5K5NA

Crystal structure of gsk-3beta complexed with pf-04802367, a highly selective brain-penetrant kinase inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
347
structure length
331
Chain Sequence
KVTTVVATPGDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQNRELQIMRKLDHCNIVRLRYFFYSSDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogen synthase kinase-3 beta
publication title Discovery of a Highly Selective Glycogen Synthase Kinase-3 Inhibitor (PF-04802367) That Modulates Tau Phosphorylation in the Brain: Translation for PET Neuroimaging.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 331
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5k5nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5k5nA01
2W1DA 2OXDA 4MH7A 4IAIA 5HOAA 3ZEWA 1R0PA 3H4JA 4BCNA 1M7NA 3SW7A 5E92A 5G1XA 5HCXA 3TT0A 2ZOQA 2GNIA 3QYZA 3F88A 4LOPA 4AF3A 5B2LA 5TE0A 3SXSA 4X2KA 2YIRA 4EK6A 1OITA 2QO9A 1JSUA 4AQCA 2W9FB 2WTDA 2BRMA 5A14A 1ZY5A 4L45A 2XBAA 1Y8YA 2PVJA 3PE1A 2CJMA 3RP9A 3T3UA 3ZMMA 3EIDA 4W9WA 4R5SA 3S00A 2QOQA 3HMIA 4XG3A 4IW0A 4DEBA 4RWLA 3I6WA 3ZRMA 4A9UA 3W8LA 4BHZA 3QHRA 4FYOA 2SRCA 1ATPE 3SA0A 3K5VA 4A9TA 5CSWA 5HORA 4G2FA 3P0MA 3OT8A 5CSVA 5FBOA 3R8LA 4MHAA 3VUTA 4A4OA 3QXPA 4Z16A 2HAKA 2YLEA 4RC2A 4JQ8A 3R21A 1H08A 1WBNA 4RQVA 3SKCA 4YZCA 3UYSA 1XWSA 2ZAZA 3HA8A 2VX3A 3C50A 3R7YA 2JEDA 1UVRA 4NIFA 3CKXA 4BI1A 5HD4A 3BLRA 3EFJA 5M4UA 2QHMA 4P4CA 5DNRA 2C5NA 5BQ0A 4GCJA 2OF4A 3RZFA 3A4OX 3BKBA 4KA3A 5AUXA 4R7BA 1GOLA 2J0KA 4QMZA 5E8YA 3HAMA 2BAKA 3D4QA 4ASDA 4EOPA 2EWAA 2HZ4A 4QP9A 1KOAA 5FGKA 1F5QA 1LEZA 2Y6OA 5E8TA 5EDPA 1JSVA 1U54A 2VWZA 2Z7LA 4JAIA 3QALE 3VUMA 2PY3A 2W5BA 2XNMA 4IACA 1M7QA 5EHOA 3UIUA 3QKKA 1OL5A 4E4MA 5M06A 2BALA 2VWXA 3AMYA 1LR4A 4AOJA 4IVDA 3F3UA 3FMLA 3SRVB 4FTOA 1DS5A 2XK6A 1Q62A 2PE0A 2C5OA 3QTWA 3WOWA 5CSHA 4EH5A 1A48A 2WEIA 4LL5A 4XJ0A 1FOTA 3UZPA 1E9HA 3ZBFA 5IA4A 1ZMVA 4Y73A 5JT2A 2CHLA 2CLQA 4L3LA 4OTQA 1Y91A 3MBLA 2JDOA 4V0GA 3C4CA 4BCFA 2QG7A 3CJGA 4D58A 5A4CA 3HV3A 2OK1A 1NA7A 2NRYA 4P2KA 5E90A 5AR7A 3TZ9A 4CZYB 4XBRA 3EN4A 4FV4A 2OJFE 5J9LA 4ANBA 5HD7A 4AUAA 4EOSA 4J98A 4RC4A 2ZVAA 2ZJWA 2XJ2A 5KMKA 5D12A 2UVZA 4L52A 4CCUA 2EU9A 3FAAA 5EK7A 4DH7A 3MFSA 2O64A 2YM7A 3I5ZA 5A4LA 3I81A 4X3JA 4WBBB 2BDWA 5DWRA 3UMWA 4PL5A 4ZLYA 1WBWA 3ZSGA 4CKRA 5M07A 5KBRA 2B4SB 5HHWA 1ND4A 4XH6A 1R78A 3R73A 4D4SA 5AP0A 4IWOA 4HZSA 5L6WL 2ZV8A 3KU2A 1IAJA 2ITOA 2E9UA 3Q5ZA 3VBVA 5GIOE 4RPVA 4GUEA 1QPJA 5AP5A 4HW7A 2GNFA 4F7NA 3UP2A 4HGSA 4L00A 1OBGA 2VTMA 1Q8ZA 1K2PA 4ANOA 2VTPA 5EM7A 5FP5A 1XBCA 4C36A 4F7LA 5AUUA 4KSQA 5CVGA 4QMTA 3PJ1A 4U79A 3GU7A 2UZWE 3OS3A 4PL3A 3VW6A 4EYMA 4F65A 4FKRA 4TYEA 3H30A 1U5QA 4YBJA 5IA3A 1OGUA 4FA2A 3WYXA 2FSMX 3ANRA 3MVHA 1U54B 2E9PA 3QHWA 3ZO1A 3UIBA 4LUEA 3P7AA 4CYJA 4TW9A 3RAHA 4RX8A 5DFPA 4RLLA 5JSMA 1KE7A 4QP4A 4D0XA 4DGNA 2AYPA 3FKNA 3ODYX 3ATSA 2OIDA 4I6QA 4RX5A 2ZM3A 2IW6A 2G1TA 3KCKA 3KMMA 2UZOA 3I7BA 4F0FA 4C58A 2WAJA 3NWWA 3MDYA 3GENA 1Q8YA 4ITIA 4KAOA 5K4IA 2F49A 3WIGA 1Z5MA 3QC9A 5LWNA 3MTFA 4V0GB 5DR2A 3ZFXA 4HGLA 3CPCA 4HCUA 2PE2A 4OTPA 5EW3A 3NLBA 3NW7A 4EWQA 3D0EA 2BZHB 2C6TA 5GIPE 5DR9A 1WVWA 4IX5A 5AV3A 2HIWA 2W0JA 3DBQA 3FUPA 4KBAA 5CZHA 4BCIA 4BTKA 5I9ZA 5KMNA 3DBEA 4QMUA 4RZVA 5M44A 1J91A 3P78A 1PXLA 4OBPA 4IWDA 4TN6A 3ZDIA 4RJ8A 4AGCA 1GAGA 4Y85A 4ACDA 4NZWB 3ZLWA 1W0XC 3FI3A 2VD5A 1YW2A 5DRDA 3DTCA 1PHKA 5AWMA 5L2QA 4TYGA 4R1YA 2OBJA 1GZ8A 1OPKA 3FL5A 3D5XA 4BDKA 3DXPA 3LXLA 2OU7A 4FSNA 2WTWA 5ETFA 3TKUA 3ZS5A 4DFZE 2OH4A 4NL0A 5IDNA 4CFWA 5LVPA 2GQSA 2JBOA 2IVVA 2XNEA 2OSCA 3KVWA 4X2FA 5EQPA 3ATTA 5IZFA 5IQDA 1KE5A 3VUIA 3W10A 4EKLA 4DBXA 4NEUA 3KC3A 3CY3A 5FTQA 5BUIA 4JIKA 4BYJA 3O23A 4JIAA 2B0QA 4RWIA 5BVFA 5J95A 3BWFA 2Y8OA 3THBA 1TVOA 4AZEA 3ZRKA 3MJ1A 3U8WA 4F6SA 4D9TA 2OJJA 2XNGA 3EN7A 4FV0A 5F94A 3KRXA 4CMUA 3UIMA 2XIXA 2PZYA 2X6EA 2X8IA 1PW2A 3EH9A 4DLIA 5I9XA 2XNPA 3FV8A 2IZSA 3V8TA 2BVAA 4OT5A 2RF9A 3RPYA 3DFAA 2R3JA 3EQPA 3CCNA 3JR1A 3P23A 4A9SA 3NW6A 4XG2A 5LVOA 4EZ3A 2CPKE 4R78A 5TO8A 2GNHA 1ZYDA 3VS5A 1IRKA 2P0CA 4DFUA 1UV5A 2ITZA 3Q3BA 1KE8A 4QYFA 5AUVA 4FG9A 4BN1A 4IDTA 5CALA 3Q9WA 2VO0A 1G8SA 2Y9QA 4MKCA 3PG3A 4MF1A 3SAYA 1H1WA 5FG8A 3PPKA 4GG5A 1Q3WA 2I0YA 3FLSA 4KKGA 4XG6A 2JGZA 4ACCA 2FH9A 2VWUA 3VHEA 3TDWA 4FT7A 4IH8A 1XH5A 3N51A 2E9VA 4IAKA 1JQHA 4ZMEA 3DBCA 2VTJA 3A7JA 3E92A 5IMXA 5JFWA 4ONAA 2I7QA 3OXTA 4FYNA 1Q24A 3AGMA 2VX1A 4UWBA 1OECA 4OTHA 2B53A 3RKBA 5K5NA 3HA6A 3V8SA 3R1SA 4BI2A 2WMRA 4F1OA 4ZTNA 3VRZA 3AC4A 3PZEA 5LMKA 4N6YA 5F1ZA 1Q5KA 4IB5A 4UZHA 3H9FA 5C8KA 2R9SA 4PQNA 5EOBA 4QMSA 3F5UA 3ORIA 1U59A 4YNEA 4OTDA 4I0RA 3UMXA 3HAVA 3E8DA 5AX9A 4G3CA 4QP6A 1OIQA 4A9RA 4MD8E 1CDKA 1XH6A 4O7TA 4LI5A 3UZTA 4EOLA 5AJQA 4IB0A 1UKHA 2GS2A 2B55A 3HKOA 4K6ZA 5BVKA 4EH9A 2ITYA 4PDSA 2XIRA 4YZNA 3BX5A 2YDKA 2OFUA 3G0EA 3GQIA 3UC3A 2C68A 1XH9A 2GTNA 3TNQB 3E7VA 2YZAA 3EN5A 5CEKA 4XP3A 3S0OA 5EYMA 4MD9E 3RPOA 4LRMA 5GZ8A 4QYYA 2HW6A 1H1RA 2XJ1A 1MUOA 5IQBA 4IADA 4RJ7A 3ZM4A 4EHZA 4FEXA 5AUWA 3ZUUA 3AMBA 2GDOA 2UZTA 1Y8GA 3CTQA 3LFCA 4C4EA 3D9VA 3F3VA 3QXOA 5DT0A 5C03A 5L6OA 4RGJA 4PWNA 4GYIA 5D41A 3FSKA 3LQ8A 4YO6A 2VNWA 3OW3A 2C69A 3JY0A 4L6QA 3RMFA 5AM7A 3UOHA 2ZM4A 5LMKC 3PVBA 4NTSA 3GCSA 2BROA 4QPMA 3RCDA 4A06A 4JBPA 5F95A 3C4WA 1MQBA 5CX9A 5E1SA 4C3RA 3GU8A 2PMIA 4XG9A 3E63A 3R6XA 4QYHA 4EOKA 3MH1A 1HCLA 3FZRA 5JQ8A 2XK4A 4ZZNA 4MQ2A 4U81A 3TZ7A 4A9YA 4YTHA 3I6UA 2GS6A 2OGVA 5EDRA 4AOTA 3ITZA 5B2MA 2X8DA 2R3PA 1W8CA 3LCSA 5CZIA 3ZO3A 4JI9A 1I44A 3CBLA 4FTKA 3MVJA 4IEBA 1OUYA 3AD4A 3IW4A 3RK5A 4IDVA 4D5HA 4I93A 1TQPA 2C0IA 2VGOA 5ANEA 5K4JA 2OLCA 4F9CA 3CC6A 3DB8A 4JAJA 3C9WA 3MPTA 4YJQA 2C6MA 3VS0A 1OL7A 2WMWA 2WU6A 5CYIA 3V51A 3VQUA 3W16A 5FXSA 3C4XA 4C3FA 3WI6A 4U43A 4LQMA 4KIQA 1J7UA 4ZZMA 2W96B 4FKVA 4KINA 3EQGA 2XRUA 2W1ZA 4I0SA 4LYNA 4YMJA 1LPUA 1YXVA 5AR5A 3UO4A 1I09A 2WMQA 4G1WA 3UOJA 4KABA 4LMUA 1P2AA 3L8XA 4W4YA 4J1RA 3TTJA 1MRVA 5L6PA 5A54A 2WMBA 3T3VA 1ZWSA 3ZZEA 4C2WA 3PJCA 1DAWA 2X7OA 4M8TA 3R9HA 3PG1A 4R5YA 4BTMA 4FV1A 5DHJA 2NP8A 3F66A 4G5JA 4MCVA 4R3CA 4I5CA 4JG7A 5E8UA 3VWAA 1ZAOA 4Y72A 4EOMA 4DGOA 2OF2A 4GIHA 3AQVA 1J1BA 4G34A 4YZBA 3GI3A 2JDSA 4F7JA 4CFUA 3F9NA 4N57A 4PDPA 2UZBA 4LGGA 3A7GA 5M55A 2HZIA 2JAVA 5TKDA 2UW4A 4ZY6A 2OG8A 5AX3A 1YHWA 4O7ZA 4A4XA 4U42A 4AAAA 3UBDA 4GK3A 4M0ZA 3OVVA 4FTIA 3EYGA 4FKSA 4CFXA 5LMBA 4NK9A 4ZTMA 3ULIA 5HE2A 4BDFA 4IXPA 5DE2A 3CQWA 2GNLA 1FBNA 3V5TA 1TQIA 2Y6MA 4YO4A 3TUBA 5EM5A 2PSQA 2CNQA 4JG6A 3R8VA 3WF8A 3P1AA 2EVAA 4FSQA 2ITPA 2P3GX 3OXZA 1XO2B 1PKDA 1X8BA 4YHFA 4YC3A 3POOA 3BYOA 4EH3A 4NJDA 4I20A 3A99A 5AV4A 5F9EA 4WNOA 1UU3A 4BIBA 1Q61A 1SZMA 3V04A 2BIKB 2AC3A 3MY0A 3TG1A 2R4BA 3P9JA 4I41A 1KSWA 1FQ1B 3R9DA 3U87A 5A4EA 3E3BX 4F9AA 3GUBA 3A61A 1APME 5I5ZA 3SXFA 3H9OA 3BU5A 2WTIA 3PPJA 3V5PA 4TT7A 2VO6A 4CEGA 2UZNA 2RFDA 3IOPA 1H28A 1XJDA 4JX3A 2HYYA 1AGWA 4BFMA 1W82A 3NNVA 3QF9A 4I92A 5H3QA 4D2PA 4CTCA 3G6HA 3PIZA 2WEVA 3C0IA 3E3PA 4AOIA 3QUDA 3WZEA 5CU6A 3BE2A 5BMSA 2ESMA 4L42A 3DNDA 3O2MA 2X4ZA 1RDQE 4FMQA 4KB8A 3PY3A 3BV2A 4FR4A 5AUZA 2V7OA 2X9EA 4IX3A 2PMLX 5J8IA 4ZP5A 3QA0A 3CD3A 2X7FA 4RX7A 3ULZA 4CFVA 4ZIMA 3HV4A 2UW6A 3GGFA 3HVCA 1F0QA 3IKAA 4NKSA 2VTAA 3EN6A 5L4QA 3HUBA 4QP2A 4BB4A 4BDEA 4H36A 2QO7A 2BIYA 5IEYA 4LOOA 5H9BA 4ALWA 3KN5A 3BI6A 4ORKA 3KXMA 3C4EA 4I6FA 4MBLA 3EYHA 3BE9A 3EL8A 3UYTA 2J0JA 2OJ9A 4XV1A 4FC0A 3TZ8A 2VRXA 1KWPA 3JVRA 4O21A 3EB0A 3AC8A 3QAME 4FIGA 5DBXA 4C34A 1KE6A 3F3WA 4IM2A 2PL0A 3B2WA 3EN9A 5CANA 3DQWA 1JKLA 5DIAA 3BBTB 3QRTA 4H3QA 4IAFA 5D9HA 4ACGA 2BAQA 3LPBA 3QD2B 4C57A 3FQSA 4JL9A 1PMNA 4C3PA 5HX8A 3BEGA 3VVHA 5JK3A 3PXYA 4FUXA 4DH8A 5HKMA 4W8EA 1E1XA 4M97A 1BUHA 4FKJA 2X2KA 2BRHA 3LFFA 3IDBA 2VN9A 4MAOA 1UNHA 5B0XA 4HGTA 4IAYA 3R30A 5IH4A 3ZC6A 1IR3A 2FUMA 2OO8X 4QNAA 3I4BA 3FI2A 4JQ7A 3FC2A 4M0YA 4PNKA 1JPAA 3CP9A 4G17A 3DBDA 4JVGA 4MVFA 3NMUF 4YBKA 5L8JA 2V5QA 4E6AA 1BKXA 3ZU7A 3R2YA 4YTFA 4AGDA 2PUNA 1XHAA 3B8QA 3AC5A 4NJ3A 4U8ZA 3NNXA 2W5HA 4JDKA 4F9WA 3Q2JA 5HCYA 4ZTLA 3CTHA 5LQFA 3LW0A 4B4LA 1PRYA 4G5PA 4AXAA 4EH7A 4EQCA 1SM2A 2HWOA 2XJ0A 2RG6A 3GC8A 2KULA 3R28A 4IX4A 4RVTA 5HESA 1WBSA 4YJSA 3TM0A 4XG4A 5HLPA 4RIXA 4F9YA 1BL6A 3R02A 3JYAA 2WXVA 4R77A 3F3TA 3I0OA 3JS2A 5CNOA 4UMRA 3GU4A 5C01A 3NS9A 5HICA 4B7TA 2FB8A 3LXNA 2OFVA 3DT1A 4ARKA 4D1SA 4EK5A 3IG7A 4FKGA 4XP0A 5HO6A 3AMAA 5HI2A 4GT5A 3GOPA 3QFVA 2E9OA 4YGAA 5CEIA 2IG7A 1IA8A 3GP0A 3NYXA 2RL5A 2PZIA 4PTCA 1K9AA 2X4FA 3ZFMA 4DINA 2R0UA 5J79A 3FYJX 2WZJA 3WZJA 2YA9A 4F64A 3BQCA 5DA3A 4XV9A 3Q60A 4IFCA 4IJ9A 3WYYA 3MIYA 4L44A 2O3PA 3LOKA 4FZAB 5FEQA 1IEPA 1JKTA 3SQQA 2VUWA 3QA8A 3QD0A 3QZHA 3OWPA 4X2GA 1JKKA 5KMOA 3AD5A 2PZPA 3ELJA 5I9VA 1G3NA 4B8LA 4GFOA 1ZZ2A 1S9IA 4FTRA 2XKCA 1PJKA 2XNNA 2XIZA 3LCKA 4TXCA 4EHEA 4N4SA 2FYSA 4FL1A 4ANSA 3MESA 2HELA 2WOUA 1V0OA 4C59A 5CAUA 3QGYA 3TWJA 4BBMA 3PUPA 5FUTA 3NIZA 1U5RA 4U44A 3S95A 4AN3A 2OIBA 5IUHA 4FSWA 4E20A 3CD8A 3K3JA 3G2FA 4R7HA 5ETCA 4ZTRA 3ZTXA 3HV7A 4FG7A 3F6XA 3F7ZA 4FVQA 4AE9A 2YN8A 4YTCA 5AR3A 4D2VA 3Q2MA 3FXZA 4AW5A 4XS2A 4ZY5A 4E26A 3DU8A 4QMXA 4S32A 4FTMA 4AT5A 4K9YA 3U6HA 2Q83A 4CFFA 3NYOA 1W84A 5K0KA 2R3HA 2IJMA 3ORPA 5M53A 2BKZA 3H3CA 4I5PA 4CCBA 2PYWA 2W05A 3NUXA 2BTRA 3BBWA 4IX6A 4AT3A 4M13A 3OP5A 1GY3A 4CG9A 4DG0E 4LUDA 3SRVA 4FK3A 4HNIA 4GG7A 5BMMA 3LLTA 4ANNA 3CY2A 4JDJA 5AIKA 3F5GA 5AR8A 3RAWA 3HRCA 3FZ1A 4RVKA 3AGLA 2JKOA 1AD5A 3OT3A 4M15A 4ZEGA 3ZLSA 4P90A 4FNZA 4FV6A 2ETMA 4ZTQA 4ITHA 4FOCA 2V55A 4CVAA 4RWKA 4ASZA 1YHSA 3R04A 2R7BA 3CQUA 4YSJA 3TIZA 4G9RA 1ZYLA 1IA9A 2FSOX 4CD0A 3MVMA 3OTVA 3KB7A 3AT4A 5DVRA 5FTGA 5IH6A 4RJ4A 2I40A 4FKQA 1REKA 2E2BA 3UODA 3W32A 3KF4A 4ASXA 2JKMA 2VTLA 5EW8A 3UP7A 5FXRA 3FI8A 2UZLA 4FG8A 4J53A 1V0PA 3EMGA 2WMUA 1R3CA 1PXPA 3FL4A 3U4WA 3LMHA 5T6KA 4O6EA 5EQYA 1BX6A 4GK4A 3DZOA 4K1BA 5AM6A 2PULA 5AFVA 2HZ0A 3NCGA 4AU8A 4DBNA 4ACHA 1LP4A 5LOHA 3I60A 3BGPA 1GNGA 3RK7A 2QD9A 3IOKA 2QR7A 1B39A 4M67A 3QTRA 4EOJA 4EK8A 3ACJA 4PP7A 2WU7A 3KN6A 3OWJA 5EH0A 2VTRA 4O81A 2JITA 4Z55A 4GFMA 2I6LA 4GT3A 5AMNA 3ERKA 4X6QC 2QHNA 2YIYA 3OCSA 5J87A 3RAIA 4E4LA 4A4LA 3CPBA 4YTIA 1AQ1A 4DEAA 4EH2A 4LGHA 4CG8A 2XIYA 4JNWA 2BMCA 3ZCLA 5J5TA 5K9IA 4C33A 3P5KA 2OI4X 2X81A 3LM0A 4EKKA 4QYGA 4XLVA 4OW8A 3SGCA 4WSQA 3LXKA 2C1AA 4I23A 5CSXA 4R6VA 2G9XA 1OKWA 4ZS0A 4M7IA 4CZUA 4ZSGA 3QCQA 2PMNX 3PJ8A 2O65A 3GT8A 4IQ6A 5KE0A 3LMGA 4F99A 2XYNA 1PMUA 3G0FA 3D5WA 4ID7A 1Z9XA 3DCVA 4MBJA 4Q9SA 3UNZA 5K5XA 4I6HA 3D7TA 3MTLA 3MS9A 4FOBA 2C0OA 3Q9ZA 2FVDA 4JR3A 3F2AA 3QZFA 4E6DA 3BEAA 3DAKA 4WRSA 4DFLA 4YP8A 4UWYA 5C8MA 5TF9A 5I9YA 3UO5A 4U41A 3A7IA 4DN5A 3MWUA 5JEBA 3C51A 4F1TA 4NFMA 4ZAUA 4V04A 4N70A 4QP7A 3HDMA 3VHKA 4HVDA 2Y7JA 3R7OA 3IDPA 5HE3A 5BYYA 1YI3A 1YWVA 1FMOE 4UWCA 4YSMA 1OM1A 2B9FA 1XQZA 2BR1A 5C4KA 3QD3A 2YLFA 3KRJA 4GVAA 5EW9A 3MPMA 2GPHA 4LG4A 1OZ1A 4YHJA 1IASA 4QTDA 4NW5A 5IMEA 1P14A 2PMOX 3KFAA 4YJPA 2BFYA 3RWPA 2ZV7A 3ACKA 3VUGA 1PY5A 4PMTA 2V7AA 3DQXA 3F69A 1MQ4A 3D14A 1PXJA 4JOAA 5CF4A 5I3OA 3VW8A 2XYUA 4U3YA 4FICA 4WUNA 4F6UA 4WG5A 3RBWA 2IZTA 3DJ7A 3M2WA 3EFKA 4I94A 4NTTA 4MF0A 3R83A 3SDJA 2WKMA 3G9LX 1URCA 5CT7A 3DV3A 5EHYA 4F09A 2VWVA 3GXLA 2ZB0A 3FMMA 2H34A 2UZUE 2GFSA 2YCRA 4F4PA 3OC1A 2C1BA 3F5XA 5CVHA 5KMJA 5AA9A 1DI9A 4DTKA 3POZA 4BC6A 3AC1A 4K8AA 2XF0A 4EBVA 5IA2A 3VF8A 2QKWB 2WIHA 2YABA 3ALOA 1ZYCA 2ERZE 3MB6A 4FT3A 4QP3A 4O7WA 1YI4A 3BIZA 3FKOA 5C26A 2BRBA 2PWLA 4J71A 3SV0A 3EQBA 3K2LA 1YHVA 2REIA 2UZEA 3DKFA 5ANJA 3BELA 3QQHA 5TT7A 3CSVA 1WCCA 1WFCA 4QMNA 4RJ6A 4HJOA 4USFA 4C7TA 4CYIA 3OMVA 1YVJA 4D4VA 4BF2A 1YQJA 2XK8A 3ROYA 1OL2A 3BWJA 4QMQA 5BVOA 4FTJA 3D7TB 3CKWA 3G51A 4O22A 3MH2A 4NCTA 1G5SA 5IKWA 5CU0A 3FC1X 3NUSA 4FVPA 3UQGA 1NT2A 1YDTE 2J5FA 2HY0A 2UW5A 4FEQA 4UY9A 3ZZWA 4MWIA 4CT1A 3WF5A 3C0HA 4O0RA 5AP4A 4EOQA 5TOZA 1P4OA 4G16A 1M2PA 3KF7A 1M2QA 2PVRA 4QT1A 4KKEA 4FV9A 4RLKA 4UBAA 5GHVA 3PA5A 1XBBA 4KS7A 3ZRLA 4C4GA 2GQGA 5EG3A 5ANIA 4UB7A 3RK9A 2P55A 4BCJA 2QQ7A 3EQFA 3D5VA 2OXXA 2QODA 3JPVA 4EZ7A 4E5AX 3FXXA 3TCPA 2F9GA 2YIQA 2ETRA 1H24A 4CFMA 5BPYA 4JDIA 4YHTA 3BLQA 3D94A 3LHJA 5FEDA 2F2CB 5HO7A 3U54A 3FDNA 1MRUA 5HVJA 2A4LA 3KY2A 3PSDA 4H3PA 3DAJA 4DEDA 4CFNA 5E8VA 1Q97A 1SYKA 4J99A 4BCHA 4D4YA 5M56A 2XCHA 3FZTA 3NUPA 3O8UA 4EYJA 2YERA 3OTUA 3BGQA 1Q8WA 3OCGA 4U0IA 2QURA 3KK9A 3NSZA 5CWZA 5EYCA 3V5JA 1Y57A 2C5XA 3OHTA 2OH0E 4PTGA 4WRGA 4J8MA 4YNOA 2DUVA 3RVGA 4G3DA 2G15A 1WAKA 4O0WA 4GS6A 4YJOA 4XP2A 2C3IB 4IZ7A 4MD7E 5CY3A 1BLXA 2XMYA 4UMPA 3E8EA 4NCTC 4AS0A 3R8ZA 2RKUA 4BDAA 5HNIX 3LFEA 2QVSE 5JZNA 5FLFA 1Z57A 3QD4A 2WO6A 4UYAA 3Q6WA 4RA4A 4DCEA 3LMIA 4D5KA 4D1ZA 4AFEA 2GCDA 2WTKB 3I1AA 1PYEA 4C38A 3VUDA 4E5WA 4CLJA 5IUGA 3A62A 2CN5A 4YPDA 5HX6A 4JBOA 1DI8A 4G6LA 1IAHA 4G3GA 3AXWA 4IAZA 4DEHA 4FSUA 4LRKA 4TWOA 4FGBA 3NAXA 2C6EA 1OMWA 4RFMA 4E93A 1KOBA 1NVRA 1B6CB 4AZVA 1Y6AA 4JG8A 3R00A 3UG1A 2ZDUA 3H0YA 4NU1A 4ANMA 3G5DA 3O17A 4L68A 2W1EA 3MFTA 1M14A 2P2IA 3RNYA 2XP2A 3T9IA 4XUFA 2YJSA 1PYXA 2VTQA 3C1XA 3T9TA 3FHRA 5FD2A 4EWHA 5J7HA 3UC4A 3KEXA 3VRYA 5IQAA 2I0HA 3IO7A 4HCTA 3DXQA 1CKJA 2HW7A 3IS5A 4OTRA 4ACMA 3QUEA 2JIVA 2NRUA 1TKIA 5A4TA 3DDPA 4FVRA 4CTBA 4U6RA 3QCYA 5JH6A 4W4XA 4IAAA 3OBGA 4FSMA 2BZKB 4O38A 2R3RA 4AW0A 3VBYA 3WZDA 4BCMA 3GBZA 3FKLA 5AADA 3BGZA 4J52A 1K3AA 5FDPA 1CTPE 1ZYJA 2YISA 5AAGA 3RNIA 4B99A 3KXGA 4PPAA 4QMVA 5CT0A 4H39A 3COIA 3QLFA 1O6LA 3CGOA 3FBVA 4JDHA 4E4NA 1U4DA 2VWYA 2NO3A 3W1FA 4AACA 2DS1A 2C6LA 2V0DA 5E8WA 4KIPA 2VTIA 4UYNA 1YXSA 3ORNA 1PMEA 1VEBA 2YWVA 3ORLA 3HRBA 4JBQA 3E88A 4O0XA 1KV2A 4IIRA 1OI9A 2CN8A 4I4FA 5L2SA 3PSCA 3FZOA 4EQMA 4PDYA 4RIWA 3JXWA 2GMXA 1Q8TA 4JRNA 3LCTA 4RT7A 4WNMA 4Z7GA 2NNWB 3PXZA 1GJOA 4E4XA 3CS9A 4H1MA 3P08A 2GU8A 4D2RA 4F6WA 2V62A 1GIIA 4DLJA 2WB8A 2V22A 1OUKA 1GIJA 2BRGA 2ITNA 3ZXTA 4FIEA 2XM8A 3F2NA 3OF0A 3PXQA 4YUQA 4EJNA 1FVTA 4DEIA 3ORXA 2BTSA 3OWLA 2RSVA 3PPZA 3U4UA 3WF6A 5L3AA 4DT8A 4I1ZA 5BVWA 3A7FA 1S9JA 4DEEA 1UU7A 2ZM1A 5KX8A 5DT4A 1FMKA 3I79A 4Z9LA 2C5VA 1B38A 3P7BA 3IECA 1YOJA 5BVDA 4O0UA 4O84A 1STCE 3TV7A 5IQFA 1CKIA 4DT9A 4QO9A 2W9ZB 5LWMA 2QOCA 3OD6X 5GJFA 4ZSEA 3VIDA 3DGKA 4KIKA 4LRJA 3OEZA 4WBOA 5BVNA 5CF8A 5ANGA 5JRQA 3O71A 4XEYA 3FY0A 3U55A 3MA6A 5H8EA 4BDIA 3DK6A 3MN3A 4TRLA 3G15A 3BHYA 4Z3VA 3FSFA 3MVLA 5M4CA 2JDTA 5M09A 5KZ0A 4XHKB 3R9OA 4GEOA 1YRPA 2BDJA 3PWDA 5ITAA 3W2RA 3E8NA 1CM8A 2YEXA 2YFXA 4CLIA 4O7VA 4FSZA 3SLSA 2WFYA 3ZO2A 3Q53A 3BLHA 4S2ZA 3VULA 3TXOA 4TZRA 2VX0A 1NXKA 5GNKA 3RHXA 1PXMA 3NUYA 5CAQA 3S1HA 2C3JA 4GH2A 5CQWA 4CV9A 5HBEA 3BHTA 1XR1A 2UW8A 1ZMWA 4XV2A 4J96A 3V6RA 2XK9A 2BUJA 5M51A 3K54A 1G8AA 2R3IA 4GMYA 5DRBA 4RC3A 4RIWB 4E5BA 4FBXA 4GU6A 3MW1A 3VUKA 5HO8A 4RVLA 3T8OA 3WE8A 3LAUA 2PZ5A 1ZOHA 3ET7A 3KXXA 4TWCA 2ITXA 2PVHA 3QTXA 3UNJA 3DA6A 4M12A 4ZLOA 5GJDA 5BYZA 4XV3A 3QU0A 4TPTA 2QLQA 2QOFA 4QOXA 3VUHA 4FKTA 3UPXA 2CNVA 3MH3A 1A06A 1GZOA 1PF8A 3OOGA 3QTIA 2YAKA 3I7CA 4I0TA 3V5LA 1NVSA 1ZMUA 4GRBA 4MBIA 5L8LA 4BKYA 1P5EA 4O1PA 4UXLA 2WMAA 4TY1A 5GJGA 3BRBA 4IZYA 3W33A 4C4JA 4DGLC 4DFBA 4PTEA 2UW3A 3L8SA 4BICA 4I5MA 2WMXA 4OAUC 1XH4A 4PP9A 2PUPA 4S31A 4KIOA 1OKZA 4LV8A 5AA8A 3FMJA 3VS1A 2VTNA 4QMMA 5JFVA 4EQUA 2FSLX 3IGOA 4N0SA 4F0GA 3PP0A 4UX9A 3GC7A 3MFUA 1H1PA 3F2RA 4KIKB 3HECA 2QOOA 4XCUA 1XBAA 3A4PA 3PRFA 5CAOA 5IQGA 2OW3A 4M69A 4AA0A 4EK4A 2X6DA 4O27B 4QTBA 1GZNA 4DTBA 4V01A 4O91A 4WKQA 4FEUA 4I22A 4RA5A 3NUNA 4P5QA 4CSVA 3D5UA 4PMPA 2AC5A 2BRNA 2DQ7X 1BI8A 2GQRA 5JFXA 3BU6A 4ZSJA 4MTAA 4RWJA 2W4JA 5EOLA 3G9NA 5IDPA 4HPTE 1YWRA 2XBJA 2HCKA 3AT3A 1CKPA 4FV2A 5HU9A 5IU2A 4OTWA 3R9RA 2J5EA 2I1MA 2WMVA 2Z60A 3EFLA 3CTJA 4KSPA 4GU9A 2W1IA 3DJ6A 3R8UA 3ZC5A 3W2OA 4MYGA 4WA9A 3IDCA 2UZDA 3Q9XA 4K18A 4S30A 1UU9A 4JQEA 3E5AA 1RJBA 3COHA 3CEKA 4AT4A 4RIYB 5I4NA 3EQRA 2EUFB 3HP5A 4JX7A 3HMMA 2HXQA 4NM3A 4YLLA 3WE4A 2XH5A 5JGDA 2J0IA 1VYZA 4WUAA 2JAMA 4W9XA 3UVQA 3W2PA 2Q0BA 5TR6A 3I5NA 2BHHA 4Q5HA 4ZZOA 4EHGA 2W99B 1FGKA 2ONLA 4K2RA 2YM6A 4FZ7A 4D55A 4OT6A 5LXMA 4O0SA 3GCUA 4FKLA 4G6NA 4NT4A 3FLYA 3VBWA 1ZYSA 2JBPA 4E6QA 2JKQA 2XVDA 4GSBA 4ZMFA 3VBQA 4HVIA 5CI7A 4QNYA 3KRLA 4GK2A 4FSTA 4ZJIA 4L01A 5J7BA 1U46A 4DH1A 5B7VA 2C3KA 5DN3A 2QU6A 3QLGA 1BI7A 2BAJA 3TACA 3R7UA 3TNIA 1SMHA 4D28A 5CVFA 3ANQA 4EBWA 4L9IA 1PXKA 3WARA 5C4LA 2R0IA 5A46A 4CRSA 5FTOA 3FLQA 3HP2A 3R7GA 2CKQA 5HQ0A 5IA0A 1UWJA 5L2IA 5GINE 2PUIA 3KXZA 4FNWA 1XH7A 4JXFA 4M69B 4BDJA 3OZ6A 4C8BA 3O8PA 3FHIA 4AW2A 5I0BA 2W1CA 4RSSA 4ANLA 5JN2A 2W06A 2H96A 3O0GA 3C0GA 3Q6UA 1YXTA 3H10A 3KVXA 4HZRA 4TNBA 3GOKA 4EJ7A 2J50A 4U97A 4MK0A 3Q4CA 3MJ2A 5DPVA 5GZ9A 5JQ5A 4IVBA 4NM5A 3L9NA 2ONLC 4FKOA 2CGWA 4K77A 5ETIA 4C4FA 5AIRA 4AZFA 2C6IA 5L2TA 1T45A 4RQKA 3DDQA 4MEDA 4TWNA 4O0YA 3CLYA 3GB2A 3AT2A 1OL1A 3QCXA 4QTAA 4S33A 2P4IA 2VGPA 5D7AA 5AP7A 1H01A 3R8MA 3GU6A 4G31A 4PPCA 3Q4ZA 1RE8A 2A1AB 4FGRA 5IPJA 2XRWA 3UOLA 4PRJA 4Q9ZA 5K0XA 5CNNA 2CGUA 4RJ3A 4XLIA 3PXFA 2CCIA 3P79A 1WZYA 3UOKA 3AC2A 3NZ0A 3U6IA 3C5IA 5CEQA 1QL6A 2IVSA 4NUSA 4RRVA 3GC0A 3PA3A 3PYYA 4FKPA 4FZFB 4M3QA 4XG7A 3ZLYA 2QOIA 4A07A 5CSPA 4TWPA 2XNBA 3UE4A 3FXWA 4C62A 3GC9A 2JIUA 2P33A 4DTAA 4QQCA 2IVTA 1RQQA 5AP6A 3REPA 4C4HA 2HZNA 3IW6A 4JLCA 3HNGA 3QX4A 4EUUA 1YDRE 3QWKA 2CKEA 3DPKA 4HOKA 4XMOA 3TEIA 3IK3A 4QMWA 3OUKA 5ACBC 1FVVA 2PPQA 4XX9A 3CE3A 5D10A 3QTSA 4L7SA 4AA5A 3F61A 4MX9A 5EYDA 5HCZA 1BMKA 4G3EA 4YZ9A 5HG9A 1UA2A 3OCTA 3W2SA 5B2KA 5AV0A 4CMOA 5HTCA 5E4HA 3S3IA 4YJTA 4FV3A 5EKNA 3O51A 4UMUA 2H8HA 3VJNA 4QYEA 3OEFX 3OFMA 4HVSA 1YKRA 5CENA 4O6LA 5E1EA 4M14A 2ZYBA 3TIYA 3O8TA 4PF4A 4BTFA 3NEWA 3RALA 2Z7QA 1QPCA 4IB3A 5AP1A 3V8WA 3QTUA 3PDTA 2HY81 3D7ZA 4HYSA 1VR2A 5HE0A 2O2UA 4CQGA 4QPSA 4GKIA 4QQTA 3KK8A 5ANOA 3FMKA 4I3ZA 4BGQA 2WELA 2PZRA 3OWKA 3UVPA 5DMZA 3CGFA 4L7FA 3KGAA 3R2BA 1FVRA 4QP1A 3F82A 5H2UA 5CEMA 2WQOA 4JS8A 5D7VA 1UNGA 1O9UA 3VNTA 2IN6A 4H3BA 3S2PA 4TYIA 5EM6A 2VWWA 4QRCA 4UXQA 4O83A 4KKHA 4DGMA 3SVVA 3UDBA 1ZOGA 3F3ZA 3FMNA 1YWNA 3NPCA 3NYVA 4RJ5A 1H0WA 4TYHA 4WNKA 5JFSA 4Y5QA 4R7IA 2I0EA 5KHWA 5J1VA 3ENMA 4Y95A 4OTFA 3ZUVA 2VNYA 4HPUE 4OGRA 5IEVA 3UQCA 3V5WA 5EI8A 3GCVA 3FEGA 3UNKA 2ZMDA 3UIXA 2KTYA 4FSYA 2ETKA 4MXOA 3DKGA 3KQ7A 4IJPA 4BCQA 3NVMB 3FYKX 4MXXA 5IISA 5CF5A 4YC8A 4ZY4A 2QO2A 5KZIA 3R7VA 2G2IA 2XZSA 2R5TA 5C27A 4B8MA 4BCOA 4F1MA 3VN9A 3BHHA 3A60A 1Q3DA 2C47A 3FZPA 4YJUA 5CAPA 2UW0A 3LQ3A 3GCPA 4ALVA 3C7QA 3QWJA 5FM3A 2H6DA 3FI4A 3LFDA 4XG8A 5KMMA 2HK5A 5IQCA 4GFGA 3CIKA 3R9NA 3HMOA 3CXWA 4GV1A 2C3LA 2VO7A 3QRJA 3E87A 4IE9A 3LJ2A 3SD0A 3EOCA 3VF9A 2YAAA 2FA2A 3ORTA 4KUJA 2H9VA 3LXPA 5FEEA 5IG1A 5CQUA 5DI1A 4XBUA 3QQLA 4W4WA 1H27A 4UN0C 4AP7A 4C0TA 4O96A 2NPQA 3LFSA 4U45A 3MGYA 4L43A 2ERKA 2QOBA 2YIXA 4QQJA 4TTHB 2YM5A 3JUHA 2CKPA 3FJQE 3LE6A 4UMQA 4ZSLA 2PTKA 3WF9A 4KBKA 4O2ZA 5DT3A 4CMTA 4NW6A 4AZSA 1E1VA 3RCJA 1GIHA 3QRUA 3A8XA 4EC8A 3EQCA 2EB2A 4FIJA 3ZBXA 5CEOA 2OIQA 4DH3A 5T3QA 5A3XA 5CU4A 2FO0A 3RI1A 3OG7A 5FP6A 3BYSA 3QUPA 4WO5A 4ANQA 1OL6A 2XS0A 4FZ6A 3OUNB 1OPJA 3BYUA 2RFSA 3BYVA 3VS6A 4C2VA 4I6BA 3N4TA 5C8NA 3PP1A 3TKHA 4IB1A 4ENXA 4NH1A 2RFNA 3ALNA 3DAEA 3NRMA 4FTLA 3SG9A 2XEYA 5DR6A 3PRIA 5KMIA 2C4GA 4TYHB 4CT2A 3DK3A 3QRKA 4EUTA 3E62A 3ORMA 5BX0A 2W17A 3I0QA 2VTSA 3UZRA 2W4KA 3H9RA 3LCDA 3ORKA 3R63A 4FI1A 4XRLA 5CS6A 2YWPA 5DEYA 1OKVA 3PVUA 3TJCA 4BZOA 4CNHA 5JKGA 2CGVA 3IW5A 3OXIA 3EL7A 2QOLA 2ZB1A 1H8FA 2GS7A 3BV3A 3II5A 4K0YA 5JRSA 3TNPC 4CZTA 2LAVA 5L2WA 4FTUA 2XKEA 2R3LA 3BU3A 3QX2A 4GVJA 2YM3A 3Q5IA 4S34A 4UALA 3UPZA 4PX6A 3AOXA 4WIHA 2XNOA 3TV6A 2YM8A 5EFQA 3L8VA 3M11A 4FIIA 4BGHA 2W1FA 2WNTA 4IBMA 3V3VA 5IA5A 4BGGA 2VWBA 3MSSA 2PU8A 4QPAA 4FK6A 3NUAA 3ZUTA 4GIIA 4ZXTA 3W8QA 5E8SA 5BVEA 4IM0A 1JKSA 4B0GA 3QZIA 3Q52A 5HVYA 5HU3A 4BL1A 1YXXA 2UVYA 1CMKE 2HXLA 2JFMA 3PWYA 4NSTA 5A9UA 4ERKA 1YI6A 4F9BA 3DOGA 5H8BA 2PVFA 4QMOA 4FTTA 5ANDA 2Z2WA 3MFRA 4J7BA 3DLSA 2QOKA 2ZDTA 4BDGA 2B9JA 4YC6A 4KS8A 5EM8A 1J7IA 1GZKA 2WQBA 3G6GA 4GUBA 4ASEA 2B52A 4YZMA 5DEWA 2IWIA 2GSFA 4KD1A 4BWKA 2EXEA 2VAGA 1WVYA 5HZNA 4AE6A 3U6JA 5CLPA 3C5UA 4J95A 4AFJA 5JMSA 3V5QA 1PKGA 4F7SA 3EQHA 4BVUA 3FY2A 5DG5A 2OJIA 4AN2A 5JGBA 4YURA 3PJ3A 3KREA 4F70A 4IZ5A 3UO6A 1QCFA 4O2PA 1PXNA 1ZOEA 3KULA 3U9NA 2R3GA 3G33A 4FKWA 4BCKA 3RZBA 3FPMA 2R3FA 3MIAA 4DC2A 4MNFA 1R0EA 1QMZA 4GJ2A 2JDRA 2GTMA 3TJDA 2JFLA 3FLZA 2WMSA 5FXQA 4NIFB 3E64A 1H26A 4O86A 3OBJA 5CEPA 3OROA 3R7IA 2HWPA 3FLNC 3S4QA 2ITVA 3OY3A 1MRYA 2FGIA 4X21A 3TN8A 3U9CA 3D2KA 3N4UA 4U3ZA 1HOWA 4PDOA 5KUPA 2X2MA 2IZRA 3LJ1A 4DFXE 4NYEA 2DWBA 3LM5A 5CU3A 1SNUA 4D0WA 1OVEA 4FNXA 3ZFYA 3GEQA 3MB7A 3IW8A 1QPDA 4JJRA 4D2WA 4H58A 1O6KA 3MYGA 5ETAA 2C6OA 3SG8A 5J9YA 4W8DA 1BYGA 5HBJA 4BDCA 5IEXA 1R1WA 4MQ1A 4A7CA 5LCJA 1ZARA 3ZOSA 3LFNA 3NR9A 3QBNA 3RHKA 3VS7A 4BHNA 5FM2A 3HGKA 4R3RA 3HL7A 4K33A 4RG0A 4BIEA 5J1WA 4OTGA 2RG5A 4B6LA 1TQMA 3BHUA 5AEPA 5FDXA 2RFEA 2QOHA 3ZEPA 3ZHPC 4F08A 5BUEA 4HVGA 1URWA 2R3QA 1NW1A 5HE1A 2F4JA 3TV4A 4PUZA 1QPEA 4LMNA 4ENYA 2VWIA 2WTKC 4XRJA 5EDQA 2HENA 4ZJVA 1VYWA 4ZLZA 4DAWA 3PFQA 4WG4A 2E9NA 5IF1A 2RGPA 2R2PA 4O7RA 4QD6A 2G2HA 4CXAA 4YJVA 4I21A 1NY3A 3DS6A 2GHLA 3U51A 4BBFA 5HG5A 4BZDA 2W7XA 3QKMA 4BIDA 3RM7A 2G01A 3KULB 4HYIA 4APCA 2CGXA 1KE9A 3QYWA 4QMYA 4FIFA 1ZRZA 1H25A 2VTOA 5DOSA 2B9HA 4ERWA 4TKSA 1M2RA 2UZVA 4MXYA 3ZO4A 4D2SA 5HTBA 3PIXA 3DLZA 4FTAA 3TZMA 3VS2A 4E73A 3UG2A 2EB3A 2QCSA 2J0LA 1LUFA 3MY1A 4XOYA 3QQUA 5LCKA 4EZ5A 3DKOA 2WTVA 3PY0A 3WZKA 4W4VA 2J0MB 2WOTA 3LVPA 3PZHA 4WSYA 3PVGA 2F7ZE 4II5A 3R7EA 2WTJA 1WMKA 3R1QA 5A6OA 3F7WA 3RINA 4O7YA 3FMHA 3OW4A 2VU3A 4J8NA 3EFWA 4NFNA 3SC1A 1JAMA 4KNBA 5KMLA 3LFBA 5I3RA 4O7NA 2W4OA 1YXUA 4QQ5A 1JNKA 2R64A 4DA5A 2VO3A 3NDMA 3BCEA 3GFWA 3RGFA 1Y6BA 3GU5A 5IA1A 5CTPA 4EONA 2BZJA 2QKRA 2Q0NA 1UKIA 4FEVA 1UU8A 1OIUA 3A8WA 4L53A 5E7RA 2WMTA 4EH4A 2R3MA 4MXCA 4IC7A 2YZLA 3AD6A 3R8PA 2W5AA 4BTJA 4D9UA 3TKIA 3FLWA 1JBPE 3KXHA 4D1XA 1H00A 3ZXZA 2ZMCA 2BHEA 4NKAA 4FKIA 2QONA 1XH8A 4KRCA 4RX9A 2IW9A 5A6NA 2WQNA 3ETAA 4JR7A 4YJNA 1OB3A 3ZONA 3KMUA 4JBVA 5DYJA 5EQEA 2XKFA 4OLIA 2WHBA 5IUIA 4DFNA 2ITWA 4EC9A 3E7OA 1LEWA 3R22A 1H1SA 3HLLA 2ITTA 5F20A 2ITUA 3PXRA 2Z02A 2YACA 2A27A 5DGZA 3L9PA 4RMZA 4QTEA 3PVWA 2C5YA 4XNEA 4DF3A 5HNBA 4UV0A 2X8EA 4ALUA 3Q4TA 3PXKA 4GW8A 2CNUA 2JIIA 3BPRA 3O50A 4YPSA 5DLSA 5HIDA 4I24A 4GKHA 2Z7SA 5F4NA 2X1NA 3BYMA 4ITJA 4J97A 3E93A 4FT0A 4FV5A 3D83A 4IVAA 1UWHA 2F57A 4BDDA 3KL8A 3EZVA 3DK7A 4IVCA 4AWIA 5LJJA 3DBFA 3MV5A 3DNEA 2WD1A 4ZK5A 4RBLA 4DYMA 3Q96A 2ZV2A 4EEVA 1JVPP 3QQFA 3WF7A 4ZJJA 4Y5HA 5HIBA 1J3HA 4IFGA 3HMNA 3QQGA 3GCQA 3LIJA 2YM4A 3LLAA 5BNJA 4FTQA 4OBOA 3RAKA 3KA0A 4PPBA 5M08A 3O96A 5EI2A 4WHZA 2J51A 3PY1A 2J2IB 3FPQA 2R3OA 3F5PA 2B1PA 4FKUA 5FBNC 1YOLA 3D2IA 3VBTA 5HLWA 4ZTHA 3C4ZA 5M4IA 3AC3A 3LZBA 2WIPA 4TNDA 4X2JA 4BZNA 3TTIA 4I4EA 1W83A 3TNHA 5G6VA 3UTOA 2GNGA 3KMWA 3HMPA 3NCZA 4JRVA 3ZDUA 4BYIA 3EHAA 4B9DA 4HNFA 4C02A 3NVKI 4FTCA 4CQEA 4BR3A 4GJ3A 3WBLA 3IW7A 3O7LB 2XIKA 2BILB 2YITA 4R1VA 5I9UA 4RFYA 5JGAA 5CXHA 5EI6A 4GYGA 2XUUA 4DEGA 3UVRA 3MA3A 4EH8A 1M17A 2X2LA 1L3RE 4BKZA 2PE1A 5DH3A 4BKJA 3M1SA 4DGGA 3JY9A 4NWMA 4UMTA 2J9MA 3FQEA 2R3KA 5AR2A 3ODZX 5HG7A 3QQKA 1ZXEA 4QMPA 3NW5A 4D4RA 2O5KA 2BZIB 5AP2A 2CSNA 4RVMA 5C9CA 4E7WA 3DXNA 4HVHA 1CSNA 3PJ2A 4YZDA 5HIEA 3N4VA 3HEGA 2QG5A 4G9CA 4HGEA 3HDNA 2GFCA 3M42A 3EKKA 3R1NA 4RIYA 5FQDC 2IVUA 4L8MA 4AGUA 1ZY4A 4Z7HA 3PLSA 4O0TA 4PNIA 5FRIA 3SW4A 3O7LD 4ZOGA 4Y83A 2F2UA 4MXAA 3ORZA 3B8RA 1OIRA 3MI9A 4K11A 4XOZA 2PVLA 2QLUA 3MPAA 2QI8A 4FZDB 3DFCB 5AV1A 1UNLA 1P4FA 2XA4A 4USEA 3NAYA 3HX4A 5LMAA 4KWPA 2IPXA 1W98A 4JT3A 3FWQA 3LQ5A 4EORA 5ICPA 1V1KA 3RWQA 2WQEA 3ID6C 2I0VA 1SNXA 4P7EA 5D1JA 3VQHA 4AZWA 2IW8A 4UEUA 3DTWA 4BRXA 3SX9A 2A2AA 3FQHA 1Q8UA 4FF8A 5K3YA 3W2QA 4IMYA 5M4FA 3C4FA 3BQRA 2A0CX 2R7IA 1W7HA 4RFZA 3IQ7A 1IG1A 2WPAA 2PK9A 2CCHA 4HYUA 3WIKA 4OAVB 5AAFA 2CLXA 3GQLA 2BCJA 4L67A 3OY1A 3QRIA 4I5HA 2J4ZA 4BI0A 2R3NA 2PUUA 3RPVA 1Q99A 2JDVA 5IQIA 3EQDA 3R1YA 4M66A 4DG3E 3QL8A 4X3FA 4EHVA 3SHEA 3KKVA 2W1GA 2A19B 3L1SA 4IHPA 4IM3A 1EH4A 4WG3A 3ROCA 3V01A 2QC6A 3PTGA 4F0IA 2BFXA 4LL0A 2ACXA 2YDJA 3PIYA 2HOGA 4LOQA 4OR5A 4QP8A 4FV7A 3HV5A 4R8QA 1BL7A 3NGAA 3TI1A 5A4QA 2XK7A 4O0VA 2JKKA 4RZWA 3BHVA 4FL2A 3KRRA 4X2NA 4X0MA 5EHLA 1J1CA 2OXYA 3AG9A 4EOOA 5KO1A 4FTNA 3DKCA 2DYLA 4DCAA 3P86A 4M84A 4O1OA 4AG8A 5JZJA 5IH5A 2EXCX 2OWBA 3HZTA 1YDSE 4NM0A 4Y8DA 3EWHA 5ACKA 1WBVA 3KXNA 4EL9A 5C1QB 2O0UA 5ANKA 3JVSA 3GFEA 1REJA 3ZH8A 5E8ZA 2QNJA 5J5SA 4MXZA 3COMA 4E6CA 1A9UA 2GHGA 2JD5A 5HG8A 2C6DA 1H4LA 4FEWA 2IO6A 3K3IA 2P2HA 2PVNA 3IONA 4EK3A 3Q9YA 2B7AA 2FSTX 2X9FA 2WGJA 4WD5A 5HNGA 5KHXA 3ZSIA 3H0ZA 1O6YA 1M52A 4X6RA 5KBQA 4Q5EA 4BDHA 2JLDA 2Y0AA 4WOVA 4DE4A 4D2TA 1R39A 3TUDA 4PMMA 3LJ0A 2GNJA 5E9EA 2UUEA 3A7HA 4X3FC 3MH0A 4C35A 1JWHA 4YR8A 3NX8A 4HCVA 2YCFA 3E8CA 3CQEA 2C6KA 3L9MA 2QR8A 3QCSA 1SVHA 3R01A 1H07A 3VJOA 4L46A 2YHVA 2JC6A 3Q04A 3RM6A 5FWKK 2PVYA 3VC4A 3OCBA 4HYHA 3UGCA 3LKMA 3PLAE 4C37A 4BWPA 2B54A 3PSBA 5D11A 2XK3A 1FGIA 3UQFA 4FIHA 3OOMA 4X3FB 5T68A 3CR0A 1MP8A 2BDFA 4UZDA 2F7EE 4BBEA 5L8KA 4EOIA 3QGWA 1DM2A 2Z7RA 5E91A 5AP3A 5LVNA 2Y4IC 4U80A 2OJGA 2UVXA 3DZQA 3ZSHA 4FODA 4AN9A 2PVMA 4V05A 1NVQA 3RTPA 2O8YA 3N9XA 1Q41A 1OIYA 2W1HA 4FT9A 4LM5A 4MNEA 3NIEA 4U9AA 3WZUA 4AZTA 3LFQA 4BCPA 3NYNA 1H1QA 1Q4LA 3BZ3A 2WTCA 3RJCA 5KNJA 3P7CA 4IC8A 1ERKA 4RIOA 4YLKA 3QQJA 5AV2A 3V6SA 4AA4A 2B9IA 2OKRA 4CV8A 4BCGA 5LARA 5KCVA 4CKJA 2UW9A 4G3FA 4X7QA 1J7LA 3DY7A 5I9WA 2XEZA 4PMSA 2Y4IB 1T46A 3P4KA 2C0TA 4FX3A 5HGIA 4U40A 5AAEA 1OBDA 3PE2A 2YCSA 4GL9A 1F3MC 4L3PA 4E3CA 4PV0A 4DH5A 1V0BA 1JOWB 3NUUA 1WVXA 4OUCA 4WNPA 1JLUE 2VTHA 1H0VA 2WQMA 3HYHA 1WBTA 4QMLA 1HCKA 4M68A 2YJRA 4ZTSA 3Q4UA 3ZYAA 4ZSAA 3EJ1A 3EKNA 4PL4A 3FMDA 1FINA 4CGAA 4TL0A 3KRWA 2GHMA 3SXRA 3COKA 1SVGA 4E8AA 4FE2A 3TDVA 1PXOA 2CDZA 2CMWA 2IZUA 2OZAA 4E1ZA 4H1JA 5HTIA 3LCOA 2J6MA 3QTQA 3QTZA 4YJRA 1KUTA 3A2CA 2RIOA 3QC4A 4AW1A 2J90A 3ZM9A 5CASA 4O7SA 4H05A 5CU2A 3GVUA 2OICA 3VS3A 1OKYA 1PMVA 2PHKA 4AX8A 5H8GA 4FL3A 1YOMA 2UW7A 4KBCA 4DHFA 5AUTA 2EXMA 3KCFA 5CAVA 5E8XA 4CKIA 3FMEA 3Q32A 1WBPA 1VJYA 2O63A 2PVKA 4F63A 2AUHA 4MWHA 5IQHA 1JSTA 3NNUA 4FUYA 5LVLA 5CF6A 1L8TA 2F7XE 3EZRA 4LGDA 4Y46A 4QTCA 5IQEA 3NNWA 2YIWA 1PXIA 1VZOA 2C30A 4ZS4A 4FNYA 3VAPA 4MNEB 4FT5A 3L9LA 4BY9E 3FZSA 4CRLA 2XB7A 4LV5A 2BPMA 3GNIB 5HLNA 4IWQA 5LVMA 2J7TA 5HVKA 2ITQA 3IGGA 3ENHA 2VV9A 3PA4A 4N6ZA 2Y4PA 4WT6A 4O82A 4U5JA 4KRDA 5EYKA 4OTIA 4OBQA 4XYFA 5HBHA 4FV8A 2X39A 4DITA 1WBOA 3ZLXA 4EH6A 3EQIA 4GT4A 4NM7A 5AR4A 4BWXA 4YLJA 2YCQA 1ZZLA 4C4IA 5EKOA 4DG2E 3D15A 3RPSA 5BYLA 4PY1A 3VBXA 5J9ZA 3SOCA 1ZLTA 2OZOA 5GZAA 4EI4A 1OPLA 3VO3A 4IZAA 2CKOA 3W18A 4FSRA 3QZGA 4IWPA 2X7GA 3DJ5A 4U7ZA 3K5UA 4O7LA 3L8PA 5KKRC 4APPA 1SVEA 1RW8A 2LGCA 3DB6A 4L3JA 4LFIA 3RPRA 3HUCA 3HRFA 3VS4A 4BDBA 4DFYA 2OZAB 2QU5A 4P5ZA 3R71A 2UV2A 2XCKA 5AUYA 4R3PA 2VZ6A 3LFAA 1KV1A 4USDA 4Q2AA 2X0GA 3HV6A 3W55A 5CXZA 3TUCA 2G2FA 2VTTA 2XKDA 3W2CA 2XM9A 4RIXB 1DAYA 4AGWA 3IPHA 3TNWA 1FPUA 4IANA 5HEZA 3C13A 4G6OA 5CI6A 4YU2A 5M57A 3FE3A 3MY5A 5KKRB 2YDIA 3B2TA 2ZV9A 5BUJA 3CJFA 3WILA 3G90X 2BKKA 3QKLA 3R0TA 4C61A 3TL8A 3UJGA 4TYJA 1XKKA 3SOAA 2Z8CA
chains in the Genus database with same CATH superfamily
2W1DA 2OXDA 4MH7A 4IAIA 5HOAA 3ZEWA 1R0PA 3H4JA 4BCNA 1M7NA 3SW7A 5E92A 5G1XA 5HCXA 3TT0A 2ZOQA 2GNIA 3QYZA 3F88A 4LOPA 4AF3A 2AQXA 5B2LA 5TE0A 3SXSA 4X2KA 2YIRA 4EK6A 1OITA 2QO9A 1JSUA 4AQCA 2W9FB 2WTDA 2BRMA 5A14A 4F78A 1ZY5A 4L45A 2XBAA 1Y8YA 2PVJA 3PE1A 2CJMA 3RP9A 3T3UA 3ZMMA 3EIDA 4W9WA 4R5SA 3S00A 2QOQA 3HMIA 4XG3A 4IW0A 4DEBA 4RWLA 3I6WA 3ZRMA 4A9UA 3W8LA 4BHZA 3QHRA 4FYOA 2SRCA 1ATPE 3SA0A 3K5VA 4A9TA 5CSWA 5HORA 1VLRA 4G2FA 3P0MA 3OT8A 5CSVA 5FBOA 3R8LA 4MHAA 3VUTA 4A4OA 3QXPA 4Z16A 2HAKA 2YLEA 4RC2A 4JQ8A 4AXCA 3R21A 1H08A 1WBNA 4RQVA 3SKCA 4YZCA 3UYSA 1XWSA 2ZAZA 3HA8A 2VX3A 3C50A 3R7YA 2JEDA 1UVRA 4NIFA 3CKXA 4BI1A 5HD4A 3BLRA 3EFJA 5M4UA 2QHMA 4P4CA 5DNRA 2C5NA 5BQ0A 4GCJA 2OF4A 3RZFA 3A4OX 3BKBA 4KA3A 5AUXA 4R7BA 1GOLA 2J0KA 4QMZA 5E8YA 3HAMA 2BAKA 3D4QA 4ASDA 4EOPA 2EWAA 2HZ4A 4QP9A 1KOAA 5FGKA 1F5QA 1LEZA 2Y6OA 5E8TA 5EDPA 1JSVA 1U54A 2VWZA 2Z7LA 4JAIA 3QALE 3VUMA 2PY3A 2W5BA 2XNMA 4IACA 4LV7A 1M7QA 5EHOA 3UIUA 3UDZA 3QKKA 1OL5A 4E4MA 5M06A 2BALA 2VWXA 3AMYA 1LR4A 4AOJA 4IVDA 3F3UA 3FMLA 3SRVB 4FTOA 1DS5A 2XK6A 1Q62A 2PE0A 2C5OA 3QTWA 3WOWA 5CSHA 4EH5A 1A48A 2WEIA 4LL5A 4XJ0A 1FOTA 3UZPA 1E9HA 3ZBFA 5IA4A 1ZMVA 4Y73A 5JT2A 2CHLA 2CLQA 4L3LA 4OTQA 1Y91A 3MBLA 2JDOA 4V0GA 3C4CA 4BCFA 2QG7A 3CJGA 4D58A 5A4CA 3HV3A 2OK1A 1NA7A 2NRYA 4P2KA 5E90A 5AR7A 3TZ9A 4CZYB 4XBRA 3EN4A 4FV4A 2OJFE 5J9LA 4ANBA 5HD7A 4AUAA 4EOSA 4J98A 4RC4A 2ZVAA 2ZJWA 2XJ2A 5KMKA 5D12A 2UVZA 4L52A 4CCUA 2EU9A 3FAAA 5EK7A 4DH7A 3MFSA 2O64A 2YM7A 3I5ZA 5A4LA 3I81A 3W0QA 4X3JA 4WBBB 2BDWA 5DWRA 4O4BB 4PL5A 3UMWA 1WBWA 3ZSGA 4ZLYA 4CKRA 4FJVA 5KBRA 5M07A 2B4SB 5HHWA 1ND4A 4XH6A 1R78A 3R73A 4D4SA 5AP0A 4IWOA 4HZSA 5L6WL 2ZV8A 3KU2A 1IAJA 2ITOA 2E9UA 3Q5ZA 3VBVA 5GIOE 4RPVA 4GUEA 1QPJA 5AP5A 4HW7A 2GNFA 4F7NA 3UP2A 4HGSA 4L00A 1OBGA 2VTMA 1Q8ZA 1K2PA 4ANOA 2VTPA 5EM7A 5FP5A 1XBCA 4C36A 4F7LA 5AUUA 4KSQA 5CVGA 4QMTA 3PJ1A 4U79A 3GU7A 2UZWE 3OS3A 4PL3A 3VW6A 4EYMA 4F65A 4FKRA 4TYEA 3H30A 1U5QA 4YBJA 5IA3A 1OGUA 4FA2A 3WYXA 2FSMX 3ANRA 3MVHA 1U54B 2E9PA 3QHWA 3ZO1A 3UIBA 4LUEA 3P7AA 4CYJA 4TW9A 3RAHA 4RX8A 5DFPA 4RLLA 5JSMA 1KE7A 4QP4A 4D0XA 4DGNA 2AYPA 3FKNA 3ODYX 3ATSA 2OIDA 4I6QA 4RX5A 2ZM3A 2IW6A 2G1TA 3KCKA 3KMMA 2UZOA 3I7BA 4F0FA 4C58A 2WAJA 3NWWA 3MDYA 3GENA 1Q8YA 4ITIA 4KAOA 5K4IA 2F49A 3WIGA 1Z5MA 3QC9A 5LWNA 3MTFA 4V0GB 5DR2A 3ZFXA 4HGLA 3CPCA 4HCUA 2PE2A 4OTPA 5EW3A 3NLBA 3NW7A 4EWQA 3D0EA 2BZHB 2C6TA 5GIPE 5DR9A 1WVWA 4IX5A 5AV3A 2HIWA 2W0JA 3DBQA 3FUPA 4KBAA 5CZHA 4BCIA 4BTKA 5I9ZA 5KMNA 3DBEA 4QMUA 4RZVA 5M44A 1J91A 3P78A 1PXLA 4OBPA 4IWDA 4TN6A 3ZDIA 4RJ8A 4AGCA 1GAGA 4Y85A 4ACDA 4NZWB 3ZLWA 1W0XC 3FI3A 2VD5A 1YW2A 5DRDA 3DTCA 1PHKA 5AWMA 5L2QA 4TYGA 4R1YA 2OBJA 1GZ8A 1OPKA 3FL5A 3D5XA 4BDKA 3DXPA 3LXLA 2OU7A 4FSNA 2WTWA 5ETFA 3TKUA 3ZS5A 4DFZE 2OH4A 4NL0A 5IDNA 4CFWA 5LVPA 2GQSA 2JBOA 2IVVA 2XNEA 2OSCA 3KVWA 4X2FA 5EQPA 3ATTA 5IZFA 5IQDA 1KE5A 3VUIA 3W10A 4EKLA 4DBXA 4NEUA 3KC3A 3CY3A 5FTQA 5BUIA 4JIKA 4BYJA 3O23A 4JIAA 2B0QA 4RWIA 5BVFA 5J95A 3BWFA 2Y8OA 3THBA 1TVOA 4AZEA 3ZRKA 3MJ1A 3U8WA 4F6SA 4D9TA 2OJJA 2XNGA 3EN7A 4FV0A 5F94A 3KRXA 4CMUA 3UIMA 2XIXA 2PZYA 2X6EA 2X8IA 1PW2A 3EH9A 4DLIA 5I9XA 2XNPA 3FV8A 2IZSA 3V8TA 2BVAA 4OT5A 2RF9A 3RPYA 3DFAA 2R3JA 3EQPA 3CCNA 3JR1A 3P23A 4A9SA 3NW6A 4XG2A 5LVOA 4EZ3A 2CPKE 4R78A 5TO8A 2GNHA 1ZYDA 3VS5A 1IRKA 2P0CA 4DFUA 1UV5A 2ITZA 3Q3BA 1KE8A 4QYFA 5AUVA 4FG9A 4BN1A 4IDTA 5CALA 3Q9WA 2VO0A 1G8SA 2Y9QA 4MKCA 3PG3A 4MF1A 3SAYA 1H1WA 5FG8A 3PPKA 4GG5A 1Q3WA 2I0YA 3FLSA 4KKGA 4XG6A 2JGZA 4ACCA 2FH9A 2VWUA 3VHEA 3TDWA 4FT7A 4IH8A 1XH5A 3N51A 2E9VA 4IAKA 1JQHA 4ZMEA 3DBCA 2VTJA 3A7JA 3E92A 5IMXA 5JFWA 4ONAA 2I7QA 3OXTA 4FYNA 1Q24A 3AGMA 2VX1A 4UWBA 1OECA 4OTHA 2B53A 3RKBA 5K5NA 3HA6A 3W0PA 3V8SA 3R1SA 4BI2A 2WMRA 4F1OA 4ZTNA 3VRZA 3AC4A 3PZEA 5LMKA 4N6YA 5F1ZA 1Q5KA 4IB5A 4UZHA 3H9FA 5C8KA 2R9SA 4PQNA 5EOBA 4QMSA 3F5UA 3ORIA 1U59A 4YNEA 4OTDA 3NFFB 4I0RA 3UMXA 3HAVA 3E8DA 5AX9A 4G3CA 4QP6A 1OIQA 4A9RA 4MD8E 1CDKA 1XH6A 4O7TA 4LI5A 3UZTA 4EOLA 5AJQA 4IB0A 1UKHA 2GS2A 2B55A 3HKOA 4K6ZA 5BVKA 4EH9A 2ITYA 4PDSA 2XIRA 4YZNA 3BX5A 2YDKA 2OFUA 3G0EA 3GQIA 3UC3A 2C68A 1XH9A 2GTNA 3TNQB 3E7VA 2YZAA 3EN5A 5CEKA 4XP3A 3S0OA 5EYMA 4MD9E 3RPOA 4LRMA 5GZ8A 4QYYA 2HW6A 1H1RA 2XJ1A 1MUOA 5IQBA 4IADA 4RJ7A 3ZM4A 4EHZA 4FEXA 5AUWA 3ZUUA 3AMBA 2GDOA 2UZTA 1Y8GA 2X0PA 3CTQA 3LFCA 4C4EA 3D9VA 3F3VA 3QXOA 5DT0A 5C03A 5L6OA 4RGJA 4PWNA 4GYIA 5D41A 3FSKA 3LQ8A 4YO6A 2VNWA 3OW3A 2C69A 3JY0A 4L6QA 3RMFA 5AM7A 3UOHA 2ZM4A 5LMKC 3PVBA 4NTSA 3GCSA 2BROA 4QPMA 3RCDA 4A06A 4JBPA 5F95A 3C4WA 1MQBA 5CX9A 5E1SA 4C3RA 3GU8A 2PMIA 4XG9A 3E63A 3R6XA 4QYHA 4EOKA 3MH1A 1HCLA 3FZRA 5JQ8A 2XK4A 4ZZNA 4MQ2A 4U81A 3TZ7A 4A9YA 4YTHA 3I6UA 2GS6A 2OGVA 5EDRA 4AOTA 3ITZA 5B2MA 2X8DA 2R3PA 1W8CA 3LCSA 5CZIA 3ZO3A 4JI9A 1I44A 3CBLA 4FTKA 3MVJA 4IEBA 1OUYA 3AD4A 3IW4A 3RK5A 4IDVA 4D5HA 4I93A 1TQPA 2C0IA 2VGOA 5ANEA 5K4JA 2OLCA 4F9CA 3CC6A 3DB8A 4JAJA 3C9WA 3MPTA 4YJQA 2C6MA 3VS0A 1OL7A 2WMWA 2WU6A 5CYIA 3V51A 3VQUA 3W16A 5FXSA 3C4XA 4C3FA 3WI6A 4U43A 4LQMA 4KIQA 1J7UA 4ZZMA 2W96B 4FKVA 4KINA 3EQGA 2XRUA 2W1ZA 4I0SA 4LYNA 4YMJA 1LPUA 1YXVA 5AR5A 3BL9A 3UO4A 1I09A 2WMQA 4G1WA 3UOJA 4KABA 4LMUA 1P2AA 3L8XA 4W4YA 4J1RA 3TTJA 1MRVA 5L6PA 5A54A 2WMBA 3T3VA 1ZWSA 3ZZEA 4C2WA 3PJCA 1DAWA 2X7OA 4M8TA 3R9HA 3PG1A 4R5YA 4BTMA 4FV1A 5DHJA 2NP8A 3F66A 3P5JC 4G5JA 4MCVA 4R3CA 4I5CA 4JG7A 5E8UA 3VWAA 1ZAOA 4Y72A 4EOMA 4DGOA 2OF2A 4GIHA 3AQVA 1J1BA 4G34A 4YZBA 3GI3A 2JDSA 4F7JA 4CFUA 3F9NA 4N57A 4PDPA 2UZBA 4LGGA 3A7GA 5M55A 2HZIA 2JAVA 5TKDA 2UW4A 4ZY6A 2OG8A 5AX3A 1YHWA 4O7ZA 4A4XA 4U42A 4AAAA 3UBDA 4GK3A 4M0ZA 3OVVA 4FTIA 3EYGA 4FKSA 4CFXA 5LMBA 4NK9A 4ZTMA 3ULIA 5HE2A 4BDFA 4IXPA 5DE2A 3CQWA 2GNLA 1FBNA 3V5TA 1TQIA 2Y6MA 4YO4A 3TUBA 5EM5A 2PSQA 2CNQA 4JG6A 3R8VA 3WF8A 3P1AA 2EVAA 4FSQA 4DDIA 2ITPA 2P3GX 3OXZA 1XO2B 1PKDA 1X8BA 4YHFA 4YC3A 3POOA 3BYOA 4EH3A 4NJDA 4I20A 3A99A 5AV4A 5F9EA 4WNOA 1UU3A 4BIBA 1Q61A 1SZMA 3V04A 2BIKB 2AC3A 3MY0A 3TG1A 2R4BA 3P9JA 4I41A 1KSWA 1FQ1B 3R9DA 3U87A 5A4EA 4LDTA 3E3BX 4F9AA 3GUBA 3A61A 1APME 5I5ZA 3SXFA 3H9OA 3BU5A 2WTIA 3PPJA 3V5PA 4TT7A 2VO6A 4CEGA 2UZNA 2RFDA 3IOPA 1H28A 1XJDA 4JX3A 2HYYA 1AGWA 4BFMA 1W82A 3NNVA 3QF9A 4I92A 5H3QA 4D2PA 4CTCA 3G6HA 3PIZA 2WEVA 3C0IA 3E3PA 4AOIA 3QUDA 3WZEA 5CU6A 3BE2A 5BMSA 2ESMA 4L42A 3DNDA 3O2MA 2X4ZA 1RDQE 4FMQA 4KB8A 3PY3A 3BV2A 4FR4A 5AUZA 2V7OA 2X9EA 4IX3A 2PMLX 5J8IA 4ZP5A 3QA0A 3CD3A 2X7FA 4RX7A 3ULZA 4CFVA 4ZIMA 3HV4A 2UW6A 3GGFA 3HVCA 1F0QA 3IKAA 4NKSA 2VTAA 3EN6A 5L4QA 3HUBA 4QP2A 4BB4A 4BDEA 4H36A 2QO7A 2BIYA 5IEYA 4LOOA 5H9BA 4ALWA 3KN5A 3BI6A 4ORKA 3KXMA 3C4EA 4I6FA 4MBLA 3EYHA 3BE9A 3EL8A 3UYTA 2J0JA 1XMLA 2OJ9A 4XV1A 4FC0A 3TZ8A 2VRXA 1KWPA 3JVRA 4O21A 3EB0A 3AC8A 3QAME 4FIGA 5DBXA 4C34A 1KE6A 3F3WA 4IM2A 2PL0A 3B2WA 3EN9A 5CANA 3DQWA 1JKLA 5DIAA 4DHJA 3BBTB 3QRTA 4H3QA 4IAFA 5D9HA 4ACGA 2BAQA 3LPBA 3QD2B 4C57A 3FQSA 4JL9A 1PMNA 4C3PA 5HX8A 3BEGA 3VVHA 5JK3A 3W0SA 3PXYA 4FUXA 4DH8A 1TZDA 5HKMA 4W8EA 1E1XA 4M97A 1BUHA 4FKJA 2X2KA 2BRHA 3LFFA 3IDBA 2VN9A 4MAOA 1UNHA 5B0XA 4HGTA 4IAYA 3R30A 5IH4A 3ZC6A 1G8JA 1IR3A 2FUMA 2OO8X 4QNAA 3I4BA 3FI2A 4JQ7A 3FC2A 4M0YA 4PNKA 1JPAA 3CP9A 4G17A 3DBDA 4JVGA 4MVFA 3NMUF 4YBKA 5L8JA 2V5QA 4E6AA 1BKXA 3ZU7A 3R2YA 4YTFA 4AGDA 2PUNA 1XHAA 3B8QA 3AC5A 4NJ3A 4U8ZA 3NNXA 2W5HA 4JDKA 4F9WA 3Q2JA 5HCYA 4ZTLA 3CTHA 5LQFA 3LW0A 4B4LA 1PRYA 4G5PA 4AXAA 4EH7A 4EQCA 1SM2A 2HWOA 2XJ0A 2RG6A 3GC8A 2KULA 3R28A 4IX4A 4RVTA 5HESA 1WBSA 3UDTA 4YJSA 3TM0A 4XG4A 5HLPA 4RIXA 4F9YA 1BL6A 3R02A 3JYAA 2WXVA 4R77A 3F3TA 3I0OA 3JS2A 5CNOA 4UMRA 3GU4A 5C01A 4MUQA 3NS9A 5HICA 2XALA 4B7TA 2FB8A 3LXNA 2AEGA 2OFVA 3DT1A 4ARKA 4D1SA 4EK5A 3IG7A 4FKGA 4XP0A 5HO6A 3AMAA 5HI2A 4GT5A 3GOPA 3QFVA 2E9OA 4YGAA 5CEIA 2IG7A 1IA8A 3GP0A 3NYXA 2RL5A 2PZIA 4PTCA 1K9AA 2X4FA 3ZFMA 4DINA 2R0UA 5J79A 3FYJX 2WZJA 3WZJA 2YA9A 4F64A 3BQCA 5DA3A 4XV9A 3Q60A 4IFCA 4IJ9A 3WYYA 3MIYA 4L44A 2O3PA 3LOKA 4FZAB 5FEQA 1IEPA 1JKTA 3SQQA 2VUWA 3QA8A 3QD0A 3QZHA 3OWPA 4X2GA 1JKKA 5KMOA 3AD5A 2PZPA 3ELJA 5I9VA 1G3NA 4B8LA 4GFOA 1ZZ2A 1S9IA 4FTRA 2XARA 2XKCA 1PJKA 2XNNA 2XIZA 3LCKA 4TXCA 4EHEA 4N4SA 2FYSA 4FL1A 4ANSA 3MESA 2HELA 2WOUA 1V0OA 4C59A 5CAUA 3QGYA 3TWJA 4BBMA 3PUPA 5FUTA 3NIZA 1U5RA 4U44A 3S95A 4AN3A 2OIBA 5IUHA 4FSWA 4E20A 3CD8A 3K3JA 3G2FA 4R7HA 5ETCA 4ZTRA 3ZTXA 3HV7A 4FG7A 3F6XA 3F7ZA 4FVQA 4AE9A 2YN8A 4YTCA 5AR3A 4D2VA 3Q2MA 3FXZA 4AW5A 4XS2A 4ZY5A 4E26A 3DU8A 4QMXA 4S32A 4FTMA 4AT5A 4K9YA 3U6HA 2Q83A 4CFFA 3NYOA 1W84A 5K0KA 2R3HA 2IJMA 3ORPA 5M53A 2BKZA 3H3CA 4I5PA 4CCBA 2PYWA 4AAYA 2W05A 3NUXA 2BTRA 3BBWA 4IX6A 4AT3A 4M13A 3OP5A 1GY3A 4CG9A 4DG0E 4LUDA 3SRVA 4FK3A 4HNIA 4GG7A 5BMMA 3LLTA 4ANNA 3CY2A 4JDJA 5AIKA 3F5GA 2XANA 5AR8A 3RAWA 3HRCA 3FZ1A 4RVKA 3AGLA 2JKOA 1AD5A 3OT3A 4M15A 4ZEGA 3ZLSA 4P90A 4FNZA 4FV6A 2ETMA 4ZTQA 4ITHA 4FOCA 2V55A 4CVAA 4RWKA 4ASZA 1YHSA 3R04A 2R7BA 3CQUA 4YSJA 3TIZA 4G9RA 1ZYLA 1IA9A 2FSOX 4CD0A 3MVMA 3OTVA 3KB7A 3AT4A 5DVRA 5FTGA 5IH6A 4RJ4A 2I40A 2XAOA 4FKQA 1REKA 2E2BA 3UODA 3W32A 3KF4A 4ASXA 2JKMA 2VTLA 5EW8A 3UP7A 5FXRA 3FI8A 2UZLA 4FG8A 4J53A 1V0PA 3EMGA 2WMUA 1R3CA 1PXPA 3FL4A 3U4WA 3LMHA 5T6KA 4O6EA 5EQYA 1BX6A 4GK4A 3DZOA 4K1BA 5AM6A 2PULA 5AFVA 2HZ0A 3NCGA 4AU8A 4DBNA 4ACHA 1LP4A 5LOHA 3I60A 3BGPA 1GNGA 3RK7A 2QD9A 3IOKA 2QR7A 1B39A 4M67A 3QTRA 4EOJA 4EK8A 3ACJA 4PP7A 2WU7A 3KIOC 3KN6A 3OWJA 5EH0A 2VTRA 4O81A 2JITA 4Z55A 4GFMA 2I6LA 4GT3A 5AMNA 3ERKA 4X6QC 2QHNA 2YIYA 3OCSA 5J87A 3RAIA 4E4LA 4A4LA 3CPBA 4YTIA 1AQ1A 4DEAA 4EH2A 4LGHA 4CG8A 2XIYA 4JNWA 2BMCA 3ZCLA 5J5TA 5K9IA 4C33A 3P5KA 2OI4X 2X81A 3LM0A 4EKKA 4QYGA 4XLVA 4OW8A 3SGCA 4WSQA 3LXKA 2C1AA 4I23A 5CSXA 4R6VA 2G9XA 1OKWA 4ZS0A 4M7IA 4CZUA 4ZSGA 3BL7A 3QCQA 2PMNX 3PJ8A 2O65A 3GT8A 4IQ6A 5KE0A 3LMGA 4F99A 2XYNA 1PMUA 3G0FA 3D5WA 4ID7A 1Z9XA 3DCVA 4MBJA 4Q9SA 3UNZA 5K5XA 4I6HA 3D7TA 3MTLA 3MS9A 4FOBA 2C0OA 3Q9ZA 2FVDA 4JR3A 3F2AA 3QZFA 4E6DA 3BEAA 3DAKA 4WRSA 4DFLA 4YP8A 4UWYA 5C8MA 5TF9A 5I9YA 3UO5A 4U41A 3A7IA 4DN5A 3MWUA 5JEBA 3C51A 4F1TA 4NFMA 4ZAUA 4V04A 4N70A 4QP7A 3HDMA 3VHKA 4HVDA 2Y7JA 3R7OA 3IDPA 5HE3A 5BYYA 1YI3A 1YWVA 1FMOE 4UWCA 4YSMA 1OM1A 2B9FA 1XQZA 2BR1A 5C4KA 3QD3A 2YLFA 3KRJA 4GVAA 5EW9A 3MPMA 2GPHA 4LG4A 1OZ1A 4YHJA 1IASA 4QTDA 4NW5A 5IMEA 1P14A 2PMOX 3KFAA 4YJPA 2BFYA 3RWPA 2ZV7A 3ACKA 3VUGA 1PY5A 4PMTA 2V7AA 3DQXA 3F69A 1MQ4A 3D14A 1PXJA 4JOAA 5CF4A 5I3OA 3VW8A 2XYUA 4U3YA 4FICA 4WUNA 4F6UA 4WG5A 3RBWA 2IZTA 3DJ7A 3M2WA 3EFKA 4I94A 4NTTA 4MF0A 3R83A 3SDJA 2WKMA 3G9LX 1URCA 5CT7A 3DV3A 5EHYA 4F09A 3BLAA 2VWVA 3GXLA 2ZB0A 3FMMA 2H34A 2UZUE 2GFSA 2YCRA 4F4PA 3OC1A 2C1BA 3F5XA 5CVHA 5KMJA 5AA9A 1DI9A 4DTKA 3POZA 4BC6A 3AC1A 4K8AA 2XF0A 4EBVA 5IA2A 3VF8A 2QKWB 2WIHA 2YABA 3ALOA 1ZYCA 2ERZE 3MB6A 4FT3A 4QP3A 4O7WA 1YI4A 3BIZA 3FKOA 5C26A 2BRBA 2PWLA 4J71A 3SV0A 3EQBA 3K2LA 3PFYA 1YHVA 2REIA 2UZEA 3DKFA 5ANJA 3BELA 3QQHA 5TT7A 3CSVA 1WCCA 1WFCA 4QMNA 4RJ6A 4HJOA 4USFA 4C7TA 4CYIA 3OMVA 1YVJA 4D4VA 4DDGA 4BF2A 1YQJA 2XK8A 3ROYA 1OL2A 3BWJA 4QMQA 5BVOA 4FTJA 3D7TB 3CKWA 3G51A 4O22A 3MH2A 4NCTA 1G5SA 5IKWA 5CU0A 3FC1X 3NUSA 4FVPA 3UQGA 1NT2A 4AXDA 1YDTE 2J5FA 2HY0A 2UW5A 4FEQA 4UY9A 3ZZWA 4MWIA 4CT1A 3WF5A 3C0HA 4O0RA 5AP4A 4EOQA 5TOZA 1P4OA 4G16A 1M2PA 3KF7A 1M2QA 2PVRA 4QT1A 4KKEA 4FV9A 4RLKA 4UBAA 5GHVA 3PA5A 1XBBA 4KS7A 3ZRLA 4C4GA 2GQGA 5EG3A 5ANIA 4UB7A 3RK9A 2P55A 4BCJA 2QQ7A 3EQFA 3D5VA 2OXXA 2QODA 3JPVA 4EZ7A 4E5AX 3FXXA 3TCPA 2F9GA 2YIQA 2ETRA 1H24A 4CFMA 5BPYA 2ZFYA 4JDIA 4YHTA 3BLQA 3D94A 3LHJA 5FEDA 2F2CB 5HO7A 3U54A 3FDNA 1MRUA 5HVJA 2A4LA 3KY2A 3PSDA 4H3PA 3DAJA 4DEDA 4CFNA 5E8VA 1Q97A 1SYKA 4J99A 4BCHA 4D4YA 5M56A 2XCHA 3FZTA 3NUPA 3O8UA 4EYJA 2YERA 1ST0A 3OTUA 3BGQA 1Q8WA 3OCGA 4U0IA 2QURA 3KK9A 3NSZA 5CWZA 5EYCA 3V5JA 1Y57A 2C5XA 3OHTA 2OH0E 4PTGA 4WRGA 4J8MA 4YNOA 2DUVA 3RVGA 4G3DA 2G15A 1WAKA 4O0WA 4GS6A 4YJOA 4XP2A 2C3IB 4IZ7A 4MD7E 5CY3A 1BLXA 2XMYA 4UMPA 3E8EA 4NCTC 4AS0A 3R8ZA 2RKUA 4BDAA 5HNIX 3LFEA 2QVSE 5JZNA 5FLFA 1Z57A 3QD4A 2WO6A 4UYAA 3Q6WA 4RA4A 4DCEA 3LMIA 4D5KA 4D1ZA 4AFEA 2GCDA 2WTKB 3I1AA 1PYEA 4C38A 3VUDA 4E5WA 4CLJA 5IUGA 3A62A 2CN5A 4YPDA 5HX6A 4JBOA 1DI8A 4G6LA 1IAHA 4G3GA 3AXWA 4IAZA 4DEHA 4FSUA 4LRKA 4TWOA 4FGBA 3NAXA 2C6EA 1OMWA 4RFMA 4E93A 1KOBA 1NVRA 1B6CB 4AZVA 1Y6AA 4JG8A 3R00A 3UG1A 2ZDUA 3H0YA 4NU1A 4ANMA 3G5DA 3O17A 4L68A 3VONA 2W1EA 3MFTA 1M14A 2P2IA 3RNYA 2XP2A 3T9IA 4XUFA 2YJSA 1PYXA 2VTQA 3C1XA 3T9TA 3FHRA 5FD2A 4EWHA 5J7HA 3UC4A 3KEXA 3VRYA 5IQAA 2I0HA 3IO7A 4HCTA 3DXQA 1CKJA 2HW7A 3IS5A 4OTRA 4ACMA 3QUEA 2JIVA 2NRUA 1TKIA 5A4TA 3DDPA 4FVRA 4CTBA 4U6RA 3QCYA 5JH6A 4W4XA 4IAAA 3OBGA 4FSMA 2BZKB 4O38A 2R3RA 4AW0A 3VBYA 3WZDA 4BCMA 3GBZA 3FKLA 5AADA 3BGZA 4J52A 1K3AA 4O4CA 5FDPA 1CTPE 1ZYJA 2YISA 5AAGA 3RNIA 4B99A 3KXGA 4PPAA 4QMVA 5CT0A 4H39A 3COIA 3QLFA 1O6LA 3CGOA 3FBVA 4JDHA 4E4NA 1U4DA 2VWYA 3W0RA 2NO3A 3W1FA 4AACA 2DS1A 2C6LA 2V0DA 5E8WA 4KIPA 2VTIA 4UYNA 1YXSA 3ORNA 1PMEA 1VEBA 2YWVA 3ORLA 3HRBA 4JBQA 3E88A 4O0XA 1KV2A 4IIRA 1OI9A 2CN8A 4I4FA 5L2SA 3PSCA 3FZOA 4EQMA 4PDYA 4RIWA 3JXWA 2GMXA 1Q8TA 4JRNA 3LCTA 4RT7A 4WNMA 4Z7GA 2NNWB 3PXZA 1GJOA 4E4XA 3CS9A 4H1MA 3P08A 2GU8A 4D2RA 4F6WA 2V62A 1GIIA 4DLJA 2WB8A 2V22A 1OUKA 1GIJA 2BRGA 2ITNA 3ZXTA 4FIEA 2XM8A 3F2NA 3OF0A 3PXQA 4YUQA 4EJNA 1FVTA 4DEIA 3ORXA 2BTSA 3OWLA 2RSVA 3PPZA 3U4UA 3WF6A 5L3AA 4DT8A 4I1ZA 5BVWA 3A7FA 1S9JA 4DEEA 1UU7A 2ZM1A 5KX8A 5DT4A 1OGYA 1FMKA 3I79A 4Z9LA 2C5VA 1B38A 3P7BA 3IECA 1YOJA 5BVDA 4O0UA 4O84A 1STCE 3TV7A 5IQFA 1CKIA 4DT9A 2IEWA 4QO9A 2W9ZB 5LWMA 2QOCA 3OD6X 5GJFA 4ZSEA 3VIDA 3DGKA 4KIKA 4LRJA 3OEZA 4WBOA