5K5NA

Crystal structure of gsk-3beta complexed with pf-04802367, a highly selective brain-penetrant kinase inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
347
structure length
331
Chain Sequence
KVTTVVATPGDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQNRELQIMRKLDHCNIVRLRYFFYSSDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycogen synthase kinase-3 beta
publication title Discovery of a Highly Selective Glycogen Synthase Kinase-3 Inhibitor (PF-04802367) That Modulates Tau Phosphorylation in the Brain: Translation for PET Neuroimaging.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 331
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5k5nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5k5nA01
2VTNA 3M1SA 3QQGA 4KKGA 4F7LA 3OS3A 4RJ6A 4BIBA 3NUSA 4FBXA 2NP8A 3AC8A 4BGHA 5CSWA 1OKVA 1UU7A 5ANOA 2JKOA 3EN5A 1GAGA 4ALWA 3DGKA 2OI4X 2XCKA 1CSNA 3OG7A 5DPVA 4DE4A 1W0XC 2XM8A 1H0VA 3NNWA 3LFDA 3FQEA 4P7EA 4AFJA 4AT3A 3F5XA 3LW0A 3QFVA 5HCYA 3KREA 3LKMA 5IQFA 3WARA 4E4MA 5EW3A 4WG4A 2C0OA 3NDMA 1PXNA 3ACJA 1Q8ZA 4A9SA 4AU8A 1E1XA 3UNJA 3UZPA 2BFXA 3PJ2A 1CM8A 1WBSA 2G2IA 4R1YA 1KOBA 5D9HA 2B52A 4ANNA 2R0IA 1PMUA 4F6UA 3KCFA 2PVFA 3D83A 2WOTA 4ITHA 3EL7A 4X2KA 5CEQA 2PE1A 2JKKA 4FI1A 3SG8A 2UW7A 1QL6A 1ZYSA 4FV1A 3VS2A 4JQ7A 2W1CA 1CKPA 2IVUA 4OTPA 5HG8A 4IEBA 5H2UA 4FVQA 2EVAA 1RJBA 3G90X 5E90A 5E9EA 2GNLA 3BHYA 4U8ZA 5IEYA 3FXWA 4FNWA 1MP8A 4FEVA 1WMKA 4J99A 4EH4A 4EHEA 4GVJA 3S95A 3PPKA 3PY1A 4YURA 5HD4A 4WUAA 4OTDA 2BAJA 3FI8A 3QTXA 5IEVA 3HVCA 4FKWA 4RWJA 3TKIA 2B9FA 4D4VA 3HRFA 3L8VA 4BDJA 1R3CA 4C02A 4QTEA 2GNFA 4O21A 1KUTA 3NUAA 4CRSA 4PPBA 4HVIA 1YKRA 1NW1A 2WMXA 4IX4A 4TYEA 2V55A 3FL4A 4DHFA 3HMNA 3EFLA 1VJYA 5BVOA 1U4DA 4M0ZA 3KK9A 3UVRA 4FKPA 4BRXA 4MNEA 3GB2A 1F5QA 3NMUF 3EJ1A 1OB3A 5KMMA 5GINE 2QLUA 4D5KA 3U8WA 4I93A 5FTQA 3MW1A 1UWJA 5HNBA 1JAMA 2Z7LA 4FKRA 3BGQA 2ITNA 3MBLA 1R78A 2BHHA 3BYUA 2Q0NA 2WMUA 4CQGA 4FSYA 2JKMA 5LOHA 2OIBA 5CVGA 3FJQE 3IOPA 3IW4A 5DN3A 3DTWA 4I4EA 2J9MA 3QCXA 4GFMA 3OT3A 3TTIA 2QVSE 2Y6OA 2HIWA 4G2FA 5M06A 2XBJA 3LFSA 2EXMA 5AIKA 3T3UA 3OC1A 4EI4A 1FOTA 4GU6A 4RMZA 4DCAA 3OBJA 1WAKA 1PW2A 2XF0A 5IDPA 5ANJA 4TPTA 5HIBA 3RMFA 4MYGA 3VUIA 3HUCA 5HX6A 4W8EA 5CWZA 3TV4A 4RVMA 4K1BA 4JDJA 4QTCA 5E8ZA 3V3VA 1U5RA 4YTCA 5JH6A 1SVGA 4F1OA 3CKWA 5C8NA 3S1HA 2UVXA 5EM5A 1YXUA 1X8BA 3PLSA 5KHWA 5AAGA 2WOUA 2HWOA 3RTPA 3U4UA 3QQLA 3O71A 4C4FA 2O64A 3FYJX 2GU8A 2XA4A 3CD3A 3NLBA 2GNGA 5DA3A 4DH8A 4G6OA 2VV9A 4L3PA 1H25A 4RIWB 4NJDA 3U9NA 3WBLA 1S9IA 5B2MA 1BYGA 5AR7A 5DR6A 3O51A 5M56A 5KMNA 5BMSA 2Z2WA 3BE2A 4AA0A 5HORA 2HENA 4UMRA 2A27A 5HIEA 2YJSA 4UWYA 4FEUA 3JY9A 5AAFA 5DYJA 2H96A 4IW0A 5HCXA 1T46A 1TQIA 4ZS0A 5E1EA 3PXRA 4MEDA 3RWPA 4P4CA 3AC4A 4ZIMA 3ANQA 3FWQA 3R9OA 3UG2A 2I7QA 2W5HA 1LPUA 3LLTA 1GZKA 1LP4A 4FEXA 2KTYA 4TYJA 4AZWA 5EYMA 3P1AA 2W0JA 4I1ZA 4RT7A 2YWVA 1YRPA 1HCLA 2VWIA 1YDTE 3PZEA 2RL5A 2GS2A 3NS9A 4H3PA 1UV5A 3ETAA 2YN8A 5D7VA 4D2SA 2JEDA 2G9XA 4D58A 2WO6A 2XIYA 5TE0A 5DEYA 2CLQA 3TV6A 3M42A 4YSJA 2FUMA 4A9UA 3KA0A 4X2FA 2VTHA 4U9AA 1VYWA 4OBPA 3FZ1A 3QTRA 3ZU7A 2GFCA 4JL9A 1GIJA 4BKJA 4S33A 4WIHA 3GEQA 2Y4IB 4USFA 3KC3A 4L9IA 3H4JA 3QLFA 4AW5A 4OBQA 4IANA 5A3XA 3PFQA 5HQ0A 3S0OA 4UYAA 3KULA 2YDKA 2GS7A 2I0YA 3JPVA 2EXCX 4FGBA 4CMUA 4HW7A 3U4WA 4XG6A 4NTTA 4IWQA 1V0BA 2P3GX 2WXVA 3VN9A 4XV1A 4HYHA 2WIHA 3RHKA 4KRDA 4AZSA 2BRMA 4JJRA 1WBVA 1FBNA 4NH1A 2NNWB 4GL9A 4HYIA 1KOAA 5CAQA 3AC1A 2XMYA 3JS2A 5K4IA 1Y8GA 4FOBA 3MIAA 4YLKA 2UW5A 4XHKB 1PRYA 4ANMA 4WNPA 3ERKA 3EL8A 4BCKA 3IO7A 3NGAA 4BFMA 4F64A 5L8JA 5ETFA 3AT3A 5EOLA 2ZM3A 4CEGA 2W9ZB 3CKXA 4E4LA 5L6OA 2VAGA 4P5ZA 5AR3A 1GY3A 4FV4A 3GFWA 4A9TA 4BDHA 4QMWA 4II5A 1DS5A 2OO8X 3MJ1A 4E4NA 5HTBA 1H01A 3RI1A 4AT5A 3PJCA 4ACDA 5HX8A 4V05A 2RG5A 4ZY6A 4ZTMA 3D7TA 2E9VA 4IM3A 4DN5A 4E5AX 4FUXA 4UXQA 5FXSA 3RZFA 2VWVA 3UO6A 1YWNA 4A4OA 2ONLA 4O0YA 4RSSA 3GUBA 5D11A 3TACA 5IISA 4BIEA 4O7LA 4AQCA 2FH9A 2ZB0A 3R7VA 4ERWA 3PG1A 3BHUA 3OUKA 1OZ1A 2F2UA 3HV3A 3E8DA 3PXYA 4G1WA 2XP2A 4N0SA 4V0GA 4ARKA 4PF4A 3UIBA 2R3IA 2PUIA 3QRUA 4J8MA 2PZ5A 4M0YA 2G2HA 1A06A 5CEIA 2G2FA 1SZMA 3ZO2A 1BUHA 4LRJA 3F2RA 4OTGA 2I40A 2JAVA 3RAIA 2ZV8A 2QR7A 5F4NA 2E9OA 3D5VA 4L00A 3H10A 3LXKA 4A06A 2V7OA 5GZ9A 4C33A 4YO4A 2R0UA 3HV7A 3NYXA 1W84A 3DDPA 3OBGA 4NFMA 5EDQA 5BVKA 3BU5A 4C61A 2GFSA 4ENXA 3KF7A 4EOIA 2ZM4A 3AT2A 3QUDA 2YIYA 5I3OA 4C59A 4DT8A 3A8XA 3NYNA 3WE8A 5IPJA 2BRHA 3VC4A 4EZ5A 4FKOA 4QTAA 2GSFA 2YISA 4MBIA 2X7FA 4D2WA 4DEDA 2GDOA 3BGPA 3KK8A 3QWJA 3VW8A 3D5XA 4RLLA 3KY2A 3ZXTA 3FQSA 1Z57A 2JDVA 4FSRA 3SLSA 3IDBA 2C5VA 2PZYA 4LRMA 3R9NA 3LMGA 1VR2A 2WU6A 3FL5A 3QKLA 4ANQA 1OUYA 2R3NA 3QTSA 1F3MC 3BKBA 3C0IA 4FT7A 1XO2B 3Q6UA 4C3PA 4EBVA 4CKIA 3SXFA 2QOLA 3DTCA 4IAKA 1Q8TA 1NVSA 1RW8A 2ERZE 2YEXA 2WU7A 4IFGA 4PDPA 3ROCA 4LGGA 4LM5A 3A4PA 3ORMA 4YZMA 5FP5A 4JX3A 3MPTA 1Q24A 4S31A 2UW0A 4GJ3A 1KE8A 4M14A 5EQEA 3JXWA 3O7LD 5A4TA 1OPLA 2ZM1A 3DCVA 4OAUC 4IAIA 3WILA 1Q99A 4PNIA 4EQCA 2B4SB 3WYXA 3ZSHA 1Q8UA 1GZ8A 4FTOA 3I81A 4I5MA 4DEAA 4NL0A 4FICA 5CU0A 4JG8A 5IQHA 5CVHA 2R3GA 1EH4A 4FTTA 1SYKA 4BZOA 3OXIA 4DEIA 3PYYA 3TZ9A 4BZDA 2R2PA 1M17A 3QA0A 4RG0A 3QZGA 5HBEA 1M52A 4QP7A 4ZTNA 4ZJJA 1G8SA 1H1QA 3R9RA 4R5SA 3SV0A 2XIRA 4O7YA 1R0PA 2DS1A 3VUDA 3W32A 3EQIA 5JN2A 2PVNA 3V5JA 4QYHA 2RSVA 4USDA 3QBNA 4N57A 4FNZA 4JG6A 5DRBA 4ZZNA 4HPTE 3BWFA 1S9JA 1TKIA 2KULA 2Y6MA 4QMZA 3R7EA 3P78A 3MA3A 3PE1A 4JBOA 4JDIA 2CGVA 2J0IA 4HOKA 4WSYA 3V5QA 4RX5A 5AM7A 2QURA 1OGUA 2WTKC 3F7ZA 5BVFA 2OH4A 1OPKA 3CR0A 4PPCA 3F5GA 3R71A 4YLLA 5TOZA 3THBA 4W4XA 3POZA 2C3JA 4L43A 2XKEA 3TZ8A 3Q6WA 5EYKA 1JKSA 2X9FA 5EHYA 2RFSA 2X1NA 5LVOA 5F20A 3SHEA 3HP5A 2OLCA 5IUIA 3UMWA 1F0QA 4WA9A 3CGOA 2I0HA 3SXSA 2B55A 2OFUA 3IONA 4QMXA 4BYIA 2RFEA 4J97A 5JRSA 3ZZEA 5BX0A 3WI6A 5C8MA 5HE0A 5EI8A 3NNUA 4Y83A 5LCJA 4H3BA 3H30A 3QTUA 4CGAA 2Q0BA 4RC2A 5A4CA 5BVNA 3R8MA 4AFEA 4HCTA 4S2ZA 1PKGA 3SDJA 4UV0A 5J1WA 5HZNA 1YXTA 3EFKA 1J7IA 1Q97A 3O8UA 4ORKA 2W06A 5H8BA 4LUEA 3ZDUA 5JSMA 3KN6A 4IDTA 4R3RA 2OG8A 5C27A 5C1QB 4EZ7A 1ZOEA 3JY0A 3TNHA 3V5LA 5IUHA 2C3KA 4PV0A 4L6QA 2W1ZA 2XIXA 1PY5A 3QL8A 4UZDA 3QC4A 3TEIA 2Y4IC 3OY3A 3QA8A 1HOWA 4IB0A 3IOKA 4MQ2A 4MBLA 4XV2A 4NKAA 3WIGA 5LARA 3IW5A 4NM3A 5CVFA 3I6UA 1ZMVA 2GPHA 4ZSJA 1JWHA 2LGCA 3SAYA 5IF1A 3JYAA 3FAAA 5LCKA 3COMA 4EORA 4CKJA 3ORZA 4I5PA 4X3FB 4DH7A 5IA4A 4E6DA 2CKPA 1Q5KA 3IQ7A 4HNFA 4FKSA 4XBRA 1BKXA 4M97A 3HL7A 3RBWA 5DT0A 2QHNA 2DWBA 1WFCA 2PVJA 2X81A 4PMSA 3F3TA 2W1IA 1UU3A 3DKGA 4K11A 4OTHA 2GHMA 4WNMA 1K2PA 4LGHA 4FT5A 3VUHA 3GU8A 3MFRA 5J9YA 4PL4A 5DIAA 4TYHB 2B53A 4JQ8A 3UPXA 3TKHA 2GMXA 4QMOA 2Y9QA 4PNKA 1Y6AA 4TWPA 3QHRA 1U5QA 3ORLA 4FVRA 3PTGA 2C0IA 2QU5A 5HE1A 1IR3A 3RCJA 3UC4A 4BDIA 5B2LA 3EIDA 4O7VA 3A62A 2PVLA 4QYFA 3ACKA 3BQRA 1J1BA 4XX9A 2OZOA 4G31A 5CF5A 1XH9A 4ZTRA 1NXKA 2P55A 5KMLA 3TIYA 4O6LA 3R7IA 4I22A 3JUHA 2YHVA 3ORPA 2EUFB 5IDNA 4I6FA 3GENA 4ACCA 2R4BA 1K9AA 4FTRA 4HGLA 4LUDA 2A4LA 1JNKA 5ANDA 2QKWB 3I1AA 4GJ2A 2R3KA 3QD3A 3FZRA 4I92A 4HGSA 5CX9A 3KL8A 4EKKA 1W82A 5AP4A 2YACA 3MVMA 4DFXE 2YDIA 2ZVAA 4Y46A 2UW3A 1KE6A 3C4XA 3ZFYA 5M08A 1DI9A 3OF0A 5B0XA 3TN8A 4AZTA 3EWHA 2W1HA 3O23A 2CKOA 2Q83A 3WF6A 1T45A 2V5QA 4U43A 5HO7A 3QCSA 1MRYA 4FZAB 1ZY4A 5KCVA 5E8YA 2XJ0A 4HVDA 3FV8A 4FX3A 3RKBA 4F1TA 1YHWA 3ZRKA 4KIQA 5BYLA 4J8NA 4JG7A 2X4FA 2VTAA 5B2KA 5HO6A 5EOBA 3U9CA 1O6KA 2C6DA 5KMKA 4RFMA 1OIYA 2JD5A 4MKCA 2JDTA 1P5EA 2R3PA 2VU3A 3L9NA 4OTIA 3RPRA 2VO7A 3PJ3A 2G1TA 4NIFB 4K0YA 4GYGA 3GCSA 3ZONA 3POOA 3DJ6A 4YJOA 3HUBA 5DR9A 4Z55A 5ETIA 3VRZA 3OWPA 4J1RA 4PDSA 1O6LA 5G1XA 3V8WA 5GZ8A 4RVKA 4F0IA 2X7GA 3GXLA 2FVDA 3UMXA 5IQCA 4JQEA 4ANLA 4ZLZA 5KBRA 4MXOA 4F99A 3FI4A 2I0EA 3ATTA 3F3VA 4ZJIA 2IVVA 3D5WA 4ACMA 1UNLA 3DJ5A 1L3RE 2QOBA 4O1PA 1RE8A 3E63A 4FOCA 3Q4ZA 1O9UA 3V5TA 5AA8A 3FMDA 3WF8A 2E9UA 2VUWA 3LVPA 2IZUA 4FT3A 1H28A 3R21A 4IE9A 4L68A 2B9JA 3C4FA 3COHA 5CZHA 3H9RA 1OL5A 4FTJA 2J50A 1XBBA 2XIZA 2XNGA 4R8QA 3DNEA 4AN9A 4F70A 4YUQA 4AN3A 1E1VA 3FI2A 2R5TA 3MWUA 3OW4A 5CXHA 4E3CA 2YAKA 2XRWA 4J52A 5H8EA 2WNTA 4OT6A 5LWMA 3E3PA 3QYWA 1CKJA 3MFSA 3RINA 2UZBA 4JS8A 2CNVA 3BYMA 3ZRMA 1YDSE 2W1FA 2O0UA 4C36A 4D2TA 2Z7SA 2ZDTA 2FGIA 3DJ7A 3MB7A 4G5PA 1JLUE 4X2GA 4CT1A 2O8YA 2BRGA 4HVGA 1TQPA 3BQCA 1GNGA 4DFZE 3ORKA 1M2RA 1AGWA 2OBJA 4FR4A 3ZUVA 3BIZA 4DEHA 3OCTA 4L53A 4YHTA 3DXPA 3LQ5A 3DK7A 2P2IA 4E5BA 5AV2A 5HI2A 2XKFA 5K0KA 3T8OA 4AAAA 3SC1A 5HNGA 3DOGA 5T3QA 5IZFA 1WBTA 4NKSA 5F94A 4DTBA 3FLQA 1XHAA 4HZRA 4LMNA 4IWPA 4XG3A 5I9WA 2X2LA 3BEGA 4PDOA 3TXOA 2R3LA 2JKQA 3QZHA 4EQUA 1ZAOA 3N4TA 4JIKA 4FG9A 4ZLYA 4EOJA 2QC6A 2HXQA 4J95A 4ANOA 4AF3A 4ALUA 5AUUA 5M44A 2WMVA 3W33A 1Q8YA 3VBVA 1IA9A 1M7NA 1M14A 3W2QA 1FVRA 3O96A 3G0FA 1YXXA 2XBAA 3VHKA 3GQIA 4GT5A 3FBVA 4CFNA 3REPA 4KIKA 3TM0A 3A61A 2QOHA 5L8LA 3UODA 3KMWA 4OT5A 4BWPA 5TKDA 5HVJA 1P4OA 2Z7QA 2W7XA 3DV3A 3EQGA 1ZYLA 3GVUA 3VS0A 5C9CA 4YSMA 3LQ8A 1YDRE 4FKGA 4J7BA 3R8PA 3V5PA 4QQ5A 2GNIA 4FKJA 2OZAA 3NWWA 3FPQA 3ATSA 4GCJA 3UQGA 4NJ3A 2OU7A 2I6LA 3DFCB 1Y91A 4YR8A 2O63A 4YO6A 5HESA 1H4LA 3DDQA 4KB8A 3UTOA 4ZY5A 4IHPA 3MYGA 2YA9A 4FL2A 4IVBA 4C3FA 4EH8A 3ZMMA 3IECA 5DRDA 3HV4A 5HG9A 1ZLTA 1PXPA 4AA4A 2W96B 4K9YA 2WQEA 5KE0A 5DHJA 4NZWB 3KXNA 3LCSA 3RPYA 4AXAA 3FZTA 4DH5A 3IPHA 3A4OX 2ZV2A 5IMXA 5M4FA 1PXOA 1SVEA 5A14A 4Y5QA 3FLSA 2OXDA 3JVRA 3P0MA 4NT4A 3DAEA 2WQMA 5KZ0A 4EOPA 1OPJA 3A8WA 3PJ1A 2CSNA 1Y6BA 2R3QA 3BRBA 3EQFA 5EHLA 2HELA 5FUTA 3WE4A 5E8UA 3VBWA 1GJOA 3LXPA 3PJ8A 3AT4A 5DH3A 1PXMA 5E8TA 5ETAA 4MBJA 3EQHA 5JFSA 3P79A 3I5ZA 3DZQA 2BDFA 3GU4A 3MVHA 4FV7A 4DAWA 3JVSA 3TTJA 5DWRA 3FMNA 3HV6A 3NPCA 4RWLA 5J87A 4PUZA 3FKNA 1NVRA 4AZVA 1ATPE 1NA7A 3OUNB 4F0FA 4CLIA 4L8MA 4RIXA 4UMPA 5EM7A 5LJJA 3MY5A 4W4WA 2O3PA 4XP2A 4ID7A 2XH5A 2WB8A 4YJUA 5FBNC 3LXNA 4CKRA 4EK4A 4KIOA 4FTQA 4HGEA 2AYPA 3CJFA 4G3DA 1WZYA 4J71A 1OITA 4ZP5A 3L9MA 4G3FA 3SX9A 4BL1A 3R7GA 3CE3A 4RIOA 4EWQA 5AADA 3EYGA 3PVUA 5HTIA 2BKKA 3HA6A 4IBMA 4U40A 5CENA 5LVLA 1PKDA 2PWLA 4YTHA 4Q5HA 4GK2A 3LHJA 4CTCA 5AP7A 3GP0A 3PUPA 4U7ZA 3CBLA 5DG5A 2OW3A 3IW7A 4RX7A 1ZWSA 4WG3A 3PY3A 4BDAA 4F9YA 3U55A 3BYSA 3LFEA 4HCUA 4AGDA 3GC9A 4C2VA 5CF6A 2HYYA 2BHEA 2ZAZA 2YM6A 3IG7A 3QF9A 4FUYA 5L6WL 2NPQA 5H8GA 3PE2A 4G9RA 4U6RA 4UY9A 4CLJA 1H26A 3M11A 3SKCA 2EB2A 2PMLX 1UWHA 2ZMDA 4BGGA 3ELJA 3IS5A 4FK6A 2VN9A 4RVLA 3LJ2A 3SOAA 1LUFA 5ANEA 1BI8A 2WMWA 3BV3A 2LAVA 4AWIA 2BRNA 2RFNA 3F5PA 4LGDA 4XP3A 4Y85A 4BDGA 1OI9A 2ITUA 4NYEA 5CF4A 3HDMA 1JKKA 4KS7A 3CQEA 5DFPA 4LFIA 4UB7A 1GOLA 3C4ZA 3KFAA 4R3PA 4YJNA 3A7JA 1TVOA 4IIRA 4PTGA 3HMMA 1VEBA 1ZOHA 2JIUA 3KMUA 4CZUA 3BPRA 4BTKA 2R7BA 4XRJA 3ORTA 4DEGA 3LE6A 4ZLOA 4FV0A 4FYOA 4DFYA 3PZHA 2HZ4A 2WTDA 5EKNA 4ZTLA 3R9HA 4I6HA 4CG8A 5GNKA 1SMHA 3R73A 4WHZA 4PPAA 1IA8A 2WQNA 3HRCA 4O82A 4WSQA 4LQMA 3UP7A 4UEUA 1OL2A 3EQDA 1ZMUA 4Q5EA 3BHVA 2E9NA 3VUMA 4EQMA 4G3EA 4B8MA 3ZS5A 3IKAA 3LFFA 3TCPA 3PSBA 2PVKA 1XH5A 4X7QA 4O96A 3IK3A 4EKLA 3R8ZA 4EOKA 5KBQA 4IACA 4NEUA 4WNKA 5AP3A 4XG2A 3V6RA 3A2CA 3CPCA 4QQJA 3AOXA 5JGDA 3F3ZA 2R3JA 2X39A 5CEKA 4G17A 4TW9A 4ZSEA 2YJRA 2OICA 4GSBA 4H39A 2IW8A 4R6VA 3W2RA 1R1WA 3PPJA 1ZMWA 3Q4TA 2C1AA 2J0LA 1FVVA 2HZNA 3A60A 3AMBA 3CTHA 3E87A 4ZMEA 2ZV7A 4I23A 4LV8A 4U44A 4ASEA 2YCSA 3QD0A 3S00A 3P9JA 4XG8A 3FZSA 4O83A 3NAYA 3S3IA 3BE9A 5LVMA 2C47A 1DI8A 4APCA 3U6HA 1OBGA 2ETKA 3Q04A 3UE4A 1A9UA 5J9LA 3VS6A 4ZMFA 4EONA 2ZJWA 2VGOA 4O38A 3GGFA 4O0RA 1H24A 4X0MA 5FXRA 4WKQA 4I41A 3WZJA 2I1MA 2IG7A 1NT2A 3R01A 5A46A 4YZNA 3MS9A 4FL3A 2WTJA 3FPMA 4KINA 1Y57A 3WZDA 3D7TB 4U80A 4UWCA 4KAOA 3D7ZA 2WEVA 2Y4PA 3Q9XA 5FEEA 1YXVA 1ZYDA 3OVVA 2OGVA 1AQ1A 2ERKA 4UZHA 3FZOA 3QZIA 5EW9A 2X6EA 5CI7A 4LOPA 2WEIA 2H8HA 5BQ0A 4C4EA 3C5UA 4KRCA 3OTUA 5D12A 4DTKA 4FTIA 4F09A 5I3RA 3L8SA 2IZTA 2BZKB 4D1ZA 5TR6A 3KQ7A 2V22A 3VAPA 4AA5A 4E1ZA 3KEXA 5KKRC 3OEZA 3RNYA 2VO0A 4EWHA 2YM7A 4RZWA 5L2TA 1OECA 2F7XE 2VTTA 3BLHA 2UZNA 3FMLA 3CLYA 3GC8A 4WRGA 3RNIA 3MN3A 5L4QA 2VD5A 3ZO3A 4G34A 2UZUE 2VRXA 2GNHA 5FM3A 4EOQA 2YERA 5GJFA 2XB7A 3WZUA 4C4GA 3MV5A 2QODA 4Y72A 2BTSA 4G9CA 5HKMA 4QP4A 3V01A 1YOLA 4C58A 4AGWA 2Y8OA 2CJMA 2C6MA 4EH7A 1GIIA 4F4PA 4FZDB 2QCSA 4OLIA 4BCOA 4DLJA 2VTQA 1LR4A 4CZTA 4RC4A 1YOMA 3NVMB 5DE2A 5AUZA 1YI3A 3PRIA 4AW0A 4OBOA 4TYIA 4CFMA 2J7TA 2JC6A 4KIPA 5D41A 3VF8A 5EDRA 3KVWA 5H9BA 3C0HA 2HK5A 3TDWA 2H6DA 4PTCA 5IG1A 4CYJA 5E4HA 4O84A 5A4EA 2OJ9A 3H9OA 4G5JA 3CY3A 4NCTC 4A07A 4M7IA 4AE9A 3I0QA 2JIVA 1PJKA 3ZO4A 1G8AA 4QPMA 3NUXA 2VO6A 3NUNA 4EL9A 4DT9A 4O7NA 5HBJA 4QP8A 3FLZA 3QQFA 4EC8A 2BDWA 2VX1A 4L3LA 3ULIA 4BKYA 3V6SA 3G2FA 4YGAA 2O2UA 4HCVA 2IJMA 4ZTHA 4C2WA 4CVAA 4BR3A 4BC6A 5L6PA 3EN7A 1KWPA 4KD1A 1SNXA 2IVTA 2PE0A 3OTVA 4DC2A 4FZ6A 4GT3A 4YJTA 5A9UA 2AC5A 1OL6A 2X8IA 4XV9A 2GNJA 4L46A 4ZXTA 3ZBFA 4HGTA 4P90A 2YCFA 5H3QA 3A99A 3GU5A 5TO8A 4EOMA 4TNDA 4DFNA 3CY2A 4GG7A 4MNFA 5HBHA 2QOFA 1Z5MA 4Q9ZA 5DI1A 4RIYA 4DG2E 3QHWA 4JDHA 4R1VA 5IMEA 4GK3A 4E93A 5CF8A 5EYDA 2Y0AA 4H1MA 4I0RA 4EUTA 2UW4A 4YJSA 4LG4A 4ZZOA 4XLVA 3F82A 3E62A 3TG1A 4DINA 4EBWA 4R78A 4CCUA 2REIA 4EEVA 2ETMA 4FV6A 2Z02A 5IA0A 4O7ZA 4EOLA 3DZOA 2XZSA 3O8TA 1GIHA 2YLFA 3PVWA 4U3YA 4IB5A 3F66A 4CT2A 2QNJA 4O0VA 4NU1A 4UYNA 3U87A 1FQ1B 3UQCA 2BZJA 4DG3E 4XP0A 3NSZA 5I5ZA 3HDNA 3KMMA 3R1QA 4FMQA 4FTCA 4NTSA 4NUSA 3LMHA 2PTKA 4E73A 3FY2A 5G6VA 5C8KA 2WHBA 3DLZA 3QAME 3ZC6A 2WKMA 4FK3A 2OF4A 4EZ3A 3AC2A 3C4WA 3D14A 4Z16A 5HOAA 3G9NA 4D0XA 4YZ9A 4KSQA 4YPDA 1QCFA 4D9TA 1OBDA 5F1ZA 4FT9A 4ERKA 5HG5A 4KBKA 4LMUA 4NFNA 1IASA 3VS1A 1B6CB 1RDQE 4TT7A 3KXXA 3DFAA 1XH4A 3VIDA 4BICA 3V04A 3QTWA 4ALVA 3EMGA 3QXPA 4WNOA 5CSPA 1P4FA 2F9GA 3BBTB 4QPAA 3ANRA 3KB7A 3NIEA 3OHTA 3W2CA 4EOSA 4FIGA 5BPYA 3OW3A 1ZZLA 3C9WA 3Q9ZA 3DB8A 4IWOA 5HEZA 2YM4A 5DNRA 3R04A 4RJ7A 4JRNA 2YWPA 4L3JA 4X3JA 4B99A 3I60A 2X2KA 2UZLA 5JMSA 1XBAA 3SGCA 4DBXA 4FIJA 5E1SA 3UVQA 4O1OA 1OUKA 2CKQA 4UWBA 1REJA 5CNOA 4IM0A 4JX7A 3ZSGA 4BDEA 5EI6A 2W1GA 5HHWA 1Q41A 1ZY5A 3DBEA 4BCGA 3GOPA 3Q2JA 3F5UA 5CSXA 2VX3A 3V51A 1FGKA 4AT4A 4QMNA 1W98A 2XNEA 3AD5A 2ITTA 4FIHA 2V62A 4B9DA 3QD2B 4IH8A 3OZ6A 5FG8A 2JFMA 2JDSA 1H00A 1PMNA 3PA3A 3PRFA 3K5VA 3W18A 4FA2A 5EK7A 3ZO1A 3QKMA 3QTZA 4CCBA 5IQEA 2HW6A 2OJGA 5HVYA 4M12A 3MTLA 3MESA 4YMJA 1FGIA 2WAJA 4ZSAA 3HV5A 2XEZA 4FSUA 5AP6A 1DAYA 4OTWA 3Q2MA 4BDCA 2XIKA 3C5IA 3U54A 4X21A 5BVEA 4CQEA 3TL8A 3GU7A 5JEBA 3OEFX 5EKOA 5JRQA 4O7SA 3BCEA 3AMAA 4YZBA 3F7WA 3UYSA 4RA5A 2C6LA 5M55A 4IB1A 3B2TA 1PXIA 4JBPA 4JOAA 2QOKA 2RKUA 4W9WA 3VUGA 5I9YA 3O0GA 4ACGA 3EN6A 5AV1A 4EK3A 3NUUA 2W4OA 4FC0A 4OTFA 3Q5IA 2YITA 1M2PA 4GEOA 3AC5A 4HYSA 4KABA 1OKYA 2A1AB 4UXLA 1GZOA 3TNIA 4D5HA 4J96A 3U51A 4MXCA 5ANGA 5CQWA 5LXMA 3VBYA 2P4IA 4C4JA 4CZYB 2ITZA 4W4VA 4EYJA 4Z9LA 5C4LA 2PU8A 3FSFA 3TUCA 3Q5ZA 5KMIA 3P4KA 1FPUA 3NIZA 2VTLA 5E8XA 3ZUTA 4D28A 4EHGA 1GZNA 3B8QA 3EQCA 4RJ5A 4GV1A 4BHZA 3FKLA 3SD0A 4IX5A 4BDDA 3VWAA 4IJPA 3EN9A 4BVUA 3PIZA 3TUBA 3VBQA 4MHAA 2YCRA 4GT4A 4NM0A 4CFWA 3KN5A 3PXQA 4W8DA 1B38A 1YWRA 2IN6A 3ZLXA 4YC6A 3OP5A 2DYLA 5JQ8A 3PA5A 4JAJA 4C8BA 5BUEA 4RJ3A 3HAVA 3QRKA 1H8FA 3SRVA 2BROA 3F61A 3VO3A 4NSTA 4ANSA 4WUNA 2OJIA 3GNIB 4GUEA 4YP8A 3TDVA 3NCGA 3HECA 3UZTA 3OCBA 4WD5A 4O81A 2R9SA 1KV1A 3UDBA 4O0WA 5IU2A 5HLWA 4Z7HA 5CU4A 3RAWA 1KE9A 2B9HA 3BU3A 3R2BA 3R9DA 3PWDA 3VJOA 3MPAA 4X6RA 3C4EA 3EQPA 1WCCA 4YLJA 4QNAA 4QYEA 5AX9A 4BCQA 2YIRA 5E92A 4QMMA 1CMKE 2P0CA 3DS6A 3MPMA 2W17A 4M69B 5AP1A 5AR4A 1BI7A 1MRVA 4AOTA 4AW2A 1H08A 2BILB 2OIQA 5TF9A 3VS5A 4NW6A 5A4LA 3TNWA 5AP5A 3DPKA 2ETRA 4RX9A 2WELA 2OFVA 4CMOA 3COIA 3OD6X 4B4LA 4NM5A 2QOOA 3AQVA 2QOIA 1CTPE 2F2CB 2VTOA 3R28A 4C0TA 2WMBA 4WO5A 1P14A 3QQUA 3E64A 3MI9A 1R0EA 3LCOA 3VS4A 4I6BA 1YVJA 3UOLA 5FDPA 2IW6A 3GC0A 4PL3A 2PVYA 4B0GA 4DEBA 1UA2A 3W2OA 5ANKA 5C26A 2PZIA 2ITYA 4PMPA 1IAJA 3HA8A 3F88A 3FYKX 1WVWA 1MQ4A 2WMAA 5J8IA 2JBOA 2CGXA 2C0TA 2GS6A 4CTBA 3K54A 4IMYA 3HMIA 3Q52A 2C5OA 3D94A 3CQUA 4JXFA 4CD0A 1XR1A 1KSWA 5AV4A 2HW7A 4DGOA 4D4YA 1PXKA 2YLEA 4DGMA 2C5XA 5FTOA 1WVYA 4H58A 2FSOX 1AD5A 3OFMA 4FEWA 1URCA 2WTIA 3E8EA 3R30A 4ITJA 2J0KA 4APPA 5BMMA 2CPKE 4YHJA 3WF7A 4AZEA 4BCFA 2XUUA 1JSVA 3HMOA 1Q4LA 2XJ1A 2GCDA 3B2WA 4FKVA 3ZLYA 4G6LA 5J95A 4DTAA 1LEZA 4MTAA 4DFUA 2PMIA 2W9FB 5ACKA 2X4ZA 2B54A 4R3CA 5CXZA 3NR9A 2VWBA 2WGJA 4ZK5A 2VWYA 4PMTA 3KF4A 2V7AA 3RM6A 4O6EA 4FIFA 3P7CA 3DBQA 3UC3A 1ZRZA 3KCKA 1L8TA 3LFCA 5FWKK 1UU8A 4RWKA 5M4CA 3WYYA 3ORIA 3FZPA 4F1MA 1ZXEA 3U6IA 4B7TA 4N6ZA 3RGFA 2R3RA 3W2SA 4A9RA 4BYJA 4EK6A 4UALA 4D55A 4TWOA 2VTRA 4EJ7A 3E8NA 3OMVA 4MH7A 3NNVA 3BELA 3D5UA 4Y73A 3C51A 1M2QA 3QTQA 1BL6A 3BGZA 4AOIA 5F9EA 2F49A 2ZOQA 1W8CA 3QC9A 3EKNA 3ORNA 3BWJA 4AX8A 4TYHA 1QPJA 3UPZA 2C6KA 4C35A 3HRBA 4GYIA 3G33A 4K18A 3I5NA 3QRIA 4DGLC 1JKTA 3W10A 2QONA 2QLQA 3I6WA 1OMWA 4YNEA 3CTQA 2PPQA 3NVKI 2XK3A 4KBCA 3MH3A 3TJDA 2XEYA 4WG5A 2QG5A 4BDBA 2PYWA 5D10A 4C62A 2EXEA 5CQUA 4YTIA 4DLIA 1UNGA 3FSKA 2WMTA 3PG3A 4F7NA 5LMKC 2YAAA 2JDOA 2YCQA 2XK9A 4I0TA 2A0CX 2UZTA 3UGCA 4D2RA 4ZOGA 4FV2A 4BIDA 3OCSA 5EHOA 4EK5A 3QGWA 4RQKA 5I9XA 5E8SA 3KRLA 4RBLA 3R83A 1ZYJA 2CNQA 5J7HA 4DBNA 4YHFA 5CLPA 3FXZA 4PDYA 3E5AA 1PYXA 3CIKA 5CANA 4GH2A 2WMSA 1U54A 4PMMA 5ITAA 3H3CA 5CYIA 4DH3A 3KXGA 4AUAA 4QOXA 4G3GA 5DBXA 3WF5A 1A48A 1QPDA 4JAIA 4NWMA 3DKOA 3E7VA 1YI4A 3F6XA 4YJVA 3EFWA 2H9VA 3QZFA 2QU6A 4IXPA 3QQKA 3FMHA 4TNBA 4GMYA 3F3UA 2WTWA 5EG3A 5DT4A 4BCPA 3RK7A 3FMEA 5I9ZA 3FY0A 4C4IA 3BU6A 3FQHA 5KUPA 3RAKA 4IZAA 3W55A 2HOGA 4MXZA 4YC8A 5AIRA 4ZSLA 4MWHA 5E91A 2CNUA 5HU3A 4NIFA 4A4LA 2XJ2A 4TY1A 4O86A 2JITA 3N9XA 2XNOA 4BKZA 3PA4A 2WZJA 5C4KA 4YU2A 1OVEA 3BI6A 2X2MA 5CY3A 3CC6A 1WBNA 4FIEA 4K2RA 3LFAA 3OY1A 3N4VA 3RALA 4EH6A 1FINA 3BYOA 4GS6A 4EHZA 1MRUA 4QTBA 3F9NA 5JT2A 2JGZA 2QKRA 4BB4A 4UMUA 1H1SA 5CI6A 3LCTA 4IFCA 3HP2A 4R7HA 1W7HA 2OXXA 5BVDA 4XEYA 4O7RA 3LFNA 4XG9A 3D15A 4KKEA 3OWKA 4L7FA 3D0EA 4D9UA 4OAVB 3ZEWA 4U0IA 4R7IA 1FMOE 2ITPA 2OK1A 2X8EA 2C69A 4XG7A 2JIIA 2CGWA 3FC1X 2B9IA 4O0TA 4FYNA 2YZLA 4X6QC 2DUVA 4PY1A 2FSTX 2C5NA 1OKZA 4HJOA 4MNEB 4XUFA 3C7QA 4MWIA 3QXOA 4BCMA 4CG9A 2A2AA 2W4JA 1I44A 3QWKA 3UNKA 5J79A 4YZDA 5ETCA 3VULA 4X3FC 4FGRA 3EN4A 5AP0A 3Q4CA 4RJ4A 3WF9A 4FG7A 3QLGA 5AWMA 2G15A 5IA5A 4PWNA 3G6GA 3TV7A 2C6OA 3AC3A 2X9EA 4RPVA 5E7RA 4GVAA 4JDKA 3MH0A 3VRYA 2R7IA 5BUJA 3G15A 2PK9A 5IQGA 2F4JA 2BVAA 2C6IA 4PTEA 1U46A 4TZRA 4IDVA 4DITA 4EJNA 3E3BX 4K77A 5HGIA 3VW6A 3MFTA 5EI2A 4PRJA 2VX0A 3RWQA 2EWAA 5M07A 3RHXA 4IVDA 4F9WA 4H36A 5CU3A 5CAUA 2OKRA 3HAMA 3VF9A 4CFFA 2UZVA 3CPBA 2PMNX 1XKKA 2YABA 4L01A 4RJ8A 3SA0A 2PULA 4ZS4A 3AXWA 4QPSA 2PZPA 1PMEA 4UBAA 5L2WA 1YHVA 1SNUA 3PY0A 5ICPA 3LJ0A 4D1SA 3MH2A 4IAYA 3A7IA 4YJQA 5M4IA 1Q8WA 2PUUA 4CXAA 3ZUUA 4DYMA 3OXZA 4D2VA 1OIRA 5J5SA 3LM5A 4IX6A 4LV5A 3VVHA 4JT3A 5AJQA 3E92A 4QQCA 4A4XA 4FV8A 4IAZA 1JSUA 4QP1A 5A54A 3W1FA 4F9AA 2PVRA 4FKQA 2UW8A 3MY1A 3GI3A 4Y5HA 4F08A 4MQ1A 4EK8A 5M4UA 4DF3A 4D0WA 4KSPA 1LEWA 4XOZA 5KZIA 3F3WA 3R7UA 4U41A 4FNYA 2CCHA 1HCKA 1I09A 5GJGA 4AGCA 5CZIA 2WFYA 2FYSA 5A4QA 3R02A 1URWA 2HXLA 2XYNA 4TXCA 4G3CA 4HYUA 2IW9A 4AS0A 4IWDA 5AUTA 2W5BA 3OXTA 2QQ7A 5EQYA 3DXNA 2HY0A 5JGAA 3C13A 4NCTA 2OIDA 2ZMCA 1SVHA 3QGYA 2ZV9A 4FG8A 4GFOA 4KKHA 5I9VA 4JBQA 4IAFA 1Q62A 2UVZA 3NEWA 4TRLA 4PP7A 3GCVA 3R8LA 3MVLA 5FM2A 5IQAA 4GUBA 2C68A 3A7GA 1DM2A 4O2PA 5IKWA 4BF2A 2YZAA 3WOWA 5IEXA 3DK3A 3EB0A 4IQ6A 3I4BA 3OROA 3T3VA 3KULB 5JFWA 4JVGA 3FI3A 4QQTA 4O22A 4G16A 5AA9A 5BVWA 3PDTA 3NAXA 3PP1A 4O91A 4QP3A 3QUPA 2C3IB 2W05A 4MAOA 4I21A 3ZOSA 3TNPC 1V1KA 4MD7E 2XNNA 1JSTA 3A7FA 1K3AA 1MUOA 2Z8CA 4KUJA 2CN8A 4ZEGA 4F65A 1WBPA 2QOCA 5FXQA 4AW1A 5CEOA 3L8PA 5EFQA 3KRXA 3BLRA 5LWNA 2CKEA 3T9IA 4TKSA 3G5DA 3DAKA 4QO9A 1CDKA 3ZH8A 4C3RA 4TL0A 4M68A 3TZ7A 3HYHA 4X2JA 2ITQA 5CAVA 1UKIA 2UZWE 1UU9A 5GIPE 4CRLA 4QMVA 1TQMA 4BBFA 1UNHA 5CNNA 4FKUA 3ODYX 2WTKB 4MD9E 4YTFA 3H0ZA 3DK6A 4CNHA 3TUDA 2WPAA 4IZYA 3DKFA 3DAJA 5FEDA 5AUXA 4IC8A 4BTJA 4EC9A 4QP9A 3TNQB 4ASXA 5KNJA 4C57A 1Q3WA 1NY3A 4F0GA 1PHKA 4FL1A 3VUKA 5LMBA 3ID6C 3EQBA 3GOKA 4RZVA 1IAHA 3P7AA 4GRBA 2HCKA 3H9FA 3MGYA 5IQDA 2P33A 4NW5A 4I94A 4Q2AA 1NVQA 2YIWA 4U97A 3OT8A 4F7JA 4ASDA 2ACXA 4BDKA 2UZDA 3LCKA 3PP0A 4IX3A 4N4SA 2J51A 4V0GB 4BBMA 3PPZA 4IM2A 5E8VA 3VQHA 3G0EA 5ANIA 4BCHA 2BDJA 2GQGA 3B8RA 2FA2A 3MB6A 3Q9YA 4OUCA 2W4KA 4RIYB 3ZDIA 4C7TA 4ZAUA 2PVHA 5M51A 1YQJA 3PVGA 3EHAA 2FB8A 5HIDA 3BX5A 5EDPA 3S4QA 3PXFA 2B1PA 4KBAA 4QMPA 2J5FA 2HAKA 4XOYA 4V04A 2E2BA 4GKHA 3EZVA 1Z9XA 2RGPA 3LJ1A 3ITZA 2H34A 4RWIA 3RJCA 3UIUA 4MXYA 2W1DA 5EH0A 4F9CA 3AGMA 2R3MA 5A6NA 3KRJA 3IDCA 4JNWA 3E93A 5AX3A 3PWYA 4YJPA 5IQIA 1FVTA 2PUNA 4BN1A 4UMTA 1M7QA 4G6NA 4U5JA 4FKTA 3BZ3A 4MD8E 4XBUA 3RPOA 1BX6A 3FHRA 3L8XA 2CN5A 2QHMA 2X6DA 5KX8A 2B0QA 2Y7JA 2YM5A 3I7CA 3ZTXA 3NRMA 4AZFA 3DT1A 3P86A 5AUYA 4FIIA 4V01A 5LMAA 3O8PA 3E7OA 4ZZMA 4QTDA 3R8VA 3GFEA 3NYOA 3P5KA 4YJRA 3G9LX 3LZBA 4QP2A 4ACHA 2BCJA 4FTKA 4AE6A 1U59A 2IWIA 5AR8A 4BI1A 2W99B 4U79A 1YHSA 2HZIA 3O17A 3R63A 2PE2A 3ZEPA 2GTMA 5GJDA 3ZFXA 2BAKA 2XK6A 4RIWA 1BL7A 1H1RA 5TT7A 3ODZX 4GIHA 4QYYA 4BI2A 2UV2A 3QQJA 3UYTA 3TKUA 5IH6A 2VWWA 4TTHB 5FQDC 2C6EA 5HE2A 2PVMA 2QO9A 1IRKA 4AGUA 4AP7A 3ENMA 4XYFA 5AR5A 3W2PA 4DGNA 3TZMA 1H0WA 4UN0C 5KHXA 3M2WA 5IQBA 1DAWA 4C37A 4C38A 3COKA 5DLSA 5JQ5A 3NNXA 4OGRA 3CP9A 3QU0A 3KXHA 4LI5A 1W83A 4XJ0A 5HTCA 4XH6A 3UO4A 5J5TA 3AGLA 3N4UA 3FE3A 4QMTA 2E9PA 3I0OA 1BLXA 3FMMA 3LPBA 5FEQA 3VNTA 4R5YA 3WZEA 3EH9A 2WMRA 4F63A 5I9UA 1KE7A 5KMJA 3VBXA 4ENYA 3KXZA 4GU9A 1P2AA 4Z7GA 1E9HA 3D4QA 1ND4A 3RM7A 3ZSIA 4BI0A 4DFLA 4OTRA 5HG7A 3LOKA 2ITOA 2UZEA 4I3ZA 2RG6A 3CGFA 3LXLA 4KA3A 4P2KA 3GQLA 4TYGA 5DVRA 3MIYA 3W8QA 2NO3A 1JBPE 3I79A 3BYVA 3E8CA 1WBOA 4FKLA 3ZFMA 4FTLA 4M3QA 3V5WA 2ESMA 3FLWA 4RFYA 4JR7A 4KWPA 3VBTA 2VTIA 3EKKA 3QCQA 4J98A 3OCGA 1G5SA 3ZLWA 2C6TA 2PUPA 4MK0A 5M57A 3FDNA 3QUEA 3QYZA 5AUVA 1OM1A 3SOCA 3FMJA 4M13A 5CT0A 3R7OA 3SQQA 3W16A 4IAAA 4BZNA 2J0JA 3UIXA 4QRCA 2Z7RA 5CASA 4I6QA 4KS8A 4F7SA 2YDJA 3BBWA 3VUTA 5IUGA 1H07A 2F57A 2PY3A 3BEAA 2ITVA 3MH1A 4ZJVA 2XKCA 3SW7A 1XH7A 3QALE 5CAOA 2R3OA 4O0SA 4CFVA 5EYCA 3KRWA 4FODA 4ANBA 3LQ3A 2SRCA 3GBZA 4EH3A 4MXXA 3IDPA 2ZYBA 4BTMA 1ZYCA 4FEQA 4JLCA 1OIQA 3DA6A 3MFUA 3NCZA 2OXYA 4KNBA 1ZOGA 3UO5A 2XK7A 3L1SA 4M8TA 2J0MB 4GFGA 4R7BA 3HEGA 2JDRA 4RLKA 3R8UA 3ZXZA 4YBJA 3ZC5A 2OH0E 3DBDA 1MQBA 2ITWA 3DQXA 4I4FA 5FLFA 1PF8A 1XH8A 2OSCA 3CXWA 5GZAA 1H27A 2PL0A 2CLXA 1B39A 3HX4A 3UVPA 1O6YA 2J90A 2BR1A 4RRVA 3FMKA 3T9TA 4E8AA 4O0UA 4QNYA 4O7TA 5K4JA 4BTFA 2ZB1A 2X7OA 4EH5A 5T68A 4XG4A 3ORXA 5CSHA 4Z3VA 2IZRA 1OIUA 4MXAA 3KXMA 3SRVB 4FSNA 1WBWA 5T6KA 4UX9A 2WTVA 4YZCA 3OOGA 5IA1A 2QR8A 5LVNA 1JPAA 5J1VA 3MY0A 3R1SA 4GK4A 3K3JA 3Q96A 4MX9A 5JKGA 5GHVA 2WQOA 4RGJA 2QD9A 1RQQA 2C3LA 2VTMA 2J4ZA 3KU2A 3RPVA 5L2IA 5M53A 1J7UA 4FE2A 3SW4A 3II5A 2I0VA 5F95A 4RX8A 2UVYA 5IH5A 4QMLA 4EOOA 2VWZA 5FGKA 4ZTQA 3MVJA 4CYIA 3R7YA 4FZ7A 5EQPA 2CGUA 3QD4A 4BGQA 4OR5A 3R2YA 1ZARA 3C0GA 4FTAA 3ZBXA 2XRUA 4ZY4A 2QI8A 3PVBA 2EB3A 3IW6A 4B8LA 5ACBC 3C4CA 4U45A 3Q60A 5CSVA 3PXZA 3UJGA 2BALA 4EH9A 4E6CA 3G51A 3IGGA 1J3HA 4XNEA 5JFVA 4FNXA 2C5YA 2BZHB 4D4SA 1PXJA 3K2LA 3KVXA 5HD7A 4AOJA 3GC7A 4EHVA 4S32A 2ZDUA 5DGZA 3NW5A 4L67A 1PYEA 5IA3A 3OOMA 3TI1A 5I0BA 5HLNA 3LMIA 2JLDA 4L52A 4HVHA 1ERKA 3RZBA 4I24A 2R3FA 2EU9A 2ONLC 4W4YA 2BIYA 4CMTA 4BY9E 3FUPA 2IPXA 1J91A 2RF9A 2VZ6A 2X8DA 3R6XA 2IO6A 5CT7A 2PSQA 5M09A 3FLYA 2XVDA 5L2SA 3CEKA 5AEPA 3Q4UA 2PHKA 2B7AA 2XK8A 4RFZA 5AV0A 3VS7A 4FKIA 3CSVA 3RK5A 4IVCA 3D9VA 2CCIA 4IJ9A 5L3AA 2R64A 2XM9A 4CFUA 4LYNA 3ZZWA 5LMKA 2VTSA 5FP6A 5JZNA 3QCYA 3G6HA 4YPSA 1JOWB 5DOSA 1JQHA 3P7BA 3DY7A 1BMKA 2GTNA 3SXRA 2FO0A 3BHHA 4FV3A 4TN6A 4CFXA 3UOJA 3UQFA 1CKIA 2GHLA 3PIXA 4WRSA 2JBPA 3U6JA 3VHEA 4EUUA 4ONAA 4E5WA 2XK4A 3HMPA 2BUJA 3LIJA 3VQUA 4BBEA 4EYMA 3AD6A 3CS9A 4Y8DA 4BDFA 3ZLSA 1YOJA 2CMWA 2OJFE 1YI6A 3MTFA 4IB3A 4E6QA 3QX4A 4PL5A 4EH2A 2UW9A 4XV3A 3ENHA 3ZM4A 4O2ZA 3PSCA 4ZTSA 5BNJA 4N6YA 4XRLA 5KO1A 4W9XA 5CS6A 4R77A 5J7BA 1WVXA 3QX2A 2HY81 4IVAA 2OJJA 3UOKA 2C30A 4S30A 3LFQA 3LCDA 3P23A 2WTCA 1KV2A 3NW6A 3TIZA 4Q9SA 4HNIA 4K8AA 2WIPA 2HZ0A 3HKOA 1XH6A 2QG7A 2VTPA 2BTRA 3QTIA 4B6LA 5LVPA 4WT6A 4NK9A 4GW8A 2XYUA 3NZ0A 2XNMA 2UUEA 5DMZA 4BWXA 3QRTA 2W1EA 3AD4A 1J1CA 4U3ZA 2QO2A 5CTPA 4E26A 5HO8A 4CV8A 4QMQA 2XKDA 4M66A 3O50A 2FSMX 3LFBA 3ROYA 5DT3A 3GCPA 4FSQA 5HCZA 3Q32A 5I4NA 4E7WA 1SM2A 2W5AA 4L7SA 3UOHA 1G3NA 3GU6A 4HPUE 5EM6A 5A6OA 3I7BA 5FDXA 4YNOA 2GQSA 2BAQA 4CSVA 5BYYA 5EW8A 4YBKA 3EOCA 3NW7A 5AUWA 4QMSA 3AG9A 5CEMA 1QMZA 3PSDA 2YM3A 4M15A 5HU9A 5CU2A 2GHGA 3TT0A 3A7HA 3D2KA 4WBBB 3Q9WA 3GCUA 4BCJA 4FTNA 4ZSGA 4NM7A 5B7VA 1OL7A 2J6MA 4YC3A 3ET7A 3DB6A 4I5CA 4LL5A 4DA5A 4IADA 5JGBA 2BIKB 3AMYA 1UKHA 3K3IA 2XS0A 1U54B 2YIXA 5BYZA 3DXQA 4DEEA 3LLAA 4QD6A 2BRBA 3V8SA 4FF8A 3RCDA 1IG1A 4AN2A 5IA2A 5K0XA 3JR1A 2VTJA 4O0XA 2J5EA 3UIMA 3BHTA 1XWSA 4H05A 3DQWA 3CJGA 4XCUA 3QRJA 3OWJA 4CV9A 2PMOX 4FVPA 3VJNA 5J9ZA 5GIOE 4LRKA 4OTQA 4X2NA 4X3FA 3NUPA 3O2MA 3QKKA 5HE3A 4A7CA 4FSWA 3KRRA 2BKZA 4IZ7A 4RQVA 2OF2A 3EYHA 4UMQA 4JRVA 4ASZA 2GQRA 4WOVA 4QMUA 4GIIA 3MA6A 3UZRA 5C01A 2IZSA 2PZRA 4KIKB 4XS2A 1Q3DA 1UVRA 3S2PA 2ITXA 2JAMA 3MDYA 2NRUA 5JZJA 4I20A 2YFXA 2UZOA 4FTMA 1ZZ2A 5AM6A 3HLLA 5HLPA 4MVFA 4FTUA 1VYZA 2WQBA 1FMKA 3E88A 3PLAE 4BCIA 4LL0A 2XNPA 1V0OA 4F9BA 1Y8YA 2OZAB 4M69A 4PX6A 1R39A 3FHIA 1REKA 2VNWA 3ZM9A 3R00A 5K9IA 3EFJA 4O7WA 4XMOA 5D7AA 5D1JA 5KMOA 1IEPA 3WZKA 4FT0A 4PP9A 4QT1A 1H1WA 3R1NA 2C1BA 4TWCA 3NYVA 4E6AA 4Y95A 4P5QA 2A19B 2RIOA 2DQ7X 3V8TA 1PXLA 2NRYA 3D2IA 1H1PA 4L44A 4M67A 3HZTA 4N70A 1OKWA 4PQNA 5FBOA 2BZIB 3FEGA 3PIYA 2VWXA 5CU6A 4JI9A 3R0TA 3SVVA 3HNGA 5AP2A 3GCQA 3BV2A 2XNBA 2F7EE 3RVGA 4FSMA 3CTJA 2O5KA 3L9PA 4O27B 3ULZA 2QO7A 3ZHPC 2YIQA 3H0YA 5C03A 3L9LA 2Z60A 2F7ZE 1KE5A 2G01A 1XQZA 2VGPA 3O7LB 4WBOA 4BHNA 3UBDA 3RP9A 4LOQA 1QPEA 5AFVA 4C4HA 4H3QA 3QQHA 3DKCA 3CQWA 4F6WA 5AR2A 4QMYA 3ALOA 3FKOA 4IC7A 4A9YA 3DLSA 5HICA 3N51A 5BUIA 4MF1A 4RC3A 5K3YA 3UG1A 4DCEA 3SG9A 4USEA 3OWLA 4K33A 2HWPA 4RA4A 4RIXB 2FSLX 2VO3A 4MCVA 2BMCA 2IVSA 2J2IB 3KGAA 3LM0A 3MSSA 3KKVA 2P2HA 4E4XA 4U81A 3ZYAA 3FC2A 4HVSA 4JBVA 1JKLA 3CCNA 1JVPP 3GT8A 5HVKA 1APME 2UW6A 4DG0E 5JK3A 3HGKA 1YW2A 4DH1A 5CALA 3F69A 4RVTA 4F6SA 3LAUA 2CDZA 2VWUA 2XCHA 5HNIX 3TJCA 4E20A 5FD2A 2QOQA 3FLNC 3WIKA 3K5UA 1OL1A 2JFLA 4FSZA 5DR2A 3TWJA 3F2AA 1V0PA 4BCNA 1VZOA 2AC3A 1XBCA 4HZSA 4I0SA 4D1XA 3CD8A 4ITIA 4L45A 4DGGA 2WMQA 5AMNA 4K6ZA 4U42A 5KKRB 4J53A 4L42A 1YWVA 5AAEA 5L8KA 4QP6A 1J7LA 1PMVA 2BFYA 3IGOA 5DEWA 1Q61A 2X0GA 3DNDA 3ZCLA 4QYGA 3Q3BA 4M84A 2R3HA 5AV3A 4H1JA 3ALNA 4MF0A 3UP2A 3EZRA 3NX8A 2CHLA 4FV5A 4I5HA 4AACA 5IH4A 4JIAA 5FRIA 3R22A 4DFBA 2AUHA 3C1XA 3FXXA 2YM8A 4GKIA 3DU8A 3DBFA 1STCE 3UNZA 3RPSA 4LOOA 4FZFB 3BLQA 5K5NA 3F2NA 4FV9A 4BWKA 4FSTA 3EQRA 3Q53A 4TWNA 5EM8A 3C50A 4JR3A 4IZ5A 5E8WA 2BPMA 5CEPA 1YXSA 3PXKA 1XJDA 4GG5A 3VS3A 2RFDA 4D2PA 3RAHA 4D4RA 5LQFA 3DBCA 5K5XA 2WD1A 2C4GA 4C34A 2V0DA 4XLIA 3W8LA 3ZRLA 2VNYA 3R1YA 1QPCA 5CAPA 5L2QA 3P08A 5JFXA 4S34A 5FTGA 3IW8A 2O65A 3RK9A 4OW8A 2OWBA 3NUYA 3MJ2A 4AG8A
chains in the Genus database with same CATH superfamily
2VTNA 3M1SA 3QQGA 4KKGA 4F7LA 3OS3A 4RJ6A 4BIBA 3NUSA 4FBXA 2NP8A 3AC8A 4BGHA 5CSWA 1OKVA 1UU7A 5ANOA 2JKOA 3EN5A 1GAGA 4ALWA 3DGKA 2OI4X 2XCKA 1CSNA 3OG7A 5DPVA 4DE4A 1W0XC 2XM8A 1H0VA 3NNWA 3LFDA 3FQEA 4P7EA 4AFJA 4AT3A 3F5XA 3LW0A 3QFVA 5HCYA 3KREA 3LKMA 5IQFA 3WARA 4E4MA 5EW3A 4WG4A 2C0OA 3NDMA 1PXNA 3ACJA 1Q8ZA 4A9SA 4AU8A 1E1XA 3UNJA 3UZPA 2BFXA 3PJ2A 1CM8A 1WBSA 2G2IA 4R1YA 1KOBA 5D9HA 2B52A 4ANNA 2R0IA 1PMUA 4F6UA 3KCFA 2PVFA 3D83A 2WOTA 4ITHA 3EL7A 4X2KA 5CEQA 2PE1A 2JKKA 4FI1A 3SG8A 2UW7A 1QL6A 1ZYSA 4FV1A 3VS2A 4JQ7A 2W1CA 1CKPA 3W0MA 2IVUA 4OTPA 5HG8A 4IEBA 5H2UA 4FVQA 2EVAA 1RJBA 3G90X 5E90A 2NYAA 2GNLA 3BHYA 4U8ZA 5E9EA 5IEYA 3FXWA 4FNWA 1MP8A 4FEVA 1WMKA 4J99A 4EH4A 4EHEA 4GVJA 3S95A 3PPKA 3PY1A 4YURA 5HD4A 4WUAA 4OTDA 2BAJA 3FI8A 3QTXA 5IEVA 3HVCA 4FKWA 4RWJA 3TKIA 2B9FA 4D4VA 3HRFA 3L8VA 4BDJA 1R3CA 4C02A 4QTEA 2GNFA 4O21A 3NFFB 1KUTA 3NUAA 4CRSA 4PPBA 4HVIA 1YKRA 1NW1A 2WMXA 4IX4A 4TYEA 2V55A 3FL4A 4DHFA 3HMNA 4DDGA 3EFLA 1VJYA 5BVOA 1U4DA 4M0ZA 3KK9A 3UVRA 4FKPA 4BRXA 4MNEA 3GB2A 1F5QA 3NMUF 3EJ1A 1OB3A 5KMMA 5GINE 2QLUA 4D5KA 3U8WA 4I93A 5FTQA 3MW1A 1UWJA 5HNBA 1JAMA 2Z7LA 4FKRA 3BGQA 2ITNA 3MBLA 1R78A 2BHHA 3BYUA 2Q0NA 2WMUA 4CQGA 4FSYA 2JKMA 5LOHA 2OIBA 5CVGA 3FJQE 3IOPA 3IW4A 5DN3A 3DTWA 4I4EA 2J9MA 3QCXA 4GFMA 3OT3A 3TTIA 2QVSE 2Y6OA 2HIWA 4G2FA 5M06A 2XBJA 1TFFA 3LFSA 2EXMA 5AIKA 3T3UA 3OC1A 4EI4A 1FOTA 4GU6A 4RMZA 4DCAA 3OBJA 4O4EA 1WAKA 1PW2A 2XF0A 5IDPA 5ANJA 4TPTA 5HIBA 3RMFA 4MYGA 3VUIA 3HUCA 5HX6A 4W8EA 5CWZA 3TV4A 4RVMA 4K1BA 4JDJA 4QTCA 5E8ZA 3V3VA 1U5RA 4YTCA 5JH6A 1SVGA 4F1OA 3CKWA 5C8NA 3S1HA 2UVXA 5EM5A 1YXUA 1X8BA 3PLSA 5KHWA 5AAGA 2WOUA 2HWOA 3RTPA 3U4UA 3QQLA 3O71A 4C4FA 2O64A 3FYJX 2GU8A 2XA4A 3CD3A 3NLBA 2GNGA 5DA3A 4DH8A 4G6OA 2VV9A 4L3PA 4AXEA 1H25A 4RIWB 4NJDA 3U9NA 3WBLA 1S9IA 5B2MA 1BYGA 5AR7A 5DR6A 3O51A 5M56A 5KMNA 5BMSA 4F78A 2Z2WA 3BE2A 4AA0A 5HORA 2HENA 4UMRA 2A27A 5HIEA 2YJSA 4UWYA 4FEUA 3JY9A 5AAFA 5DYJA 2H96A 4IW0A 5HCXA 2AEGA 1T46A 1TQIA 4ZS0A 5E1EA 3PXRA 4MEDA 3RWPA 4P4CA 3AC4A 4ZIMA 3ANQA 3FWQA 3R9OA 3UG2A 2I7QA 2W5HA 1LPUA 3LLTA 1GZKA 1LP4A 4FEXA 2KTYA 4TYJA 4AZWA 5EYMA 3P1AA 2W0JA 4I1ZA 4RT7A 2YWVA 1YRPA 1HCLA 2VWIA 1YDTE 3PZEA 2RL5A 2GS2A 3NS9A 4H3PA 1UV5A 3ETAA 2YN8A 5D7VA 4D2SA 2JEDA 2G9XA 4D58A 2WO6A 2XIYA 5TE0A 5DEYA 2CLQA 3TV6A 3M42A 4YSJA 2FUMA 4A9UA 3KA0A 4X2FA 2VTHA 4U9AA 1VYWA 4OBPA 3FZ1A 3QTRA 3ZU7A 2GFCA 4JL9A 1GIJA 4BKJA 4S33A 4WIHA 3GEQA 2Y4IB 4USFA 3KC3A 4L9IA 3H4JA 3QLFA 4AW5A 4MUQA 4OBQA 4IANA 5A3XA 3PFQA 5HQ0A 3S0OA 4UYAA 5BV3A 3KULA 2YDKA 2GS7A 2I0YA 3JPVA 2EXCX 4FGBA 4CMUA 4HW7A 3U4WA 4XG6A 4NTTA 4IWQA 1V0BA 2P3GX 2WXVA 3VN9A 4XV1A 4HYHA 2WIHA 3RHKA 4KRDA 4AZSA 2BRMA 4JJRA 1WBVA 1FBNA 4NH1A 2NNWB 4GL9A 4HYIA 1KOAA 5CAQA 3AC1A 2XMYA 3JS2A 5K4IA 1Y8GA 4FOBA 3MIAA 4DDIA 4YLKA 2UW5A 4XHKB 1PRYA 4ANMA 4WNPA 3ERKA 3EL8A 4BCKA 3IO7A 3NGAA 4BFMA 4F64A 5L8JA 5ETFA 3AT3A 5EOLA 2ZM3A 4CEGA 2W9ZB 3CKXA 4E4LA 5L6OA 4LV7A 2VAGA 4P5ZA 5AR3A 1GY3A 4FV4A 3GFWA 4A9TA 4BDHA 4QMWA 4II5A 1DS5A 2OO8X 3MJ1A 4E4NA 5HTBA 1H01A 3RI1A 4AT5A 3PJCA 4ACDA 5HX8A 4V05A 2RG5A 4ZY6A 4ZTMA 3D7TA 2E9VA 4IM3A 4DN5A 4E5AX 4FUXA 4UXQA 5FXSA 3RZFA 2VWVA 3UO6A 1YWNA 4A4OA 2ONLA 4O0YA 4RSSA 3GUBA 5D11A 3TACA 5IISA 4BIEA 4O7LA 4AQCA 2FH9A 2ZB0A 3R7VA 4ERWA 3PG1A 3BHUA 3OUKA 1OZ1A 2F2UA 3HV3A 3E8DA 3PXYA 4G1WA 3W0PA 2XP2A 4N0SA 4V0GA 4ARKA 4PF4A 3UIBA 2R3IA 2PUIA 3QRUA 4J8MA 2PZ5A 4M0YA 2G2HA 1A06A 5CEIA 2G2FA 1SZMA 3ZO2A 1BUHA 4LRJA 3F2RA 4OTGA 2I40A 2JAVA 3RAIA 2ZV8A 2QR7A 5F4NA 2E9OA 3D5VA 4L00A 3H10A 3LXKA 4A06A 2V7OA 5GZ9A 4C33A 4YO4A 2R0UA 3HV7A 3NYXA 1W84A 3DDPA 3OBGA 4NFMA 5EDQA 5BVKA 3BU5A 4C61A 2GFSA 4ENXA 3KF7A 4EOIA 2ZM4A 3AT2A 3QUDA 2YIYA 5I3OA 4C59A 4DT8A 3A8XA 3NYNA 3WE8A 5IPJA 2BRHA 3VC4A 4EZ5A 4FKOA 4QTAA 2GSFA 2YISA 4MBIA 2X7FA 4D2WA 4DEDA 2GDOA 3BGPA 3KK8A 3QWJA 3VW8A 3D5XA 4RLLA 3KY2A 3ZXTA 3FQSA 1Z57A 3BL9A 2JDVA 4FSRA 3SLSA 3IDBA 2C5VA 2PZYA 4LRMA 3R9NA 3LMGA 1VR2A 2WU6A 3FL5A 3QKLA 4ANQA 1OUYA 2R3NA 2XALA 3QTSA 1F3MC 3BKBA 3C0IA 4FT7A 1XO2B 3Q6UA 4C3PA 4EBVA 4CKIA 3SXFA 2QOLA 3DTCA 4IAKA 1Q8TA 1NVSA 1RW8A 2ERZE 2YEXA 2WU7A 4IFGA 4PDPA 3ROCA 4LGGA 4LM5A 3A4PA 3ORMA 4YZMA 5FP5A 4JX3A 3MPTA 1Q24A 4S31A 2UW0A 4GJ3A 1KE8A 4M14A 5EQEA 3JXWA 3O7LD 5A4TA 1OPLA 2ZM1A 3DCVA 4OAUC 4IAIA 3WILA 1Q99A 4PNIA 4EQCA 2B4SB 3WYXA 3ZSHA 1Q8UA 1GZ8A 4FTOA 3I81A 4I5MA 2XARA 4DEAA 4NL0A 4FICA 5CU0A 4JG8A 5IQHA 5CVHA 2R3GA 1EH4A 4FTTA 1SYKA 4AQKA 4BZOA 3OXIA 4DEIA 3PYYA 3TZ9A 4BZDA 2R2PA 1M17A 3QA0A 4RG0A 3QZGA 5HBEA 1M52A 4QP7A 4ZTNA 4ZJJA 1G8SA 1H1QA 3R9RA 4R5SA 3SV0A 2XIRA 2XAMA 4O7YA 1R0PA 2DS1A 3VUDA 3W32A 3EQIA 5JN2A 2PVNA 3V5JA 4QYHA 2RSVA 4USDA 3QBNA 4N57A 4FNZA 4JG6A 5DRBA 4ZZNA 4HPTE 3BWFA 1S9JA 1TKIA 2KULA 2Y6MA 4QMZA 3R7EA 3P78A 3MA3A 3PE1A 4JBOA 4JDIA 2CGVA 2J0IA 4HOKA 4WSYA 3V5QA 4RX5A 5AM7A 2QURA 1OGUA 2WTKC 3F7ZA 5BVFA 2OH4A 1OPKA 3CR0A 4PPCA 3F5GA 3R71A 4YLLA 5TOZA 3THBA 4W4XA 3POZA 2C3JA 4L43A 2XKEA 3TZ8A 3Q6WA 5EYKA 1JKSA 2X9FA 5EHYA 2RFSA 2X1NA 5LVOA 1TZDA 5F20A 3AKKA 3SHEA 3HP5A 1ST4A 5IUIA 2OLCA 3UMWA 1F0QA 4WA9A 3CGOA 2I0HA 3SXSA 2B55A 2OFUA 3IONA 4QMXA 4BYIA 2RFEA 4J97A 4AXCA 5JRSA 3ZZEA 5BX0A 3WI6A 5C8MA 5HE0A 5EI8A 3NNUA 4Y83A 5LCJA 4H3BA 3H30A 3QTUA 4CGAA 2Q0BA 4RC2A 5A4CA 5BVNA 3R8MA 4AFEA 4HCTA 4S2ZA 1PKGA 3SDJA 4UV0A 5J1WA 5HZNA 1YXTA 3EFKA 1J7IA 1Q97A 3O8UA 4ORKA 2W06A 5H8BA 4LUEA 3ZDUA 5JSMA 3KN6A 4IDTA 4R3RA 2OG8A 5C27A 5C1QB 4EZ7A 1ZOEA 3JY0A 3TNHA 3V5LA 5IUHA 2C3KA 4PV0A 4L6QA 2W1ZA 2XIXA 1PY5A 3QL8A 4UZDA 3QC4A 3TEIA 2Y4IC 3OY3A 3QA8A 1HOWA 4IB0A 3IOKA 4MQ2A 4MBLA 4XV2A 4NKAA 3WIGA 5LARA 3IW5A 4NM3A 5CVFA 3I6UA 1ZMVA 2GPHA 4ZSJA 1JWHA 2LGCA 3SAYA 5IF1A 3JYAA 3FAAA 5LCKA 3COMA 4EORA 4CKJA 3ORZA 4I5PA 4X3FB 4DH7A 1W2FA 5IA4A 4E6DA 2CKPA 1Q5KA 3IQ7A 4HNFA 4FKSA 4XBRA 1BKXA 4M97A 2X0OA 3HL7A 3RBWA 5DT0A 2QHNA 2DWBA 1WFCA 2PVJA 2X81A 4PMSA 3F3TA 2W1IA 1UU3A 3DKGA 4K11A 4OTHA 2GHMA 4WNMA 1K2PA 4LGHA 4FT5A 3VUHA 3GU8A 3MFRA 5J9YA 4PL4A 5DIAA 4TYHB 2B53A 4JQ8A 3UPXA 3TKHA 2GMXA 4QMOA 2Y9QA 4PNKA 1Y6AA 4TWPA 3QHRA 1U5QA 3ORLA 4FVRA 3PTGA 2C0IA 2QU5A 5HE1A 1IR3A 3RCJA 3UC4A 4BDIA 5B2LA 3EIDA 4O7VA 3A62A 2PVLA 4QYFA 3ACKA 3BQRA 1J1BA 4XX9A 2OZOA 4G31A 5CF5A 1XH9A 4ZTRA 1NXKA 2P55A 5KMLA 3TIYA 4O6LA 3R7IA 4I22A 3JUHA 2YHVA 3ORPA 2EUFB 5IDNA 4I6FA 3GENA 4ACCA 2R4BA 1K9AA 2AQXA 4FTRA 4HGLA 4LUDA 2A4LA 1JNKA 5ANDA 2QKWB 3I1AA 4GJ2A 2R3KA 3QD3A 3FZRA 4I92A 4HGSA 5CX9A 3KL8A 4EKKA 1W82A 5AP4A 2YACA 3MVMA 4DFXE 2YDIA 2ZVAA 4Y46A 2UW3A 1KE6A 3C4XA 3ZFYA 5M08A 1DI9A 3OF0A 5B0XA 3TN8A 4AZTA 3EWHA 2W1HA 3O23A 2CKOA 2Q83A 3WF6A 1T45A 2V5QA 4U43A 5HO7A 3QCSA 1MRYA 4FZAB 1ZY4A 5KCVA 5E8YA 2XJ0A 4HVDA 3FV8A 4FX3A 3RKBA 4F1TA 1YHWA 3ZRKA 4KIQA 5BYLA 4J8NA 4JG7A 2X4FA 2VTAA 5B2KA 5HO6A 5EOBA 3U9CA 1O6KA 2C6DA 5KMKA 4RFMA 1OIYA 2JD5A 4MKCA 2JDTA 1P5EA 2R3PA 2VU3A 3L9NA 4OTIA 3RPRA 2VO7A 3PJ3A 2G1TA 4NIFB 4K0YA 4GYGA 3GCSA 3O5AA 3ZONA 3POOA 3DJ6A 4YJOA 3HUBA 5DR9A 4Z55A 5ETIA 3VRZA 3OWPA 4J1RA 4PDSA 3W0SA 1O6LA 5G1XA 3V8WA 5GZ8A 4RVKA 4F0IA 2X7GA 3GXLA 2FVDA 3UMXA 5IQCA 4JQEA 4ANLA 4ZLZA 5KBRA 4MXOA 4F99A 3FI4A 2I0EA 3ATTA 3F3VA 4ZJIA 2IVVA 3D5WA 4ACMA 1UNLA 3DJ5A 1L3RE 2QOBA 4O1PA 1RE8A 3E63A 4FOCA 3Q4ZA 1O9UA 3V5TA 5AA8A 3FMDA 3WF8A 2E9UA 2VUWA 3LVPA 2IZUA 4FT3A 1H28A 3R21A 4IE9A 4L68A 2B9JA 3C4FA 3COHA 3W0QA 5CZHA 3H9RA 1OL5A 4FTJA 2J50A 1XBBA 2XIZA 2XNGA 4R8QA 3DNEA 4AN9A 4F70A 4YUQA 4AN3A 1E1VA 3FI2A 2R5TA 3MWUA 3OW4A 5CXHA 4E3CA 2YAKA 2XRWA 4J52A 5H8EA 2WNTA 4OT6A 5LWMA 3E3PA 3QYWA 1CKJA 3MFSA 3RINA 2UZBA 4JS8A 2CNVA 3BYMA 3ZRMA 1YDSE 2W1FA 2O0UA 4C36A 4D2TA 2Z7SA 1W2CA 2ZDTA 2FGIA 3DJ7A 3MB7A 4G5PA 1JLUE 4X2GA 4CT1A 2O8YA 2BRGA 4HVGA 1TQPA 3BQCA 1GNGA 4DFZE 3ORKA 1M2RA 1AGWA 2OBJA 4FR4A 3ZUVA 3BIZA 4DEHA 3OCTA 4L53A 4YHTA 3DXPA 3LQ5A 3DK7A 2P2IA 4E5BA 5AV2A 5HI2A 2XKFA 5K0KA 3T8OA 4AAAA 3SC1A 5HNGA 3DOGA 5T3QA 5IZFA 1WBTA 4NKSA 5F94A 4DTBA 3FLQA 1XHAA 4HZRA 4LMNA 4IWPA 4XG3A 5I9WA 2X2LA 3BEGA 4PDOA 3TXOA 2R3LA 2JKQA 3QZHA 4EQUA 1ZAOA 3N4TA 4JIKA 4FG9A 4ZLYA 4EOJA 2QC6A 2HXQA 4J95A 4ANOA 4AF3A 4ALUA 5AUUA 5M44A 2WMVA 3W33A 1Q8YA 3VBVA 1IA9A 1M7NA 1M14A 3W2QA 1FVRA 3O96A 3G0FA 3NFGB 1YXXA 2XBAA 3VHKA 3GQIA 4GT5A 3FBVA 4CFNA 3REPA 4KIKA 3TM0A 3A61A 2QOHA 5L8LA 3UODA 3KMWA 4OT5A 4BWPA 5TKDA 5HVJA 1P4OA 2Z7QA 2W7XA 3DV3A 3EQGA 1ZYLA 3GVUA 3VS0A 5C9CA 4YSMA 3LQ8A 1YDRE 4FKGA 4J7BA 3R8PA 3V5PA 4QQ5A 2GNIA 4FKJA 2OZAA 3NWWA 3FPQA 3ATSA 4GCJA 3UQGA 3BLAA 4NJ3A 2OU7A 2I6LA 3DFCB 1Y91A 4YR8A 2O63A 4YO6A 5HESA 1H4LA 3DDQA 4KB8A 3UTOA 4ZY5A 4IHPA 3MYGA 2YA9A 4FL2A 4IVBA 4C3FA 4EH8A 3ZMMA 3IECA 5DRDA 3HV4A 5HG9A 1ZLTA 1PXPA 4AA4A 2W96B 4K9YA 2WQEA 5KE0A 5DHJA 4NZWB 3KXNA 3LCSA 3RPYA 4AXAA 3FZTA 4DH5A 3IPHA 3A4OX 2ZV2A 5IMXA 5M4FA 1PXOA 1SVEA 5A14A 4Y5QA 3FLSA 2OXDA 3JVRA 3P0MA 4NT4A 3DAEA 2WQMA 5KZ0A 4EOPA 1OPJA 3A8WA 3PJ1A 2CSNA 1Y6BA 2R3QA 3BRBA 3EQFA 5EHLA 2HELA 5FUTA 3WE4A 5E8UA 3VBWA 4DHJA 1GJOA 3LXPA 3PJ8A 3AT4A 5DH3A 1PXMA 5E8TA 5ETAA 4MBJA 3EQHA 5JFSA 3P79A 3I5ZA 3DZQA 2BDFA 3GU4A 3MVHA 4FV7A 4DAWA 3JVSA 3TTJA 5DWRA 3FMNA 3HV6A 3NPCA 4RWLA 5J87A 4PUZA 3FKNA 1NVRA 4AZVA 2IEWA 1ATPE 4I6LA 1NA7A 3OUNB 4F0FA 4CLIA 4L8MA 4RIXA 4UMPA 5EM7A 5LJJA 3MY5A 4W4WA 2O3PA 4XP2A 4ID7A 2XH5A 2WB8A 4YJUA 5FBNC 3LXNA 4CKRA 4EK4A 4KIOA 4FTQA 4HGEA 2AYPA 3CJFA 4G3DA 1WZYA 4J71A 1OITA 4ZP5A 3L9MA 4G3FA 3SX9A 4BL1A 3R7GA 3CE3A 4RIOA 4EWQA 5AADA 3EYGA 3PVUA 5HTIA 2BKKA 3HA6A 4IBMA 4U40A 5CENA 5LVLA 1PKDA 2PWLA 4YTHA 4Q5HA 4GK2A 3LHJA 4CTCA 5AP7A 3GP0A 3PUPA 4U7ZA 3CBLA 5DG5A 2OW3A 3IW7A 4RX7A 1ZWSA 4WG3A 3PY3A 4BDAA 4F9YA 3U55A 3BYSA 3LFEA 4HCUA 4AGDA 3GC9A 4C2VA 5CF6A 2HYYA 2BHEA 2ZAZA 2YM6A 3IG7A 3QF9A 4FUYA 5L6WL 2NPQA 5H8GA 3PE2A 4G9RA 4U6RA 4UY9A 4CLJA 1H26A 3M11A 3SKCA 2EB2A 2PMLX 1UWHA 2ZMDA 4BGGA 3ELJA 3IS5A 4FK6A 2VN9A 4RVLA 3LJ2A 3SOAA 1LUFA 5ANEA 1BI8A 2WMWA 3BV3A 2LAVA 4AWIA 2BRNA 2RFNA 3F5PA 4LGDA 4XP3A 4Y85A 4BDGA 1OI9A 2ITUA 4NYEA 5CF4A 3HDMA 1JKKA 4KS7A 3CQEA 5DFPA 4LFIA 4UB7A 1GOLA 3C4ZA 3KFAA 4R3PA 4YJNA 3A7JA 1TVOA 4IIRA 4PTGA 3HMMA 1VEBA 1ZOHA 2JIUA 3KMUA 4CZUA 3BPRA 4BTKA 2R7BA 4XRJA 3ORTA 4DEGA 3LE6A 4ZLOA 4FV0A 4FYOA 4DFYA 3PZHA 2HZ4A 2WTDA 5EKNA 4ZTLA 3R9HA 4I6HA 4CG8A 5GNKA 3PFYA 1SMHA 3R73A 4WHZA 4PPAA 1IA8A 4AAYA 2WQNA 3HRCA 4O82A 4WSQA 4LQMA 3UP7A 4UEUA 1OL2A 3EQDA 1ZMUA 4Q5EA 3BHVA 2E9NA 3VUMA 4EQMA 4G3EA 4B8MA 3ZS5A 3IKAA 3LFFA 3TCPA 3PSBA 2PVKA 1XH5A 4X7QA 4O96A 3IK3A 4EKLA 3R8ZA 4EOKA 5KBQA 4IACA 4NEUA 4WNKA 5AP3A 4XG2A 3V6RA 3A2CA 3CPCA 4QQJA 3AOXA 5JGDA 3F3ZA 2R3JA 2X39A 5CEKA 4G17A 4TW9A 4ZSEA 2YJRA 2OICA 4GSBA 4H39A 2IW8A 4R6VA 3W2RA 1R1WA 3PPJA 1ZMWA 3Q4TA 2C1AA 2J0LA 1FVVA 2HZNA 3A60A 3AMBA 3CTHA 3E87A 4QEBA 4ZMEA 2ZV7A 4I23A 4LV8A 4U44A 4ASEA 2YCSA 3QD0A 3S00A 3P9JA 4XG8A 3FZSA 4O83A 3NAYA 3S3IA 3BE9A 5LVMA 2C47A 1DI8A 4APCA 3U6HA 1OBGA 2ETKA 3Q04A 3UE4A 1A9UA 5J9LA 3VS6A 4ZMFA 4EONA 2ZJWA 2VGOA 4O38A 3GGFA 4O0RA 1H24A 4X0MA 5FXRA 4WKQA 4I41A 3WZJA 2I1MA 2IG7A 1NT2A 3R01A 5A46A 4YZNA 3MS9A 4FL3A 2WTJA 3FPMA 4KINA 1Y57A 3WZDA 3D7TB 4U80A 4UWCA 4KAOA 3D7ZA 2WEVA 2Y4PA 3Q9XA 5FEEA 1YXVA 1ZYDA 3OVVA 2OGVA 1AQ1A 2ERKA 4UZHA 3FZOA 3QZIA 5EW9A 2X6EA 5CI7A 4LOPA 2WEIA 2H8HA 5BQ0A 4C4EA 3C5UA 4KRCA 3OTUA 5D12A 4DTKA 4FTIA 4F09A 5I3RA 3L8SA 2IZTA 2BZKB 4D1ZA 5TR6A 3KQ7A 2V22A 3VAPA 4AA5A 4E1ZA 3KEXA 5KKRC 3OEZA 3RNYA 2VO0A 4EWHA 2YM7A 4RZWA 5L2TA 1OECA 2F7XE 2VTTA 3BLHA 2UZNA 3FMLA 3CLYA 3GC8A 4WRGA 3RNIA 3MN3A 5L4QA 2VD5A 3ZO3A 4G34A 2UZUE 2VRXA 2GNHA 5FM3A 4EOQA 2YERA 5GJFA 2XB7A 3WZUA 4C4GA 3MV5A 2QODA 4Y72A 2BTSA 4G9CA 5HKMA 4QP4A 3V01A 1YOLA 4C58A 4AGWA 2Y8OA 2CJMA 2C6MA 4EH7A 1XMLA 1GIIA 4F4PA 4FZDB 2QCSA 4OLIA 4BCOA 4DLJA 2VTQA 1LR4A 4CZTA 4RC4A 1YOMA 3NVMB 5DE2A 5AUZA 1YI3A 3PRIA 4AW0A 4OBOA 4TYIA 4CFMA 2J7TA 2JC6A 4KIPA 5D41A 3VF8A 5EDRA 3KVWA 5H9BA 3C0HA 2HK5A 3TDWA 2H6DA 4PTCA 5IG1A 4CYJA 5E4HA 4O84A 3W0OA 5A4EA 2OJ9A 3H9OA 4G5JA 3CY3A 4NCTC 4A07A 4M7IA 4AE9A 3I0QA 2JIVA 1PJKA 3ZO4A 1G8AA 4QPMA 3NUXA 2VO6A 3NUNA 4EL9A 4DT9A 4O7NA 5HBJA 4QP8A 3FLZA 3QQFA 4EC8A 2BDWA 2VX1A 4L3LA 3ULIA 4BKYA 3V6SA 3G2FA 4YGAA 2O2UA 4HCVA 2IJMA 4ZTHA 4C2WA 4CVAA 4BR3A 4BC6A 5L6PA 3EN7A 1KWPA 4KD1A 1SNXA 2IVTA 2PE0A 3OTVA 4DC2A 4FZ6A 4GT3A 4YJTA 5A9UA 2AC5A 1OL6A 2X8IA 4XV9A 2GNJA 4L46A 4ZXTA 3ZBFA 4HGTA 4P90A 2YCFA 5H3QA 3A99A 3GU5A 5TO8A 4EOMA 4TNDA 4FJVA 4DFNA 3CY2A 4GG7A 4MNFA 5HBHA 2QOFA 1Z5MA 4Q9ZA 4AXDA 5DI1A 4RIYA 4DG2E 3QHWA 4JDHA 4R1VA 5IMEA 4GK3A 4E93A 3AKJA 5CF8A 5EYDA 2Y0AA 4H1MA 4I0RA 4EUTA 2UW4A 4YJSA 4LG4A 4ZZOA 4XLVA 3F82A 3E62A 3TG1A 4DINA 4EBWA 4R78A 4CCUA 2REIA 4EEVA 2ETMA 4FV6A 2Z02A 2X0QA 5IA0A 4O7ZA 4EOLA 3DZOA 2XZSA 3O8TA 1GIHA 2YLFA 3PVWA 4U3YA 4IB5A 3F66A 4CT2A 2QNJA 4O0VA 4NU1A 4UYNA 3U87A 3VONA 1FQ1B 3UQCA 2BZJA 4DG3E 4XP0A 3NSZA 5I5ZA 3HDNA 3KMMA 3R1QA 4FMQA 4FTCA 4NTSA 4NUSA 3LMHA 2PTKA 3ML1A 4E73A 3FY2A 5G6VA 5C8KA 2WHBA 3DLZA 3QAME 3ZC6A 2WKMA 4FK3A 2OF4A 4EZ3A 4LDTA 3AC2A 3C4WA 3D14A 4Z16A 5HOAA 3G9NA 4D0XA 4YZ9A 4KSQA 4YPDA 1QCFA 4D9TA 1OBDA 5F1ZA 4FT9A 4ERKA 5HG5A 4KBKA 4LMUA 4NFNA 1IASA 3VS1A 1B6CB 1RDQE 4TT7A 3KXXA 3DFAA 1XH4A 3VIDA 4BICA 3V04A 3QTWA 4ALVA 3EMGA 3QXPA 4WNOA 5CSPA 1P4FA 2F9GA 3BBTB 4QPAA 3ANRA 3KB7A 3NIEA 3OHTA 3W2CA 4EOSA 4FIGA 5BPYA 3OW3A 1ZZLA 3C9WA 3Q9ZA 3DB8A 4IWOA 5HEZA 2YM4A 5DNRA 3R04A 4RJ7A 4JRNA 2YWPA 4L3JA 4X3JA 4B99A 3I60A 2X2KA 2UZLA 5JMSA 1XBAA 3SGCA 4DBXA 4FIJA 5E1SA 3UVQA 4O1OA 1OUKA 2CKQA 3W0NA 4UWBA 1REJA 5CNOA 4IM0A 4JX7A 3ZSGA 4BDEA 5EI6A 2W1GA 5HHWA 1Q41A 1ZY5A 3DBEA 4BCGA 3GOPA 3Q2JA 3F5UA 5CSXA 2VX3A 3V51A 1FGKA 4AT4A 4QMNA 1W98A 2XNEA 3AD5A 2ITTA 4FIHA 2V62A 4B9DA 3QD2B 4IH8A