1Q5KA

Crystal structure of glycogen synthase kinase 3 in complexed with inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
350
structure length
345
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycogen synthase kinase-3 beta
publication title Structural insights and biological effects of glycogen synthase kinase 3-specific inhibitor AR-A014418.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 345
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q5kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q5kA01
4I1ZA 1YRPA 1VJYA 1Y6AA 2BKZA 3DPKA 5FQDC 2FSOX 1IR3A 2OICA 4RFYA 5AP6A 1CKPA 5CZIA 2VD5A 4RIXB 3FLQA 3E3PA 5DT3A 5FLFA 2OFUA 3F3ZA 4G1WA 4DEGA 5ANKA 3TJCA 5LWNA 4PL3A 3NDMA 1ZZ2A 1XQZA 2ITXA 2XZSA 3PJCA 4X3FC 3ZFYA 5C01A 2EXEA 3FZ1A 3UC3A 1BI8A 1DAYA 3NWWA 3FPQA 3UG2A 3PXKA 2BR1A 3UP7A 1M7QA 3ACKA 4HPUE 3DK7A 3OWJA 2BAKA 3OY1A 3R02A 3R63A 3QFVA 4RIXA 2GPHA 1CSNA 2PK9A 2W1CA 3KEXA 3OTUA 4JI9A 5FRIA 5HX6A 4D2WA 3D94A 4BYIA 3PP0A 2W99B 2CNVA 2C4GA 4AT4A 2B9JA 4IM3A 4MXXA 4UZDA 2BRGA 3QD0A 4FC0A 4CFVA 5HICA 1H01A 4QMOA 5EYMA 4AGUA 3ZO3A 2W1ZA 3LCDA 2XKDA 4J99A 4YJUA 3ENHA 4KD1A 3KMMA 4L3JA 4LV8A 4YZMA 3SXRA 4FIFA 4IANA 4BCFA 1WCCA 4TYJA 4B8LA 2PWLA 2CLXA 2ZB0A 4KRCA 1FGKA 1REJA 1FVTA 2B53A 4YJTA 3I1AA 5H2UA 5A6NA 2GHGA 5FEQA 2J4ZA 2C0OA 3OBGA 4BBFA 2WMVA 1F3MC 3BV3A 4MAOA 4W4XA 5DH3A 3QXOA 4EK3A 1UU8A 3EQRA 5C4LA 3BGPA 2O0UA 1ZOEA 5TT7A 1PKDA 1L8TA 3DJ7A 1P4FA 2C5VA 3DBCA 4NJ3A 5LVNA 1W0XC 3NUYA 3H9FA 4KB8A 3V8TA 4O6EA 3VS5A 4WUNA 3VJOA 2PUPA 3LFAA 2O65A 5DEWA 4WUAA 2QG5A 3NGAA 1WMKA 4FKRA 3P5KA 2QQ7A 2XRUA 3L8XA 3B8QA 4QMVA 3HA8A 4DEBA 3V8SA 2PVJA 4EH3A 4FEUA 2ONLA 4JBOA 2GTMA 2NP8A 3CD3A 1LP4A 2UZVA 4NIFB 4R6VA 4YJSA 4EOIA 2J90A 4KNBA 3UODA 3WZEA 1XBCA 3Q60A 4E7WA 3OUNB 5CEOA 4AZEA 3FQHA 3QD2B 3RAHA 2OXYA 1P4OA 5DNRA 2XUUA 4JDJA 5T68A 2XNOA 1SM2A 2WQOA 4F09A 2C6OA 4OGRA 4NIFA 2CKOA 2PUUA 2VWUA 2WTKB 2YIWA 3SOAA 2CKPA 1P14A 3DKFA 3OS3A 3QTSA 4RJ8A 4ZTRA 3THBA 2XB7A 4QMUA 2WU6A 1STCE 4O86A 3IDPA 1H0WA 4IWQA 4RJ6A 5LMAA 4L42A 4C58A 1H0VA 4FIIA 4CKIA 1W7HA 3QKKA 4PDOA 2OIBA 2G01A 2VV9A 4FKUA 3ZLXA 5AJQA 1T45A 4ZXTA 4ZAUA 4BYJA 1UU9A 4LMUA 4LOPA 2UVZA 3GI3A 4P2KA 4CZYB 2YM8A 3D5WA 3LFQA 4QMSA 2ZM4A 3FZSA 3UZPA 3RTPA 1WVWA 3D83A 4NSTA 1GAGA 2QG7A 3VUMA 1SYKA 3Q96A 1JOWB 4BCOA 3HP5A 4BRXA 4OAVB 2WAJA 4RFMA 5CI7A 3GXLA 4IIRA 4LYNA 3U6HA 3NVMB 2F49A 2CNUA 5CASA 4U9AA 3AD6A 4O83A 1OM1A 1KV2A 1HCLA 2BILB 4DTBA 4C3PA 3BGQA 5CT0A 5CF6A 2R3PA 4AWIA 2PZ5A 2E2BA 4FL1A 3MPTA 5AM6A 3WZJA 4O82A 5EHLA 3BYVA 2YJRA 2C6LA 3KCFA 4CRSA 2VWWA 4NKAA 4BBMA 2C0TA 3VULA 2PMLX 3ZEWA 3GFEA 4O7WA 5FXQA 4QYFA 4FL2A 4LL0A 3PG3A 4EZ7A 1UU7A 2BMCA 2QO9A 3KRRA 4KKEA 3SQQA 2OJIA 3C4ZA 3UE4A 4FTMA 4G3FA 1CDKA 4LGDA 4RVKA 3UO6A 4O0TA 4YTIA 3TT0A 4O1OA 4ZTLA 4D2PA 2V22A 4F1OA 2VO6A 4A7CA 4XBUA 3TACA 3K54A 4UMUA 1NVSA 4XLVA 4Z9LA 3MVLA 4I94A 3AC4A 4X6RA 2RSVA 3UVQA 3O8UA 3REPA 4CCUA 5L2TA 5M51A 4LM5A 4ZZMA 1UNGA 4LOOA 4DH5A 4M66A 2YABA 5ITAA 3V5TA 4D9UA 3QCYA 4CZUA 5ACBC 1WBWA 1JNKA 2XJ0A 3EQIA 2A0CX 1ZXEA 2UZEA 3FC1X 3C50A 3MA6A 2BDFA 4L7SA 3KC3A 3NX8A 4FK3A 4ASZA 2RFSA 4FIJA 3FE3A 4O38A 3UQCA 1ND4A 3BPRA 3DDQA 4BL1A 2LAVA 1Y57A 5J7BA 3IGGA 3LLTA 1H07A 4EH8A 5IUHA 5JN2A 4QOXA 5M56A 5M09A 4RJ5A 2C3LA 1OIYA 3OXZA 3A8XA 4I5CA 4ANQA 3IW7A 4LUEA 4QYYA 3LM0A 2C30A 4MQ1A 5M55A 4FV8A 4AACA 2AYPA 2GTNA 3A8WA 3JVRA 4M69B 5A4TA 5H8BA 3FMLA 2CN8A 3ZONA 5D12A 3BV2A 5DA3A 4XG8A 4O0YA 3AC2A 4FTOA 4GT3A 4PPCA 5ANGA 3UBDA 3SA0A 3D7TB 2B52A 4EL9A 5JSMA 4JX7A 5EM8A 4I5MA 3QTZA 2OJ9A 3BLRA 5GJGA 1XH8A 3SDJA 2C47A 4M69A 4QTEA 5M57A 2PE2A 4I6BA 3ET7A 4FIEA 4RJ3A 5AAFA 4GL9A 3D7TA 1HOWA 3M1SA 1Q8YA 2PZIA 3PPZA 3OW3A 5GJFA 4BCQA 5F1ZA 4AQCA 5JFWA 4N6ZA 3HMIA 1IG1A 4AXAA 4D9TA 4LG4A 2OXXA 4EH2A 4J98A 2PY3A 4CMUA 4CGAA 3NW5A 3FZOA 4M3QA 4LL5A 5DLSA 3ODZX 2HELA 1PRYA 4HW7A 2P2HA 2JFMA 2XEYA 5JFSA 5L8KA 2YM4A 5EQEA 2XKCA 3SVVA 4KIOA 4YTCA 3HZTA 3HKOA 3WI6A 4R1VA 4G16A 3LCOA 4TWNA 3R9HA 3TZ9A 2PSQA 4FMQA 3DBEA 4G34A 4TWOA 3FXZA 2OIDA 2XCKA 2BRBA 4RIWB 1Y8GA 2HZ0A 4U81A 3TTJA 4D0XA 4EC9A 3TUDA 3JR1A 1H28A 3Q6UA 1XJDA 4QP2A 3U87A 3QRUA 3ORMA 1WBVA 2J0KA 4EH4A 3UNKA 5HZNA 5K0XA 1PMVA 3Q2JA 4O7SA 1FGIA 5JKGA 4P5QA 4RIWA 3ALNA 5K3YA 3QCQA 4IVDA 5E8WA 3LVPA 5DYJA 3BE9A 4JOAA 4FTQA 4K9YA 2W1IA 4IE9A 4U44A 4AE9A 2VTNA 3QTIA 2WTDA 3PE1A 4IMYA 4JR7A 2QCSA 4YP8A 3OXIA 4D4VA 2WEIA 3LFSA 1O6KA 4XV2A 5DBXA 4PMPA 5ETIA 2R4BA 3UO4A 4TKSA 1ZRZA 3EYGA 2WD1A 3HV7A 4YUQA 4UWCA 1FPUA 1PXLA 3Q9ZA 2Y8OA 3V5JA 1MUOA 4IVAA 5HLPA 5J5TA 4JBQA 3UG1A 4EOSA 4O91A 4QMWA 4ITJA 5DGZA 3F88A 4WKQA 4RJ7A 4ACGA 2X8DA 5D1JA 5JGDA 5AUWA 4DAWA 5JQ5A 2HY81 1JPAA 2BZKB 1U4DA 4C61A 4YNOA 2X7FA 3SV0A 3O2MA 4MX9A 2HZ4A 2ZJWA 4PMMA 5AA9A 4CFUA 4L6QA 5JMSA 2W0JA 4E5BA 4O27B 2VWYA 4GH2A 4CVAA 1KOAA 5FXRA 3FC2A 2PVKA 3F61A 5CEPA 2PVMA 3EFKA 3UO5A 4QP7A 3UIMA 2BIYA 4UWBA 1SZMA 3TI1A 5CEQA 2JDOA 2PUIA 4PP7A 2JD5A 4U97A 2ZVAA 5CLPA 3PLSA 4H3QA 1XHAA 3TG1A 3HRBA 3PXZA 1W98A 1FQ1B 2ZV9A 4GV1A 4DEEA 4U40A 1OL2A 5AUZA 2ZV8A 5KMNA 2IWIA 4TWPA 3QHRA 4IADA 1U46A 4QD6A 3MIAA 3OT3A 2B1PA 2IVVA 5ETFA 2BTRA 4QPSA 1F5QA 3ATSA 4X2JA 5HCZA 4MBJA 5AP5A 3MA3A 5AA8A 4ZMFA 3NNVA 3RPOA 4AT5A 3LPBA 3VNTA 1IA9A 4TYGA 5EM7A 3R7IA 1RDQE 3WYXA 1H1RA 1QPJA 2WB8A 3PXRA 4AW2A 2WMTA 1URCA 4OTPA 4WOVA 2GFSA 4JRVA 1BX6A 3MFRA 2XIYA 1GOLA 4OTFA 5HE2A 2O5KA 4WIHA 3KRXA 3IOKA 2UW5A 3FMDA 3HV4A 3LXLA 3RHXA 3ZSHA 1Q41A 1R78A 3MV5A 3ZBXA 2V0DA 1Q61A 4F1MA 4YTFA 4YO6A 3WZUA 5CVGA 3R7OA 3AG9A 5DFPA 5IH6A 1YHSA 3FI8A 2Z60A 4D2VA 1I09A 2J2IB 4IFCA 3QBNA 4H3PA 2ZMDA 4D1ZA 4I92A 4KIKB 4FIGA 1KE6A 2ITQA 2OU7A 1XR1A 2YCFA 1R0EA 4MWHA 4MNEB 4O0SA 3VBWA 4Q2AA 4C57A 3MJ1A 2WTJA 2UZTA 3EQFA 3ETAA 2WMSA 4KIKA 4WNPA 5TR6A 5LMKC 3ATTA 3MWUA 3F3UA 3JS2A 3L9LA 4L01A 4MNEA 2XK6A 2OGVA 4IAFA 4L43A 2IJMA 4WBBB 3DT1A 3I7BA 2HOGA 4A9UA 5HIEA 4E6DA 3NZ0A 3CJGA 3R9OA 5HX8A 5LOHA 4C4GA 4QRCA 4FI1A 1LEZA 4MXZA 4X6QC 5LARA 4RVLA 4FSMA 5KMOA 5J9LA 3QUDA 4NYEA 4BTKA 3VO3A 5B2LA 3O23A 3HMOA 4TPTA 4IM0A 5E8SA 5J8IA 1JWHA 5J95A 5AR7A 3PVBA 3DLZA 3VUDA 3BEGA 2UVXA 4FTCA 2C6EA 4BDJA 4EOMA 2XRWA 2IVUA 3LXPA 5KMIA 3D5XA 4EOJA 3DQWA 3R1YA 1BL6A 4BCNA 3HV5A 2YIXA 2YM3A 4TNBA 4UXLA 4ERKA 4M0YA 3VC4A 2FA2A 3ORIA 3VUTA 3MH1A 2W9ZB 4PQNA 5CF4A 4F64A 2WNTA 3FSKA 5AUTA 4I0TA 4BHNA 3MH3A 3PIZA 3UOKA 4HPTE 4DGMA 3GQIA 1XH9A 4HYHA 3BELA 3OOMA 5ANJA 4F9BA 5HTCA 3OROA 4X7QA 3RZFA 2C3IB 1TQPA 2JAVA 4HGSA 3PTGA 4RWKA 4J53A 4ZSLA 3VBXA 1JVPP 1A06A 3PVGA 2GQSA 5HIDA 4D2SA 2Z7RA 4GFGA 3RK5A 1URWA 4G9CA 2QVSE 4GSBA 2BHHA 2GNJA 3F69A 3MW1A 4M68A 5ETAA 1OPKA 4MXOA 2XNPA 4W9WA 5H8GA 2JDSA 5AM7A 3VS2A 1G8AA 4K33A 3AC5A 4JLCA 4OBQA 3IS5A 4R3CA 4ALWA 3DTWA 4IACA 3QQLA 2WZJA 4EWQA 1BYGA 1DI9A 1UNHA 3QA8A 4QTBA 3I6UA 5CAQA 4EUTA 4FG7A 3PSDA 4Q5HA 5C03A 4YBJA 3UIXA 4AGWA 4CTBA 4IAKA 3TV6A 2CSNA 4O7YA 2J0LA 1U59A 3ELJA 2EB3A 3ZUVA 3ORKA 2XNGA 1YWNA 1YXUA 4O21A 3FL5A 5ANIA 1OKVA 5FDPA 4IZYA 5FP6A 4EZ3A 3OCTA 3E8CA 1FBNA 3MYGA 4RC3A 4XNEA 4J96A 2VWVA 3LZBA 1OBDA 3MI9A 4EBWA 3NAXA 3HVCA 3MB6A 5F95A 3OG7A 2R64A 1KWPA 5AV3A 4HVIA 5AIRA 3K2LA 5H3QA 3QKMA 4KSQA 1BLXA 4YURA 2YM7A 3AQVA 5LCKA 3DAJA 3M2WA 2WMXA 3QQUA 3V04A 4ALUA 3HV3A 3QQHA 1PMUA 4IQ6A 5EDQA 3VRYA 3PP1A 3VWAA 5CU0A 4GIHA 3SC1A 1UVRA 2HY0A 2R3RA 3CD8A 1Q24A 5AP2A 4FV5A 2WFYA 4HYIA 1J7LA 2BVAA 5EQYA 4EOLA 4G3EA 4EQCA 4HNIA 5HD7A 3COIA 3BX5A 4B8MA 4BDHA 1UU3A 2XNNA 4R7IA 3HAMA 3NNWA 5DE2A 3UPZA 1JKKA 2RGPA 4FR4A 4NM5A 4XG9A 4A4LA 3CKXA 4II5A 5B7VA 3C4FA 4R1YA 2Z7LA 4K8AA 4DCAA 3NMUF 1PKGA 4IAZA 2XJ2A 4FT3A 1KUTA 5F20A 2JKKA 5C4KA 4BCJA 3ZBFA 4YO4A 2ESMA 3RCJA 3F2AA 4HYSA 4Y83A 1YI4A 1BI7A 1CMKE 1W84A 3C5UA 3NCGA 4IX5A 3RPVA 3VVHA 1TKIA 4F0GA 3G6GA 4YSJA 4LUDA 2YAAA 1QPCA 2G9XA 1L3RE 2G1TA 4NCTA 4XJ0A 4E6CA 4IX3A 2XF0A 4EH6A 5FBNC 4C2VA 3QALE 4EHEA 2H9VA 2PVHA 2W4OA 4HCTA 4U0IA 3E3BX 4O81A 4DT9A 5BVOA 2F7EE 1KE8A 2OF2A 2YM6A 3MH2A 1ZOHA 2JIVA 4FZ6A 4OBPA 4RG0A 5IUIA 2IZSA 1U5QA 2WTIA 1E1VA 3LFFA 3PY0A 4IJPA 1A9UA 4KBAA 3DKOA 4M14A 4CLJA 1BUHA 1YHVA 3HUBA 5FWKK 4YLKA 3POZA 3VUHA 4BZNA 3ZXZA 2J0JA 4U42A 5CYIA 4S33A 3WE4A 3DFAA 1XKKA 2CDZA 3FY2A 4IHPA 4X2GA 4B0GA 4DFXE 4F4PA 2X4FA 3LLAA 4NM3A 4E93A 1QPEA 2ZAZA 3PE2A 5HTBA 1XH7A 4D55A 2HIWA 3R01A 4R77A 2IZRA 1KE5A 4IZ7A 4IZAA 2OI4X 3QX4A 4ENXA 1V0OA 4DH8A 5CEMA 5AR8A 5CI6A 2J5EA 5BMMA 3KB7A 5M07A 2HW6A 4I24A 4F08A 2R3OA 4P4CA 5CEKA 2UUEA 1H1PA 2JBOA 3OUKA 3QAME 4A9TA 1OL7A 1AGWA 1WVXA 1JSTA 1PXMA 4IWPA 2I0VA 3GCPA 4ANNA 4U80A 3ZCLA 3ORZA 3S4QA 4EH5A 5IDNA 5L2WA 4QNAA 5AX9A 4PMSA 2OSCA 4AGCA 4W4YA 2OFVA 3OOGA 5DR9A 4C4IA 5A9UA 5IMEA 3OHTA 4AP7A 1Q99A 4AW0A 4BGQA 4GKHA 1PF8A 4AN3A 5TF9A 4FZ7A 4E4NA 3FEGA 3G90X 2JBPA 3OZ6A 3Q2MA 4ZY4A 1OGUA 3G9NA 1HCKA 1VR2A 4U43A 3DKGA 3ZZEA 5I5ZA 4AA0A 4NU1A 3RAKA 2X8EA 4C3FA 4IVBA 3A62A 3OF0A 2ONLC 3A7HA 5CAUA 3FLWA 3ITZA 3KL8A 4GJ3A 5I9VA 4BKYA 4QTDA 3KRJA 1YOMA 2UW9A 3FXXA 4X2NA 1YXTA 3WILA 3IW6A 3RM7A 5D10A 3UTOA 5L2SA 4QPAA 5AX3A 1RE8A 3BQCA 3G15A 3IO7A 2XK9A 5IA4A 2B9IA 2UZNA 1OI9A 3BYSA 3TNHA 4IAIA 5DR2A 1NXKA 2GHMA 5FM2A 3O50A 3QRTA 2CKQA 3VW8A 3KXXA 3IQ7A 3OEFX 3BWFA 2OIQA 2RIOA 3R04A 2XBJA 3RINA 3KVWA 3FXWA 4K6ZA 1J7IA 4CT1A 3W32A 2VTTA 4O7RA 3IG7A 3U9NA 3DB8A 1KE9A 4XP0A 4CQEA 2PYWA 3C0GA 4GK2A 4EI4A 1PXKA 4P5ZA 1ATPE 3F5PA 4AOIA 5HNIX 4O7VA 4C02A 2P3GX 2WTKC 4D2RA 4R3RA 4EJNA 2VNWA 4GS6A 2YHVA 3PY1A 1WVYA 4QYGA 5K9IA 3E8EA 5AUXA 1W83A 2H6DA 3PRIA 4XG7A 5B0XA 3TL8A 4YZ9A 3ZLYA 3O51A 3A61A 2Y4IB 3UNZA 2BROA 3CSVA 4PWNA 2XMYA 5HQ0A 5IA1A 1B38A 2IW6A 3R22A 3COKA 4FOCA 2JGZA 4ZS4A 4BTJA 1KV1A 3C0HA 3D9VA 3S3IA 2XA4A 4DFLA 1KOBA 4QPMA 2CPKE 4W9XA 3VHKA 4BN1A 3IW8A 1V1KA 1R39A 2B7AA 3CTJA 1PMNA 2O8YA 3G33A 3ORPA 3R7EA 4BWKA 4F63A 3MGYA 4EQUA 5AEPA 5DI1A 3EFLA 4XV1A 3F5XA 3CKWA 3VAPA 1S9IA 3AXWA 2BFYA 4MD8E 2WIPA 4H36A 1R0PA 4V05A 5E8XA 2WIHA 3NUPA 2JKQA 3RBWA 3Q52A 5IUGA 1T46A 3AMYA 4FV1A 4MF1A 4WG4A 4TL0A 3FHRA 5HVYA 4Y95A 4BCPA 5T3QA 2ZV7A 4HJOA 4OLIA 4M8TA 4IWOA 1OBGA 3GU5A 3I6WA 1VZOA 3T9IA 4FKGA 4EKKA 4N57A 3H30A 3A7JA 3FKLA 3CY3A 2VTOA 3PVUA 4S30A 4UYAA 1OKZA 2VGPA 4M12A 2W5BA 3GOKA 1ZYJA 4D58A 4ZZNA 3BLHA 5HG5A 2WU7A 3MDYA 3BRBA 4I0SA 3ZSGA 1UV5A 5C27A 3E62A 4DFUA 4CV8A 3GCSA 3JUHA 4ZSAA 4PDPA 1IRKA 2UZWE 3DK6A 3V5QA 4NM0A 2BZHB 3HRCA 4TT7A 4YZDA 2IN6A 3N4TA 3F3WA 3EQGA 2QO7A 2Z02A 1YXXA 4YBKA 2VTAA 4I6QA 4F1TA 2CCHA 4NTTA 4UALA 2IO6A 5DT4A 2F2CB 3V5LA 2UW8A 2GNIA 4JS8A 3TV7A 3DDPA 4Q9SA 2X6DA 5KHXA 3C9WA 3JXWA 4HGTA 4FK6A 4NW6A 5LVOA 3QC9A 3WF5A 4CXAA 3OVVA 4BCMA 2GHLA 2UV2A 4U7ZA 2CLQA 4IX4A 3DJ5A 5AFVA 2XIXA 1FMOE 2Y0AA 3W33A 5D7AA 4CG9A 3MJ2A 3HYHA 4WT6A 3UQGA 3EFWA 4ZSJA 5TKDA 3DY7A 2JDTA 4Z55A 3KXNA 2B9FA 3TZMA 3ZTXA 5BUEA 4N4SA 3BBTB 4EK8A 3LW0A 4IVCA 4IX6A 5J9YA 4QP3A 3PXFA 4L53A 1YWVA 1XH5A 3NPCA 2WQEA 4X3FB 3OW4A 4I22A 3E8DA 3KF4A 1PYEA 3BU5A 3VBYA 3KRWA 5FM3A 5F9EA 3LMIA 5HIBA 3ZH8A 4I21A 4RMZA 2Z7QA 4UX9A 2PZPA 1U5RA 4CT2A 3RK9A 1GNGA 2VZ6A 4FV4A 5IG1A 3EKNA 4BDDA 2J9MA 2OH4A 4JDIA 3LFDA 2OJJA 4O2ZA 4FSQA 4BDFA 2QHMA 2BCJA 5ANOA 4OTDA 1Q8WA 2NRYA 2I0YA 3QQFA 2ZV2A 4NUSA 3U51A 1DS5A 3EZRA 3EL8A 5IQHA 5AR4A 3QA0A 1J3HA 1NY3A 3SG9A 3QZFA 4KSPA 4EHGA 3PDTA 4O0XA 4O0VA 3F7ZA 4G6NA 5D7VA 3E64A 4BDAA 4CZTA 4MF0A 4YJPA 3T8OA 2FH9A 4A07A 4E26A 4ONAA 3BZ3A 4C35A 3DZOA 4U41A 3ZS5A 4D5KA 4YJVA 3W8LA 1OZ1A 2ZB1A 3ORTA 3P7BA 5GZAA 4NWMA 4ANBA 4RPVA 3PIYA 4O0WA 3UOHA 1PXOA 5HO7A 2ITOA 3LJ1A 3GC8A 3MTFA 3ZUUA 4G2FA 5HD4A 5HBHA 5HVKA 5TO8A 1OMWA 2FSLX 3N4UA 4CG8A 1LUFA 3DA6A 4J71A 3LOKA 2C5YA 2VTRA 3FI2A 4GCJA 4LRKA 4B6LA 3FZTA 3ROYA 4AT3A 4TWCA 5AP3A 4BY9E 2ZMCA 2YCRA 3QF9A 5L8LA 3MFUA 5BX0A 3PWDA 4FG8A 5KKRC 3G9LX 2RG5A 4U45A 4UY9A 4ID7A 4JG7A 4NT4A 1MQBA 3CTQA 2YAKA 3FWQA 5HGIA 1H26A 4QMYA 4UB7A 3O17A 5FDXA 1RJBA 5EDPA 3A2CA 4FSNA 3Q4UA 3S0OA 5M06A 3R8PA 5C8KA 3K3JA 3DNDA 3OP5A 3Q3BA 3Q6WA 2XIKA 3UMXA 4D1XA 3ZC5A 3QCSA 3K5UA 2ETKA 5FTOA 2Y6MA 4XP2A 2VAGA 4GG5A 1TVOA 3QYWA 4K18A 3UNJA 3W10A 4E4LA 1DM2A 1WZYA 5KBRA 4GMYA 4KWPA 5EG3A 4BB4A 1H24A 2X9EA 3P7CA 2WMAA 4WSQA 4IH8A 3LM5A 1J1CA 2NRUA 2XK8A 4EONA 5KO1A 1WBTA 5FXSA 3PIXA 3VHEA 1P5EA 1Z5MA 4GUBA 3VF8A 1PXPA 4QP6A 4G3CA 2V5QA 4AOTA 2YWVA 4DH1A 1UKHA 3U9CA 4J8NA 3T3UA 5CAPA 3R7GA 2YZLA 3Q5ZA 3OY3A 1TQIA 3SXFA 2YM5A 4AS0A 3FSFA 5DHJA 4ZY5A 3A60A 2HYYA 4HVGA 2R5TA 2H34A 2PVNA 3FZRA 2J51A 4XG6A 5FBOA 5FGKA 5LVLA 2OO8X 4ZTHA 5BYLA 3PLAE 2YN8A 4AFEA 2VTIA 3W2CA 2VRXA 2C6IA 3OEZA 5BPYA 5I3OA 2WQNA 3OC1A 3ORLA 4GW8A 3RGFA 2R3IA 5CTPA 4E5WA 4LOQA 2IZTA 3AD4A 5BVWA 4ZTMA 2OBJA 5GINE 2F7ZE 2A27A 3OFMA 4XYFA 3TEIA 5GZ8A 3K5VA 3G51A 3EN7A 3O7LD 4U79A 5HBEA 4QMNA 3L8SA 4NW5A 4PDSA 3O71A 4PPBA 3TNIA 4ZS0A 4RX8A 4JNWA 3II5A 5CVFA 5E8ZA 3E8NA 3ZXTA 3ORXA 3UZTA 4YZNA 5EOLA 2C5NA 2HW7A 3RWPA 2ZM3A 4QMPA 2W1FA 4JX3A 1G3NA 3W55A 2NNWB 4ACMA 4ASDA 4Y8DA 4MCVA 3A4PA 3NUSA 4RWIA 5AWMA 3HL7A 1SNXA 2FB8A 2OWBA 4XS2A 4DEDA 3VS6A 4TW9A 2PPQA 4H1JA 1SVEA 5HEZA 3QTQA 5I9YA 3FLZA 4E1ZA 3NNUA 1JKLA 2BFXA 3HA6A 4DHFA 2BDJA 1BL7A 3ALOA 3CXWA 3RNYA 2FUMA 3GBZA 3KXZA 3L9NA 4L68A 3QQGA 2F9GA 3TWJA 3P0MA 3B2TA 4OTQA 4YHJA 2WELA 3RZBA 3TKIA 4BF2A 5IQGA 2WOUA 1VYZA 4W8EA 2J5FA 5HLWA 4R8QA 2X2KA 5L6PA 2Z7SA 4TYHB 2J0IA 3EQPA 4I4FA 2PMOX 3FI3A 2R3MA 4D5HA 4BR3A 2C3JA 1M52A 3EZVA 4QMXA 2VO0A 5BVEA 4Z3VA 3LIJA 4WRSA 1IAHA 4DYMA 1Q3WA 3LXKA 3RK7A 3HMNA 4TYHA 4H3BA 3KK8A 4C4EA 1XH6A 2QU5A 4DC2A 4RSSA 4FVPA 5IEYA 2VTLA 1P2AA 2BDWA 5EDRA 3VS4A 4ASEA 4UMPA 3UC4A 4TN6A 3Q53A 3CPBA 4N0SA 3EN9A 2CNQA 3HMPA 3KU2A 1NA7A 4OTWA 4QMLA 3KXMA 4LRJA 2G2HA 3D0EA 2W1EA 4XBRA 5FD2A 3RALA 3L8VA 4I93A 4LGGA 4HZRA 4ACHA 4B7TA 5BVNA 2C1BA 1PMEA 3PWYA 4GT5A 4OTRA 4RA4A 4EYMA 4FX3A 2UW4A 1Q97A 5JZJA 3Q32A 2XK7A 3DXNA 4CKRA 4FEWA 2YDJA 4BI0A 4GFOA 2HWOA 2XK4A 2GSFA 1OKWA 3F6XA 4MWIA 1VYWA 5EHOA 4EHVA 3WYYA 3GNIB 2DQ7X 4IWDA 5EI2A 3V6SA 4LGHA 2DWBA 3R30A 2QOHA 4UEUA 5EHYA 5AADA 2O63A 3SG8A 4UYNA 4GT4A 3FQSA 4BC6A 2R7IA 1GY3A 4QP4A 4RWLA 2JC6A 2OK1A 3I79A 4MK0A 3ZU7A 1BKXA 4W4VA 4S2ZA 3NYOA 4P90A 1YW2A 3QC4A 3KULB 2GQGA 1Q62A 1XH4A 4EYJA 3ZFMA 2W7XA 4FL3A 3MBLA 2C5XA 5A4QA 2YFXA 2OZOA 5JH6A 1WFCA 3FHIA 1OL1A 3ZM4A 5AUUA 4DH7A 2E9PA 4YSMA 5HO6A 4YZCA 3KULA 3BWJA 4QQTA 4BZOA 3NUAA 5A4LA 4XH6A 3QGWA 4J8MA 2XJ1A 4K11A 5CNNA 4ZTSA 4QQJA 1MP8A 3LMHA 2VWXA 3QTUA 2F4JA 5M44A 2BRNA 3S2PA 3QD3A 2UZBA 5DT0A 3QHWA 5DPVA 5B2KA 1OVEA 2PULA 3ZMMA 3DBFA 5JT2A 2YCSA 3CP9A 5FTGA 2PVLA 2X4ZA 4DGLC 4C38A 5FUTA 2VTPA 3SOCA 5LMBA 2E9NA 3VUIA 2VX1A 2WMUA 4MH7A 4C7TA 5J7HA 2RF9A 3D14A 5HESA 2OF4A 3H0YA 5JEBA 4BTMA 2R3LA 1E9HA 1Y8YA 2P2IA 2UZUE 3DZQA 3R7UA 3LXNA 4DFNA 3BBWA 3G0FA 4QMZA 4L9IA 5EK7A 2XK3A 5JK3A 3I0QA 4MD9E 3T3VA 3VBVA 3GOPA 4ACCA 4CFFA 3GGFA 3CS9A 5M4IA 2O64A 2YJSA 4FGRA 3W18A 1PXIA 4K0YA 2QOBA 4DITA 4PNKA 4JR3A 4FUXA 2YDKA 4FVRA 4HCVA 3ZDUA 3KN6A 3B2WA 3EN4A 3TZ7A 4IM2A 4OT5A 3DOGA 2B4SB 5GHVA 4F9AA 3I7CA 2ITNA 5HO8A 4Z7HA 5I0BA 2QLUA 4EK5A 4YNEA 1YDTE 1EH4A 2I6LA 4O0UA 3CTHA 3H4JA 3QRJA 1M7NA 4I23A 4I6HA 5IEVA 3CLYA 4NFNA 4AAAA 2R3KA 2GNLA 5KBQA 1G8SA 4A9YA 4PTGA 1Q8ZA 3G0EA 1OKYA 3DBDA 1GIIA 3LQ8A 3CQUA 4FT0A 2F57A 3MB7A 3F66A 3WZDA 2VWBA 3CEKA 4GKIA 4FT5A 3P78A 4Z7GA 4KKHA 3HDNA 4UWYA 4BWXA 5IQCA 2HZIA 3V6RA 4FKTA 3FMMA 4WO5A 3FLNC 5HNBA 1NW1A 4GU6A 4DGNA 4X21A 3TKUA 4FF8A 4FSWA 2QKWB 3DAKA 3QYZA 3B8RA 2R9SA 4IC8A 4DF3A 4YR8A 3ID6C 4ZMEA 3VJNA 4FKJA 3ZOSA 4I5PA 5D11A 3ZFXA 4ZTNA 1ZMWA 5CS6A 3R1QA 5AV1A 4KAOA 5EW8A 2PMIA 4OUCA 5CZHA 4AN2A 5E8VA 3W2SA 5IF1A 3Q4TA 3NVKI 4JJRA 4FTJA 1A48A 3R21A 4K2RA 3IW5A 1YXSA 4YGAA 4J97A 4FE2A 4O6LA 3VRZA 2VUWA 3P4KA 3KK9A 4IB3A 3N9XA 1WBPA 4JAIA 3RPRA 4RIOA 4EH9A 2XNBA 4FUYA 3NEWA 3VS3A 5K4IA 3F2NA 3BE2A 4FZAB 4CRLA 4TZRA 4LV5A 3UOJA 3UIUA 4WNMA 4HVSA 2R0UA 2WMRA 3I5ZA 3MPMA 2EU9A 3IECA 4TY1A 5D9HA 3PG1A 2ZDTA 3AOXA 4S32A 4FTUA 5IQIA 4LQMA 2RFDA 2PVFA 5BVDA 2UZDA 2WKMA 4QQ5A 4BI1A 3FMHA 4WNOA 3W2QA 4DFYA 4FVQA 3FLYA 2WEVA 3KRLA 1YHWA 3KY2A 5DIAA 2DYLA 2ZOQA 4GU9A 4DEHA 3QUEA 5KMKA 4LMNA 3I5NA 4IFGA 5H8EA 3NAYA 4TYIA 3F82A 1WBSA 3QZIA 3N51A 5M08A 4JBVA 3W2RA 3LCTA 4M67A 3ZO1A 4AW5A 5BVKA 3OCBA 4PY1A 3LHJA 3D15A 2QD9A 4L44A 4BCGA 4KKGA 3GU4A 5AAEA 3RMFA 2PMNX 2WTVA 3H9OA 3AC8A 5J5SA 5HU9A 3ACJA 3KVXA 4J52A 1CM8A 3PZHA 4PUZA 3R8LA 4CFMA 4FBXA 4PTCA 4ZJJA 5CXHA 4HVDA 3AT4A 4PRJA 3MSSA 3TIZA 2QOLA 4ZLOA 1R3CA 2XCHA 4YZBA 1IEPA 5L2QA 5C8MA 4XEYA 3FZPA 5GZ9A 4EWHA 2P0CA 3MVJA 1ZLTA 5CSVA 5E7RA 4NEUA 3QKLA 3CY2A 4E20A 4RVTA 4HOKA 1K2PA 4TXCA 2PZYA 3BHHA 4EHZA 2W4JA 3HP2A 4AG8A 2GDOA 5IH5A 4L46A 5H9BA 2HXQA 2Y7JA 4PF4A 5M4FA 4GK3A 4D4SA 1JKTA 4MEDA 3WZKA 3EIDA 2REIA 2YACA 4EK6A 3GC0A 1Q3DA 4NJDA 4O7ZA 4F9YA 2UW0A 3NYXA 3TNQB 3WF6A 5CT7A 2Z8CA 4DGOA 4S31A 5K0KA 3R7VA 2DS1A 2AC3A 2CMWA 3GEQA 4UBAA 3TDWA 3LCKA 3EMGA 4RBLA 2WTCA 3EL7A 2I40A 3L9MA 4FKIA 2JAMA 3ULZA 3ZLSA 4FEXA 3WIKA 2XYUA 2ACXA 4E4MA 4CKJA 5IQFA 5BVFA 4BDGA 5FTQA 3D5UA 2V62A 4X3JA 2ZDUA 3ZO4A 3E7OA 5DMZA 3OT8A 3R71A 4LRMA 3T9TA 2GNFA 4HGEA 5M4UA 2CGVA 5EYKA 2OJGA 3EFJA 4C2WA 3LQ3A 5AP4A 3UMWA 1SNUA 2WGJA 4FSYA 5A4CA 2GFCA 4E8AA 5CAOA 3R7YA 3AT3A 1UWHA 1REKA 2V55A 4FGBA 2R3HA 3A7IA 2X7GA 4YHTA 4YU2A 5EH0A 1M2QA 3BI6A 3DNEA 3A4OX 4F7NA 4GFMA 4QNYA 4ZJVA 4RQKA 4FSTA 2ETRA 4QP9A 4RFZA 4XX9A 4QMQA 4AW1A 4ZZOA 3OXTA 5JQ8A 3LJ0A 5IQDA 3FY0A 1CTPE 3O96A 2IPXA 4DLIA 5LWMA 5KNJA 3H9RA 3KKVA 4ERWA 3WF8A 4GJ2A 3H0ZA 4FNWA 4A9RA 1UWJA 3DCVA 3LE6A 4XG4A 5E91A 2GQRA 5HNGA 4FZDB 3ZRLA 4RC4A 2BPMA 2XNEA 5J79A 5AV2A 4NM7A 4JIAA 5KMMA 3TNPC 4EQMA 4RX5A 3QRIA 1YOJA 2XVDA 2IVSA 4Q5EA 3GP0A 3I0OA 4AUAA 4D4RA 1OB3A 4M0ZA 3MN3A 1X8BA 3OWKA 4DG3E 5DRBA 4AU8A 3AGMA 4N6YA 4IW0A 5CQUA 2X7OA 2NO3A 2VN9A 2YIRA 3FYJX 4JG8A 3HMMA 4P7EA 2XKEA 4V0GB 4A4OA 4OTGA 3RKBA 3OCSA 1XBBA 4BI2A 5E4HA 3NNXA 4FV3A 2O2UA 4XOYA 5CX9A 2PHKA 4EOPA 5LJJA 1FOTA 2AUHA 2BUJA 4E3CA 1MRYA 4DCEA 2FSTX 3MESA 5AR5A 2X39A 3JPVA 4UV0A 4X2FA 3L9PA 3VF9A 3U6JA 1M2PA 5HE0A 1MRVA 3BYUA 3CIKA 5G6VA 1SVHA 3V5WA 4Y72A 3UGCA 3N4VA 5EI8A 3EQBA 3R8ZA 5HOAA 4JDKA 3VS7A 4LFIA 4GYGA 4EOOA 2CGUA 3R9RA 4AZSA 4YLLA 5ICPA 4CMTA 5A46A 3DGKA 3R0TA 3VIDA 5AP7A 5F4NA 4ANMA 3ZUTA 1OL5A 1IASA 2WO6A 5KE0A 5CF5A 5FEEA 2YEXA 5CALA 2FSMX 3C13A 3MS9A 4W8DA 3OTVA 4ZSEA 5IMXA 5A54A 4B9DA 5EKOA 3NUUA 3UJGA 4NL0A 4CFNA 3C0IA 4GK4A 2JDRA 2CJMA 2C6DA 3PPJA 4ZLYA 4APPA 3C4EA 3EKKA 4ZIMA 5J9ZA 2C1AA 4ZY6A 2R3QA 3RPYA 4USDA 1AD5A 2I0EA 5A6OA 4WNKA 3AT2A 4JAJA 4JIKA 5L6OA 4M84A 4BDEA 3LFBA 3V51A 3U4WA 3PY3A 4G9RA 4XG2A 4NH1A 3TV4A 2R3JA 5I4NA 4C4HA 3Q4CA 2JKOA 4JL9A 4C0TA 4PDYA 4FTAA 4XUFA 1FVRA 1WBOA 2QOIA 4KUJA 3KREA 2OJFE 4OTIA 4BFMA 3TM0A 4I20A 5KZIA 3PJ1A 5IA2A 5DOSA 1Y6BA 4ANSA 3FMKA 3TDVA 4TNDA 3PSBA 3RP9A 3VW6A 1GIHA 1K9AA 4O22A 3R8UA 2ITPA 2J50A 4I4EA 5C26A 4QTAA 3MY1A 1LPUA 1SMHA 4FTTA 5A4EA 5JFXA 5L2IA 4EEVA 3DS6A 3I81A 4OR5A 2XH5A 2KTYA 5HHWA 2VX0A 5A14A 3KCKA 1PW2A 2O3PA 4XHKB 3JYAA 3ANQA 3GC7A 4ZTQA 2PL0A 1ZOGA 2BAQA 2C6MA 3S95A 5KMLA 1MQ4A 3C4WA 5BYZA 5HTIA 2ERKA 4HYUA 4CEGA 5CANA 5I9WA 3GVUA 2SRCA 3O8PA 3QTRA 4L3LA 2XIRA 4FTKA 4KABA 4BKZA 3W1FA 5EM6A 4F7SA 1J7UA 2ZM1A 3ZEPA 3DBQA 2C5OA 1H8FA 4EJ7A 5LVPA 2P33A 3E92A 3IDBA 1M14A 3OCGA 4BDCA 2QO2A 2PZRA 5M53A 3FAAA 3SGCA 2VO3A 3TJDA 5CWZA 2YCQA 4MXAA 4DFBA 2QR7A 1B39A 3NIEA 3RM6A 4AZWA 4PNIA 3D5VA 4AOJA 4FYOA 4GIIA 4CD0A 5CEIA 1AQ1A 3IDCA 3POOA 4F7LA 5L4QA 4YJNA 1PYXA 3FUPA 2X9FA 3CPCA 3QZHA 5GIOE 2W5HA 5CQWA 4QYHA 4YHFA 4YC8A 4F9CA 1JSUA 5C9CA 4PP9A 1PHKA 3ZSIA 1WBNA 2VTJA 1FVVA 4AA4A 2OW3A 3P23A 5C1QB 1QL6A 4FODA 4F65A 3R9NA 4JRNA 2RKUA 2YZAA 4FKVA 5HORA 1F0QA 2OG8A 4M97A 4OAUC 3RJCA 3FV8A 2BRMA 3U8WA 4IB5A 1W8CA 3GU6A 2F7XE 4FTRA 5AP0A 5DWRA 3VUKA 3LFEA 3NIZA 4TTHB 5IZFA 4BCIA 4WG5A 4RRVA 3LQ5A 4MNFA 5HCXA 1K3AA 3FKNA 4BWPA 3RAIA 3PJ3A 4FV9A 3RWQA 4C3RA 2YWPA 3HGKA 3HRFA 4B99A 4YTHA 4V04A 4BDBA 3CQEA 4OBOA 2ITYA 4XG3A 2JFLA 3IONA 4PTEA 3WOWA 4UN0C 5E1SA 3GFWA 5CU2A 3GQLA 1W82A 3FYKX 3RVGA 5DG5A 2B0QA 4X3FA 3E87A 1Z9XA 2X8IA 1QMZA 5KZ0A 4F0IA 2XEZA 3G2FA 1RW8A 4WA9A 4GG7A 2XP2A 2IW9A 4ZSGA 4Y73A 3IPHA 4FICA 5EFQA 2HXLA 2QHNA 2GCDA 4Y85A 4E4XA 4HGLA 2ITUA 2QOOA 4H39A 4YPDA 1JLUE 3SHEA 1NT2A 3FMEA 2LGCA 4WBOA 1FINA 2UW7A 3NCZA 4JG6A 4C33A 2G2IA 4D28A 4USFA 5HLNA 1G5SA 2XNMA 2YLEA 3L8PA 1H25A 2XM9A 3PA5A 3QX2A 4G3GA 4I0RA 4J7BA 2XBAA 3RHKA 3ZHPC 2A4LA 4I3ZA 4K1BA 4A9SA 2Q83A 4Y5QA 3SAYA 2EWAA 1JBPE 3MY0A 5BNJA 3JY9A 1H1WA 4IAYA 4FKLA 3UYSA 4D0WA 2QR8A 4XV3A 3BHYA 3MFSA 2GNHA 4CYIA 4EZ5A 3VS0A 2VGOA 4L52A 4BGGA 4ANOA 5EQPA 3EH9A 3CC6A 4FV7A 2X0GA 5A3XA 4F9WA 2X2MA 4CFWA 4YC6A 3F2RA 4XOZA 2QOCA 3QQKA 1ZYLA 4RZVA 2I1MA 5IU2A 2EVAA 5CSXA 3GENA 4F6SA 5CXZA 4KIPA 5AUYA 4L7FA 2RG6A 1GIJA 5HU3A 1YI6A 4DBXA 3VN9A 4D4YA 5EYCA 4AA5A 3BLQA 1UKIA 1E1XA 1QPDA 2VU3A 4JBPA 5AV4A 5CENA 1NVQA 4W4WA 2ITVA 4BVUA 3QGYA 1PXJA 3EN6A 4MTAA 3W2OA 2EB2A 2JIIA 3DKCA 5CY3A 4E5AX 2WXVA 3BYMA 4DLJA 1U54B 1Z57A 4FSRA 4EUUA 2EXCX 1ZYSA 4FT9A 4RLKA 3WARA 4RX7A 3ZLWA 3SW7A 1LEWA 2CN5A 1OITA 3MH0A 4DTKA 3HDMA 4G6LA 1ZZLA 4ZLZA 2C6TA 3IKAA 4JQ7A 5JGAA 1U54A 1VEBA 2W06A 2QOFA 2HENA 2VTHA 2VWIA 2VWZA 2W05A 2Y4PA 3DU8A 1XWSA 5LQFA 4QMMA 4O1PA 4O7NA 3EOCA 5AIKA 1H4LA 5E8YA 1PY5A 3P7AA 5C8NA 5IA5A 3P9JA 2YITA 4FZFB 4L8MA 5HE3A 4B4LA 3EB0A 3HUCA 4C4JA 3KXHA 3PYYA 3KXGA 3R2YA 5DVRA 1APME 3QQJA 4JQEA 4BDKA 3E7VA 3U4UA 3Q4ZA 5I9XA 3DJ6A 4IC7A 2R7BA 4R7BA 5CSHA 4ZOGA 4F6UA 4I6FA 2CHLA 5E8UA 4AZFA 2EXMA 4ACDA 4EORA 1YKRA 1WAKA 3DQXA 4AE6A 3FMNA 3KA0A 3KQ7A 4Y46A 3F9NA 5EM5A 2VTQA 4HVHA 2QKRA 3COMA 2VTMA 3TNWA 2XKFA 4DEAA 1LR4A 2PE1A 3TZ8A 2RFEA 3QD4A 2E9UA 1NVRA 2P4IA 2W96B 3WE8A 4CNHA 5CSPA 5EKNA 4F0FA 2BHEA 2A1AB 3EHAA 2JITA 3UDBA 3PJ8A 5ACKA 4G31A 4RJ4A 4XLIA 5DN3A 5JFVA 3LKMA 1YOLA 2YISA 3GCQA 4CMOA 2WMQA 4FKOA 3JY0A 4L45A 3ZRKA 4QO9A 4LI5A 4APCA 3P79A 3FMJA 4CV9A 3MFTA 3PXYA 2C3KA 5EI6A 2QOKA 2RFNA 1YWRA 2YDIA 3H3CA 2B54A 3AMBA 5KKRB 2CGWA 4MVFA 5HI2A 4UZHA 4XRJA 2V7AA 3DK3A 3F3VA 3FQEA 4GVJA 4R3PA 3CCNA 3UZRA 3ENMA 4FIHA 3BIZA 3IW4A 4G5JA 4XV9A 4IDTA 4F6WA 4U3ZA 1DI8A 1TQMA 4KA3A 3SLSA 3SKCA 3IGOA 2VTSA 2ERZE 4RZWA 4YJRA 3TN8A 3F7WA 4BIDA 2Q0BA 3BGZA 2R3FA 4E73A 2YIYA 3QU0A 5J87A 1V0PA 4E6QA 2BKKA 4ORKA 3ORNA 4DT8A 2OKRA 1CKJA 4ITIA 4XRLA 4H1MA 2UW3A 3Q5IA 4MHAA 5AV0A 5L6WL 4UMQA 2H96A 3BCEA 1PJKA 4NFMA 4UMRA 3U54A 5KX8A 3PZEA 1GZOA 4AX8A 3L1SA 4O7LA 5HG9A 1OIUA 3ODYX 4FEVA 2UVYA 3W8QA 3COHA 3HEGA 5HVJA 4BDIA 3RCDA 2B55A 2CKEA 3K3IA 5F94A 4RA5A 1OL6A 5IH4A 2W1HA 5M4CA 2FYSA 3R2BA 4KINA 4BCHA 5CVHA 3C1XA 2IG7A 2G2FA 5HKMA 3RPSA 3CBLA 4O2PA 3CGFA 3OWPA 4C8BA 3PUPA 2CGXA 2J7TA 4KBKA 5AMNA 3PPKA 4HNFA 3PRFA 1O6YA 1UA2A 5L8JA 4FNXA 4RWJA 5CF8A 1KSWA 5E92A 3UQFA 2HZNA 3F5UA 5FP5A 4KIQA 4CLIA 4QYEA 4BBEA 4MBIA 2NPQA 3BKBA 3QTXA 5JZNA 4AF3A 5T6KA 4C62A 4DFZE 2XM8A 1V0BA 3P08A 3R28A 4FKSA 4IZ5A 4F7JA 5K5XA 5AR3A 2E9VA 2X2LA 5EW3A 1H1QA 2W5AA 4U6RA 2UZLA 5IA0A 4DE4A 4XP3A 3ROCA 2A19B 2BTSA 3QUPA 3WBLA 3PA4A 5LVMA 3ZRMA 3TCPA 4G5PA 3C5IA 3PA3A 5TE0A 4C34A 4IEBA 2R3GA 2UZOA 3EQCA 3Q9YA 4QT1A 4BZDA 2HCKA 2W1GA 3SXSA 4C36A 3UPXA 2JLDA 3O0GA 4X0MA 4BIBA 5HBJA 3A99A 4EH7A 3AGLA 3O8TA 4KS7A 2JIUA 2QONA 4CSVA 1M17A 1S9JA 5IISA 4IDVA 3NS9A 4OT6A 1ZYDA 1JKSA 4A06A 2BZIB 4JXFA 3MY5A 4ASXA 3PSCA 4AZTA 4C4FA 3PXQA 1I44A 2YIQA 2QI8A 4BHZA 3E63A 1R1WA 3FPMA 5E8TA 3ZZWA 3ERKA 3OMVA 5B2MA 1RQQA 3R83A 4EOKA 3E93A 4FEQA 1YXVA 2BALA 4FV6A 1OECA 4YJQA 5DRDA 2QOQA 4PX6A 5IDPA 3MIYA 2ITZA 2ITTA 2W4KA 4X2KA 3GUBA 4AZVA 2Q0NA 3D4QA 3Q9WA 4TRLA 2W1DA 3NW6A 1J1BA 4FNZA 4G3DA 1GZKA 1YVJA 4I5HA 4KRDA 4CTCA 4MXCA 3DXPA 4GUEA 2G15A 3TTIA 4DA5A 1QCFA 4QMTA 2Y9QA 1O9UA 4FKQA 2IW8A 1ZY4A 3DLSA 3R73A 4IBMA 1OUYA 4FG9A 4Y5HA 1MRUA 3S00A 5IPJA 4QP8A 4NK9A 2ITWA 4O0RA 1ZYCA 5JRSA 4JQ8A 3F5GA 4JDHA 4FTLA 4WD5A 1Q4LA 4XCUA 3NSZA 2KULA 2BRHA 5E1EA 1YDRE 3D7ZA 3LJ2A 4GVAA 5K4JA 2QNJA 4FYNA 2X1NA 4UXQA 2HAKA 5GNKA 3DXQA 3UOLA 4ZJIA 4O7TA 4ZEGA 5HG8A 4YC3A 2RL5A 3PFQA 5E9EA 5GIPE 2BIKB 1H08A 2GMXA 4O84A 4R78A 4FTNA 3C4CA 3BHVA 3UVRA 4EKLA 4FV2A 2QODA 2OXDA 3MVHA 4OW8A 5I9UA 3KMUA 5HE1A 5AUVA 2FGIA 3P86A 2IZUA 5D41A 4IAAA 5BYYA 1XBAA 3CGOA 4PL4A 4G17A 2XIZA 4PL5A 5DEYA 1ZMVA 3M11A 2HK5A 4FTIA 4NCTC 4DTAA 3MTLA 5AAGA 4KS8A 5ETCA 3RAWA 2JKMA 2GNGA 2GS7A 4K77A 5LCJA 4R5SA 4TYEA 5HG7A 3FI4A 3EWHA 5IKWA 2C69A 4FNYA 2OLCA 1IA8A 3V8WA 2ETMA 1OIRA 5IA3A 4U8ZA 2AC5A 3TUBA 3TXOA 2W17A 4CQGA 4CFXA 3GU7A 4CCBA 4RGJA 4F70A 3LFCA 4DG2E 4AFJA 2Z2WA 5CU4A 3C7QA 4BTFA 1OPJA 3BHTA 3I4BA 2C6KA 1FMKA 4GEOA 4C59A 4DG0E 4FT7A 2PVYA 1H1SA 3HNGA 3KN5A 1OPLA 3LAUA 4ITHA 3HV6A 3BU6A 3I60A 4FOBA 3UIBA 4AGDA 5KHWA 3HAVA 4H05A 1B6CB 5BUIA 3R1NA 1IAJA 4YPSA 4BICA 2YA9A 3EJ1A 3HLLA 3TKHA 3FKOA 3F3TA 4QP1A 5G1XA 3BHUA 1OUKA 5I3RA 5J1VA 2GU8A 4MXYA 3NR9A 3MVMA 4ARKA 4O96A 4RQVA 5IQBA 4HCUA 3H10A 2PUNA 2GS6A 2DUVA 3U6IA 4G6OA 3GB2A 2W9FB 1YQJA 3ZYAA 3TIYA 4GRBA 5EOBA 5DR6A 5IEXA 2WQMA 5IQAA 4L3PA 4CYJA 3SX9A 2YERA 3Q9XA 4ANLA 4C37A 4Q9ZA 2X6EA 3AD5A 3WIGA 4RVMA 2WPAA 2X81A 4DINA 2GS2A 1Y91A 1YDSE 3BU3A 3FL4A 5K5NA 3GCUA 2PVRA 5LMKA 4S34A 4M15A 4YJOA 3R9DA 4BKJA 3SRVB 4QQCA 3GCVA 3SW4A 1OIQA 4FV0A 4MBLA 3M42A 4U3YA 1ZY5A 3E5AA 5I9ZA 5J1WA 3WF7A 4ALVA 5L3AA 3AC1A 2WMBA 4Z16A 3D2KA 3D2IA 4YMJA 5BUJA 2C0IA 3CR0A 1M2RA 3CE3A 4FKWA 3SRVA 3C51A 3VBTA 1DAWA 3R00A 1YI3A 1UNLA 4YLJA 3ZDIA 3FLSA 2XYNA 5JGBA 3PVWA 2J6MA 3E88A 3R6XA 4UMTA 4A4XA 3BYOA 1H27A 5E90A 3KFAA 3ZM9A 4V01A 3BEAA 5FEDA 3MPAA 1KE7A 3AMAA 4DBNA 1ZWSA 3QZGA 4HZSA 4USEA 2QURA 2UW6A 4MKCA 4PV0A 4RX9A 2OZAB 2F2UA 5FG8A 3A7FA 4FSZA 5ANDA 4IB1A 4RLLA 1ERKA 3FJQE 2R3NA 2P55A 3QL8A 4U5JA 2C68A 4WG3A 1CKIA 1JAMA 3EN5A 4ENYA 3IK3A 1SVGA 4R7HA 2VNYA 4ZK5A 2JDVA 4BCKA 3BQRA 3UP2A 1Q5KA 1J91A 3ZC6A 3O7LB 2OZAA 4MQ2A 4N70A 2QC6A 4RT7A 4IB0A 4MD7E 5AR2A 2XS0A 2H8HA 1H00A 4M7IA 1ZMUA 3C4XA 2B9HA 4AN9A 4EK4A 3UYTA 4FKPA 3NUXA 4NZWB 1BMKA 3HX4A 3OD6X 5CSWA 5EW9A 2R0IA 3QWJA 3ZO2A 5HCYA 4R5YA 3EQHA 1PXNA 3NRMA 4J95A 3NUNA 3EQDA 3GT8A 3TUCA 3CQWA 1ZARA 3QLFA 2YLFA 5GJDA 2Y4IC 3CJFA 2QLQA 5IQEA 4NKSA 5ANEA 3QTWA 2WMWA 4H58A 3LFNA 3VBQA 4IXPA 3DFCB 4IJ9A 3PJ2A 2OH0E 1Q8TA 2FO0A 3G5DA 3W16A 4KBCA 4MYGA 4L00A 2WOTA 4WHZA 4XMOA 2J0MB 2CCIA 4E6AA 4EBVA 4F99A 3V01A 3EYHA 1GJOA 4FA2A 2IVTA 2R2PA 3NYNA 5BQ0A 2E9OA 1GZ8A 2VO7A 3QLGA 3U55A 3AC3A 4BIEA 5TOZA 3V3VA 1JSVA 4ZP5A 5LXMA 1O6LA 4EOQA 4QTCA 2WQBA 1XO2B 3WF9A 4DEIA 3DTCA 2BAJA 2FVDA 4DH3A 2I0HA 2QU6A 3UVPA 4M13A 3W2PA 3DV3A 4OTHA 3JVSA 3SD0A 2JEDA 4V0GA 2VX3A 1Q8UA 3RI1A 3ULIA 4NTSA 3VS1A 5KUPA 2Y6OA 3VUGA 5CNOA 4BGHA 3LCSA 2PTKA 3Q04A 3QCXA 5JRQA 5CU3A 3DAEA 4WSYA 3QXPA 3R8MA 4DGGA 3IOPA 2EUFB 2WHBA 3NYVA 3QRKA 3LMGA 4J1RA 2I7QA 5CU6A 3FDNA 3HECA 3P1AA 3DB6A 4PPAA 3R8VA 4PMTA 5KMJA 2ZYBA 1GZNA 4D2TA 3KMWA 3KGAA 3R1SA 3NW7A 4EC8A 5KCVA 4WRGA 3RNIA 3A7GA 3OWLA 1JQHA 5BMSA 4I41A 4JT3A 1ZAOA 2BZJA 4RIYB 4RC2A 3S1HA 3GC9A 2WTWA 3ANRA 4FSUA 3OBJA 5EYDA 2A2AA 3G6HA 3VQUA 4JVGA 4GYIA 5AP1A 3VQHA 3QWKA 4DN5A 3FBVA 2PE0A 5CAVA 3NLBA 2PU8A 4L67A 3KF7A 2V7OA 4D1SA 3V5PA 4RIYA 3GU8A 2HWPA
chains in the Genus database with same CATH superfamily
4I1ZA 1YRPA 1VJYA 1Y6AA 2BKZA 3DPKA 5FQDC 2FSOX 1IR3A 2OICA 4RFYA 5AP6A 1CKPA 5CZIA 2VD5A 4RIXB 3FLQA 3E3PA 5DT3A 5FLFA 2OFUA 3F3ZA 4G1WA 4DEGA 5ANKA 3TJCA 5LWNA 4PL3A 3NDMA 4DHIB 1ZZ2A 1XQZA 2ITXA 2XZSA 3PJCA 4X3FC 3ZFYA 5C01A 2EXEA 3FZ1A 3UC3A 1BI8A 1DAYA 3NWWA 3FPQA 3UG2A 3PXKA 2BR1A 3UP7A 1M7QA 3ACKA 4HPUE 3DK7A 3OWJA 2BAKA 3OY1A 3R02A 3R63A 3QFVA 4RIXA 2GPHA 1CSNA 2PK9A 2W1CA 3KEXA 3OTUA 4JI9A 5FRIA 5HX6A 4D2WA 3D94A 4BYIA 3PP0A 2W99B 2CNVA 2C4GA 4AT4A 2B9JA 4IM3A 4MXXA 4UZDA 2BRGA 3QD0A 4FC0A 4CFVA 5HICA 1H01A 4QMOA 5EYMA 4AGUA 3ZO3A 2W1ZA 3LCDA 2XKDA 4J99A 4YJUA 3ENHA 4KD1A 3KMMA 4L3JA 4LV8A 4YZMA 3SXRA 4FIFA 4IANA 4BCFA 1WCCA 4TYJA 4B8LA 2PWLA 2CLXA 2ZB0A 4KRCA 1FGKA 1REJA 1FVTA 2B53A 4YJTA 3I1AA 4DDGA 5H2UA 5A6NA 2GHGA 5FEQA 2J4ZA 2C0OA 3OBGA 4BBFA 2WMVA 1F3MC 3BV3A 4MAOA 4W4XA 5DH3A 3QXOA 4EK3A 1UU8A 3EQRA 5C4LA 3BGPA 2O0UA 1ZOEA 5TT7A 1PKDA 1L8TA 3DJ7A 1P4FA 2C5VA 3DBCA 4NJ3A 5LVNA 1W0XC 3NUYA 3H9FA 4KB8A 3V8TA 4O6EA 3VS5A 4WUNA 3VJOA 2PUPA 3LFAA 2O65A 5DEWA 4WUAA 2QG5A 3NGAA 1WMKA 4FKRA 3P5KA 2QQ7A 1XMLA 2XRUA 3L8XA 3B8QA 4QMVA 3HA8A 4DEBA 3V8SA 2PVJA 4EH3A 4FEUA 2ONLA 4JBOA 2GTMA 2XALA 2NP8A 3CD3A 1LP4A 2UZVA 4NIFB 4R6VA 4YJSA 4EOIA 2J90A 4KNBA 3UODA 3WZEA 1XBCA 3Q60A 4E7WA 3OUNB 5CEOA 4AZEA 3FQHA 3QD2B 3RAHA 2OXYA 1P4OA 5DNRA 2XUUA 4JDJA 5T68A 2XNOA 1SM2A 2WQOA 4F09A 2C6OA 4O4EA 4OGRA 4NIFA 2CKOA 2PUUA 2VWUA 2WTKB 2YIWA 3SOAA 2CKPA 1P14A 3DKFA 3OS3A 3QTSA 4RJ8A 4ZTRA 3THBA 2XB7A 4QMUA 2WU6A 1STCE 4O86A 3IDPA 1H0WA 4IWQA 4RJ6A 5LMAA 4L42A 4C58A 1H0VA 4FIIA 4CKIA 1W7HA 3QKKA 4PDOA 2OIBA 2G01A 2VV9A 4FKUA 3ZLXA 5AJQA 1T45A 4ZXTA 4ZAUA 4BYJA 1UU9A 4LMUA 3BL7A 4LOPA 2UVZA 3GI3A 4P2KA 4CZYB 2YM8A 3D5WA 3LFQA 4QMSA 4LV7A 2ZM4A 3FZSA 3UZPA 3RTPA 1WVWA 3D83A 4NSTA 1GAGA 2QG7A 3VUMA 1SYKA 3Q96A 1JOWB 4BCOA 3HP5A 4BRXA 4OAVB 2WAJA 4RFMA 5CI7A 3GXLA 4IIRA 4LYNA 3U6HA 3NVMB 2F49A 2CNUA 5CASA 4U9AA 4AAYA 3AD6A 4O83A 1OM1A 1KV2A 1HCLA 2BILB 4DTBA 4C3PA 3BGQA 5CT0A 5CF6A 2R3PA 4AWIA 2PZ5A 2E2BA 4FL1A 3MPTA 5AM6A 3WZJA 4O4BB 5EHLA 3BYVA 2YJRA 2C6LA 3KCFA 4O82A 4CRSA 2VWWA 4NKAA 4BBMA 2C0TA 3VULA 2PMLX 3ZEWA 3GFEA 4O7WA 5FXQA 4QYFA 4FL2A 4LL0A 3PG3A 4EZ7A 1UU7A 2BMCA 2QO9A 3KRRA 4KKEA 3SQQA 2OJIA 3C4ZA 3UE4A 4FTMA 4G3FA 1CDKA 4QEBA 4LGDA 4RVKA 1W2CA 3UO6A 4O0TA 4YTIA 3TT0A 4O1OA 4ZTLA 4D2PA 4BJJB 2V22A 4F1OA 2VO6A 4A7CA 4XBUA 3TACA 3K54A 4UMUA 1NVSA 4XLVA 4Z9LA 3MVLA 4I94A 3AC4A 4X6RA 2RSVA 3UVQA 3O8UA 3REPA 4CCUA 5L2TA 5M51A 4LM5A 4ZZMA 1UNGA 4LOOA 4DH5A 4M66A 2YABA 4BJJA 5ITAA 3V5TA 4D9UA 3QCYA 4CZUA 5ACBC 1WBWA 1JNKA 2XJ0A 3EQIA 2A0CX 1ZXEA 2UZEA 3FC1X 3C50A 3MA6A 2BDFA 4L7SA 3KC3A 3NX8A 4FK3A 4ASZA 2RFSA 4FIJA 3FE3A 4O38A 3UQCA 1ND4A 3BPRA 3DDQA 4BL1A 2LAVA 1Y57A 5J7BA 3IGGA 3LLTA 1H07A 4EH8A 5IUHA 5JN2A 4QOXA 5M56A 2XANA 4RJ5A 2C3LA 1OIYA 3OXZA 3A8XA 4I5CA 4ANQA 3IW7A 4LUEA 4QYYA 3LM0A 2C30A 4MQ1A 5M55A 4FV8A 4AACA 2AYPA 2GTNA 3A8WA 3JVRA 4M69B 5A4TA 5H8BA 3FMLA 2CN8A 3ZONA 5D12A 3BV2A 5DA3A 4XG8A 4O0YA 3AC2A 4FTOA 4GT3A 4PPCA 5ANGA 3UBDA 3SA0A 1ST0A 3D7TB 2B52A 4EL9A 5JSMA 4JX7A 4QDVA 5EM8A 4I5MA 3QTZA 2OJ9A 3PUFC 3BLRA 5GJGA 1XH8A 3SDJA 2C47A 4M69A 4QTEA 5M57A 2PE2A 4I6BA 3ET7A 4FIEA 4RJ3A 5AAFA 4GL9A 3D7TA 1HOWA 3M1SA 1Q8YA 1XMMA 2PZIA 3PPZA 4QDEA 3OW3A 5GJFA 4BCQA 5F1ZA 4AQCA 5JFWA 4N6ZA 3HMIA 1IG1A 4AXAA 4D9TA 4LG4A 2OXXA 4EH2A 4J98A 2PY3A 4CMUA 4CGAA 3NW5A 3FZOA 4M3QA 4LL5A 5DLSA 3ODZX 2HELA 1PRYA 4HW7A 2P2HA 2JFMA 2XEYA 5JFSA 5L8KA 2YM4A 5EQEA 2XKCA 3SVVA 4KIOA 4YTCA 3HZTA 3HKOA 3WI6A 4R1VA 4G16A 3LCOA 4TWNA 3R9HA 3TZ9A 2PSQA 4FMQA 3DBEA 4G34A 4TWOA 3FXZA 2OIDA 2XCKA 2BRBA 4RIWB 1Y8GA 2HZ0A 4U81A 3TTJA 4D0XA 4EC9A 3TUDA 3JR1A 1H28A 3Q6UA 1XJDA 4QP2A 3U87A 3QRUA 3ORMA 1WBVA 2J0KA 4EH4A 3UNKA 3KIOC 5HZNA 5K0XA 1PMVA 3Q2JA 4O7SA 1FGIA 5JKGA 4P5QA 4RIWA 3ALNA 5K3YA 3QCQA 4IVDA 5E8WA 3LVPA 5DYJA 3BE9A 4JOAA 4FTQA 4K9YA 2W1IA 4IE9A 4U44A 4AE9A 2VTNA 3QTIA 2WTDA 3PE1A 4IMYA 4JR7A 2QCSA 4YP8A 3OXIA 4D4VA 2WEIA 3LFSA 1O6KA 4XV2A 5DBXA 4PMPA 5ETIA 2R4BA 3UO4A 4TKSA 1ZRZA 3EYGA 2WD1A 3HV7A 4YUQA 4UWCA 1FPUA 1PXLA 3Q9ZA 2Y8OA 3V5JA 1MUOA 4IVAA 5HLPA 5J5TA 4JBQA 3UG1A 4EOSA 4O91A 4QMWA 4ITJA 5DGZA 3F88A 4WKQA 4RJ7A 4ACGA 2X8DA 5D1JA 5JGDA 5AUWA 4DAWA 5JQ5A 2HY81 1JPAA 2BZKB 1U4DA 4C61A 4YNOA 2X7FA 3SV0A 3O2MA 4MX9A 2HZ4A 2ZJWA 4PMMA 5AA9A 4CFUA 4L6QA 5JMSA 2W0JA 4E5BA 4O27B 2VWYA 4GH2A 4CVAA 1KOAA 5FXRA 3FC2A 2PVKA 3F61A 5CEPA 2PVMA 3EFKA 3UO5A 4QP7A 3UIMA 2BIYA 4UWBA 1SZMA 3TI1A 5CEQA 2JDOA 2PUIA 4PP7A 2JD5A 4U97A 2ZVAA 5CLPA 3PLSA 4H3QA 1XHAA 3TG1A 3HRBA 3W0RA 3PXZA 1W98A 1FQ1B 2ZV9A 4GV1A 4DEEA 4U40A 1OL2A 1G8JA 5AUZA 2ZV8A 5KMNA 2IWIA 4TWPA 3QHRA 4IADA 1U46A 2IEWA 3MIAA 3OT3A 2B1PA 2IVVA 4QD6A 5ETFA 2BTRA 4QPSA 1F5QA 3ATSA 4X2JA 5HCZA 4MBJA 5AP5A 3MA3A 5AA8A 4ZMFA 3NNVA 3RPOA 4AT5A 3LPBA 3VNTA 1IA9A 4TYGA 5EM7A 3R7IA 1RDQE 3WYXA 1H1RA 1QPJA 2WB8A 3PXRA 4AW2A 2WMTA 1URCA 4OTPA 4WOVA 2GFSA 4JRVA 1BX6A 3MFRA 2XIYA 1GOLA 3AKLA 3P5JC 4OTFA 5HE2A 2O5KA 4WIHA 3KRXA 3IOKA 2UW5A 3FMDA 3HV4A 3LXLA 3RHXA 3ZSHA 1Q41A 1R78A 2X0QA 3MV5A 3ZBXA 2V0DA 1Q61A 4F1MA 4YTFA 4YO6A 3WZUA 5CVGA 3R7OA 3AG9A 5DFPA 5IH6A 1YHSA 3FI8A 2Z60A 4D2VA 1I09A 2J2IB 4IFCA 3QBNA 4H3PA 2ZMDA 4D1ZA 4I92A 4KIKB 4FIGA 1KE6A 2ITQA 2OU7A 1XR1A 2YCFA 1R0EA 4MWHA 4MNEB 4O0SA 3VBWA 4Q2AA 4C57A 3MJ1A 2WTJA 2UZTA 3EQFA 3W0SA 3ETAA 2WMSA 4KIKA 4WNPA 5TR6A 5LMKC 3ATTA 3MWUA 3F3UA 3JS2A 3L9LA 4L01A 4MNEA 2XK6A 2OGVA 4IAFA 4L43A 2IJMA 4WBBB 3DT1A 3I7BA 2HOGA 4A9UA 5HIEA 4E6DA 3NZ0A 3CJGA 3R9OA 5HX8A 5LOHA 4C4GA 4QRCA 4FI1A 1LEZA 4MXZA 4X6QC 5LARA 4RVLA 4FSMA 5KMOA 5J9LA 3QUDA 4NYEA 4BTKA 3VO3A 5B2LA 3O23A 3HMOA 4TPTA 4IM0A 5E8SA 5J8IA 1JWHA 5J95A 5AR7A 3PVBA 3DLZA 3VUDA 3BEGA 2UVXA 4FTCA 2C6EA 4BDJA 4EOMA 2XRWA 2IVUA 3LXPA 5KMIA 3D5XA 4EOJA 3DQWA 3R1YA 1BL6A 4BCNA 3HV5A 2YIXA 2YM3A 4TNBA 4UXLA 4ERKA 4M0YA 3VC4A 5BV3A 2FA2A 3ORIA 3VUTA 3MH1A 2W9ZB 4PQNA 5CF4A 4F64A 2WNTA 3FSKA 5AUTA 4I0TA 4BHNA 3MH3A 3PIZA 3UOKA 4HPTE 4DGMA 3GQIA 1XH9A 4HYHA 3BELA 3OOMA 5ANJA 4F9BA 5HTCA 3OROA 4X7QA 3RZFA 2C3IB 1TQPA 2JAVA 4HGSA 3PTGA 4RWKA 4J53A 4ZSLA 3VBXA 1ST4A 1JVPP 1A06A 3PVGA 2GQSA 5HIDA 4D2SA 2Z7RA 4GFGA 3RK5A 1URWA 4G9CA 2QVSE 4GSBA 2BHHA 2GNJA 3F69A 3MW1A 4M68A 5ETAA 1OPKA 4MXOA 2XNPA 4W9WA 5H8GA 2JDSA 5AM7A 3VS2A 1G8AA 4K33A 3AC5A 4JLCA 4OBQA 3IS5A 4R3CA 4ALWA 3DTWA 4IACA 3QQLA 2WZJA 4EWQA 1BYGA 1DI9A 1UNHA 3AKKA 3QA8A 4QTBA 3I6UA 5CAQA 4EUTA 4FG7A 3PSDA 4Q5HA 2IF8A 5C03A 4YBJA 3UIXA 4AGWA 4CTBA 4IAKA 3TV6A 2CSNA 4O7YA 2J0LA 1U59A 3ELJA 2EB3A 3ZUVA 3ORKA 2XNGA 1YWNA 1YXUA 4O21A 3FL5A 5ANIA 1OKVA 5FDPA 4IZYA 5FP6A 4EZ3A 3OCTA 3E8CA 1FBNA 3MYGA 4RC3A 4XNEA 4J96A 2VWVA 3LZBA 1OBDA 3MI9A 4EBWA 3NAXA 3HVCA 3MB6A 5F95A 3OG7A 2R64A 1KWPA 5AV3A 4HVIA 5AIRA 3K2LA 5H3QA 3QKMA 4KSQA 1BLXA 4YURA 2YM7A 3AQVA 5LCKA 3DAJA 3M2WA 2WMXA 3QQUA 3V04A 4ALUA 3HV3A 3QQHA 1PMUA 4IQ6A 5EDQA 3VRYA 3PP1A 3VWAA 5CU0A 4GIHA 3SC1A 1UVRA 2HY0A 2R3RA 3CD8A 1Q24A 5AP2A 4FV5A 2WFYA 4HYIA 1J7LA 2BVAA 5EQYA 4EOLA 4G3EA 4EQCA 4HNIA 5HD7A 3COIA 3BX5A 4B8MA 4BDHA 1UU3A 2XNNA 4R7IA 3HAMA 3NNWA 5DE2A 3UPZA 1JKKA 2RGPA 4FR4A 1TFFA 4NM5A 4XG9A 4A4LA 3CKXA 4II5A 5B7VA 3C4FA 4R1YA 2Z7LA 4K8AA 4DCAA 3NMUF 1PKGA 4IAZA 2XJ2A 4FT3A 1KUTA 5F20A 2JKKA 5C4KA 4BCJA 3ZBFA 4YO4A 2ESMA 3RCJA 3F2AA 4HYSA 4Y83A 1YI4A 1BI7A 1CMKE 1W84A 3C5UA 3NCGA 4IX5A 3RPVA 3VVHA 1TKIA 4F0GA 3G6GA 4YSJA 4LUDA 2YAAA 1QPCA 2G9XA 1L3RE 2G1TA 4NCTA 4XJ0A 4E6CA 4IX3A 2XF0A 4EH6A 5FBNC 4C2VA 3QALE 4EHEA 2H9VA 2PVHA 2W4OA 4HCTA 4U0IA 3E3BX 4O81A 4DT9A 5BVOA 2F7EE 1KE8A 2OF2A 2YM6A 3MH2A 1ZOHA 2JIVA 4FZ6A 4OBPA 4RG0A 5IUIA 2IZSA 1U5QA 2WTIA 1E1VA 3LFFA 3PY0A 4IJPA 1A9UA 4KBAA 3DKOA 4M14A 4CLJA 1BUHA 1YHVA 3HUBA 5FWKK 4YLKA 3POZA 3VUHA 3AKJA 4BZNA 3ZXZA 2J0JA 4U42A 5CYIA 4S33A 3WE4A 3DFAA 1XKKA 2CDZA 3FY2A 1TZDA 4IHPA 4X2GA 4FRFA 4B0GA 4DFXE 4F4PA 2X4FA 3LLAA 4NM3A 4E93A 1QPEA 2ZAZA 3PE2A 5HTBA 1XH7A 4D55A 2HIWA 3R01A 4R77A 2IZRA 1KE5A 4IZ7A 4IZAA 2OI4X 3QX4A 4ENXA 1V0OA 4DH8A 5CEMA 5AR8A 5CI6A 2J5EA 5BMMA 3KB7A 2XARA 5M07A 2HW6A 4I24A 4F08A 2R3OA 4P4CA 5CEKA 2UUEA 1H1PA 2JBOA 3OUKA 3QAME 4A9TA 1OL7A 1AGWA 1WVXA 1JSTA 1PXMA 4IWPA 2I0VA 3GCPA 4ANNA 4U80A 3ZCLA 3ORZA 3S4QA 4EH5A 5IDNA 5L2WA 4QNAA 5AX9A 4PMSA 2OSCA 4AGCA 4W4YA 2OFVA 3OOGA 5DR9A 4C4IA 5A9UA 5IMEA 3OHTA 4AP7A 1Q99A 4AW0A 4BGQA 4GKHA 1PF8A 4AN3A 5TF9A 4FZ7A 4E4NA 3FEGA 3G90X 2JBPA 3OZ6A 3Q2MA 4ZY4A 1OGUA 3G9NA 1HCKA 1VR2A 4U43A 3DKGA 3ZZEA 5I5ZA 4AA0A 4NU1A 3RAKA 2X8EA 4C3FA 4IVBA 3A62A 3OF0A 2ONLC 3A7HA 5CAUA 3FLWA 3UDTA 3ITZA 3KL8A 4GJ3A 5I9VA 4BKYA 4QTDA 3KRJA 1YOMA 2UW9A 3FXXA 4X2NA 1YXTA 3WILA 3IW6A 3RM7A 5D10A 3UTOA 4CD0A 5L2SA 4QPAA 5AX3A 1RE8A 3BQCA 3G15A 3IO7A 2XK9A 5IA4A 2B9IA 2UZNA 1OI9A 3BYSA 3TNHA 4IAIA 5DR2A 1NXKA 2GHMA 5FM2A 3O50A 3QRTA 2CKQA 3VW8A 3KXXA 3IQ7A 3OEFX 3BWFA 2OIQA 2RIOA 3R04A 2XBJA 3RINA 3KVWA 3FXWA 4K6ZA 1J7IA 4CT1A 3W32A 2VTTA 4O7RA 3IG7A 3U9NA 3DB8A 1KE9A 4XP0A 4CQEA 2PYWA 3C0GA 4GK2A 4EI4A 1PXKA 4P5ZA 1ATPE 3F5PA 4AOIA 5HNIX 4O7VA 4C02A 2P3GX 2WTKC 4D2RA 4R3RA 4EJNA 2VNWA 4GS6A 2YHVA 3PY1A 1WVYA 4QYGA 5K9IA 3E8EA 5AUXA 1W83A 2H6DA 3PRIA 4XG7A 5B0XA 3TL8A 4YZ9A 3ZLYA 3O51A 3A61A 2Y4IB 3UNZA 2BROA 3CSVA 4PWNA 2XMYA 5HQ0A 5IA1A 1B38A 2IW6A 3R22A 3COKA 4FOCA 2JGZA 4ZS4A 4BTJA 1KV1A 3C0HA 3D9VA 3S3IA 4DHZA 2XA4A 4DFLA 1KOBA 4QPMA 2CPKE 4W9XA 3VHKA 4BN1A 3IW8A 1V1KA 1R39A 2B7AA 3CTJA 1PMNA 2O8YA 3G33A 3ORPA 3R7EA 4BWKA 4F63A 3MGYA 4EQUA 5AEPA 5DI1A 3EFLA 4XV1A 3F5XA 3CKWA 3VAPA 1S9IA 3AXWA 2BFYA 4MD8E 2WIPA 4H36A 1R0PA 4V05A 5E8XA 2WIHA 3NUPA 2JKQA 3RBWA 3Q52A 5IUGA 1OGYA 1T46A 3AMYA 4FV1A 4MF1A 4WG4A 4TL0A 3FHRA 5HVYA 4Y95A 4BCPA 5T3QA 2ZV7A 4HJOA 4OLIA 4M8TA 4IWOA 1OBGA 3GU5A 3I6WA 1VZOA 3T9IA 4FKGA 4EKKA 4N57A 3H30A 3A7JA 3FKLA 3CY3A 2VTOA 3PVUA 4S30A 4UYAA 1OKZA 2VGPA 4M12A 2W5BA 3GOKA 1ZYJA 4D58A 4ZZNA 3BLHA 5HG5A 2WU7A 3MDYA 3BRBA 4I0SA 3ZSGA 1UV5A 5C27A 3E62A 4DFUA 4CV8A 3GCSA 3JUHA 4ZSAA 4PDPA 1IRKA 2UZWE 3DK6A 3V5QA 4NM0A 2BZHB 3HRCA 4TT7A 4YZDA 2IN6A 3N4TA 3F3WA 3EQGA 2QO7A 2Z02A 1YXXA 4YBKA 2VTAA 4I6QA 4F1TA 2CCHA 4NTTA 4UALA 2IO6A 5DT4A 2F2CB 3V5LA 2UW8A 2GNIA 4JS8A 3TV7A 3DDPA 4Q9SA 2X6DA 5KHXA 3C9WA 3JXWA 4HGTA 4FK6A 4NW6A 5LVOA 3QC9A 3WF5A 4CXAA 3OVVA 4BCMA 2GHLA 2UV2A 4U7ZA 2CLQA 4IX4A 3DJ5A 5AFVA 2XIXA 1FMOE 2Y0AA 3W33A 5D7AA 4CG9A 3MJ2A 3HYHA 4WT6A 3UQGA 3EFWA 4ZSJA 5TKDA 3DY7A 2JDTA 4Z55A 3KXNA 2B9FA 3TZMA 3ZTXA 5BUEA 4N4SA 3BBTB 4EK8A 3LW0A 4IVCA 4IX6A 5J9YA 4QP3A 3PXFA 4L53A 1YWVA 1XH5A 3NPCA 2WQEA 4X3FB 3OW4A 4I22A 3E8DA 3KF4A 1PYEA 3BU5A 3VBYA 3KRWA 5FM3A 5F9EA 3LMIA 5HIBA 3UDSA 3ZH8A 4I21A 4RMZA 2Z7QA 4UX9A 2PZPA 1U5RA 4CT2A 3RK9A 1GNGA 2VZ6A 4FV4A 5IG1A 3EKNA 4BDDA 2J9MA 2OH4A 4JDIA 3LFDA 2OJJA 4O2ZA 4O4CA 4AXFA 4FSQA 4BDFA 2QHMA 2BCJA 5ANOA 4OTDA 1Q8WA 2NRYA 2I0YA 3QQFA 2ZV2A 4NUSA 3U51A 1DS5A 3EZRA 3EL8A 5IQHA 1W2FA 5AR4A 3QA0A 1J3HA 1NY3A 3SG9A 3QZFA 4KSPA 4EHGA 3PDTA 4O0XA 4O0VA 3F7ZA 4G6NA 5D7VA 3E64A 4BDAA 4CZTA 4MF0A 4YJPA 3T8OA 2FH9A 4A07A 4E26A 4ONAA 3BZ3A 4C35A 3DZOA 4U41A 3ZS5A 4D5KA 4YJVA 3W8LA 1OZ1A 2ZB1A 3ORTA 3P7BA 5GZAA 4NWMA 4ANBA 4RPVA 3PIYA 4O0WA 3UOHA 1PXOA 5HO7A 2ITOA 3LJ1A 3GC8A 3MTFA 3ZUUA 4G2FA 5HD4A 5HBHA 5HVKA 5TO8A 1OMWA 2FSLX 3N4UA 4CG8A 1LUFA 3DA6A 4J71A 3LOKA 2C5YA 2VTRA 3FI2A 4GCJA 4LRKA 4B6LA 3FZTA 3ROYA 4AT3A 4TWCA 5AP3A 4BY9E 2ZMCA 2YCRA 3QF9A 5L8LA 3MFUA 5BX0A 3PWDA 4FG8A 5KKRC 3G9LX 2RG5A 4U45A 4UY9A 4ID7A 4JG7A 4NT4A 1MQBA 3CTQA 2YAKA 3FWQA 5HGIA 1H26A 4QMYA 4UB7A 3O17A 5FDXA 1RJBA 5EDPA 3A2CA 4FSNA 3Q4UA 3S0OA 5M06A 3R8PA 5C8KA 3K3JA 3DNDA 3OP5A 3Q3BA 3Q6WA 2XIKA 3UMXA 4D1XA 3ZC5A 3QCSA 3K5UA 2ETKA 5FTOA 2Y6MA 4XP2A 2VAGA 4GG5A 1TVOA 3QYWA 4K18A 3UNJA 3W10A 4E4LA 1DM2A 1WZYA 5KBRA 4GMYA 4KWPA 5EG3A 4BB4A 1H24A 2X9EA 3P7CA 2WMAA 4WSQA 4IH8A 3LM5A 1J1CA 2NRUA 2XK8A 4EONA 5KO1A 1WBTA 5FXSA 3PIXA 3VHEA 1P5EA 1Z5MA 4GUBA 2XAMA 3VF8A 1PXPA 4QP6A 4G3CA 2V5QA 4AOTA 2YWVA 4DH1A 1UKHA 3U9CA 4J8NA 3T3UA 5CAPA 3R7GA 2YZLA 3Q5ZA 3OY3A 1TQIA 3SXFA 2YM5A 4AS0A 3FSFA 5DHJA 4ZY5A 3A60A 2HYYA 4HVGA 2R5TA 2H34A 2PVNA 3FZRA 2J51A 4XG6A 5FBOA 5FGKA 5LVLA 2OO8X 4ZTHA 5BYLA 3PLAE 2YN8A 4AFEA 2VTIA 3W2CA 2VRXA 2C6IA 3OEZA 5BPYA 5I3OA 2WQNA 3OC1A 3ORLA 4GW8A 3RGFA 2R3IA 5CTPA 4E5WA 4LOQA 2IZTA 3AD4A 5BVWA 4ZTMA 2OBJA 5GINE 2F7ZE 2A27A 3PFYA 3OFMA 4XYFA 3TEIA 5GZ8A 3K5VA 3G51A 3EN7A 3O7LD 4U79A 5HBEA 4QMNA 3L8SA 4NW5A 4PDSA 3O71A 4PPBA 3TNIA 4ZS0A 4RX8A 4JNWA 3II5A 5CVFA 5E8ZA 3E8NA 3ZXTA 3ORXA 3UZTA 4YZNA 5EOLA 4MUQA 2C5NA 2HW7A 3RWPA 2ZM3A 4QMPA 2W1FA 4JX3A 1G3NA 3W55A 2NNWB 4ACMA 4ASDA 4Y8DA 4MCVA 3A4PA 3NUSA 4RWIA 5AWMA 3HL7A 1SNXA 2FB8A 2OWBA 4XS2A 4DEDA 3VS6A 4TW9A 2PPQA 4H1JA 1SVEA 5HEZA 3QTQA 5I9YA 3FLZA 4E1ZA 3NNUA 1JKLA 2BFXA 3HA6A 4DHFA 2BDJA 1BL7A 3ALOA 3CXWA 3RNYA 2FUMA 3GBZA 3KXZA 3L9NA 4L68A 3QQGA 2F9GA 3TWJA 3P0MA 3B2TA 4OTQA 4YHJA 2WELA 3RZBA 3TKIA 4BF2A 5IQGA 2WOUA 1VYZA 4W8EA 2J5FA 5HLWA 4R8QA 2X2KA 5L6PA 2Z7SA 4TYHB 2J0IA 3EQPA 4I4FA 2PMOX 3FI3A 2R3MA 4D5HA 4BR3A 2C3JA 1M52A 3EZVA 4QMXA 2VO0A 5BVEA 4Z3VA 3LIJA 4WRSA 1IAHA 4DYMA 1Q3WA 3LXKA 3RK7A 3HMNA 4TYHA 4H3BA 3KK8A 4C4EA 1XH6A 2QU5A 4DC2A 4RSSA 4FVPA 5IEYA 2VTLA 1P2AA 2BDWA 5EDRA 3VS4A 4ASEA 4JMQA 4UMPA 3UC4A 4TN6A 3Q53A 3CPBA 4N0SA 3EN9A 2CNQA 3HMPA 3KU2A 1NA7A 4OTWA 4QMLA 3KXMA 4LRJA 2G2HA 3D0EA 2W1EA 4XBRA 5FD2A 3RALA 3L8VA 4I93A 4LGGA 4HZRA 4ACHA 4B7TA 5BVNA 2C1BA 1PMEA 3PWYA 4GT5A 4OTRA 4RA4A 4EYMA 4FX3A 2UW4A 1Q97A 5JZJA 3Q32A 2XK7A 3DXNA 4CKRA 4FEWA 2YDJA 4BI0A 4GFOA 2HWOA 2XK4A 2GSFA 1OKWA 3F6XA 4MWIA 1VYWA 5EHOA 4EHVA 3WYYA 3GNIB 2DQ7X 4IWDA 5EI2A 3V6SA 4LGHA 2DWBA 3R30A 2QOHA 4UEUA 5EHYA 5AADA 2O63A 4LDTA 4UYNA 3SG8A 4GT4A