 1YWRA 4MD9E 4MXCA 3NYXA 4MYGA 1UA2A 4YZMA 4C4EA 4JG7A 4KA3A 3IGGA 3L8SA 3QKMA 3U9NA 3U87A 3R22A 4JIKA 3A4PA 3EFJA 4FIJA 3TNIA 3Q2JA 4M13A 2B9FA 4FG7A 3IGOA 5AR3A 3RAWA 1HCLA 4CT2A 4PP9A 5LMKA 2XH5A 4M14A 3MVHA 2WTDA 2GFCA 4MXOA 4GU9A 1OKYA 4WSQA 2PY3A 5DVRA 3S95A 4CFUA 3D94A 3DNEA 4NFMA 4H58A 5K4JA 3RAKA 2WTCA 4CG9A 3EOCA 4EHZA 4YNEA 3UQFA 1ZZLA 4Q9SA 4WSYA 5D7AA 4BIBA 5I5ZA 4LQMA 4V0GA 1OKVA 4ARKA 2PMLX 5IUIA 3DAJA 3GFEA 4C4FA 3HECA 2C47A 5HNIX 1BX6A 2W1HA 3FV8A 4KINA 4I23A 3EQCA 4EL9A 2EXMA 4FMQA 4RIYB 4EH2A 5E92A 4RVKA 4LGDA 3Q04A 2QOOA 2ZYBA 3II5A 4I4EA 3FI4A 4TXCA 3BU5A 3VIDA 4HNFA 3W10A 5J8IA 2I0HA 3HMMA 5FLFA 2JBPA 3THBA 4ZTLA 4MTAA 4IH8A 3LFCA 3VVHA 4IB0A 5KUPA 4RJ8A 5AUUA 3W2OA 2RSVA 2X9EA 3OTVA 3OUNB 2BZKB 3HEGA 2C68A 1QPJA 4YZ9A 3VN9A 5IQCA 5JMSA 3V5WA 5HQ0A 4QP3A 1WMKA 1DI9A 1XHAA 5AAFA 4Z9LA 4IWOA 5HG9A 1CKIA 1WBOA 3GQLA 3QTZA 4JDIA 4OTDA 4P90A 4QNYA 4G6NA 5AFVA 3F2NA 3GBZA 2XIZA 2XNGA 3VUIA 2RGPA 4PY1A 1BLXA 3I4BA 5CANA 2EU9A 3MH1A 4IW0A 4LL5A 3U8WA 2CKQA 2EXEA 1JSUA 3KK9A 4RRVA 3WE8A 2B1PA 1BUHA 4X2NA 3VS4A 2Q83A 5A6OA 3RWPA 1PMEA 4U80A 3EZRA 4IM3A 2CLQA 3QRKA 3R63A 3R7UA 4AGUA 3RHKA 3V8WA 2R3QA 3D14A 4U81A 3POZA 5IF1A 5IZFA 2ITTA 4DEGA 4ANSA 3C4WA 4K77A 5KE0A 5CEMA 2XIXA 3KMMA 3QWKA 1VJYA 4E4MA 4RWKA 2R3HA 2VU3A 4LOOA 3HAVA 3ANQA 4DH3A 5EDRA 2F7EE 1OIRA 1JPAA 3EN4A 3QTXA 4C57A 5HX6A 4CSVA 2P2IA 4FV6A 2RF9A 3TKIA 2GNLA 1O9UA 4FOBA 4ZOGA 4Y85A 2IW6A 4JDJA 2OFVA 2OK1A 3C4EA 4ITHA 4TYHA 4KBAA 2DQ7X 3L8VA 1IR3A 2IVSA 3P7BA 3QXOA 2GHMA 5DR6A 3ETAA 3IW8A 2V62A 4FEQA 4QMYA 4BZDA 3PXFA 2C5OA 3RK5A 4L00A 3OWKA 4XLIA 2R7IA 2ZV2A 2J0JA 2VD5A 3DKOA 4GT4A 4MXYA 4YU2A 1GZOA 2ITQA 4U5JA 4F70A 3UNJA 3LMHA 1MRYA 4O1OA 2VTRA 4HGLA 1Q97A 2QKWB 1VR2A 4LMNA 1TQIA 4D5KA 2XNOA 5EW9A 3KF7A 4IX3A 4XG8A 5FP5A 2ZMCA 4GSBA 5HE2A 3COKA 3TZ7A 4C3PA 1W83A 2CNVA 2WTIA 2ZV9A 3EQFA 5CAOA 5J7BA 3DTWA 5GIOE 4DEDA 3DCVA 2WMQA 4KBCA 1MUOA 4WG4A 4YJUA 4W4VA 3GC7A 5JRSA 2UZNA 2W5BA 4BY9E 1Q61A 4AOJA 3N4UA 4ZTHA 3ZFYA 4BBFA 4E93A 3H0ZA 5DRDA 4G16A 3ATTA 3UYTA 2UW8A 5L6PA 3MH0A 2HENA 1Z57A 1L8TA 4ZMEA 2XBJA 1OL2A 2WQBA 5BYYA 3EKNA 4JOAA 2G2HA 3Q32A 4BI0A 4F9WA 3Q5IA 4FVRA 5CF8A 1AQ1A 4OBOA 3GXLA 4GUBA 3ZUTA 4HGTA 5CAPA 3BCEA 4LMUA 3PWYA 4MCVA 4X21A 5DT0A 1STCE 2WIPA 3PVGA 3ZSHA 2YWPA 4YTHA 3RNIA 2IZTA 1PYEA 2X2KA 4J98A 5EI6A 3SXSA 4ORKA 4UMPA 2V5QA 2O65A 5HU3A 4FT3A 4KS7A 4R7HA 3SD0A 3DA6A 3FYJX 4PTGA 5JT2A 2BZJA 2OF2A 2WTJA 4IJPA 4ZTQA 4ERKA 3RCDA 4IVAA 3AGLA 1PXOA 3HMNA 4D1SA 3HL7A 5K5XA 3ZMMA 3R9RA 4QPSA 3P5KA 4GVAA 3R2BA 4MXAA 3KC3A 3EIDA 3UVPA 3PPZA 4O6EA 2X8DA 4JJRA 3FY2A 2YM5A 4RVTA 4AX8A 1B6CB 1Q41A 4BTFA 4O6LA 4EKLA 4E26A 5LMAA 5AAGA 1XH9A 3ODYX 2B52A 2E9VA 1V0PA 3LVPA 2UW5A 4FNWA 2VX1A 1OKZA 5DE2A 4D5HA 4RGJA 4GG5A 2BDJA 4RWLA 4UYAA 4L9IA 4PDSA 3I60A 4WUAA 3UOKA 3QZFA 4D1ZA 3VBWA 3IDCA 3C5IA 3LJ2A 1E1XA 1LP4A 1WZYA 1ZXEA 2IZRA 4PRJA 5DBXA 5IQDA 2YIRA 3Q96A 3R83A 3S3IA 2BPMA 4JG8A 1ZY5A 2BCJA 4XG2A 3VUTA 1WCCA 4AW1A 5K0KA 5J9YA 3NVKI 5A6NA 4RVLA 3JXWA 3RHXA 4NM0A 1LEZA 5LVLA 1TKIA 4RJ7A 1BL7A 2PU8A 2HY0A 3PIXA 2V7OA 4N70A 4FTTA 4TN6A 2YZLA 3D5XA 2W4JA 3OT3A 3ERKA 4ZEGA 4YSJA 5LOHA 4PNKA 3FJQE 4MQ1A 3OCGA 3TT0A 4BYIA 4CFVA 5FBOA 3F2RA 4DG0E 4FX3A 3SG8A 4PX6A 3SOAA 3LQ5A 3F7WA 4ZZOA 1OKWA 5E8SA 2C0TA 3T9IA 2VTSA 3F7ZA 3TTIA 4D4VA 4EQMA 1OL5A 1SZMA 2PL0A 2CGVA 3DK3A 3H9OA 3A60A 4BGGA 4F7JA 4YTFA 2OZOA 4OT6A 2QO9A 5HO7A 4BWPA 2BTSA 2PULA 4G17A 2UW0A 4NCTC 4NH1A 4AT4A 1M7QA 3LFNA 2I0VA 2R7BA 3PFQA 4AF3A 4GVJA 5EFQA 2O0UA 3F5UA 4IIRA 3DBQA 3K5UA 4GS6A 4O0WA 4KAOA 4DITA 2O8YA 2SRCA 2VWZA 1Y6BA 5CVGA 4D1XA 4CD0A 2XKCA 4R5YA 5BVEA 4IVBA 4F1MA 3ZCLA 4E4XA 3PLSA 4E6DA 4FTRA 4L01A 3HUBA 4LRKA 3DAEA 4ZTNA 3GCQA 3FE3A 4RJ6A 2B9IA 4GFOA 1AGWA 3LCOA 4UMQA 4XCUA 2VUWA 4LGHA 1PXLA 3P0MA 5E8YA 3DXNA 5H9BA 2UW7A 5HORA 4BGQA 3PA4A 3S00A 2O3PA 2HZ4A 3AD6A 3PVUA 4O0UA 2I7QA 1OL7A 2BKKA 5DT4A 1SVGA 5HLNA 5L2QA 2B54A 3FKOA 4J53A 3AC3A 2WIHA 3FPMA 3OF0A 4O96A 4ZS0A 5AA9A 1UU7A 5IU2A 4J1RA 2C3KA 4TWPA 4NW6A 5FEQA 2P4IA 3IOPA 2O63A 2XB7A 3ORTA 3UGCA 3RBWA 4IWPA 5EW3A 4AAAA 4GKIA 4FR4A 4CXAA 5IEVA 1K9AA 4R5SA 1O6LA 4F08A 3QUDA 4TTHB 4TYHB 3V6RA 4ZXTA 4RPVA 4C3FA 4NKSA 3C4XA 4DG2E 4LRMA 4P5QA 3IECA 5IQEA 5DEWA 4WIHA 5M55A 2OWBA 4QTAA 2HXQA 4Z16A 4YC8A 2CKEA 3B2WA 3O0GA 4F6SA 4M0YA 3QC9A 2Y7JA 3SA0A 1OL1A 2HW7A 3QLGA 5FTGA 1OPJA 3ZZEA 3PY3A 3R21A 4FTQA 4I6BA 5KBRA 4ANQA 5E1EA 3I0QA 3OD6X 4LG4A 4AFJA 4FV7A 5FXSA 4M97A 2HIWA 2ITZA 4BCIA 2WNTA 4OTPA 2XCHA 3KU2A 3PSBA 4V01A 3SLSA 2YA9A 5CYIA 1RQQA 1CSNA 4QT1A 3KQ7A 4GT3A 4IVCA 4O27B 2VWIA 5TOZA 2C3JA 4QP4A 4FG9A 4L3LA 4QRCA 3VS2A 3FUPA 4S30A 3RINA 4I1ZA 3IW5A 5HX8A 3FMJA 3RM6A 3R9NA 5J7HA 3OW4A 4B99A 4LFIA 4R7IA 2JDTA 3BGQA 5LJJA 1KOBA 2FVDA 5C4KA 3D83A 2XNMA 3DLZA 5EYDA 4F65A 4O0SA 5AP6A 2HOGA 2QQ7A 4FNXA 4ANOA 3KF4A 3OFMA 5EYKA 3QTSA 5KHWA 3NUAA 3QXPA 3G51A 4IM2A 3QX4A 4FSYA 4O0YA 3R9HA 2PVRA 4CQEA 4FI1A 4IZ7A 5K9IA 4HVDA 3OVVA 3ZU7A 4ASZA 4ZJVA 5BVFA 5IQAA 3DJ6A 4QTDA 4MH7A 4EUUA 4K9YA 4C59A 3R8PA 3K2LA 4UXLA 1FMKA 4YJOA 4D2VA 4YPSA 3FLQA 4UYNA 1WBWA 5HZNA 5EOBA 4PTEA 3BYVA 5E1SA 4DG3E 3UZRA 3G5DA 4DEEA 1E9HA 3NUUA 2F2CB 3EN6A 2A0CX 4ACMA 4E6CA 2GMXA 3Q5ZA 4FV8A 2WEIA 4EOOA 4FEVA 1Q3DA 4EH7A 3E3PA 4FKUA 5CXZA 5DNRA 2IVUA 3BYOA 3WOWA 3W1FA 1GIIA 4XV3A 3F3TA 3RPOA 1QCFA 1SVEA 4B8LA 3RVGA 4B9DA 1FBNA 2W1CA 4JQ8A 5EM5A 3RM7A 5A4EA 2ZDTA 4CFXA 2F2UA 1W82A 2CGWA 3TDVA 3EKKA 3Q4ZA 4CFFA 3DDPA 3CBLA 3FMHA 1NVSA 2GQGA 2ZMDA 3O8PA 3ORKA 3EQGA 3JVSA 5IISA 2R0UA 4BI2A 4O83A 1M17A 4O0XA 3OG7A 4L42A 3CXWA 4YHJA 2P3GX 4U97A 5L6WL 3BYUA 4DEHA 2OBJA 4BTJA 4O82A 3MWUA 1XH7A 2OH0E 3PG1A 2QU5A 3A7JA 4I3ZA 2C6TA 4ZMFA 3FLZA 4L7SA 4BL1A 1IA8A 2H6DA 3RAIA 3QTWA 4XEYA 2Y8OA 3PDTA 3A4OX 1WBSA 4BF2A 4U42A 3JUHA 5KZ0A 3BWFA 2FH9A 3T8OA 4QP2A 3KB7A 4YJVA 3WIGA 2H8HA 5G1XA 4NL0A 4QYEA 4LGGA 1YOLA 4YUQA 3ZS5A 1ZOGA 5A54A 2GS2A 4OR5A 2F9GA 3NUNA 2OJFE 4JT3A 3HV6A 4ONAA 3FXWA 2OW3A 4F7SA 4EC8A 3U6IA 3VC4A 3P86A 2PMIA 5BVOA 3G15A 4EYJA 2X7GA 2UV2A 3IK3A 3M2WA 4PMPA 4ZSGA 2IVVA 2P55A 4QTCA 4D9TA 3S2PA 3DT1A 5JZNA 5CEIA 4EONA 3SRVA 3AXWA 3GFWA 4M67A 4BDFA 2RFNA 2Y4IB 5HG8A 4FSWA 1ZYCA 4RIXA 4EH3A 1A48A 3PE2A 5J95A 4EWHA 3KK8A 4HYHA 3UC4A 4DGNA 5ICPA 5IMEA 4CRSA 3PP0A 1BKXA 4ITJA 4E5WA 4O86A 4KS8A 3BQRA 3FBVA 3F88A 4QP6A 4E1ZA 1SMHA 2Y9QA 3ORZA 1FINA 4IEBA 5ANDA 1XKKA 3LOKA 5AV4A 2YCQA 5FGKA 2CHLA 1IEPA 1PY5A 3NNVA 2B55A 2WMRA 2OIDA 3EL7A 4XG3A 5CX9A 3NYOA 3FI8A 3MIAA 3H9FA 2XK7A 3HV3A 3DKGA 2I0YA 4JQ7A 1U59A 3UPXA 1DM2A 1ERKA 5AUWA 3GENA 5CT7A 1XH6A 2W1DA 4MNFA 1MRUA 3VUGA 2CDZA 5CTPA 4UBAA 3HYHA 3HMPA 4GH2A 3LMGA 4C3RA 4H05A 2RL5A 3TZ9A 3OEZA 4C36A 1TQPA 5H8BA 4MF1A 4FTOA 2IZSA 3LCKA 4RIWA 3PXRA 3Q9WA 3QD3A 2R3MA 4FKWA 2ITYA 4JBQA 2Z7RA 2E9NA 3E7OA 3EQBA 5LCJA 1WBVA 1ND4A 2OZAA 2XS0A 3FLNC 4GIIA 5ACKA 3ALNA 3WYYA 4WT6A 5IKWA 4QMWA 4DGOA 5BMMA 1OUKA 3AC4A 3Q3BA 4FKPA 3UE4A 5GZ8A 2QCSA 3PPKA 3QU0A 3COMA 4A07A 4FZDB 2WO6A 2YZAA 4FTCA 4IVDA 3ZYAA 1GIHA 2VGOA 1YI3A 3ZONA 3VO3A 2B9HA 2UVYA 2UW6A 5HVYA 3CCNA 2WXVA 4CCUA 3KFAA 3LFEA 2PHKA 4UB7A 3MY1A 3EHAA 2F49A 4GRBA 4PL5A 5J87A 4M3QA 2JFMA 2HXLA 4EWQA 1G3NA 4II5A 4JDHA 3R8VA 4CMUA 4DFZE 3ZM9A 3NX8A 4N0SA 1M7NA 3CKXA 5DYJA 4NM5A 2BTRA 3QD2B 3R30A 3DY7A 2GQRA 3FHRA 5AV0A 3FWQA 4AP7A 2ETRA 2RFDA 5DA3A 5DEYA 3IG7A 4XJ0A 3GB2A 4FV5A 4U40A 2WMXA 3FMDA 3SXFA 4DFLA 4ZTRA 3UP7A 3OBGA 3EL8A 3VS6A 4ZY4A 3SVVA 3FXZA 3R28A 3IDBA 4C7TA 3NW5A 3HVCA 1JKSA 3IW4A 4U3YA 5TKDA 4UMUA 5IH6A 1YXTA 1URWA 3G9LX 3GP0A 5I9YA 2C6KA 4L45A 3ORXA 2XNNA 4O84A 3CS9A 2OI4X 2ZM3A 3EJ1A 4IAZA 5AIKA 3NNWA 4EEVA 2WOTA 1YI6A 3VBQA 4CFWA 2ZM4A 3QZIA 3F66A 3UG1A 4LOQA 2Q0BA 1GY3A 2QURA 4KIOA 3C13A 5C1QB 4P5ZA 3LLAA 4K1BA 3Q6WA 3BYMA 3GVUA 4E20A 3LIJA 4KRDA 3AC1A 4AT5A 2EXCX 1J1BA 3SX9A 4AACA 3AMAA 3UBDA 3G0EA 3ZRMA 1WVWA 3EWHA 4FV4A 3FDNA 4AUAA 5M06A 3OC1A 4ZTMA 3RALA 4AQCA 4FNZA 3M42A 3TNHA 2R5TA 4OTFA 5JKGA 3ZM4A 5E8XA 3CJGA 4D2SA 5IA2A 3AT4A 3PY1A 3PVBA 5J5TA 5AP1A 5FXRA 1FGIA 3F6XA 3R04A 4IB1A 3GEQA 4Q5HA 2BROA 3W33A 3ZRKA 5EK7A 1UU8A 4NCTA 5L2TA 3GC8A 3V8TA 3ZSGA 1Q8TA 4IQ6A 2JDVA 4J71A 3N9XA 5C03A 5BNJA 3CD8A 5IEXA 3TWJA 3BX5A 4WBOA 4Q9ZA 2OJIA 5HBHA 5JRQA 1XBBA 2V0DA 3AMYA 2VZ6A 5C8NA 4G5JA 4EKKA 2Z60A 4IDVA 2A1AB 4H36A 1XBAA 5CSHA 5D1JA 3F5XA 3TTJA 5I4NA 1J7LA 3MPTA 2Y6OA 1FMOE 1S9IA 2CMWA 2YM6A 5BUJA 3A7HA 2V22A 4W9XA 3OCTA 2J0MB 3EFWA 4O91A 3D9VA 4BRXA 4TL0A 4GCJA 3A2CA 4RIOA 2YLEA 5IH4A 4AZWA 4QYGA 3EN9A 4TWCA 4D0XA 2YN8A 4UN0C 3ANRA 3UZPA 5D10A 5FEDA 4EUTA 2ZM1A 4TT7A 2J6MA 2CN8A 2OFUA 4NFNA 1BI8A 5C27A 3RPRA 4YC6A 4N4SA 5IH5A 1GZKA 3IO7A 3RZBA 3VS5A 4YLLA 3TZMA 4MXXA 2YJSA 1T46A 5J9ZA 3SRVB 5KX8A 1RW8A 3KMUA 4FICA 3ZOSA 2XNBA 4JL9A 3ZO1A 4E8AA 3UIBA 2XJ1A 4FIFA 4RC4A 4RIXB 4BDAA 4FKOA 2R64A 1YVJA 4C2VA 5CY3A 3ZEWA 1H8FA 1E1VA 2BAKA 4GFMA 4FV2A 4F9YA 5E8WA 5L8LA 3O8TA 3ORMA 2G9XA 4XOYA 5FG8A 1Y8YA 4EZ5A 4JDKA 4P4CA 2CCHA 4ANMA 5AP4A 4F0GA 4GEOA 4CGAA 2VN9A 2PUIA 2X6DA 3EQPA 2UW4A 3NCZA 5DPVA 5HTBA 2JBOA 4FTIA 1IAJA 2YCSA 3AC2A 3B2TA 3F3UA 4I94A 2P2HA 2JKOA 3FSKA 3QTIA 4G9RA 4M12A 3OW3A 4EOPA 4MX9A 2VWYA 4AZFA 4J7BA 3MVJA 2WQOA 4AN9A 4HCVA 4GK3A 3L1SA 4R3RA 2LAVA 4B0GA 4CV8A 4BKZA 3DFCB 3ROYA 4BCKA 5ANOA 2ITUA 3PXZA 3QTQA 1QPCA 3OXTA 5FDXA 3C0HA 5JK3A 2X8IA 1GOLA 4RIWB 4WNPA 1CDKA 3FZ1A 2VWVA 4FE2A 1FOTA 2JITA 3WF7A 5J5SA 3MY0A 2YISA 3AT2A 4YJTA 2OZAB 2BMCA 4FEWA 4O0VA 5AR8A 5ETFA 1ZOHA 2R3PA 3L9PA 3QCYA 3T3VA 3TUCA 2XVDA 3F82A 1YWNA 3MDYA 5IEYA 2ZB0A 5E7RA 4FUYA 3W2QA 3C5UA 4BDCA 4DEBA 2GHGA 4WOVA 4FODA 4G9CA 1MQBA 2X8EA 4GMYA 3R7IA 4TY1A 4XLVA 2A19B 3BZ3A 5HI2A 1Y57A 3DQWA 1VZOA 4NUSA 2JIUA 4YBKA 1R78A 5ACBC 5HG7A 4YHFA 5KNJA 3TL8A 3WZJA 4BKJA 5CASA 3NZ0A 1H26A 3MSSA 5DLSA 4R3PA 5KKRC 2B53A 3HNGA 3GNIB 1JVPP 3EZVA 4QOXA 2YM7A 2H96A 3QCXA 4YLKA 3RMFA 3PJCA 4BDKA 3FLSA 3MESA 1YW2A 3SAYA 3O23A 5I9UA 3ODZX 4WUNA 4AE6A 2R3GA 2RFEA 4BI1A 3PIZA 2BHEA 4TNBA 4D2PA 3R7VA 4A4XA 4FBXA 4RA5A 5EKNA 3LAUA 3P7AA 4J8MA 2PZ5A 2QHNA 3HP2A 5AUTA 4EK8A 5JQ8A 1OMWA 3FZPA 4E6AA 2FSTX 2YWVA 4NYEA 2HYYA 4C33A 2QONA 3DFAA 3BEAA 3HV5A 4G5PA 3LE6A 1Q4LA 4OTQA 5IA4A 3NMUF 3NGAA 3OWJA 4CZTA 4XG9A 3HMIA 3FI2A 1JQHA 2VO7A 4K0YA 4E73A 4OBQA 5H3QA 4EOKA 1K2PA 3MTLA 4ZY5A 5C26A 5IUGA 3U4UA 4CV9A 3V3VA 4PF4A 3QZHA 3DK7A 4UMRA 4W8EA 4TPTA 2XK3A 3BLRA 3D2IA 3ZDIA 4F9BA 4ZZNA 4USEA 5CU4A 5CLPA 3FLWA 5CALA 2QD9A 3OWLA 4MWHA 3S0OA 4IAFA 4QQCA 5EM8A 4DH8A 4B8MA 2OKRA 2Z8CA 2PZIA 3OXIA 1Q8UA 2WTVA 5DWRA 4EH5A 4USFA 4UMTA 3R1QA 4F9AA 1PMVA 2XIYA 3FMKA 4KIPA 4KABA 2CGUA 4AN3A 1PRYA 2R3RA 4NTTA 5JZJA 3NNXA 2QOQA 4C2WA 5AR5A 2OH4A 4PV0A 3PJ2A 4QQTA 4FZ6A 3R1SA 2CJMA 2FUMA 3R6XA 4O1PA 1UU3A 2OICA 3R8ZA 2X4FA 2YM3A 3MN3A 2XRWA 3O8UA 2G01A 4G3EA 2BALA 5C9CA 3PP1A 3DS6A 1M2QA 3D5WA 4FC0A 2YAAA 4AGWA 2B7AA 3FXXA 4GYGA 4IE9A 2KULA 3E5AA 3GCSA 2PVNA 3PZHA 5AX3A 2OU7A 2YDJA 3C0IA 4ZK5A 4D2TA 4EJ7A 1ZWSA 4JRVA 3LHJA 1OECA 4FEXA 2W1FA 4AA5A 4KKEA 1Q8ZA 5GZAA 1KE6A 4FIGA 3FC1X 4FTKA 2VTLA 5EYCA 3NPCA 2WQNA 4X2KA 5LVPA 3ITZA 3GT8A 4IHPA 1PKDA 1I09A 4CYIA 2NO3A 4OBPA 3R71A 3TI1A 5KZIA 3ET7A 3NUSA 3SXRA 3BYSA 3MJ2A 3WILA 3CEKA 3FY0A 5A46A 3RNYA 4RLKA 4XOZA 4MD8E 2UZWE 5AR4A 3RKBA 5L8JA 5GZ9A 2C0IA 4IX6A 2F7XE 3A62A 2Z7LA 1OPLA 4FSMA 4ZJIA 5AP5A 4YR8A 2W17A 3PG3A 1B39A 4FUXA 5E9EA 1P4OA 5EHYA 4EK5A 1JWHA 2P0CA 2PE1A 1R3CA 2WMWA 2PE0A 3ATSA 4EOLA 4IC8A 5DR2A 5HBJA 5IMXA 4BR3A 4IAIA 3HRFA 3W8QA 1YHVA 4GU6A 2XCKA 4E3CA 4AZSA 1DAYA 2C3IB 1NA7A 4P2KA 2UZBA 3NW7A 5A4LA 1M2PA 5HNBA 1SYKA 3ZO3A 2OLCA 3R2YA 2YM8A 5CSVA 3K5VA 3FMNA 4IZAA 4RBLA 4RQVA 5IA0A 1ZYSA 5KO1A 3EMGA 3VBXA 4ERWA 2W4KA 4QP1A 2PUPA 4AGDA 4YZDA 2J5FA 1OITA 3G0FA 3DV3A 3AG9A 5AP3A 5HIDA 1R39A 4JBPA 3KRRA 3RP9A 5JH6A 4DN5A 3R02A 3F5PA 1PXMA 1ZZ2A 2XK6A 3Q4UA 3Q6UA 4JI9A 4L68A 4S34A 3QFVA 2JFLA 4QP8A 5C8MA 2WTKB 3ZLSA 3ZUVA 4QMSA 3WE4A 4BDDA 4ZY6A 4O21A 4FG8A 4DGLC 5FDPA 3PJ3A 2JKMA 3OOGA 4NK9A 3VJOA 3NCGA 4YC3A 5H8GA 1LPUA 5EH0A 1LEWA 4X7QA 4A9TA 1BMKA 1UV5A 4BN1A 3S1HA 2ITWA 5L2WA 3T9TA 4OTWA 4C4IA 4LYNA 1REJA 3TNQB 3MB7A 3KXMA 1WBPA 4HPTE 3CTJA 3C4ZA 5I9VA 3H0YA 2BRMA 1HCKA 2NP8A 3IOKA 3VUDA 3U6HA 2HWPA 3KL8A 3OTUA 5AAEA 2C69A 4FGBA 5K4IA 5KHXA 4NTSA 4QTEA 5AEPA 4BZOA 3CTHA 4LRJA 5ANEA 5HD4A 3S4QA 1J3HA 5HG5A 2I0EA 3EN7A 4X3JA 4M7IA 4QMQA 4R1YA 2GU8A 2XYUA 2YIYA 4RLLA 2EVAA 4FT0A 3LCDA 5M44A 1UNGA 2YAKA 4J52A 3UNZA 2R3LA 4JRNA 3BLHA 4W4WA 4Y46A 3O71A 3UIMA 3MGYA 3ZRLA 5GINE 1UWHA 4UXQA 2VTHA 4A06A 2QODA 5CI7A 4AZTA 3QQFA 3TKHA 4IWQA 3MFSA 1B38A 2EUFB 1H01A 4FF8A 3P79A 4F7LA 2UZTA 5C8KA 3IDPA 3TDWA 2XZSA 5T68A 4IMYA 2Z2WA 4P7EA 3E62A 4BDIA 1JNKA 4OTGA 4QPAA 4CLIA 4O7LA 4G3DA 3I79A 3GOKA 2OJJA 5EQPA 3V51A 1OL6A 4D4SA 1G8SA 4MXZA 2PE2A 5AP2A 3QQGA 4JIAA 1YI4A 5FP6A 2YERA 4FOCA 4JR7A 1KWPA 4HVHA 4MBJA 3E8NA 4ZAUA 5FM3A 1H1QA 3EYHA 3LFSA 2FSMX 2JKQA 2BILB 4GJ3A 1WAKA 4QMUA 2XEZA 3L8XA 4JBVA 4DFNA 5L2IA 4WBBB 4GKHA 3EFLA 4LV5A 3G6HA 5HD7A 5DI1A 3LZBA 5KMIA 2HY81 4APPA 1SNUA 1Q8YA 4FA2A 1JKKA 4RJ5A 4M15A 1QL6A 2WMUA 1PXKA 2XM9A 4FTLA 3KREA 4G1WA 2PVKA 5IQFA 3BKBA 1XH8A 3DDQA 3FMMA 3U9CA 5AV2A 2VAGA 2BUJA 3CGOA 4AS0A 2WTKC 3WZUA 4GG7A 3R7OA 3RCJA 5CNOA 2W9FB 3CPCA 4XUFA 4BHZA 4CYJA 1F5QA 4DGGA 3W2CA 3DTCA 3MFTA 5F95A 2AUHA 4QNAA 2HZ0A 5CS6A 2ITXA 1J1CA 3ZC5A 3VS3A 2YCRA 2C6DA 1JLUE 5G6VA 3WF6A 3MJ1A 4AOTA 5M51A 3CY3A 2JEDA 4FT5A 4IAKA 4K11A 4O7TA 4DBNA 3TCPA 2UVZA 1YXVA 4NKAA 5JGBA 3ENMA 3G9NA 3CE3A 4PMTA 5CWZA 4L3PA 3NS9A 1KE5A 2VTOA 2PVYA 3BBTB 1DAWA 4FKJA 4R7BA 3LFFA 2XJ2A 2GS7A 4PL3A 3GCPA 3ZSIA 4DFUA 4L53A 3QAME 4QMTA 4HPUE 4XV9A 5D9HA 3UC3A 1NY3A 1KV2A 3UQCA 3TIZA 5E8UA 2WMVA 4XNEA 2G2FA 2R3JA 4FV0A 4F09A 4O7NA 3Q2MA 4H3BA 3C7QA 3BEGA 5LARA 4QYHA 3RK9A 3VHEA 3MB6A 4IX4A 4RFZA 3H30A 3QWJA 1YOJA 4CZYB 3C4CA 4I93A 4E5AX 1UKIA 4H3PA 3QYZA 4W9WA 5BUEA 4I24A 4G31A 5CU0A 3KCFA 2OO8X 5D12A 4I0SA 2VTPA 4DT8A 4YJNA 4ANLA 3RGFA 4BKYA 4U8ZA 3VBTA 4ACDA 4Y5QA 1XWSA 5JQ5A 3UOLA 5AUVA 3ZC6A 1J7UA 2C1BA 1XH4A 2YABA 3NDMA 4XBUA 3H10A 5IDNA 4EOQA 3JYAA 4XP2A 5FQDC 2IW8A 2RKUA 3SDJA 3TIYA 5CAVA 3TACA
chains in the Genus database with same CATH superfamily
3G6GA 4IFGA 4YSMA 5JFVA 5LWNA 2XBAA 3KRWA 3NIEA 4ZZMA 4O7VA 3ORPA 3BGPA 3SW7A 4LUDA 4M68A 2VWWA 4YJSA 2XEYA 2ITPA 4CMOA 5CENA 1EH4A 1UVRA 2Z7SA 4EH8A 4Q2AA 1WVXA 2YIXA 5KMJA 2XK8A 2XAMA 5JN2A 3UO5A 1DS5A 4AXFA 3D5VA 4HOKA 3F3ZA 3NYNA 3QQKA 4ACCA 2WMAA 4X2GA 5DRBA 2QNJA 4RZWA 3AC8A 2C6LA 2YM4A 2W06A 4IADA 2Z7QA 3EN5A 5TT7A 2QG7A 3QBNA 4L8MA 2XNPA 3QTRA 3UP2A 4FEUA 2C5YA 3B8QA 1SVHA 3KXHA 3PVWA 5B2MA 5EG3A 5CF6A 1NVQA 4JS8A 4BDHA 2W5AA 4FKLA 3KEXA 4TYIA 2XK4A 4UZDA 4BJJA 1YXXA 1OM1A 4ENYA 3PJ1A 4O7WA 5ITAA 2HW6A 1Q8WA 4ZSJA 3MBLA 2GPHA 1W7HA 2UZEA 5IPJA 3TV4A 2PK9A 3NYVA 4NT4A 4A4LA 1JSVA 5GNKA 4I6HA 1KOAA 1H25A 3LW0A 5J9LA 3P78A 4PWNA 1H07A 3C0GA 5IQGA 4YO4A 2G2IA 4MEDA 3UQGA 4HVSA 2PVMA 3KXNA 5TO8A 4S33A 5AMNA 4ASDA 3O50A 4C8BA 1OBGA 2PVHA 3VS0A 3NR9A 3BIZA 2O2UA 5KMOA 4HVIA 4IACA 2W1GA 3MV5A 2OXXA 1W98A 1SM2A 3CD3A 3HZTA 4OTIA 4RVMA 4BHNA 4FSQA 4F1TA 5J79A 1YXSA 4CEGA 2JDRA 2X6EA 4CFMA 1Y8GA 4QMLA 3RZFA 4EI4A 4YTCA 3D0EA 4BBMA 3FI3A 3RK7A 1H28A 4GK2A 2ITVA 3HV7A 3ZLWA 3LMIA 3PWDA 3OY3A 3RI1A 4L7FA 2CLXA 3F3VA 3DQXA 4F1OA 5BMSA 3NIZA 3BE9A 3KY2A 4ACGA 2V55A 3CQWA 3C9WA 4DFYA 1M52A 4BDGA 4OAUC 4HZSA 4NM7A 1PXPA 2FSOX 3NAXA 3QRJA 5CVHA 3K3IA 5F1ZA 4M8TA 5HOAA 3U6JA 2C3LA 2HWOA 3LM5A 4NJ3A 2JKKA 4UZHA 3NRMA 4C38A 2UZOA 3IQ7A 3MFRA 3ZTXA 4BIEA 4CNHA 3DOGA 4JXFA 4AOIA 2VO0A 1IAHA 3AT3A 3QKKA 3FZTA 4TZRA 1CM8A 4FGRA 3W2PA 2CGXA 3QC4A 2J51A 2V7AA 2YACA 2XP2A 2J50A 3D7ZA 4RX8A 4Z7GA 2X7OA 4C02A 4GYIA 1PXNA 2I6LA 3DBFA 5ANGA 3SKCA 4EC9A 4AQKA 3EB0A 4HGEA 4XV1A 2C4GA 4U7ZA 3R8UA 3ACKA 5D7VA 3NWWA 4QMPA 2W99B 2C6EA 3HV4A 2W5HA 4BB4A 3CGFA 4KD1A 3LXPA 4E7WA 2CKOA 5DMZA 1OIYA 4EK3A 4AT3A 4GIHA 5A4QA 2BZIB 2WKMA 2GS6A 5E4HA 4TYEA 3R7GA 5A4TA 4KKHA 4O4DA 3HLLA 5D11A 1PF8A 3W8LA 5AADA 4JG6A 4ALWA 2OJGA 3TV7A 3SW4A 1F0QA 3PUPA 4OTHA 3GU7A 3U55A 2BIKB 3LFDA 4QP7A 3CSVA 1O6KA 1ZY4A 2O5KA 3AD4A 3KCKA 4UV0A 3TJCA 1CKPA 2GDOA 3V5QA 4BCJA 2YITA 3O17A 5JGAA 1I44A 4JR3A 4S31A 4DTKA 5AUXA 5CAUA 1UWJA 4HCTA 1NW1A 4KWPA 5DHJA 4PP7A 4CG8A 5HLWA 4O2ZA 4F63A 3GC9A 4LOPA 4HCUA 5I9ZA 5A14A 3Q60A 3QD0A 1A06A 2WMTA 1H4LA 3L9NA 2XK9A 3CIKA 3KGAA 2W0JA 4G3GA 2X0PA 4FKSA 3VF8A 4RG0A 4NU1A 4ENXA 1OZ1A 2ZV7A 2QOBA 4NJDA 4E6QA 5HE0A 3A8WA 2BAJA 5BX0A 3KRJA 4FTMA 1OIUA 2ERZE 1APME 3DGKA 5EI8A 4X3FC 4OLIA 5F94A 2QOKA 4EOJA 5LQFA 1V0BA 4L52A 2JDOA 4RX9A 2BFXA 3MPMA 5GHVA 2BKZA 3HP5A 1YHWA 2VX3A 5B2LA 4IBMA 3I1AA 3KULA 3R7YA 1YWVA 2NRYA 4U45A 4OGRA 5CVFA 3DU8A 1ZAOA 5CSXA 3VAPA 1CMKE 1VEBA 3BRBA 3FQHA 4LI5A 4B4LA 3PIYA 5HO6A 1RJBA 2EB3A 4MWIA 4EH9A 2VWUA 3EYGA 3E8CA 3QYWA 2PVLA 4EBVA 1JOWB 3Q9ZA 5E90A 1U5RA 1W2CA 4IM0A 3U54A 3ZH8A 3TXOA 3A7GA 5FXQA 5KMNA 1H1SA 3JS2A 2IJMA 3DLSA 3KRLA 3Q53A 4QD6A 3R7EA 3VONA 3R1NA 4PPAA 5IA5A 3V04A 2YJRA 4Y72A 4D28A 1Q3WA 2QVSE 4JAIA 4RWJA 1W84A 3A7FA 3QLFA 4CZUA 4EHEA 3SGCA 4Y73A 4RZVA 2GNHA 5FRIA 4ANNA 4AW5A 3UNKA 3P1AA 1K3AA 1PJKA 3QA8A 5TR6A 4BYJA 3JVRA 4EHGA 2PUNA 1JKLA 2J2IB 2E9UA 2QLQA 5HICA 4BGHA 3COIA 5DIAA 2QHMA 5CT0A 5HCYA 3NVMB 2OGVA 3EQHA 3UMWA 4J99A 3VUHA 4WKQA 3ORIA 4L3JA 3ROCA 3QRTA 2QI8A 5KKRB 2F7ZE 1DI8A 4X2FA 5BVDA 3WI6A 5EM7A 3PXYA 4MQ2A 4R6VA 5EYMA 5L6OA 4MKCA 2YFXA 5HU9A 3DBEA 5B2KA 3HRCA 2X2MA 4J8NA 3IONA 2A98A 3RTPA 3A7IA 4AA0A 5L4QA 5M57A 2IWIA 4EYMA 4EQUA 5DN3A 3HGKA 4RT7A 2IZUA 3T3UA 1FVVA 3L8PA 5CQWA 2IVTA 4QQJA 3PZEA 2BAQA 2PZRA 2XNEA 4BJJB 4DTBA 2UZUE 4BBEA 4RWIA 3PXKA 3VULA 2I40A 4KUJA 2QO2A 2YDIA 2VTMA 4IZ5A 4L43A 4BCQA 4FT9A 4KNBA 5AV1A 2A27A 3DBCA 2WD1A 2EB2A 5K0XA 4O81A 2FB8A 3QQLA 3HDNA 1R1WA 4AE9A 3LXLA 4J97A 2BRNA 4UY9A 3UG2A 3VWAA 4DBXA 4FZAB 2JLDA 4F64A 4PDPA 1ZYJA 1PW2A 4KB8A 4ZLYA 3TYKA 4E4LA 2ZOQA 3ZDUA 2ZDUA 4GK4A 5I3OA 1YKRA 4FZ7A 2IN6A 4FV9A 2E9OA 2ONLC 2G15A 4FSNA 4CMTA 4XYFA 1P5EA 4JX3A 5A9UA 3UO6A 2R4BA 3VS7A 4X2JA 3P7CA 3O51A 3BV3A 3ELJA 4O38A 4X0MA 2OIQA 3LXKA 3FZOA 4BCPA 5AUYA 3QCSA 4M0ZA 1XH5A 2P33A 2W9ZB 2ZV8A 5EHLA 4CKJA 3E7VA 3LFBA 4X6QC 3DKCA 4FV1A 3DJ7A 3MA6A 5M09A 3PSCA 4NZWB 3CQEA 3BHYA 3GC0A 4H1MA 3BQCA 2CSNA 3BU6A 4HYIA 3GU6A 5H2UA 4AW2A 3U4WA 4FKTA 2UZDA 2JAVA 4AA4A 5CU2A 4YBJA 4AW0A 3R1YA 5CEOA 2PTKA 4JAJA 1M2RA 3ULIA 2WEVA 4I20A 4B6LA 4BDJA 5GIPE 2YIWA 3A61A 4QMOA 5LWMA 2B4SB 4QYYA 4L67A 4S2ZA 3AOXA 4K18A 4EOMA 3QQJA 4WNOA 3WARA 3OP5A 2XIKA 1GJOA 4IJ9A 4U79A 2J4ZA 4YPDA 4BDEA 3ZBFA 3VBVA 4F99A 1XJDA 4I22A 4LL0A 2VTIA 3DKFA 3KRXA 2WQMA 3OCBA 4BIDA 1P2AA 3LFQA 4CVAA 4KKGA 5CSWA 4F9CA 3EQRA 5I9XA 1NVRA 3OCSA 1CTPE 2WMSA 4GL9A 3PE1A 3D4QA 5EQEA 2QG5A 3D5UA 3ZXTA 5AM6A 3WF5A 2PVFA 1AD5A 1OIQA 3KVWA 2R3IA 3DPKA 2GNFA 3MA3A 5GJGA 3G90X 4GJ2A 3BWJA 3DAKA 1U46A 4EZ7A 2AYPA 2YCFA 2VNYA 2C6MA 3R0TA 2QLUA 2C1AA 4TW9A 1BYGA 3MH3A 4I5CA 3LJ1A 4UX9A 3LCTA 4PDYA 4IB3A 4FYOA 4IX5A 3MH2A 4AN2A 4E5BA 1YQJA 2ETKA 3H4JA 3V8SA 5DT3A 3QGWA 4O7SA 4D58A 4TKSA 5B0XA 3GI3A 4KIQA 4PQNA 4XBRA 3DB8A 3I5NA 5AM7A 4Z3VA 3CJFA 4DGMA 4FIEA 4N6ZA 4FKIA 3QA0A 5EOLA 3KULB 3QKLA 3ID6C 4H39A 4ZJJA 4DLJA 3WZDA 3C50A 4AGCA 3C1XA 2YDKA 3QF9A 4F0FA 1ST0A 4RJ4A 4ZP5A 3TZ8A 4ALUA 3ZO4A 4C4JA 5IA3A 2GHLA 3CC6A 4Q5EA 5EQYA 5F9EA 5DH3A 1YDRE 3UPZA 1Q5KA 5AP7A 4D0WA 3AGMA 5HHWA 3W16A 3UOHA 4AU8A 1KV1A 2BRGA 3DZOA 4YJRA 4NM3A 1U54A 5FTOA 5HE3A 2QKRA 4FL3A 5A3XA 5BPYA 3FKLA 5CAQA 3TUDA 1FGKA 2AC5A 3PTGA 5DGZA 2J0LA 3ZBXA 2X2LA 3F61A 3KA0A 4APCA 3KN5A 3E8EA 5CZHA 2J0IA 2IF8A 2HAKA 4I41A 2GNIA 2IO6A 1JKTA 3F3WA 5AV3A 5IA1A 5CI6A 3ACJA 1VYWA 3IKAA 3QRIA 3UMXA 1OPKA 2R3OA 2ZVAA 3JR1A 4JVGA 4EH6A 1R0PA 4D9UA 4ZLOA 3BL7A 4IAAA 2E2BA 4JQEA 1NT2A 5JEBA 3FMLA 2R3NA 4JNWA 3I7CA 3JPVA 5ETCA 3E92A 2H34A 2OXDA 4Y95A 2HCKA 5E91A 3PXQA 3R00A 5JSMA 2WQEA 4M84A 1ZMVA 2NRUA 4YNOA 4GW8A 4AFEA 3W0MA 1WBNA 3WIKA 1GIJA 2VO3A 2WU7A 3CLYA 3QTUA 4MVFA 4PUZA 5EW8A 4TNDA 5FEEA 4GFGA 3BI6A 2GNGA 2WGJA 4IWDA 4OW8A 3R8MA 5C4LA 4HYSA 1UKHA 3RPSA 3VW8A 3FPQA 5HCXA 2FGIA 2R3KA 4DT9A 5CSPA 3PJ8A 4YLJA 4QMVA 3C4FA 2GFSA 3A99A 3E3BX 2XA4A 3C51A 2BZHB 4FYNA 3O5AA 2UUEA 3BHHA 1X8BA 4DFBA 2BRBA 4KBKA 3D7TA 3KXZA 5HKMA 4G34A 2HK5A 3REPA 1YOMA 2PZYA 4KRCA 4ZLZA 3TG1A 4CTBA 3MI9A 2PWLA 3V5PA 3VUMA 4S32A 2A4LA 3JY9A 4UEUA 4WRGA 4FK6A 4QMZA 3W2SA 2R3FA 1IRKA 3TV6A 3OY1A 3SV0A 4A9UA 3GGFA 4NSTA 2ETMA 3FZRA 4RQKA 3WZEA 3ORNA 4XS2A 3VNTA 4O0RA 5HCZA 3QQUA 3PA5A 4USDA 4F4PA 4I21A 4DH7A 5CZIA 2GTMA 1ZYDA 1U5QA 2W1ZA 2JD5A 3W18A 4HJOA 4AXAA 3QD4A 4AZVA 4CT1A 3FMEA 4I5MA 5HE1A 1G8AA 1MRVA 3AKKA 2OF4A 2QOHA 1FVTA 3DK6A 4FVQA 4XG4A 3CY2A 2HELA 3M11A 1H0WA 2XKFA 2RIOA 3VQUA 5M4IA 4CRLA 1YHSA 4KIKA 3AC5A 1Q24A 2WTWA 4IZYA 3KXXA 1QPDA 2QO7A 5HLPA 3GU8A 4MUQA 1OI9A 2GNJA 4IAYA 1ATPE 2BDFA 3G2FA 4KSQA 2GCDA 4R8QA 5AP0A 1MP8A 4IXPA 3W0QA 4BC6A 2J90A 3CPBA 5CF5A 1OVEA 3FEGA 1VLRA 2CKPA 4NW5A 3ENHA 4Z7HA 4RFYA 3FLYA 5BVNA 3OXZA 3UJGA 3HAMA 2VWXA 3OHTA 4GT5A 2BRHA 2NPQA 3OROA 5DG5A 2J0KA 3HA6A 3K54A 4I6FA 4X3FA 4OAVB 3EQIA 5FD2A 5M4UA 1L3RE 3R01A 2AC3A 1Y91A 1ZMUA 2HZNA 3AD5A 3DB6A 4YTIA 5DFPA 4DTAA 4DEIA 3BPRA 5T3QA 3LKMA 4RFMA 4YZNA 2WFYA 4E4NA 4FTUA 1ZYLA 2R2PA 2WMBA 2Y0AA 2YHVA 4V0GB 3HA8A 5DR9A 1G8JA 3BHTA 4FSTA 4XHKB 3OWPA 3Q52A 3QUEA 5M53A 5ANKA 5IDPA 1W0XC 5K5NA 4DHIB 3FSFA 3PPJA 3ZFMA 3VUKA 1S9JA 2FSLX 2REIA 3UVRA 1VYZA 3IS5A 5A4CA 4H1JA 4HGSA 1H00A 4XRLA 2C0OA 5BVWA 2F57A 2QC6A 1HOWA 4BZNA 3LLTA 3QALE 2WZJA 5EHOA 4G6LA 3DNDA 2Q0NA 2W96B 3P9JA 2CPKE 5I9WA 2DWBA 3HRBA 5IG1A 4UWBA 2YIQA 3O7LD 3TEIA 4TWNA 3H3CA 1KE9A 4IC7A 1H08A 2Y6MA 2RG6A 3KVXA 4RJ3A 4IDTA 4RC3A 4V05A 4C4GA 1H1PA 3O96A 5M08A 2WOUA 3RPVA 3BLQA 4I6QA 3E87A 4DC2A 2F4JA 1FPUA 2XJ0A 3KMWA 4I5PA 5LVNA 3R9DA 2ZAZA 5FTQA 2VTNA 2JAMA 2C5XA 3D15A 2VWBA 2UW9A 5KMLA 3VF9A 4A9SA 1IASA 4YMJA 1PXJA 2C6OA 2VX0A 1NXKA 4G2FA 5BYZA 4CFNA 4FTJA 1MQ4A 1XBCA 3LM0A 4MBLA 4CQGA 4EHVA 5LMBA 3UO4A 4HW7A 4DHFA 3MTFA 4BTKA 4DCAA 2ZB1A 4M69A 5F4NA 5AWMA 2DYLA 3ZO2A 5CEPA 5CQUA 3QRUA 3HMOA 3SOCA 3NUXA 2ZJWA 2W7XA 3CP9A 4FZFB 4NIFA 3IW7A 4PPCA 1T45A 4XX9A 5HESA 3V5LA 3I6WA 5B7VA 4ZSLA 1WFCA 5HEZA 5I0BA 2HZIA 3OT8A 4U44A 3SG9A 2IEWA 4D4YA 3OEFX 1U54B 4B7TA 4YGAA 5CNNA 3COHA 3BGZA 3U51A 1Z9XA 2VTAA 1SNXA 4WD5A 5J1WA 3O2MA 5EKOA 3QZGA 4XG6A 4XP3A 3EQDA 4LM5A 1GAGA 5FWKK 3BHVA 3V5TA 1OGUA 2GSFA 4QMNA 4N57A 4I4FA 3NUYA 3E64A 5JFSA 2KTYA 4I92A 2X39A 2G1TA 2ONLA 3D2KA 5LMKC 3I5ZA 3I6UA 3MY5A 3UODA 3ZHPC 4BCMA 5AR7A 3GOPA 2X7FA 2XRUA 4PPBA 5CU6A 2R0IA 4FKVA 5HTIA 5L8KA 2XAOA 5FM2A 4ZSEA 2JGZA 2JIVA 4FNYA 5L3AA 4X6RA 5IUHA 2CNQA 3Q4CA 4G6OA 3WF8A 1GZ8A 4PMMA 3GCUA 4O4BB 4YURA 4C61A 3IW6A 2IW9A 5TF9A 3R9OA 5C01A 3F5GA 5CEQA 3ULZA 3VRYA 4A9YA 3LFAA 2FYSA 2VV9A 3AQVA 4ZIMA 4ANBA 5HVKA 3FL5A 3W55A 4BVUA 4IANA 3D7TB 2RFSA 4WG3A 4DYMA 4KSPA 4TYGA 2XYNA 4MNEA 3Q9YA 4U0IA 4W4XA 3PLAE 3FYKX 1LR4A 1XQZA 4W4YA 5E8VA 3GUBA 5HVJA 4ALVA 4RX5A 4FL2A 2PMNX 2UVXA 2UZVA 5HTCA 4ZS4A 4BCHA 4DDGA 4WNKA 3TNPC 5ANJA 2XM8A 4DFXE 3PYYA 2X1NA 4FKGA 1V1KA 3CQUA 2XUUA 4J95A 4YZCA 4ZTSA 5CF4A 2WHBA 2WU6A 4NWMA 3LCSA 2XF0A 1H1RA 3UTOA 2QR7A 4BICA 4G3FA 5BUIA 3ZZWA 2C5NA 3N4VA 3G33A 4CCBA 4KIKB 3E93A 3W2RA 3RAHA 4EORA 3IPHA 4C4HA 4EH4A 4O4EA 2VNWA 4QQ5A 5D41A 3DXQA 4FSZA 4O22A 4ASXA 4O7RA 1WVYA 4FVPA 5AJQA 1H1WA 1KUTA 4UWCA 3QHWA 1OBDA 3EH9A 4LV8A 3TN8A 4MBIA 3F9NA 4N6YA 2BDWA 2JC6A 2WPAA 5IQBA 3ALOA 2C30A 1PMNA 1FVRA 3FZSA 3ZEPA 5HNGA 2H9VA 4X3FB 3W32A 2ERKA 4ASEA 4EOSA 1M14A 4U41A 2ITOA 3CTQA 4PL4A 2VTJA 5CU3A 4QPMA 2YEXA 3ORLA 3MFUA 1YDSE 2BIYA 1P14A 4OT5A 3L9LA 2W1EA 5AR2A 5FUTA 2PZPA 2W1IA 4YP8A 4ACHA 3BHUA 1ZMWA 2WB8A 4FV3A 3VQHA 3HUCA 2J9MA 1Z5MA 3NW6A 3AMBA 4XMOA 1GZNA 2UW3A 4Y83A 4C62A 3FL4A 3OBJA 3WBLA 4WHZA 2RG5A 3PRFA 4C35A 5KMMA 4RSSA 3NFFB 1FQ1B 4V04A 5GJFA 4WRSA 2OG8A 4CKIA 4D55A 3O7LB 3VS1A 1RDQE 5FBNC 3Q4TA 1J91A 4ID7A 4F6WA 1PXIA 3RJCA 5KBQA 2Y4PA 3I7BA 3PSDA 1XR1A 1J7IA 4O7ZA 4FSRA 4EK4A 3NEWA 5LVMA 4R3CA 3FKNA 3PA3A 2DS1A 1H0VA 4K6ZA 3QHRA 3BE2A 4F78A 4FIHA 4QO9A 4YJQA 2QOIA 3OUKA 2J5EA 4RC2A 4QP9A 4EZ3A 1Q62A 4O0TA 4FTAA 4ITIA 4C37A 5M4CA 3R73A 3WYXA 4A7CA 5JGDA 5HO8A 1ZLTA 4I0RA 2GQSA 2FA2A 1G5SA 1JBPE 4PMSA 1JAMA 3BBWA 2O64A 4IFCA 4XH6A 2XIRA 2JIIA 5TE0A 4BFMA 4EBWA 3ZFXA 3GQIA 4J96A 4GV1A 4M69B 5LVOA 1BI7A 2ESMA 2WELA 1GNGA 1QMZA 3P08A 5EI2A 4CLJA 2QOCA 2W4OA 4BDBA 4YHTA 3ZLXA 2OIBA 4FKQA 4BWXA 3LJ0A 2X81A 4BTMA 5HIEA 2CCIA 4NIFB 3V01A 3W0NA 4L44A 4MD7E 2OXYA 5EM6A 4XV2A 2C5VA 2E9PA 4RIYA 5IQHA 1KE7A 4PTCA 2B9JA 2X9FA 4TRLA 4JX7A 4WG5A 4DEAA 3UDBA 2NNWB 4DF3A 3HDMA 3ZXZA 2XKEA 4MHAA 4OUCA 1H27A 1PHKA 4K33A 3TNWA 4CTCA 3OS3A 4A9RA 3NNUA 4W8DA 1W8CA 3MYGA 1PMUA 3DBDA 4BCGA 4C58A 3H9RA 4D2WA 1YRPA 4GUEA 1ZARA 4TYJA 5M07A 2ITNA 4AG8A 1RE8A 4DLIA 4ZSAA 2C6IA 2QR8A 3FQEA 4Y5HA 3RWQA 5K3YA 5L2SA 3BU3A 5F20A 1IG1A 3LQ8A 5AA8A 1V0OA 2UZLA 4HYUA 3TUBA 2VTTA 3KXGA 3MW1A 1UNLA 3OMVA 5EDPA 3HKOA 3VHKA 2CN5A 4EQCA 1F3MC 1Q99A 2LGCA 4A4OA 2PPQA 4O7YA 3FHIA 2AEGA 3V6SA 4PDOA 1KSWA 4HVGA 1A9UA 5KMKA 3CKWA 4FTNA 1LUFA 3K3JA 4U3ZA 4QMMA 5GJDA 3ZUUA 5HBEA 5I3RA 3QCQA 3PY0A 4Z55A 2PVJA 4Y8DA 2I1MA 4U9AA 4R77A 4FK3A 4MAOA 5LXMA 4IB5A 3KN6A 2PUUA 4TWOA 5E8ZA 4DA5A 1XO2B 5HGIA 2XMYA 2OSCA 3QX2A 4YO6A 3NUPA 4YJPA 1UU9A 3GCVA 3QGYA 3SQQA 4EK6A 4FKRA 4HZRA 5ETIA 5CEKA 2XKDA 5EDQA 3P23A 4MNEB 4DH1A 4FIIA 4I0TA 2PYWA 3P4KA 2QOFA 1H24A 3UIXA 3E8DA 4G3CA 3SC1A 2VGPA 3NSZA 2VO6A 2Y4IC 5DOSA 4F6UA 2JDSA 2X4ZA 4DCEA 3F69A 1ZRZA 3N4TA 5H8EA 4L6QA 1REKA 2W05A 2EWAA 4C34A 3NAYA 1PKGA 4RMZA 3SHEA 3DJ5A 2B0QA 3DXPA 3F2AA 3A8XA 3VJNA 3FC2A 3LPBA 4D2RA 2QOLA 4WO5A 1YDTE 4QTBA 3GU5A 1IA9A 3MIYA 4MF0A 3QUPA 3ZLYA 4XG7A 5AUZA 4HNIA 3GU4A 3MPAA 4XRJA 5BQ0A 5BYLA 1JSTA 3PRIA 1UNHA 4BCOA 2X0GA 3TJDA 3OOMA 4AWIA 2A2AA 3V5JA 1YXUA 4FL1A 4H3QA 4L46A 5AIRA 5ANIA 3DZQA 3LQ3A 4WNMA 4RA4A 3BV2A 3E88A 2QU6A 1U4DA 2YLFA 3BELA 2BR1A 3LXNA 4FSUA 2BVAA 5E8TA 5ETAA 1R0EA 1P4FA 3HX4A 3VBYA 3AKLA 3OZ6A 3POOA 4K8AA 3VW6A 3NLBA 4DE4A 4WA9A 3UOJA 3MS9A 5BVKA 4R78A 1OB3A 3B8RA 1WBTA 3MVLA 2GTNA 1BL6A 4OTRA 2IG7A 3JY0A 1KE8A 2R9SA 3WZKA 4DINA 3TM0A 3I0OA 4RX7A 2BHHA 5LCKA 4BCFA 4I5HA 4C0TA 2CNUA 4UWYA 3RPYA 4QMXA 5JFWA 2J7TA 3Q9XA 3L9MA 4K2RA 5T6KA 2Z02A 5M56A 4FT7A 4QYFA 3EFKA 1ZOEA 4PNIA 5M4FA 3FQSA 4M66A 4DAWA 4F0IA 4CKRA 2VRXA 1OUYA 3CR0A 4EJNA 3UIUA 4EOIA 3QQHA 4BCNA 4D4RA 4F7NA 2IPXA 2PMOX 5HIBA 5J1VA 3TKUA 3UZTA 1CKJA 3R8LA 5CXHA 4O2PA 2VTQA 3E63A 2ACXA 2BFYA 4UALA 3KKVA 1PYXA 5JFXA 3N51A 4JLCA 4LUEA 2WAJA 1O6YA 4MK0A 4DH5A 4R1VA 3UVQA 1TQMA 3MVMA 5AX9A 3QL8A 3VRZA 2FO0A 3WF9A 4BWKA 5KCVA 3UYSA 2DUVA 2OJ9A 4JBOA 4U43A 3M1SA 3I81A 4AZEA 3FAAA 1TVOA 2PSQA 4XP0A 1URCA 4U6RA 4YZBA 3NFGB 4NEUA 1Y6AA 1QPEA 1YWRA 4MD9E 4MXCA 3NYXA 4MYGA 1UA2A 4YZMA 4C4EA 4JG7A 4KA3A 3IGGA 3L8SA 3QKMA 3U9NA 3U87A 3R22A 4JIKA 3A4PA 3EFJA 4FIJA 3TNIA 3Q2JA 4M13A 2B9FA 4FG7A 3IGOA 5AR3A 3RAWA 1HCLA 4CT2A 4PP9A 5LMKA 2XH5A 4M14A 3MVHA 2WTDA 2GFCA 4MXOA 4GU9A 1OKYA 4WSQA 2PY3A 5DVRA 3S95A 4CFUA 3D94A 3DNEA 4NFMA 4H58A 5K4JA 3RAKA 2WTCA 4CG9A 3EOCA 4EHZA 4YNEA 3UQFA 1ZZLA 4Q9SA 4WSYA 5D7AA 4BIBA 5I5ZA 4LQMA 4V0GA 1OKVA 4ARKA 2PMLX 5IUIA 3DAJA 3GFEA 4C4FA 3HECA 2C47A 5HNIX 1BX6A 2W1HA 3FV8A 4KINA 4I23A 3EQCA 4EL9A 2EXMA 4FMQA 4RIYB 4EH2A 5E92A 4RVKA 4LGDA 3Q04A 2QOOA 2ZYBA 3II5A 4I4EA 3FI4A 4TXCA 3BU5A 3VIDA 4HNFA 3W10A 5J8IA 2I0HA 3HMMA 5FLFA 2JBPA 3THBA 4ZTLA 4MTAA 4IH8A 3LFCA 3VVHA 4IB0A 5KUPA 4RJ8A 5AUUA 3W2OA 3BLAA 2RSVA 2X9EA 3OTVA 3OUNB 2BZKB 3HEGA 2C68A 1QPJA 4YZ9A 3VN9A 5IQCA 5JMSA 3V5WA 5HQ0A 4QP3A 1WMKA 1DI9A 1XHAA 5AAFA 4Z9LA 4IWOA 5HG9A 1CKIA 1WBOA 3GQLA 3QTZA 4JDIA 4OTDA 4P90A 4QNYA 4G6NA 5AFVA 3F2NA 3GBZA 2XIZA 2XNGA 3VUIA 2RGPA 4PY1A 1BLXA 3I4BA 5CANA 2EU9A 3MH1A 4IW0A 4LL5A 3U8WA 2CKQA 2EXEA 3PFYA 1JSUA 3KK9A 4RRVA 3WE8A 2B1PA 1BUHA 4X2NA 3VS4A 2Q83A 3ML1A 5A6OA 3RWPA 1PMEA 4U80A 3EZRA 4IM3A 2CLQA 3QRKA 3R63A