4F9BA

Human cdc7 kinase in complex with dbf4 and pha767491
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
356
structure length
318
Chain Sequence
GVKKDIEKLYEAVPQLSNVFKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDDLTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGWNEVPDEAYDLLDKLLDLNPASRITAEEALLHPFFKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division cycle 7-related protein kinase
publication title Crystal structure of human CDC7 kinase in complex with its activator DBF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 100
structure length 318
sequence length 356
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f9bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f9bA01
4RVLA 4DC2A 2P33A 2OH0E 5FTOA 5AEPA 4P2KA 5L4QA 4XEYA 3V8TA 5ANOA 3U4UA 4PMMA 3E8CA 4L52A 5CAPA 4OLIA 5KMLA 3Q4TA 2GU8A 2ZYBA 5AAFA 1PXKA 2HYYA 3RHXA 5TOZA 3ZEPA 5L2WA 5BUIA 4QP8A 4KA3A 2ZDTA 4GSBA 5HESA 2JAVA 5M07A 2XIXA 3TNWA 1ZWSA 5AJQA 5E7RA 4USDA 3CGFA 2OJGA 2BAQA 3CTQA 4HYHA 3FI3A 3FZRA 2VTMA 3MJ1A 5FTGA 1H1QA 3QKMA 4FGBA 3VS0A 2WU6A 1Z9XA 2YIQA 4XG8A 5B2LA 1QL6A 3RALA 3FI2A 4RLLA 4NM5A 1REKA 2UZWE 3TACA 4RVKA 4C02A 4O81A 4OW8A 4O6LA 3OC1A 3BYUA 4C2WA 3ETAA 3N9XA 3OD6X 3C51A 3VS4A 1WBSA 1M2RA 3LFNA 4IDVA 2VTNA 1PRYA 4GW8A 3KVXA 2PHKA 1MRVA 5CEQA 2OWBA 3CLYA 4P90A 3BHHA 3VS2A 1Q41A 3R04A 3CE3A 4M13A 3E63A 3DTCA 3JS2A 4P4CA 4XG3A 4AFJA 1O6KA 4U0IA 3JYAA 5DI1A 3PTGA 4H1MA 4FIGA 3HEGA 4Y46A 5HEZA 2HXLA 3UIXA 3O51A 2YJSA 5HE2A 1M7NA 4U43A 4O82A 4N6YA 3F7WA 3QRTA 1G8AA 3R8PA 3KCKA 3NYVA 3C1XA 2KULA 4LL0A 2WEVA 4I6QA 5BYZA 4YJNA 3F9NA 3HDNA 4O91A 4FTKA 5M56A 2Z7RA 4RJ5A 2Y4IC 4QQTA 1YKRA 3UYTA 3ZSGA 4XLIA 2VO0A 4MKCA 2IW6A 2V62A 4MXCA 4WD5A 5DT0A 4ZY4A 2JKKA 4BDGA 2BCJA 2J0KA 4QYHA 3MFUA 4IWOA 1QMZA 5F20A 1PXOA 3I5NA 3QTZA 3TCPA 5LVMA 5EHLA 3AT3A 3CQUA 2XRUA 1H1WA 3Q5ZA 4FTNA 4DEHA 5EDRA 3EH9A 4JL9A 4BYIA 4EEVA 4PL3A 3R7IA 4R3RA 3IK3A 1R39A 5M53A 4K8AA 2PUIA 4U44A 3U9NA 2FGIA 4AGWA 2WD1A 3R8VA 3NUYA 3VW6A 4UYNA 2ZB1A 4NTTA 2OJFE 4MNEA 3V3VA 4ASEA 4C61A 4GS6A 5ANDA 3OZ6A 3LMHA 4TXCA 4C3FA 4DT9A 3PWYA 3UVPA 2VN9A 2XM8A 4A7CA 2XZSA 4F63A 2BMCA 4M67A 5E92A 3TNQB 2C3KA 1MQBA 2VGPA 3ZTXA 3D15A 3V5PA 2HZ4A 3I79A 3U6IA 5IMXA 1H07A 4KB8A 4U42A 3ANRA 2YCRA 3HZTA 5CSXA 4CCBA 4D2SA 4EOQA 1A9UA 3PE1A 2Z7SA 4R1YA 5HIBA 2NO3A 1W0XC 3IO7A 3L8PA 4FKWA 1FMOE 5DEYA 5FM3A 3VUDA 3R9RA 4YNEA 4FIHA 4D58A 5A6NA 5BMMA 5CTPA 4WRGA 3O17A 2QNJA 2C6DA 3QUEA 3RPRA 5EYDA 3PJ1A 4WG4A 3ATTA 2R0IA 3VULA 1JSUA 2UVXA 2GHLA 3AMYA 4F0FA 3F5GA 3OT8A 4AW2A 5K5XA 4WRSA 3SOAA 2F9GA 4ANBA 4QMQA 1GZNA 3QRIA 3EB0A 3IS5A 4I4EA 3DLZA 4G2FA 2WEIA 1Y6BA 4ZSAA 2BIYA 2RF9A 1Y6AA 4YZBA 4HYUA 3CS9A 2JBOA 1TVOA 3SG8A 2GNJA 4K9YA 3KCFA 2XK9A 1ATPE 2UZVA 3FLYA 1Q97A 4BN1A 1OIUA 4O0RA 2GTNA 3OBGA 2IW9A 4E4NA 1GY3A 1SVHA 3EHAA 4OBPA 4JAJA 4AW1A 2CGWA 4E5AX 4OBQA 3KA0A 5LARA 1XBBA 2J0IA 4G6NA 3PRFA 2JEDA 5ETAA 2GS2A 4BHZA 4DG3E 4BKJA 3QQUA 4TPTA 3C0GA 5HD4A 3ZDIA 5EM7A 5CEPA 2GNIA 2W9FB 2VX3A 3A2CA 3UNZA 4J97A 2HIWA 4MAOA 5CU4A 3QUDA 4RWJA 1BI8A 3EN4A 2VTSA 3OEZA 4JRVA 4BBFA 4FSTA 3H9OA 3O2MA 2IZRA 4FKGA 2NPQA 5L6WL 4EBVA 3PSCA 5HE1A 2JIVA 3OOGA 2BAJA 5BYYA 4WBBB 4RIYA 1ZMWA 5AM7A 4BKZA 3WE4A 4ACHA 2VAGA 3QA0A 4FNYA 4FT0A 5CAOA 2YWPA 3S1HA 2XB7A 4IAKA 5BVOA 4IQ6A 2WMRA 4XJ0A 4IMYA 4CFWA 1H0WA 3PXFA 3GXLA 4FKIA 3KKVA 2B4SB 2QU5A 4JQ8A 5H8GA 3EYGA 2C6MA 5JEBA 3B2TA 2OG8A 4MQ1A 3GC0A 3ZFYA 5F94A 2BFYA 3QCXA 4KKEA 1OKWA 5AR3A 4MD7E 2HZIA 4E1ZA 2C30A 1J1BA 2C69A 1K9AA 1YWNA 2R3QA 3D2KA 4FTAA 4P7EA 5BVEA 1XBCA 4MD8E 3PJ2A 3PFQA 4ZJIA 5GZ9A 1PYEA 5JT2A 4I5HA 3OXZA 4JDKA 4XX9A 4BDDA 2C5OA 4RFYA 5E1SA 2IW8A 5JH6A 5AUVA 4IFGA 3W1FA 3VBVA 1I44A 4J7BA 5ANJA 3W2OA 4PY1A 5B2MA 5IG1A 2YM8A 4LQMA 3L8VA 4DGLC 4BBMA 4FZAB 4TYIA 2PWLA 2XK3A 3P1AA 3PVUA 1WVXA 2B9HA 1V0OA 4MXYA 5DIAA 3QCSA 3U9CA 4AZWA 4PP9A 3QD4A 4L7FA 2JDSA 3CQWA 3GP0A 2YDKA 2H8HA 3FC2A 3ZXZA 2EXMA 1DM2A 1PMVA 2CSNA 2C5XA 3F88A 3RP9A 3OY1A 2QOIA 3PRIA 2XA4A 5EK7A 3ALOA 5HU9A 1JSVA 1PMUA 2CMWA 2LAVA 3ZFMA 2ONLA 3FUPA 1GOLA 4OT6A 4KINA 4RC2A 1Y8YA 3D5WA 1WBWA 5M09A 5BMSA 2OZAB 2X81A 3VUHA 3FMDA 4FV1A 4F9BA 3DGKA 4R3CA 4PP7A 3LAUA 3EYHA 3DJ7A 3UNKA 3RZBA 1R78A 5DRDA 3QRUA 1RJBA 2VX1A 4GFGA 3ZLSA 3EMGA 5LXMA 4DHFA 1STCE 4MH7A 3U8WA 3FLZA 4BKYA 1U5RA 4PMSA 4GKIA 2CGUA 4ANNA 3AC4A 4IX3A 2C0TA 4HOKA 4O7TA 1LPUA 2PZ5A 4A4LA 1KWPA 4JG7A 5BUJA 2W4JA 4FIEA 3A4OX 2OH4A 4RX5A 3OWLA 4LGGA 2RG6A 3R2BA 3D9VA 3E7VA 1Z57A 3SRVB 5IZFA 4YZ9A 2VWUA 3IGGA 3TT0A 2IWIA 1NT2A 3DK3A 3MN3A 3G90X 4M15A 3BYSA 3SW7A 3C7QA 5FUTA 4F6SA 3LZBA 4AXAA 5IQBA 3P7AA 1V0PA 3PZHA 1Q62A 3VRYA 3C4CA 4F0GA 5HU3A 4N57A 3KRRA 4K6ZA 3I0OA 3S4QA 1BUHA 4ZZNA 3KK9A 4FE2A 2JD5A 3ATSA 2XVDA 5JZJA 1OPKA 5IA0A 4ZMFA 5CASA 4LOQA 4MD9E 5AP0A 3AT2A 2QOBA 2R4BA 5DN3A 4E4LA 3G5DA 2X39A 4YHTA 4YZDA 3WE8A 3OXTA 5HBJA 3LIJA 5CSPA 4BF2A 5KZIA 3HMPA 1Q8TA 4MEDA 3MH0A 4RX9A 4C37A 4XYFA 3HGKA 3R9DA 3D7TA 3FQEA 5CZHA 2XF0A 3GCQA 3GC7A 2BDFA 4AZFA 4O7SA 2BKZA 4YGAA 3C4WA 5KO1A 3BGPA 3H9FA 4O0SA 1SYKA 4CNHA 4TYEA 2C3JA 1U46A 5C8NA 2QU6A 4H3QA 4CFUA 3MH3A 2YIRA 2EVAA 3E3BX 4NT4A 2IJMA 4YJPA 3ZXTA 3FXZA 5D7AA 3QTIA 3ZEWA 3DBQA 4D5KA 3RBWA 4MNFA 1U59A 2HY0A 3EL8A 2JKQA 3I5ZA 3LCKA 3QTXA 2O63A 4LUDA 4XP2A 5CT7A 1PHKA 2W5AA 4KIOA 3KL8A 5DHJA 3KB7A 3QTWA 3TTIA 4EOOA 4FSUA 4QYGA 3R2YA 2JDOA 3DZQA 4W4VA 4Z7HA 3QLGA 3COHA 4Q5EA 3EZRA 3VBYA 2I7QA 2WKMA 2CNUA 2WQMA 3FY2A 2QOOA 3BRBA 4XBRA 2FB8A 2CHLA 3SXRA 2RL5A 4ZTMA 1QPCA 4RRVA 3HMMA 3P9JA 5FEEA 4BC6A 3H4JA 2JITA 2PULA 3C5IA 3KULB 3RI1A 2UW9A 3FE3A 3ZLYA 2B7AA 4H05A 2IG7A 2PUUA 4I22A 3EL7A 5JFVA 3UIBA 4AG8A 4FEWA 1UNHA 3VUIA 4QMYA 1PJKA 1ZARA 3BV2A 4PMTA 3GFWA 3Q60A 3BU3A 4MXZA 4FC0A 3ZRMA 1H00A 3LFAA 5I9VA 3CCNA 4QQJA 3DKFA 3A7FA 4LRMA 4QD6A 1B6CB 5IA3A 3OTUA 4DAWA 5IH4A 1H24A 3G6GA 2PVKA 3LFFA 4FKRA 3FSKA 1FOTA 5EW9A 4FTOA 2DWBA 2PK9A 2F7XE 2I0YA 3GQIA 4FSZA 1UNLA 5EH0A 4EH6A 5T3QA 2BZJA 3CXWA 4OTFA 4X2GA 3T8OA 3VHEA 4EH4A 1JKKA 5FDPA 1PYXA 5CF4A 3FMMA 4TWOA 5E1EA 4AOIA 5L2SA 4L3JA 4YHJA 3QTQA 3ZUTA 3KF4A 3E7OA 2X6EA 5DVRA 5H2UA 3UOKA 3FMHA 4C33A 3R02A 3R22A 3FC1X 5GJGA 1ZY5A 3V8SA 2R3PA 4U79A 4LG4A 3IG7A 2XNOA 4XCUA 4AZSA 4WG5A 4B4LA 3AMBA 3FPQA 1JQHA 3OWJA 4BI1A 3WF9A 3NGAA 3FZSA 4KIKA 5AUWA 4BCIA 1SNXA 3QD3A 5AV4A 5EM5A 3DB8A 5H8EA 4EOIA 3FJQE 2BIKB 3KMUA 5GHVA 3EQPA 4U6RA 2W1FA 4L00A 2XIRA 5A4CA 4NKSA 4QMTA 3A99A 5HKMA 4IFCA 4KABA 3T9TA 4EC9A 4ZAUA 2RIOA 3FV8A 4GKHA 4EOKA 3PA4A 5DLSA 5GNKA 4YSMA 5EI8A 5FRIA 4X2NA 1H26A 1CMKE 2UZUE 2ZM3A 4FK3A 1P4FA 2NRUA 4ITIA 5EOBA 3WIGA 3WYXA 1KOBA 3H9RA 2JFLA 4S33A 4RZVA 1JSTA 4Y72A 4YO6A 2CGXA 3CQEA 2GQRA 4PTEA 4DG2E 5HVYA 1KE9A 4Y73A 4C7TA 3KGAA 4EQCA 1X8BA 1Q8UA 5CALA 3W2PA 1J91A 2YIXA 5CLPA 4ZIMA 1H28A 3ZUVA 4MXOA 2WMBA 1W84A 4WNPA 3EFKA 4UN0C 1YXTA 5A9UA 4BL1A 3DPKA 5CYIA 4C4HA 4L68A 3TKIA 3PG3A 4RIWB 5A14A 4YTIA 4QPSA 4RFZA 4XOZA 1GZ8A 3PY0A 3ORNA 3Q6WA 2BILB 4D4RA 4KRCA 4I6FA 1YXXA 3C4XA 1MP8A 1J7IA 2J5EA 4E4XA 2VNWA 3NRMA 4FKLA 4F0IA 5IH5A 1TQMA 2IPXA 3OUKA 4OTDA 1ZYDA 3O71A 2YLFA 3FHRA 4FYOA 3L9PA 4BR3A 2ESMA 3F3ZA 4S30A 2VWXA 4XBUA 4O0XA 3FLSA 2Y8OA 2CKEA 1BKXA 4E6AA 5GZAA 5K5NA 2CN5A 2WOTA 4GRBA 4LGDA 4MWHA 3NUNA 2R3KA 4Y85A 1OECA 5D12A 4FSQA 1T45A 4AW5A 5KMOA 3U6JA 4AE6A 3VS5A 4DEBA 3T3VA 3O50A 2CCIA 3EN9A 3LM0A 4GCJA 3WF8A 4ZMEA 4QYEA 4RJ4A 3DOGA 3IW8A 4O86A 2ZMDA 2UV2A 3D5UA 4RJ3A 4KWPA 4KNBA 4FT9A 5J9LA 3I81A 4Y5HA 2A19B 3QRJA 5AP3A 4KSQA 4UYAA 3R00A 4OGRA 2V7AA 2B9IA 2EUFB 2W1EA 3CR0A 4IZYA 4UMTA 3ZC5A 4C34A 1LEZA 1ZRZA 2OZOA 4M0YA 3CSVA 3GCPA 3BHYA 4WT6A 5HO8A 3R8MA 4FSYA 2QO9A 2OSCA 3IW7A 4TWNA 4EK5A 3BEGA 2PZYA 3HL7A 3PSDA 4BZDA 3IDPA 5IA5A 3B8QA 2BZHB 1E1XA 4FV0A 4LFIA 4NH1A 4UB7A 4XHKB 3PY1A 4G17A 5J7BA 4E3CA 5BVDA 3D7ZA 2XK8A 2Z2WA 4C59A 2OIDA 4ENYA 2JBPA 2HCKA 4B8MA 4W8DA 4UXQA 3T3UA 4IW0A 4HVIA 3LFCA 4CT2A 5LWNA 3V01A 5IQIA 5IKWA 3GQLA 4FKUA 5CENA 2ITUA 4BTFA 3PG1A 4ZSEA 4CT1A 3EQGA 3SVVA 4BDJA 4RWKA 3ZSIA 3M1SA 1OL7A 1PW2A 3NUUA 1TKIA 4JDHA 4MXXA 5KNJA 3A61A 4IJPA 1WVWA 5FD2A 1PXNA 4M97A 1BMKA 2OJ9A 4ZSJA 1Y57A 3KN6A 5CSWA 3TIZA 5FQDC 3LLTA 2WPAA 2XNEA 4OAUC 3HV6A 4E26A 4ORKA 4CZYB 4UWBA 5L8LA 3MB7A 2YFXA 3QQLA 4AT5A 1OKVA 2QKRA 2ITOA 4CFMA 4D55A 4BY9E 5JFXA 5CF5A 5HCYA 4AU8A 3G0FA 3NW7A 4W9WA 3PJCA 4PUZA 1JWHA 4F99A 4PTCA 3C13A 2R3JA 3KFAA 5J5SA 1GZOA 4W9XA 3AT4A 3PPZA 3R6XA 3MPTA 2FSMX 3L9LA 3KY2A 3ZZWA 3BLHA 3PPJA 4I6HA 1OB3A 2ITQA 4WA9A 4I0RA 4DN5A 4MQ2A 1DAYA 1FGIA 2WU7A 3LFQA 4X7QA 4O7NA 2ZMCA 3D83A 3R7VA 4FG7A 4CMOA 3EN5A 3GCSA 4I5PA 5FDXA 4X2JA 2KTYA 3ORZA 3WF7A 4YJOA 4GL9A 3ZO4A 5LVLA 1W82A 3D2IA 4IVDA 3NWWA 1P2AA 4Y8DA 1W83A 2FUMA 4QTAA 3MH1A 3WBLA 5EKNA 3VS7A 2HOGA 3VN9A 3TJDA 5I9WA 2PVHA 4L9IA 3ZUUA 1PF8A 4AGUA 2O64A 1NVQA 2JDTA 4YC3A 4AX8A 4DA5A 2XUUA 3BV3A 4FSMA 4BCMA 2OFVA 3DTWA 3KXHA 1AD5A 2WZJA 3LFDA 4FTTA 4PX6A 2OF4A 3LXPA 3T9IA 4EZ5A 4GEOA 3MFTA 4ALVA 5JMSA 3PUPA 4QP4A 2CNVA 4G3DA 4H3PA 5IDPA 3OBJA 3C4FA 1BI7A 3DLSA 2WFYA 2VNYA 5AA8A 5EHOA 4PV0A 5HTIA 2YDIA 4JBQA 4XS2A 4X0MA 1WBNA 4O1OA 3QTRA 3UG1A 5LWMA 5EDPA 3QKKA 4Z9LA 4UX9A 3PXQA 1Y8GA 3DAKA 4E6CA 2O65A 4JQEA 2EXCX 2X8IA 2XK4A 3LFBA 4KS7A 5LMKA 3GENA 4DFYA 3ZO2A 2A0CX 3SG9A 1E9HA 4MCVA 3THBA 3COIA 2W4OA 4NYEA 1BLXA 2VO7A 4R6VA 2JIUA 3LHJA 4O7ZA 2JKMA 2R3MA 4ONAA 4QRCA 3DDPA 2BHEA 4N6ZA 1U54A 2X6DA 2GNGA 3QX4A 3KREA 5EYCA 4YC6A 4GT5A 1PMNA 4QMXA 5DA3A 2UUEA 4L67A 3M2WA 4IZ7A 4QP6A 4X21A 3D0EA 5HLPA 4E5BA 3LKMA 4QMSA 2FSOX 3DDQA 3K3IA 1SZMA 2G2IA 4ASDA 4IM3A 4DTAA 2GS6A 2IZTA 3NYXA 4I0SA 4QNYA 3MA3A 4HGTA 4YJQA 2UW8A 5EM8A 2XKFA 3QZFA 4BDFA 2V55A 3HNGA 5HBEA 5C01A 4YO4A 2J7TA 3L9NA 1ZOEA 5LVNA 3HECA 5AR4A 4JG6A 4EOPA 2B0QA 3BKBA 2GTMA 3QGYA 3KRLA 5HLWA 1UV5A 3QQHA 4QP1A 4FUYA 4WO5A 2F7ZE 4XRJA 2QOHA 3C4EA 3UE4A 5LMKC 5HO7A 1XWSA 2DUVA 3PA5A 4MYGA 4O7RA 2WGJA 3DXNA 2YA9A 3OP5A 1WMKA 3PIXA 3R0TA 4LMNA 5BVWA 3R73A 3R7YA 4UBAA 4A9YA 5JGBA 1W98A 2VV9A 2CKQA 2WTIA 3AMAA 3QZHA 2FVDA 2WTVA 1FQ1B 1H08A 3R8LA 2YLEA 4DGMA 4HNIA 3UZRA 4GVJA 5EHYA 2XIKA 1PXLA 3DAJA 4TN6A 2XMYA 3RK7A 2J6MA 3AC2A 4QP3A 4BCFA 1QPDA 2YABA 4XV3A 3KXMA 2RFEA 3LXKA 4RWLA 5IUGA 3LQ3A 4JLCA 4QQ5A 3UGCA 2XKEA 4G3EA 2EB2A 4ZP5A 5CEOA 1ND4A 4FGRA 2UZBA 4IANA 4I93A 4FT5A 4MTAA 4CFXA 1SVEA 4ZTQA 3OW4A 4IAZA 5A6OA 5AV2A 2BALA 2HWOA 2A1AB 3VBTA 4C36A 3REPA 5C8MA 4UMUA 4YJUA 4APPA 2Y7JA 3EQRA 1OIRA 2F49A 1F3MC 2FYSA 1M52A 3A62A 1CSNA 1H4LA 1HOWA 1TQPA 2AUHA 1FVVA 2ACXA 1KE8A 3E87A 3C50A 3DKGA 3O7LB 3L1SA 4KBCA 1YOMA 3LCOA 4HYIA 4XMOA 5HVKA 4FSRA 3AD4A 3QC9A 4FKPA 4AE9A 4BWPA 1VZOA 2WNTA 1YVJA 3P23A 4L43A 2SRCA 4ZJJA 5IQHA 2VTAA 3DZOA 2W1GA 3C4ZA 4DT8A 4U3ZA 1LP4A 3QQKA 5DR2A 1P14A 5J9ZA 2HWPA 3SGCA 3COKA 3I60A 2OF2A 2W0JA 4IVAA 3V6SA 4I92A 2PUPA 4F9AA 1KUTA 4CD0A 3O8TA 4R1VA 4AGDA 4ZY6A 4MF1A 2XYUA 2Z02A 3F5XA 2B54A 3EOCA 2X8EA 3JPVA 2H9VA 2VU3A 2F2CB 4FX3A 4QP9A 4JX7A 3LMGA 5HGIA 2C6TA 3CPBA 4X2KA 5H9BA 4YJVA 2C1AA 3OCSA 1YI4A 5DR9A 3MVJA 5AUZA 5DYJA 3WIKA 5F4NA 3H0ZA 3D5VA 3HA8A 4R78A 5JK3A 2VTHA 2UW7A 4YTFA 4IC8A 5LCKA 4ALUA 2UW4A 2V22A 5HG7A 3KRWA 4X6RA 4ANSA 4EH3A 1L3RE 4RMZA 5M4IA 2PZRA 1WAKA 4O0WA 3QQJA 2ZDUA 1Q99A 5CQWA 4DINA 4F1OA 1NW1A 5IQEA 4AZVA 4RWIA 2P55A 4RJ7A 4O6EA 3ZCLA 2ETRA 4ZS0A 3O8UA 2R0UA 3NVMB 4QMLA 5F95A 4XRLA 2C47A 2QOLA 3VIDA 4NSTA 5HTCA 3NNUA 3OWKA 4Q5HA 3RM6A 3UP2A 4ERWA 4XOYA 2VX0A 4EQMA 5J5TA 4FF8A 2BKKA 2AYPA 3GU6A 2YZAA 3ZRKA 5CSVA 5E4HA 5J9YA 3QWKA 3GFEA 4X3JA 3A7IA 3DK7A 4K77A 2XNMA 3R71A 1Q8YA 4FV6A 3D7TB 4YZCA 3TV4A 3NYOA 3P5KA 5JQ8A 2IN6A 2VTOA 2XBJA 2UZNA 3ORMA 4NKAA 4QMOA 1BX6A 4ZTHA 4CYIA 4UEUA 5CI6A 2YZLA 3ID6C 4W4WA 1FPUA 2R3GA 3PE2A 5HHWA 4BZOA 1V1KA 1IA9A 3FHIA 1OUYA 2ZAZA 3UC4A 1NXKA 1PKGA 2WAJA 3IGOA 4IB3A 4XG4A 5HCXA 3BLQA 3HX4A 3FLQA 3VRZA 1A48A 3GC8A 1YHWA 2PY3A 4FI1A 2WTDA 5JGAA 2YJRA 2X8DA 2UZEA 5D41A 5I9UA 4O84A 1QPEA 5EYKA 4HVGA 4H1JA 3F3WA 5CI7A 4CTBA 1IR3A 1FVTA 1UU3A 3LFSA 3IDCA 4O38A 1PXPA 2RGPA 3KMWA 4F7LA 2X7OA 4DTKA 2RFNA 5IQGA 4M7IA 4NU1A 3W2QA 4EK4A 2R3RA 3VUGA 2YIYA 5HICA 4BTKA 4M12A 2CKOA 4B7TA 4B6LA 3AC1A 1KE6A 2PVYA 4DH3A 3VUKA 4AN9A 2X4ZA 3CKWA 4EJ7A 1YW2A 3ZS5A 3NR9A 3DCVA 4HCVA 3EIDA 4GV1A 1YI6A 2IO6A 1ZYCA 2QI8A 3RPVA 3NAYA 4GMYA 4EBWA 3SLSA 3WF6A 4TYJA 2W99B 5EM6A 3IW6A 4E7WA 5E8TA 3MA6A 4APCA 4HGSA 5DBXA 2OXYA 3VUTA 1MRYA 4FZ7A 3CP9A 4F1TA 5M55A 5FM2A 4YR8A 5JFSA 5EQPA 3RK9A 5EQEA 4YZNA 3N4UA 3FL5A 1SNUA 2QOCA 5D9HA 4D4SA 4F7NA 4OTPA 4TRLA 2C5VA 3PDTA 3HMOA 3CJGA 1JBPE 3F61A 2ERZE 5HIDA 5C8KA 3E3PA 4ZXTA 3TDWA 3GI3A 2I0VA 3DV3A 4ZSLA 2B52A 4UMQA 3QUPA 1XH5A 4KRDA 2UZDA 2XKDA 1OL2A 3Q9XA 5GZ8A 3CPCA 1O9UA 2OO8X 5M4CA 4O7LA 4R8QA 4BCKA 1XHAA 2QR7A 4Z16A 4DTBA 3IECA 3A7HA 2A2AA 2YM4A 2GNFA 3ANQA 5E9EA 5C4LA 3FBVA 2G9XA 2QOKA 1FBNA 3QU0A 1UU8A 2PVJA 3LXNA 4TTHB 3HV7A 4KBAA 5AWMA 3LCDA 5K3YA 2REIA 3R8ZA 3HV3A 1OZ1A 4TWPA 3TJCA 4C4IA 4EL9A 5I9ZA 3UOJA 2BUJA 1P5EA 3RPOA 3UG2A 1NVSA 4S2ZA 3D4QA 2CJMA 2EB3A 4FV9A 3DS6A 2BROA 4XG9A 5CVFA 5DE2A 3MY5A 3NNXA 3SX9A 3A8WA 5AIRA 3BLRA 3CY2A 4JIAA 2XK7A 4YU2A 4K0YA 3FWQA 1OUKA 1UKIA 1VR2A 4DCEA 3MGYA 3OY3A 3P08A 3DBEA 1OGUA 3Q2MA 4FTCA 2P3GX 2Z7QA 2YEXA 5K4IA 4RFMA 4CTCA 3D5XA 3Q4ZA 4FG9A 3RVGA 2ETKA 2FH9A 3A7JA 4LUEA 3HDMA 4JT3A 4D0WA 2R3FA 4Z3VA 5IH6A 3AGLA 5H3QA 3TNHA 2ONLC 3DK6A 5EW3A 2W9ZB 5L8KA 1RQQA 2YCSA 2J50A 2YM7A 3D94A 3FMJA 4HPTE 4IDTA 4JR7A 3WARA 4CKJA 4CLJA 2BAKA 3FLNC 5G6VA 3G51A 4FL1A 3DBDA 4QPMA 3OVVA 3W2CA 4DGOA 2HW6A 2O8YA 3IDBA 3AQVA 4D2PA 4AS0A 3M42A 4DEGA 4DLIA 3RM7A 4U9AA 4F70A 3FY0A 4USFA 3SAYA 5CWZA 4W4XA 4FT3A 5BPYA 4B9DA 4K18A 2RFDA 5IEXA 4DEIA 4BIBA 3TUCA 4J52A 4EZ7A 5LVOA 2GPHA 1H27A 1J1CA 1CKJA 2C1BA 3GU8A 4D4VA 5HORA 2Q0BA 4KSPA 2GHGA 2QHMA 3Q53A 4RA5A 3MWUA 4L6QA 3EFLA 4QMUA 4UWCA 2R64A 5I0BA 4AA4A 5JSMA 4XH6A 4D9UA 3TNPC 5CU0A 3DFCB 2WMXA 4FKJA 2YN8A 2W5HA 3KXZA 3PXZA 4HZRA 4N4SA 4A9RA 3P4KA 4FEQA 1PXIA 3V6RA 4NJDA 5DR6A 3PYYA 2OIQA 4BDCA 2J0MB 5A54A 3E8DA 5HLNA 5JFWA 3O23A 3NVKI 3PP0A 3A7GA 4OAVB 3R1YA 4BGQA 2BVAA 3UTOA 3F7ZA 1FVRA 3BGZA 3RNYA 5CZIA 2OJIA 2RG5A 3BBWA 3BQCA 3UO4A 4RJ6A 2RKUA 5F9EA 5KMKA 4I21A 4DFUA 3PXYA 4ZZMA 4C4EA 1F0QA 3TI1A 4J8NA 2VTPA 1IEPA 3PP1A 3WF5A 5GJDA 4ASXA 4OTWA 4TNDA 5KBRA 1H1SA 2BFXA 2V0DA 5JRQA 3HMIA 3DNDA 3E64A 2BRNA 2G1TA 2XCKA 4FKSA 4O1PA 3ZLWA 4Q9ZA 3NUSA 2B53A 3H30A 4FEVA 2P2HA 3SKCA 1Q8ZA 4FV8A 3ELJA 4DBNA 4D4YA 2WQEA 5ITAA 4FMQA 4U41A 4O2ZA 4EC8A 4F09A 3ZBFA 3R7GA 3U6HA 4EK6A 4BB4A 3RAIA 4HVDA 2QODA 3FKNA 3K5VA 2W06A 2CDZA 1CKPA 2ERKA 5CU3A 3GT8A 2GS7A 3OEFX 3RAWA 4ZTRA 4EH2A 3DXPA 2W7XA 5L6PA 4E73A 3R9HA 4FVQA 3QWJA 2I1MA 4D1XA 2JDRA 4EK8A 4RX8A 2PL0A 3E5AA 4W4YA 4YHFA 2QD9A 4GH2A 4M69A 3GGFA 2YCQA 2WQOA 4EZ3A 4OUCA 2OZAA 1YWRA 4RZWA 1CKIA 1H25A 3OW3A 1ZYSA 4CSVA 4E4MA 4RLKA 4UV0A 3OOMA 3OT3A 4EJNA 4EOSA 5LMBA 3E92A 2ZJWA 4WNKA 4JBPA 4TL0A 4I41A 2BZKB 2PE1A 4BIDA 4JIKA 2CLQA 2C5NA 2QG5A 1V0BA 4ZTNA 2PSQA 5ETFA 2E9PA 3ROCA 3PXKA 2BDWA 1MRUA 3KXGA 3OMVA 3QHRA 3TZ9A 3UZTA 5BX0A 1GZKA 1OKYA 2C0IA 5J79A 4C8BA 3AXWA 4GIHA 3UOHA 4AOTA 3DKOA 3QZIA 3RAKA 5E8UA 5C27A 3SRVA 3P79A 4AZTA 3MPMA 1YWVA 2FSTX 4IZAA 3UMXA 3MV5A 3PXRA 4IACA 2UVYA 3OCTA 3UIMA 1A06A 1AQ1A 4HCUA 4DH7A 4LYNA 3UYSA 2EXEA 2R3LA 3FYJX 3I1AA 2OFUA 4FNWA 5E90A 4DYMA 2ITZA 2OIBA 3F5UA 3KVWA 3TKUA 1E1VA 3IQ7A 3DU8A 2GNLA 3NX8A 5DRBA 2J0JA 3R21A 5FWKK 5E8VA 5GIOE 3QCQA 2VO3A 3ACJA 3OROA 2XNGA 3TEIA 5IEYA 4ITJA 2PMNX 3CBLA 3BGQA 2B9JA 3NUAA 2JFMA 4DH1A 2JKOA 3QGWA 1Y91A 1YXUA 4H3BA 3OUNB 2I0EA 2BZIB 2UZOA 4YTHA 4QMWA 1OKZA 4J71A 2PE0A 4E6DA 4D9TA 4IX4A 5B2KA 3RHKA 3MSSA 5TT7A 4NCTA 3ZM9A 2ZV2A 4IB1A 4RGJA 2IVUA 3R1SA 2C3LA 1QCFA 3I7BA 2HAKA 4LL5A 5TKDA 3O8PA 4DGGA 3NPCA 5AA9A 1Q4LA 2PE2A 5KX8A 1Q3DA 4KS8A 3N4TA 4O7VA 3FXXA 4FOBA 3ORXA 3ZM4A 4NW5A 5KZ0A 5L2IA 2GNHA 1WBOA 2O3PA 3V8WA 1R1WA 3OWPA 4UZDA 3VQHA 3DAEA 3JY0A 2XJ0A 4NM7A 4WSYA 2V7OA 2XNPA 4FOCA 3SD0A 4FTIA 3N4VA 4ZLOA 4CVAA 4JS8A 3R8UA 3BCEA 4U8ZA 5EFQA 3WI6A 5TF9A 4K1BA 4CYJA 3UP7A 4HYSA 4BI2A 3G33A 2XRWA 3O7LD 4QTDA 5BVKA 1XQZA 3AGMA 4XV2A 5AP4A 3VS3A 4FV3A 4PPCA 4DEEA 4CMTA 4HPUE 3E93A 3V5WA 5AR5A 5HCZA 4BRXA 1OIYA 2P4IA 4RA4A 4I5CA 2X7FA 4YZMA 5LMAA 4DEDA 4EHGA 4BDHA 4C2VA 4EYMA 4XG2A 4FTQA 3Q04A 2JGZA 3NW5A 4DLJA 4HNFA 2WTCA 3F5PA 3FSFA 1UA2A 3I4BA 3B2WA 3ZYAA 4YJTA 3KULA 4QOXA 3VF8A 4E93A 4BCGA 4BGHA 4S34A 1OIQA 4IEBA 5E8XA 4BDBA 4RC3A 1VJYA 2I40A 1BL6A 4K2RA 3OCBA 5A4LA 5K4JA 1JKSA 1KV2A 2FO0A 5CT0A 4ZOGA 3ORTA 5CXZA 4ACCA 2FA2A 2ITWA 1P4OA 4FKOA 1OBDA 1RE8A 5HG5A 5LOHA 2VGOA 5M51A 4D5HA 4G16A 1IASA 4XLVA 3NLBA 2XNNA 3MDYA 4U40A 3QTUA 4DFLA 4WSQA 4AA0A 2E9OA 3R30A 3MFSA 4FTJA 4AP7A 4BVUA 1W7HA 4EI4A 3F66A 4NEUA 5IA1A 3TN8A 3G6HA 4O7YA 3TDVA 4M84A 3G9LX 3I7CA 5EW8A 3W10A 1DI9A 1WBVA 3HP2A 4YUQA 3MVHA 4X3FA 5AUYA 4AN2A 3NW6A 2ZV9A 4BIEA 4DH5A 1B38A 3GCVA 4ITHA 4L3PA 3KK8A 5J8IA 4UMPA 5B0XA 3R1QA 3IOKA 3MTFA 5BUEA 4TYGA 3NUXA 4ZZOA 2YHVA 3FZPA 1JPAA 4FEUA 4QMNA 5I4NA 3O0GA 4R3PA 4IH8A 1JOWB 2XJ2A 4XUFA 1KSWA 2VWVA 2R7IA 2ZM1A 3WILA 2J9MA 3QAME 3FMNA 5CX9A 2Y0AA 5K0XA 3MVMA 2QC6A 4GJ3A 3LE6A 4BCPA 3LJ0A 4FUXA 4ZY5A 1RW8A 5TR6A 5C26A 5J1WA 5E8ZA 4O83A 4AFEA 4EUTA 4F1MA 3QYWA 1YDSE 5JZNA 1PXMA 3CD8A 4R5SA 5T6KA 1PKDA 4YJRA 4EHZA 1REJA 4I5MA 3ENHA 3HRBA 1HCLA 2HZ0A 3CGOA 2QO2A 4QQCA 2HK5A 2XKCA 4AAAA 4TZRA 3FPMA 4WUNA 2VUWA 4DFBA 2PZIA 3W32A 2UZLA 3HUCA 4MNEB 4BCJA 3E62A 5AADA 1Q3WA 1GIIA 3DA6A 4BCOA 4YLLA 5M4FA 1QPJA 2XIZA 4V0GA 1JKTA 3HV4A 3RAHA 4I24A 3V51A 3PY3A 5KE0A 3V5JA 4FBXA 3VWAA 4CMUA 2DS1A 1H0VA 4FIJA 3MIYA 2R3IA 3BU5A 4G3FA 3MYGA 4G31A 4NJ3A 4NM0A 1Z5MA 2OKRA 3BU6A 1YI3A 5CXHA 5AUXA 2W1HA 3FZ1A 5ANEA 4A9UA 4E5WA 1XR1A 4DH8A 5GINE 1XH6A 2HW7A 3AC3A 2EU9A 3KMMA 1G3NA 4LRKA 3NEWA 4O0UA 3WZEA 4EKKA 3GBZA 5FLFA 3G15A 4N70A 1IG1A 5J1VA 2R2PA 3UVRA 3QXOA 3ZDUA 3BELA 5J87A 5EI6A 5LCJA 1IRKA 4IHPA 4QMVA 3TV7A 3V5LA 4QO9A 2FSLX 2WMQA 2Y6MA 3QQFA 3BIZA 4BCHA 3KEXA 3FDNA 2OICA 4CV8A 2XM9A 2BR1A 5FXQA 4OT5A 3F3VA 1H1RA 3WOWA 3TWJA 5EKOA 4CKRA 4WOVA 4EHEA 1UWJA 3BHUA 3NYNA 3BHTA 4G5PA 1H1PA 3NDMA 4F9YA 1XH7A 4Z55A 5FP6A 4O21A 3VBXA 4F9WA 3TV6A 2GFSA 3COMA 2QURA 1PXJA 1DI8A 1UNGA 2OGVA 4PPBA 2CKPA 3Q2JA 4CZUA 4HVSA 2B55A 5C03A 4ZTLA 3L9MA 4IAAA 3TXOA 2A4LA 2UW5A 3F2AA 3IPHA 4GG5A 4JBVA 5JGDA 3S0OA 2ITTA 4IM2A 3UIUA 2C6EA 4FIIA 3U51A 5IQDA 3R28A 3C5UA 3K3JA 2Q0NA 3EWHA 3R7UA 3RPSA 5IEVA 3QXPA 4BICA 1YOJA 5AMNA 2QG7A 3P0MA 2PTKA 4LV8A 2ITPA 2QVSE 2AC3A 3TUBA 3LQ5A 2W96B 3IKAA 4EH7A 4O22A 4BCNA 4TYHA 4EK3A 2YITA 5IA2A 2UW3A 4IB5A 3I0QA 2WMUA 2YAAA 3FMKA 4V01A 3QBNA 2ITNA 3PJ8A 4R77A 4QTCA 4RIYB 3QALE 2UW6A 3R9OA 2EWAA 2F7EE 3DY7A 4J95A 3RGFA 1ZOHA 3HUBA 4HZSA 3UQFA 3GOPA 3OS3A 3PLAE 4A07A 1VYZA 3LPBA 3SV0A 5AP7A 4PDPA 2XJ1A 2OK1A 3AD6A 4U45A 4PDYA 2XH5A 1J7UA 4L3LA 4QYYA 2VO6A 4WIHA 2VWIA 3PSBA 4II5A 1G5SA 4JAIA 3S00A 2Y4PA 4V05A 1Q61A 4EH8A 3Q52A 1K2PA 3QCYA 4WNOA 2VTIA 4X2FA 3KXXA 5AR8A 4NK9A 2YAKA 2W1CA 2IVVA 2PYWA 2Y6OA 1ZZ2A 3CEKA 4YJSA 5C4KA 2OI4X 3GC9A 4YSJA 1J7LA 1UKHA 4HJOA 1YDRE 3GU4A 4UXLA 3PJ3A 4D2VA 5KUPA 1BL7A 2R5TA 3FZOA 1XH9A 4PTGA 4Q2AA 4QMPA 4JQ7A 3RWPA 4IX6A 2BTRA 3EFJA 3S3IA 3NS9A 4QP7A 2R3NA 2VTTA 1TQIA 4C62A 3UDBA 4QT1A 4QTEA 5AAGA 3TKHA 2GQGA 3BI6A 4YURA 2HZNA 4FNXA 5C1QB 5A4QA 2C4GA 3Q96A 4TY1A 5K0KA 5EDQA 3A4PA 3F3TA 3DQXA 4IB0A 2F4JA 3ITZA 3GB2A 1DAWA 5GJFA 3RKBA 5DG5A 3UC3A 1JNKA 1OI9A 1BYGA 2RSVA 1SM2A 4CFVA 5M57A 4IWDA 3HAMA 4D1SA 3JR1A 2O2UA 4R5YA 5ETCA 4DCAA 2ZOQA 3Q9YA 4LI5A 4BFMA 2QKWB 3SOCA 2HENA 5FBNC 3MH2A 3ACKA 5DWRA 3S95A 4JR3A 3V5TA 2J90A 1KV1A 4YBKA 3VC4A 4WBOA 4FKVA 4D0XA 4CRSA 2WMSA 4PMPA 4CLIA 3GNIB 3UOLA 3HRFA 3PPKA 4D2RA 3ZO3A 2C6OA 3JVRA 5A46A 2E9VA 4F65A 2IZUA 4HGEA 4C58A 4KKGA 4A06A 1VEBA 4J1RA 3EN7A 3TZMA 3FL4A 4FSWA 5HNGA 3K54A 3TTJA 5K9IA 2YERA 4R7HA 4U80A 5M44A 5IQAA 3MBLA 2XEZA 4JBOA 2WTKB 4Y83A 4RX7A 4EWQA 3HP5A 1YQJA 3TIYA 5AP6A 4ANQA 3WZDA 1RDQE 1OVEA 4JXFA 3BPRA 4RIXA 5LQFA 4RQVA 1NVRA 1J3HA 3ZC6A 3FEGA 4ASZA 3PLSA 4CV9A 3A60A 4CRLA 4LM5A 1H8FA 5I3OA 4BI0A 1GNGA 1GAGA 3FQSA 3QL8A 2VWWA 3RINA 1WBPA 2F57A 2I0HA 3G0EA 4G1WA 5ACKA 3CY3A 3WZUA 5EI2A 3EQBA 4Y95A 3QLFA 5FEDA 4BGGA 4EH9A 4L46A 3PZEA 2PUNA 5KCVA 4ZSGA 5IUIA 3HV5A 4H39A 5JQ5A 2RFSA 5EYMA 2IVTA 1XKKA 2QOFA 2E9UA 5IMEA 2C3IB 3FKOA 4NIFA 3EQCA 4IX5A 4ACMA 4CCUA 2JDVA 3BWFA 1PY5A 5B7VA 4AACA 4G9RA 4L42A 4IM0A 3ZHPC 4EONA 4GG7A 4PNIA 3QA8A 4PRJA 5DGZA 4BDIA 2DYLA 2OU7A 3E8NA 3QRKA 4F7SA 4XV9A 4XG7A 2B9FA 1YDTE 4ARKA 4TT7A 4BWKA 2E2BA 2CLXA 4IWPA 2YM3A 4IADA 4C4GA 4FL3A 3Q9WA 4UY9A 4O2PA 4DEAA 3VUMA 3IONA 3Q9ZA 3MFRA 2YCFA 4MWIA 5DMZA 3BX5A 1L8TA 2BRMA 5IUHA 4KAOA 5E8WA 3NZ0A 4I6BA 3SXSA 2I6LA 2Y9QA 5G1XA 3UQCA 2WTJA 4OTIA 4RG0A 4XP3A 4FKQA 4CFFA 3ZOSA 5L2TA 3C0HA 4MVFA 1ZLTA 2PMLX 5HO6A 5CF8A 4JVGA 3VHKA 3W18A 4AW0A 2XCHA 3SW4A 5IQCA 5D7VA 2PVRA 4AOJA 3R83A 5M08A 2X4FA 4YTCA 3ORIA 5I5ZA 4BDEA 3F82A 3QD0A 4JG8A 3KC3A 4Y5QA 5ANGA 2WMTA 2X2LA 5AM6A 5DT3A 5HE0A 3LQ8A 4PPAA 4FIFA 1PMEA 4TWCA 3OG7A 4O0TA 3VBQA 2UVZA 3DT1A 3MTLA 4L44A 3DJ6A 4D2WA 4EHVA 4A9TA 4FSNA 4ZLYA 4M0ZA 5CVGA 1M17A 1VYWA 1ERKA 5AX3A 4AT3A 3DFAA 2OW3A 2Z60A 4V04A 2QOQA 5H8BA 2Q83A 2OXXA 4G5JA 3ZH8A 4H36A 3RMFA 1XH4A 2BPMA 3WYYA 4ALWA 2UW0A 2VTRA 4YLJA 4DFZE 3H0YA 4ZS4A 4MBLA 3DXQA 3MB6A 4CGAA 3Q6UA 2WO6A 4WHZA 3UO6A 4G9CA 2XEYA 4I3ZA 4FL2A 3ROYA 5HOAA 4JDIA 3CTHA 3NSZA 3VW8A 4XNEA 4NWMA 1Q5KA 3BE9A 4YLKA 2VWBA 2XP2A 5IU2A 5KBQA 2ITXA 2ZM4A 4J96A 4U97A 4C0TA 3JXWA 4EOJA 3KN5A 4C3RA 4O0YA 3RNIA 2BRBA 2QR8A 3NUPA 4FV4A 4I1ZA 4EWHA 3GVUA 4GYIA 3WZJA 3ZU7A 4CXAA 3GEQA 3ULZA 4KKHA 4CQGA 3VVHA 4WKQA 4AN3A 1CM8A 3QQGA 4G34A 3LM5A 4I20A 4QPAA 5HBHA 4F08A 2P0CA 3ZONA 2XBAA 2WHBA 3V5QA 3OCGA 4M69B 4O0VA 2WMVA 4E8AA 2Z7LA 2HY81 3ORLA 4RQKA 5ICPA 5I3RA 4ZEGA 1WFCA 3MI9A 4JJRA 3FI8A 3CIKA 2Z8CA 4P5QA 3U54A 4IJ9A 4CG8A 2H96A 5AUUA 2X2MA 5AV1A 4UMRA 5IISA 3RK5A 1NA7A 4E20A 3ALNA 2F2UA 4KIKB 4RSSA 3QC4A 4ENXA 3G2FA 5HTBA 2PVMA 1YRPA 3WZKA 5FXSA 3M11A 3JUHA 4M8TA 3KQ7A 3VS1A 5EG3A 5IDNA 5IA4A 4GUEA 1OL1A 4RVTA 3TZ7A 1M2QA 5CNNA 4DFNA 4IC7A 3NNWA 4WG3A 1MQ4A 1ZYLA 4RBLA 3ZZEA 4CQEA 3CC6A 4BCQA 3EN6A 4CG9A 3NNVA 3UPXA 2WIPA 3PIYA 3MPAA 4LOPA 3MJ2A 3EQIA 4FK6A 3R7EA 4DBXA 5AAEA 1ZYJA 5CVHA 3RWQA 1IAHA 5CEKA 3FMEA 4M14A 4EOLA 1IA8A 5AUTA 4GU6A 2CGVA 3EJ1A 3F2NA 4GVAA 3HYHA 4AWIA 2BTSA 2OLCA 4AA5A 3NIZA 4FV5A 5AR7A 4IXPA 4LV5A 3QF9A 1U4DA 5I9YA 5ACBC 1I09A 2ETMA 4OTRA 3POOA 4QTBA 4XP0A 4OTHA 2A27A 1KE5A 3PVGA 3W2RA 3ZO1A 4MK0A 2WTKC 1GIJA 3EQHA 3K5UA 4L7SA 4ERKA 3TM0A 1R0EA 4GU9A 2CN8A 4LOOA 3E88A 2CPKE 4O27B 5KKRB 1WCCA 2QLQA 2J51A 4J8MA 5TE0A 3ZSHA 5A4EA 1KOAA 3NMUF 1W8CA 3VJOA 5GIPE 3MY0A 4FEXA 4PWNA 4OBOA 3F6XA 4L8MA 5HIEA 5AR2A 3ERKA 4FYNA 2DQ7X 4DF3A 4YPSA 3SQQA 3H3CA 4E6QA 3DQWA 4RVMA 1YXVA 3H10A 4PNKA 3QKLA 3FZTA 3C9WA 4ID7A 2B1PA 1S9IA 4NUSA 3BE2A 3VF9A 5BYLA 2C0OA 3Q5IA 2G2FA 3LMIA 3MW1A 1DS5A 3G9NA 2GFCA 3FI4A 4PF4A 3AG9A 3P7CA 4G3GA 3VO3A 5IPJA 5CF6A 2HXQA 3BYVA 3QZGA 4LMUA 4P5ZA 3ZRLA 4C3PA 4GK2A 3U55A 2C6KA 2VRXA 4YMJA 2C6IA 3R63A 1YHVA 4HW7A 5KHXA 4AQCA 3BYOA 5FGKA 5AP1A 1K3AA 4PL4A 1Q8WA 3W55A 3Q4UA 4UWYA 4CFNA 2NNWB 2NRYA 3LCSA 4L45A 1UU7A 2WMAA 3AC8A 3VBWA 2PU8A 4ANOA 4BDKA 1UWHA 4GIIA 3JY9A 1LEWA 2NP8A 5ANIA 4QP2A 3UQGA 4GK3A 4J99A 5DH3A 3UMWA 2G2HA 3MIAA 5CEMA 4M66A 4CEGA 3BZ3A 4EYJA 3ZFXA 5KMIA 2ZV8A 3EKNA 4GJ2A 5KMNA 4S31A 5ANKA 4GT3A 1F5QA 5D10A 5AV3A 5BNJA 4FA2A 4FNZA 3LJ2A 3F3UA 2W5BA 2WQBA 2GCDA 4FVRA 5HG8A 4UZHA 3W8QA 2GQSA 3Q32A 5FXRA 4R7BA 4NW6A 2YACA 4ANMA 4GFMA 2W17A 3VQUA 3ENMA 4EKLA 3CJFA 4IVBA 1OITA 3RZFA 1IAJA 5JKGA 4U5JA 4OR5A 4WNMA 3PA3A 3FQHA 2J0LA 4JDJA 4AT4A 4HCTA 3CD3A 4IIRA 1JVPP 1H01A 4C4FA 4DGNA 4EQUA 3R9NA 1GIHA 5L8JA 1XH8A 3U87A 4X3FB 5E91A 4PDOA 5JN2A 1B39A 4YP8A 4FTRA 3BBTB 4HVHA 5EQYA 4FTUA 3ODYX 4D28A 4RT7A 2J4ZA 4NTSA 2VTJA 3KXNA 3BWJA 4PL5A 5FBOA 2E9NA 1OL5A 5CU2A 3P78A 3VAPA 4Z7GA 4X6QC 4XG6A 3POZA 4F6UA 2X9EA 3PVBA 1FGKA 5L2QA 3ORPA 2PVFA 2WB8A 4FICA 2QHNA 2QLUA 3TNIA 1SMHA 2R9SA 3MY1A 3OTVA 2R3HA 2J2IB 5AIKA 4ACDA 2XS0A 5CNOA 4IWQA 2PPQA 5L6OA 4IAFA 5CEIA 5CU6A 3R01A 3UVQA 2WXVA 5IQFA 3IW4A 3BHVA 3NCGA 3LCTA 4CZTA 5M4UA 3HVCA 5FEQA 3DKCA 4FZ6A 1UU9A 4FTLA 2OJJA 1OM1A 2YISA 3PWDA 4QMZA 4YPDA 3EQDA 2P2IA 5HVJA 4OTQA 1CTPE 5M06A 4C35A 2G15A 3LLAA 3AD5A 4BBEA 2J5FA 3GUBA 1ZXEA 4FR4A 1AGWA 4AF3A 3QYZA 3UBDA 4JOAA 2CCHA 4XV1A 5DT4A 4MF0A 4GFOA 3OHTA 2VWYA 3AC5A 3HKOA 2YM6A 3NAXA 3Q4CA 3P86A 4JRNA 4V0GB 3W33A 1O6YA 3R1NA 4TNBA 4ZTSA 3VJNA 3W8LA 5CAUA 4ZLZA 1EH4A 2PMIA 3KRJA 4MX9A 4L01A 2YM5A 4C4JA 4USEA 1JAMA 4BZNA 1YHSA 1WZYA 5HZNA 5HG9A 1S9JA 2GMXA 4EH5A 5ETIA 1APME 3QHWA 3DNEA 1OPLA 5JRSA 1ZAOA 2WTWA 3HMNA 4QMMA 3V04A 2WELA 4CKIA 5CAVA 3F2RA 3TG1A 4ACGA 3SA0A 3JVSA 2H34A 3NCZA 3C0IA 2R7BA 3O96A 2X7GA 3TL8A 5KMMA 2BDJA 2YIWA 2X9FA 3DBCA 3N51A 4GUBA 3LFEA 2WMWA 3L8SA 3R7OA 5FG8A 5CAQA 3FAAA 2CNQA 1SVGA 2VTLA 4FZFB 4NFNA 4JI9A 2X2KA 2WOUA 3RTPA 4ZK5A 2ITYA 4I4FA 1HCKA 5C9CA 2V5QA 4F4PA 4B0GA 5CANA 5DFPA 4EUUA 2BRGA 4KD1A 4BTJA 3LJ1A 4DG0E 3PVWA 3FLWA 3UODA 1M2PA 1KE7A 1U54B 4J53A 4PQNA 5DOSA 4FG8A 4AUAA 4B99A 1Q24A 3A8XA 3SDJA 3LXLA 4YNOA 1WVYA 2C5YA 3Q3BA 4F6WA 2G01A 3QD2B 1OBGA 1LR4A 2HELA 2R3OA 2VZ6A 5DEWA 3DJ5A 3DBFA 2XYNA 2PVNA 3EZVA 3SHEA 2X0GA 5KKRC 1R3CA 1XJDA 4KIQA 2UZTA 2JLDA 3NIEA 3SC1A 4A9SA 4IBMA 5E8SA 2YDJA 4NCTC 3AOXA 4QYFA 4PDSA 5AP5A 3DB6A 1ZY4A 2QQ7A 4FV7A 5IF1A 4RPVA 3RJCA 4IAYA 2QCSA 4TYHB 2Y4IB 2C68A 3BQRA 5CY3A 1G8SA 2GHMA 1UVRA 2W1DA 4BTMA 4F7JA 2VD5A 2QO7A 2VTQA 4NFMA 2ITVA 5KHWA 4BWXA 3RCDA 1LUFA 3B8RA 4JX3A 3FYKX 2C6LA 4L53A 4YBJA 5CQUA 1M7QA 5T68A 3EQFA 1M14A 3ODZX 3UZPA 2LGCA 3TZ8A 2OBJA 5FTQA 4FVPA 4GT4A 4W8EA 4K33A 5CS6A 1YXSA 2PVLA 2BHHA 4G6OA 3BEAA 4YC8A 2ZB0A 3I6WA 5DNRA 3IW5A 3MVLA 3KRXA 4JNWA 1U5QA 3II5A 3L8XA 2BRHA 4MBIA 4U81A 4KUJA 4O96A 5D1JA 3LOKA 3ZLXA 5AFVA 2XIYA 4FT7A 3OFMA 2W4KA 4G6LA 4U7ZA 2W1IA 4G3CA 1MUOA 1JKLA 5HD7A 3ULIA 4RJ8A 3HAVA 4DE4A 1CDKA 1URWA 3MS9A 1OMWA 3KU2A 4K11A 4MHAA 2PZPA 5HX6A 5AP2A 3QX2A 3GU7A 1GJOA 2W1ZA 3RCJA 5D11A 2AC5A 3GOKA 5TO8A 3U4WA 3MESA 3K2LA 4R7IA 3S2PA 2ZV7A 5FP5A 4WUAA 2IZSA 2H6DA 1O6LA 2O5KA 4GYGA 3TUDA 3FMLA 4D2TA 1JLUE 4NM3A 3LW0A 3KF7A 3HA6A 3RPYA 3IOPA 1ZMUA 3QTSA 1URCA 1ZZLA 5HE3A 4DFXE 3ZBXA 4A4XA 2QONA 1FMKA 2X1NA 4D1ZA 3UPZA 3PIZA 3BYMA 3SXFA 3UO5A 1ZOGA 2W05A 4NZWB 1FINA 2IVSA 3HLLA 4FTMA 5J95A 3OXIA 5L3AA 3OF0A 4I94A 4FKTA 4OTGA 5HQ0A 4QNAA 4RC4A 4X3FC 3FXWA 4IE9A 4BYJA 3E8EA 3GU5A 4NL0A 4C38A 2GDOA 2XNBA 3CKXA 4UALA 4N0SA 4B8LA 1R0PA 4RIWA 4BDAA 5AV0A 3P7BA 1NY3A 4F64A 1OL6A 5EOLA 3ET7A 4MXAA 3VNTA 5HNIX 4O7WA 4EORA 4TKSA 3HRCA 3EFWA 5BVNA 1XBAA 5CSHA 4FODA 4IZ5A 1WBTA 4A4OA 3ZMMA 3CTJA 5BQ0A 4AGCA 4AZEA 4DITA 4RIXB 4KIPA 2WQNA 4M68A 4Q9SA 5A4TA 4H58A 3D14A 3VS6A 4LGHA 4U3YA 5AX9A 3W2SA 3W16A 2JIIA 4C57A 5KMJA 5LJJA 2PMOX 3I6UA 4KBKA 4FZDB 2O0UA 4I23A 5E8YA 2JC6A 5HNBA 2GSFA 5A3XA 2JAMA 3QFVA 5BVFA 4IVCA 4RIOA 5LVPA 4M3QA 4MBJA 1XO2B 4J98A 2ZVAA 2OXDA 2VWZA 3FKLA 4GK4A 4BHNA 1OPJA 4EOMA 5HX8A 2XK6A 5I9XA 4FV2A 3EKKA 3GCUA 3UNJA 4ZJVA 4HGLA 4TW9A 3LVPA 4I0TA 5HI2A 1YOLA 4ANLA 5F1ZA 4F9CA 5J7HA 2YWVA 1T46A 4S32A 4IAIA 3ORKA 1ZMVA 3F69A 2WIHA 4LRJA 4NIFB 3UJGA 5DPVA
chains in the Genus database with same CATH superfamily
4RVLA 4DC2A 2P33A 2OH0E 5FTOA 5AEPA 4P2KA 5L4QA 4XEYA 3V8TA 5ANOA 3U4UA 4PMMA 3E8CA 4L52A 5CAPA 4OLIA 5KMLA 3BLAA 3Q4TA 2GU8A 2ZYBA 5AAFA 1PXKA 2HYYA 3RHXA 5TOZA 3ZEPA 5L2WA 5BUIA 4QP8A 4KA3A 2ZDTA 4GSBA 5HESA 2JAVA 5M07A 2XIXA 3TNWA 1ZWSA 5AJQA 3W0PA 5E7RA 4USDA 3CGFA 2OJGA 2BAQA 3CTQA 4HYHA 3FI3A 3FZRA 2VTMA 3MJ1A 5FTGA 1H1QA 3QKMA 4FGBA 3VS0A 2WU6A 1Z9XA 2YIQA 4XG8A 5B2LA 1QL6A 3RALA 3FI2A 4RLLA 4NM5A 1REKA 2UZWE 3TACA 4RVKA 4C02A 4O81A 4OW8A 4O6LA 3OC1A 3BYUA 4C2WA 3ETAA 3N9XA 3OD6X 3C51A 3VS4A 1WBSA 1M2RA 3LFNA 4IDVA 2VTNA 1PRYA 4GW8A 3KVXA 2PHKA 1MRVA 5CEQA 2OWBA 3CLYA 4P90A 3BHHA 3VS2A 1Q41A 3R04A 3CE3A 4M13A 3E63A 3DTCA 3JS2A 4P4CA 4XG3A 4AFJA 1O6KA 4U0IA 3JYAA 5DI1A 3PTGA 4H1MA 4FIGA 3HEGA 4Y46A 5HEZA 2HXLA 3UIXA 3O51A 2YJSA 5HE2A 1M7NA 4U43A 4O82A 4N6YA 3F7WA 3QRTA 1G8AA 3R8PA 3KCKA 3NYVA 3C1XA 2KULA 3PUFC 4LL0A 2WEVA 4I6QA 5BYZA 4YJNA 3F9NA 3HDNA 4O91A 4FTKA 5M56A 2Z7RA 4RJ5A 2Y4IC 4QQTA 1YKRA 3UYTA 3ZSGA 4XLIA 2VO0A 4MKCA 2IW6A 2V62A 4MXCA 4WD5A 5DT0A 4ZY4A 2JKKA 4BDGA 2BCJA 2J0KA 4QYHA 3MFUA 4IWOA 1QMZA 5F20A 1PXOA 3I5NA 3QTZA 3TCPA 5LVMA 5EHLA 3AT3A 3CQUA 2XRUA 1H1WA 3Q5ZA 4FTNA 4DEHA 5EDRA 3EH9A 4JL9A 4BYIA 4EEVA 4PL3A 3R7IA 4R3RA 3IK3A 1R39A 3W0OA 5M53A 4K8AA 2PUIA 4U44A 3U9NA 2FGIA 4AGWA 2WD1A 3R8VA 3NUYA 3VW6A 4UYNA 2ZB1A 4NTTA 2OJFE 4MNEA 3V3VA 4ASEA 4C61A 4DHJA 4GS6A 5ANDA 3OZ6A 3LMHA 4TXCA 4C3FA 4DT9A 3PWYA 3UVPA 2VN9A 2XM8A 4A7CA 2XZSA 4F63A 2BMCA 4M67A 5E92A 3TNQB 2C3KA 1MQBA 2VGPA 3ZTXA 3D15A 3V5PA 2HZ4A 3I79A 3U6IA 3AKKA 5IMXA 1H07A 4KB8A 4U42A 3ANRA 2YCRA 3HZTA 5CSXA 4CCBA 4D2SA 4EOQA 1A9UA 3PE1A 2Z7SA 4R1YA 5HIBA 2NO3A 1ST0A 1W0XC 3IO7A 3L8PA 4FKWA 1FMOE 5DEYA 5FM3A 3VUDA 3R9RA 4YNEA 4FIHA 4D58A 5A6NA 5BMMA 5CTPA 4WRGA 3O17A 2QNJA 2C6DA 3QUEA 3RPRA 5EYDA 3PJ1A 4WG4A 3ATTA 2R0IA 3VULA 1JSUA 2UVXA 2GHLA 3AMYA 4F0FA 3F5GA 3OT8A 4AW2A 5K5XA 4WRSA 3SOAA 2F9GA 4ANBA 4QMQA 1GZNA 3QRIA 3EB0A 3IS5A 4I4EA 3DLZA 4G2FA 2WEIA 1Y6BA 4ZSAA 2BIYA 2RF9A 1Y6AA 4YZBA 4HYUA 3CS9A 2JBOA 1TVOA 3SG8A 2GNJA 4K9YA 3KCFA 2XK9A 1ATPE 2UZVA 3FLYA 1Q97A 4BN1A 1OIUA 4O0RA 2GTNA 3OBGA 2IW9A 4E4NA 1GY3A 1SVHA 3EHAA 4OBPA 4JAJA 2XALA 4AW1A 2CGWA 4E5AX 4OBQA 3KA0A 5LARA 1XBBA 2J0IA 4G6NA 3PRFA 2JEDA 5ETAA 2GS2A 4BHZA 4DG3E 4BKJA 3QQUA 4TPTA 3C0GA 5HD4A 3ZDIA 5EM7A 5CEPA 2GNIA 2W9FB 2VX3A 3A2CA 3UNZA 4J97A 2HIWA 4MAOA 5CU4A 3QUDA 4RWJA 1BI8A 3EN4A 2VTSA 3OEZA 4JRVA 4BBFA 4FSTA 3H9OA 3O2MA 2IZRA 4FKGA 2NPQA 5L6WL 4EBVA 3PSCA 5HE1A 2JIVA 3OOGA 2BAJA 5BYYA 4WBBB 4RIYA 1ZMWA 5AM7A 4BKZA 3WE4A 4ACHA 2VAGA 3QA0A 4FNYA 4FT0A 5CAOA 2YWPA 3S1HA 2XB7A 4IAKA 5BVOA 4IQ6A 2WMRA 4XJ0A 4IMYA 4CFWA 1H0WA 3PXFA 3GXLA 4FKIA 3KKVA 2B4SB 2QU5A 4JQ8A 5H8GA 3EYGA 2C6MA 5JEBA 3B2TA 2OG8A 4MQ1A 3GC0A 3ZFYA 5F94A 2BFYA 3QCXA 4KKEA 1OKWA 5AR3A 4MD7E 2HZIA 4E1ZA 2C30A 1J1BA 2C69A 1K9AA 1YWNA 2R3QA 3D2KA 4FTAA 4P7EA 5BVEA 1XBCA 4MD8E 3PJ2A 3PFQA 4ZJIA 5GZ9A 1PYEA 5JT2A 4I5HA 3OXZA 4JDKA 4XX9A 4BDDA 2C5OA 4RFYA 5E1SA 2IW8A 5JH6A 5AUVA 4IFGA 3W1FA 3VBVA 1I44A 4J7BA 5ANJA 3W2OA 4PY1A 5B2MA 5IG1A 2YM8A 4LQMA 3L8VA 4DGLC 4BBMA 4FZAB 4TYIA 2PWLA 2XK3A 3P1AA 3PVUA 1WVXA 2B9HA 1V0OA 4MXYA 5DIAA 3QCSA 3U9CA 4AZWA 4PP9A 3QD4A 4L7FA 2JDSA 3CQWA 3GP0A 2YDKA 2H8HA 3FC2A 3ZXZA 2EXMA 4AXEA 1DM2A 1PMVA 2CSNA 2C5XA 3F88A 3RP9A 3OY1A 2QOIA 3PRIA 2XA4A 5EK7A 3ALOA 5HU9A 1JSVA 1PMUA 2CMWA 2LAVA 3ZFMA 2ONLA 3FUPA 1GOLA 4OT6A 4KINA 4RC2A 1Y8YA 3D5WA 1WBWA 5M09A 5BMSA 3W0SA 2OZAB 2X81A 3VUHA 3FMDA 4FV1A 4F9BA 3DGKA 4R3CA 4PP7A 3LAUA 3W0QA 3EYHA 3DJ7A 3UNKA 3RZBA 1R78A 5DRDA 3QRUA 1RJBA 2VX1A 4GFGA 3ZLSA 3EMGA 5LXMA 4DHFA 1STCE 4MH7A 3U8WA 3FLZA 4BKYA 1U5RA 4PMSA 4GKIA 2CGUA 4ANNA 3AC4A 4IX3A 2C0TA 4HOKA 4O7TA 1LPUA 2PZ5A 4A4LA 1KWPA 4JG7A 5BUJA 2W4JA 4FIEA 3A4OX 2OH4A 4RX5A 3OWLA 4LGGA 2RG6A 3R2BA 3D9VA 3E7VA 1Z57A 3SRVB 5IZFA 4YZ9A 2VWUA 3IGGA 3TT0A 2IWIA 1NT2A 3DK3A 3MN3A 3G90X 4M15A 3BYSA 3SW7A 3C7QA 5FUTA 4F6SA 3LZBA 4AXAA 5IQBA 3P7AA 1V0PA 3PZHA 1Q62A 3VRYA 3C4CA 4F0GA 5HU3A 4N57A 3KRRA 4K6ZA 3I0OA 3S4QA 1BUHA 4ZZNA 3KK9A 4FE2A 2JD5A 3ATSA 2XVDA 5JZJA 1OPKA 5IA0A 4ZMFA 5CASA 4LOQA 4MD9E 5AP0A 3AT2A 2QOBA 2R4BA 5DN3A 3VONA 4E4LA 3G5DA 2X39A 4YHTA 4YZDA 3WE8A 3OXTA 5HBJA 3LIJA 5CSPA 4BF2A 5KZIA 3HMPA 1Q8TA 4MEDA 3MH0A 4RX9A 4C37A 4XYFA 3HGKA 3R9DA 3D7TA 3FQEA 4MUQA 5CZHA 2XF0A 3GCQA 3GC7A 2BDFA 4AZFA 4O7SA 2BKZA 4YGAA 3C4WA 5KO1A 3BGPA 3H9FA 4O0SA 1SYKA 4CNHA 4TYEA 2C3JA 1U46A 5C8NA 2QU6A 4H3QA 4CFUA 3MH3A 2YIRA 2EVAA 3E3BX 4NT4A 2IJMA 4YJPA 3ZXTA 3FXZA 5D7AA 3QTIA 3ZEWA 3DBQA 4D5KA 3RBWA 4MNFA 1U59A 2HY0A 3EL8A 2JKQA 3I5ZA 3LCKA 3QTXA 2XAOA 2O63A 4LUDA 4XP2A 5CT7A 1PHKA 2W5AA 4KIOA 3KL8A 5DHJA 3KB7A 3QTWA 3TTIA 4EOOA 4FSUA 4QYGA 3R2YA 2JDOA 3DZQA 4W4VA 4Z7HA 3QLGA 3COHA 4Q5EA 3EZRA 3VBYA 2I7QA 3BL7A 2WKMA 2CNUA 2WQMA 3FY2A 2QOOA 3BRBA 4XBRA 2FB8A 2CHLA 3SXRA 2RL5A 4ZTMA 1QPCA 4RRVA 3HMMA 3P9JA 5FEEA 4BC6A 3H4JA 2JITA 2PULA 3C5IA 3KULB 3RI1A 2UW9A 3FE3A 3ZLYA 2B7AA 4H05A 2IG7A 2PUUA 4I22A 3EL7A 5JFVA 3UIBA 4AG8A 4FEWA 1UNHA 3VUIA 4QMYA 1PJKA 1ZARA 3BV2A 4PMTA 3GFWA 3Q60A 3BU3A 4MXZA 4FC0A 3ZRMA 1H00A 3LFAA 5I9VA 3CCNA 4QQJA 3DKFA 3A7FA 4LRMA 4QD6A 4DHIB 1B6CB 5IA3A 3OTUA 4DAWA 5IH4A 1H24A 3G6GA 2PVKA 3LFFA 4FKRA 3FSKA 2XARA 1FOTA 5EW9A 4FTOA 2DWBA 4DHZA 2PK9A 2F7XE 2I0YA 3GQIA 4FSZA 1UNLA 5EH0A 4EH6A 5T3QA 2BZJA 3CXWA 4OTFA 4X2GA 3T8OA 3VHEA 4EH4A 1JKKA 5FDPA 1PYXA 5CF4A 3FMMA 4TWOA 5E1EA 4AOIA 3W0MA 5L2SA 4L3JA 4YHJA 3QTQA 3ZUTA 3KF4A 3E7OA 2X6EA 5DVRA 5H2UA 3UOKA 3FMHA 2IEWA 4C33A 3R02A 3R22A 3FC1X 5GJGA 1ZY5A 2AQXA 2R3PA 4U79A 3V8SA 4LG4A 3IG7A 2XNOA 4XCUA 4AZSA 4WG5A 4B4LA 3AMBA 3FPQA 1JQHA 3OWJA 4BI1A 3WF9A 3NGAA 3FZSA 4KIKA 5AUWA 4BCIA 1SNXA 3QD3A 5AV4A 5EM5A 3DB8A 5H8EA 4EOIA 3FJQE 2BIKB 3KMUA 5GHVA 3EQPA 4U6RA 2W1FA 4L00A 2XIRA 5A4CA 4NKSA 4QMTA 3A99A 5HKMA 4IFCA 4KABA 3T9TA 4EC9A 4ZAUA 3TYKA 2RIOA 3FV8A 4GKHA 4EOKA 3PA4A 5DLSA 5GNKA 4YSMA 5EI8A 5FRIA 4X2NA 1H26A 1CMKE 2UZUE 2ZM3A 4FK3A 1P4FA 2NRUA 4ITIA 5EOBA 3WIGA 3WYXA 1KOBA 3H9RA 2JFLA 4S33A 4RZVA 1JSTA 4Y72A 4YO6A 2CGXA 3CQEA 2GQRA 4PTEA 4DG2E 5HVYA 1KE9A 4Y73A 4C7TA 3KGAA 4EQCA 1X8BA 1Q8UA 5CALA 3W2PA 1J91A 2YIXA 5CLPA 4ZIMA 1H28A 3ZUVA 4MXOA 2WMBA 1W84A 4WNPA 3EFKA 4UN0C 1YXTA 5A9UA 4BL1A 3DPKA 5CYIA 4C4HA 4L68A 3TKIA 3PG3A 4RIWB 5A14A 4YTIA 4QPSA 4RFZA 4XOZA 1GZ8A 3PY0A 3ORNA 3Q6WA 2BILB 4D4RA 4KRCA 4I6FA 1YXXA 3C4XA 1MP8A 1J7IA 2J5EA 4E4XA 4AXFA 2VNWA 3NRMA 4FKLA 4F0IA 5IH5A 1TQMA 2IPXA 3OUKA 4OTDA 1ZYDA 3O71A 2YLFA 3FHRA 4FYOA 3L9PA 4BR3A 2ESMA 3F3ZA 4S30A 2VWXA 4XBUA 4O0XA 3FLSA 2Y8OA 2CKEA 1BKXA 4E6AA 5GZAA 5K5NA 2CN5A 2WOTA 4GRBA 4LGDA 4MWHA 3NUNA 2R3KA 4Y85A 1OECA 5D12A 4FSQA 1T45A 4AW5A 5KMOA 3U6JA 4AE6A 3VS5A 4DEBA 3T3VA 3O50A 2CCIA 3EN9A 3LM0A 4GCJA 3WF8A 4ZMEA 4QYEA 4RJ4A 3DOGA 3IW8A 4O86A 2ZMDA 2UV2A 3D5UA 4RJ3A 4KWPA 4KNBA 4FT9A 2IF8A 5J9LA 3I81A 4Y5HA 2A19B 3QRJA 5AP3A 4KSQA 4UYAA 3R00A 4OGRA 2V7AA 2B9IA 2EUFB 2W1EA 3CR0A 4IZYA 4UMTA 3ZC5A 4C34A 1LEZA 4DDIA 1ZRZA 2OZOA 4M0YA 3CSVA 3GCPA 3BHYA 4WT6A 5HO8A 3R8MA 4FSYA 2QO9A 2OSCA 3IW7A 4TWNA 4EK5A 3BEGA 2PZYA 3HL7A 3PSDA 4BZDA 3IDPA 5IA5A 3B8QA 2BZHB 1E1XA 4FV0A 4LFIA 4NH1A 4UB7A 4XHKB 3UDZA 3PY1A 4G17A 5J7BA 4E3CA 5BVDA 3D7ZA 2XK8A 2Z2WA 4C59A 2OIDA 4ENYA 2JBPA 3ML1A 2HCKA 4B8MA 4W8DA 4UXQA 3T3UA 4IW0A 4HVIA 3LFCA 4CT2A 5LWNA 3V01A 5IQIA 5IKWA 3GQLA 4FKUA 5CENA 2ITUA 4BTFA 3PG1A 4ZSEA 4CT1A 3EQGA 3SVVA 4BDJA 4RWKA 3ZSIA 3M1SA 1OL7A 1PW2A 3NUUA 1TKIA 4JDHA 4MXXA 5KNJA 3A61A 4IJPA 1WVWA 5FD2A 1PXNA 4M97A 1BMKA 2OJ9A 4ZSJA 1Y57A 3KN6A 5CSWA 3TIZA 5FQDC 3LLTA 2WPAA 2XNEA 4OAUC 3HV6A 4E26A 4ORKA 4CZYB 4UWBA 5L8LA 3MB7A 2YFXA 3QQLA 1VLRA 4AT5A 1OKVA 2QKRA 2ITOA 4CFMA 4D55A 4BY9E 5JFXA 5CF5A 5HCYA 4AU8A 3G0FA 3NW7A 4W9WA 3PJCA 4PUZA 1JWHA 4F99A 4PTCA 3C13A 2R3JA 3KFAA 5J5SA 3NFFB 1GZOA 4W9XA 3AT4A 1XMLA 3PPZA 3R6XA 3MPTA 2FSMX 3L9LA 3KY2A 3ZZWA 3BLHA 3PPJA 4I6HA 1OB3A 2ITQA 4WA9A 4I0RA 4DN5A 4MQ2A 1DAYA 1FGIA 2WU7A 3LFQA 4X7QA 4O7NA 2ZMCA 3D83A 3R7VA 4FG7A 4CMOA 3EN5A 3GCSA 4I5PA 5FDXA 4X2JA 2KTYA 3ORZA 3WF7A 4YJOA 4GL9A 3ZO4A 5LVLA 1W82A 3D2IA 4IVDA 3NWWA 1P2AA 4Y8DA 1W83A 2FUMA 4QTAA 3MH1A 3WBLA 5EKNA 3VS7A 2HOGA 3VN9A 3TJDA 5I9WA 4AXDA 2PVHA 4L9IA 3ZUUA 3AKJA 1PF8A 4AGUA 3W0NA 2O64A 1W2CA 1NVQA 2JDTA 4YC3A 4AX8A 4DA5A 2XUUA 3BV3A 4FSMA 4BCMA 2OFVA 3DTWA 3KXHA 1AD5A 2WZJA 3LFDA 4FTTA 4PX6A 2OF4A 3LXPA 3T9IA 4EZ5A 4GEOA 3MFTA 4ALVA 5JMSA 3PUPA 4QP4A 2CNVA 4G3DA 4H3PA 5IDPA 3OBJA 3C4FA 1BI7A 3DLSA 2WFYA 2VNYA 5AA8A 5EHOA 4PV0A 5HTIA 2YDIA 4JBQA 4XS2A 4X0MA 1WBNA 4O1OA 2X0PA 3QTRA 3UG1A 5LWMA 5EDPA 3QKKA 4Z9LA 4UX9A 3PXQA 1Y8GA 3DAKA 4E6CA 2O65A 4JQEA 2EXCX 2X8IA 2XK4A 3LFBA 4KS7A 5LMKA 3GENA 4DFYA 3ZO2A 2A0CX 3SG9A 1E9HA 4MCVA 3THBA 3COIA 2W4OA 4NYEA 1BLXA 2VO7A 4R6VA 2JIUA 4AAYA 3LHJA 4O7ZA 2JKMA 2R3MA 4ONAA 4QRCA 3DDPA 2BHEA 4N6ZA 1U54A 2X6DA 2GNGA 3QX4A 3KREA 1W2DA 5EYCA 4YC6A 4GT5A 1PMNA 4QMXA 5DA3A 2UUEA 4L67A 3M2WA 4IZ7A 4QP6A 4X21A 3D0EA 2X0QA 5HLPA 4E5BA 3LKMA 4QMSA 2FSOX 3DDQA 3K3IA 1SZMA 2G2IA 4ASDA 4IM3A 4DTAA 2GS6A 2IZTA 3NYXA 4I0SA 4QNYA 3MA3A 4HGTA 4YJQA 2UW8A 5EM8A 2XKFA 3QZFA 4BDFA 2V55A 3HNGA 5HBEA 5C01A 4YO4A 2J7TA 3L9NA 1ZOEA 5LVNA 3HECA 5AR4A 4JG6A 4EOPA 1OGYA 2B0QA 3BKBA 2GTMA 3QGYA 3KRLA 5HLWA 1UV5A 3QQHA 4QP1A 4FUYA 4WO5A 2F7ZE 4XRJA 2QOHA 3C4EA 3UE4A 5LMKC 5HO7A 1XWSA 2DUVA 3PA5A 4MYGA 4O7RA 2WGJA 3DXNA 2YA9A 3OP5A 1WMKA 3PIXA 3R0TA 4LMNA 5BVWA 3R73A 3R7YA 4UBAA 4A9YA 5JGBA 1W98A 2VV9A 2CKQA 2WTIA 3AMAA 3QZHA 2FVDA 2WTVA 1FQ1B 1H08A 3R8LA 2YLEA 4DGMA 4HNIA 3UZRA 4GVJA 5EHYA 2XIKA 1PXLA 3DAJA 4TN6A 2XMYA 3RK7A 2J6MA 3AC2A 4QP3A 4BCFA 1QPDA 2YABA 4XV3A 3KXMA 2RFEA 3LXKA 4RWLA 5IUGA 3LQ3A 4JLCA 4QQ5A 3UGCA 2XKEA 4G3EA 2EB2A 4ZP5A 5CEOA 1ND4A 4FGRA 2UZBA 4IANA 4I93A 4FT5A 4MTAA 4CFXA 1SVEA 4ZTQA 3OW4A 4IAZA 5A6OA 5AV2A 2BALA 2HWOA 2A1AB 3VBTA 4C36A 3REPA 5C8MA 4UMUA 4YJUA 4BJJB 4APPA 2Y7JA 3EQRA 1OIRA 2F49A 1F3MC 2FYSA 1M52A 3A62A 1CSNA 1H4LA 1HOWA 1TQPA 2AUHA 1FVVA 2ACXA 4LV7A 1KE8A 3E87A 3C50A 3DKGA 3O7LB 3L1SA 4KBCA 1YOMA 3LCOA 4HYIA 4XMOA 5HVKA 4FSRA 3AD4A 3QC9A 4FKPA 4AE9A 4BWPA 1VZOA 2WNTA 1YVJA 3P23A 4L43A 2SRCA 4ZJJA 5IQHA 2VTAA 3DZOA 2W1GA 3C4ZA 4DT8A 4U3ZA 1LP4A 3QQKA 5DR2A 1P14A 5J9ZA 2HWPA 3SGCA 3COKA 3I60A 2OF2A 2W0JA 4IVAA 3V6SA 4I92A 2PUPA 4F9AA 4QDEA 1KUTA 4CD0A 3O8TA 4R1VA 4AGDA 4ZY6A 4MF1A 2XYUA 2Z02A 3F5XA 2B54A 3EOCA 2X8EA 3JPVA 2H9VA 2VU3A 2F2CB 4FX3A 4QP9A 4JX7A 3LMGA 5HGIA 2C6TA 3CPBA 4X2KA 5H9BA 4YJVA 2C1AA 3OCSA 1YI4A 5DR9A 3MVJA 5AUZA 5DYJA 3WIKA 5F4NA 3H0ZA 3D5VA 3HA8A 4R78A 5JK3A 2VTHA 2UW7A 4YTFA 4IC8A 5LCKA 4ALUA 2UW4A 2V22A 5HG7A 3KRWA 4X6RA 4ANSA 4EH3A 1L3RE 4RMZA 5M4IA 2PZRA 1WAKA 4O0WA 3QQJA 2ZDUA 1Q99A 5CQWA 4DINA 4F1OA 1NW1A 5IQEA 4AZVA 4FRFA 4RWIA 2P55A 4RJ7A 4O6EA 3ZCLA 2ETRA 4ZS0A 3O8UA 2R0UA 3NVMB 4QMLA 5F95A 4XRLA 2C47A 2QOLA 3VIDA 4NSTA 5HTCA 3NNUA 3OWKA 4Q5HA 3RM6A 3UP2A 4ERWA 4XOYA 2VX0A 4EQMA 3AKLA 5J5TA 4FF8A 2BKKA 2AYPA 3GU6A 2YZAA 3ZRKA 5CSVA 5E4HA 5J9YA 3QWKA 3GFEA 4X3JA 3A7IA 3DK7A 4K77A 2XNMA 3R71A 1Q8YA 4FV6A 3D7TB 4YZCA 3TV4A 3NYOA 3P5KA 5JQ8A 2IN6A 2VTOA 2XBJA 2UZNA 3ORMA 4NKAA 4QMOA 1BX6A 4ZTHA 4CYIA 4UEUA 5CI6A 2YZLA 3ID6C 4W4WA 1FPUA 2R3GA 3PE2A 5HHWA 4BZOA 1V1KA 1IA9A 3FHIA 1OUYA 2ZAZA 3UC4A 1NXKA 1PKGA 2WAJA 3IGOA 4IB3A 4XG4A 5HCXA 3BLQA 3HX4A 3FLQA 3VRZA 1A48A 3GC8A 1YHWA 2PY3A 4FI1A 2WTDA 5JGAA 2YJRA 2X8DA 2UZEA 5D41A 1TFFA 5I9UA 4O84A 1QPEA 5EYKA 4HVGA 4H1JA 3F3WA 5CI7A 4CTBA 1IR3A 1FVTA 1UU3A 3LFSA 3IDCA 4O38A 1PXPA 2RGPA 3KMWA 4F7LA 2X7OA 4DTKA 2RFNA 5IQGA 4M7IA 4NU1A 3W2QA 4EK4A 2R3RA 3VUGA 2YIYA 5HICA 4BTKA 4M12A 2CKOA 4B7TA 4B6LA 3AC1A 1KE6A 2PVYA 4DH3A 3VUKA 4AN9A 2X4ZA 3CKWA 4EJ7A 1YW2A 3ZS5A 3NR9A 3DCVA 4HCVA 3EIDA 4GV1A 1YI6A 2IO6A 1ZYCA 2QI8A 3RPVA 3NAYA 4GMYA 4EBWA 3SLSA 3WF6A 4TYJA 2W99B 5EM6A 3IW6A 4E7WA 5E8TA 3MA6A 4APCA 4HGSA 5DBXA 2OXYA 3VUTA 1MRYA 4FZ7A 3CP9A 4F1TA 5M55A 5FM2A 4YR8A 5JFSA 5EQPA 3RK9A 5EQEA 4YZNA 3N4UA 3FL5A 1SNUA 2QOCA 5D9HA 4D4SA 4F7NA 4OTPA 4TRLA 2C5VA 3PDTA 3HMOA 3CJGA 1JBPE 3F61A 2ERZE 5HIDA 5C8KA 3E3PA 4ZXTA 3TDWA 3GI3A 2I0VA 3DV3A 4ZSLA 2B52A 4UMQA 3QUPA 1XH5A 4KRDA 2UZDA 2XKDA 1OL2A 3Q9XA 5GZ8A 3CPCA 1O9UA 2OO8X 5M4CA 4O7LA 4R8QA 4BCKA 1XHAA 2QR7A 4Z16A 4DTBA 3IECA 3A7HA 2A2AA 2YM4A 2GNFA 3ANQA 5E9EA 5C4LA 3FBVA 2G9XA 2QOKA 1FBNA 3QU0A 1UU8A 2PVJA 3LXNA 4TTHB 3HV7A 4KBAA 5AWMA 3LCDA 5K3YA 2REIA 3R8ZA 3HV3A 1OZ1A 4TWPA 3TJCA 4C4IA 4EL9A 5I9ZA 3UOJA 2BUJA 1P5EA 3RPOA 3UG2A 1NVSA 4S2ZA 3D4QA 2CJMA 2EB3A 4FV9A 3DS6A 2BROA 4XG9A 5CVFA 5DE2A 3MY5A 3NNXA 3SX9A 3A8WA 5AIRA 3BLRA 3CY2A 4JIAA 2XK7A 4YU2A 4K0YA 3FWQA 1OUKA 1UKIA 1VR2A 4DCEA 3MGYA 3OY3A 3P08A 3DBEA 1OGUA 3Q2MA 4FTCA 2P3GX 2Z7QA 2YEXA 5K4IA 4RFMA 4CTCA 3D5XA 3Q4ZA 4FG9A 3RVGA 2ETKA 2FH9A 3A7JA 4LUEA 3HDMA 4JT3A 4D0WA 2R3FA 4Z3VA 5IH6A 3AGLA 5H3QA 3TNHA 2ONLC 3DK6A 5EW3A 2W9ZB 5L8KA 1RQQA 3P5JC 2YCSA 2J50A 2YM7A 3D94A 3FMJA 4HPTE 4IDTA 4JR7A 3WARA 3TMOA 4CKJA 4CLJA 2BAKA 3FLNC 5G6VA 3G51A 4FL1A 3DBDA 4QPMA 3OVVA 3W2CA 4DGOA 2HW6A 2O8YA 3IDBA 3AQVA 4D2PA 4AS0A 3M42A 4DEGA 4DLIA 3RM7A 4U9AA 4F78A 4F70A 3FY0A 4USFA 3SAYA 5CWZA 4W4XA 3PFYA 4FT3A 5BPYA 4B9DA 4K18A 2RFDA 5IEXA 4DEIA 4BIBA 3TUCA 4J52A 4EZ7A 5LVOA 2GPHA 1H27A 1J1CA 1CKJA 2C1BA 3GU8A 4D4VA 5HORA 2Q0BA 4KSPA 2GHGA 2QHMA 3Q53A 4RA5A 3MWUA 4L6QA 3EFLA 4QMUA 4UWCA 2R64A 5I0BA 4AA4A 5JSMA 4XH6A 4D9UA 3TNPC 5CU0A 3DFCB 2WMXA 4FKJA 2YN8A 2W5HA 3KXZA 3PXZA 4HZRA 4O4FA 4N4SA 4A9RA 3P4KA 4FEQA 1PXIA 3V6RA 4NJDA 5DR6A 3PYYA 2OIQA 4BDCA 2J0MB 5A54A 3E8DA 5HLNA 5JFWA 3O23A 3NVKI 3PP0A 3A7GA 4OAVB 3R1YA 4BGQA 2BVAA 3UTOA 3F7ZA 1FVRA 3BGZA 3RNYA 5CZIA 2OJIA 2RG5A 3BBWA 3BQCA 3UO4A 4RJ6A 2RKUA 5F9EA 5KMKA 4I21A</