3E93A

Crystal structure of p38 kinase in complex with a biaryl amide inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
350
structure length
346
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinase array design, back to front: Biaryl amides
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 111
structure length 346
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e93A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e93A01
2X7OA 2C6TA 1H0VA 3C4WA 3DBQA 3NUUA 3OC1A 3LIJA 4YNEA 4F9AA 4JLCA 4C3RA 4BZNA 2Z02A 1L8TA 4QMSA 1W7HA 4MF1A 3V8SA 3WBLA 3MWUA 4QTBA 4TYHA 4IM3A 4DTKA 1REJA 3E7OA 3A7HA 3C4FA 4B7TA 3GI3A 3BYMA 4K9YA 1S9IA 2BDFA 5J1WA 4V0GA 2YIRA 1WBTA 1WBNA 2GHLA 3LM5A 3LKMA 5ICPA 3Q52A 3NSZA 2NO3A 5CENA 2JAMA 1P4OA 4HVDA 4ALVA 3VS5A 4PTEA 1OIRA 3NNWA 5I3OA 3W2OA 2F2CB 4G9CA 4RWLA 2LAVA 4FEUA 4BI0A 4HYIA 3QZFA 2J5EA 5H2UA 5J87A 2WMUA 2JD5A 3HRCA 3MY1A 5CSXA 3EIDA 2HIWA 4AGUA 2VX1A 4JG7A 4RGJA 1F5QA 2ONLC 3MA6A 3A7FA 2CGWA 2F2UA 3ZXZA 2X8IA 5BQ0A 2ITTA 2OJ9A 4NL0A 3P4KA 1SVGA 3VUHA 4CQEA 4D0XA 5CU4A 2WTJA 1PKDA 5HVKA 2W1GA 3G5DA 4BDJA 2BROA 2XIRA 5CLPA 4L46A 2F4JA 2ZB0A 4ACDA 1FVVA 3NIEA 1KV2A 2VNYA 4YZDA 4EOMA 4IWDA 2IG7A 5KHXA 4GSBA 3ANRA 2R5TA 3CP9A 3IDPA 3Q4UA 2VTMA 5BYYA 1V1KA 1OKVA 3OW3A 4A7CA 4L7FA 2SRCA 3PPZA 3VQUA 2VRXA 2FO0A 3WF6A 3S4QA 4YBKA 3LXPA 3GU6A 5IQGA 4EK4A 2QO2A 3HV3A 3FWQA 5IA0A 3PXQA 4MYGA 3TL8A 3PXZA 4YGAA 1E1VA 4EHVA 3AT3A 4RC2A 5LQFA 3HL7A 3LM0A 3E7VA 4J53A 5HIEA 2BDWA 2OJJA 5AUUA 5J9YA 2YIQA 3LFQA 3ZO3A 3PVWA 5B0XA 4PTCA 3UQGA 4UMUA 3E8DA 1STCE 3R6XA 4LOPA 4BGQA 4QD6A 5M56A 4WRSA 1Y8GA 5HKMA 1JPAA 3GUBA 3PXKA 4ZY4A 1Y8YA 5IQCA 4Y5QA 1UNGA 3MIAA 5T6KA 5E8WA 4QNYA 5IU2A 4IZ7A 3VUKA 3TIZA 3IK3A 4LI5A 4LV8A 4BFMA 2OZAA 4J98A 4W4XA 4KRDA 3MESA 3PY1A 4EZ7A 5BNJA 4QMQA 2WEIA 2VTTA 2R3MA 2V0DA 4BTJA 4CCUA 1YHWA 1ZYDA 4FKWA 4H39A 3WE4A 1FMKA 3FLYA 4RFYA 4FTUA 4MH7A 2GQSA 3D14A 3FLNC 2R64A 5HLPA 3TXOA 3A4OX 1PXJA 4YSJA 4RVTA 1OKYA 1V0BA 4YNOA 4CRSA 2PE0A 4DE4A 2ZMDA 4QMLA 1MP8A 5CU3A 4QP6A 3ZLSA 2H34A 4ZZNA 2VX0A 4GFMA 5J9ZA 4E4MA 5HQ0A 3DNEA 4E26A 2PUIA 3MVLA 3FI8A 5IEXA 1DI8A 4ACCA 2QLQA 4KKEA 2W9FB 3ITZA 3QL8A 4U0IA 3QA0A 5TO8A 2VAGA 4QP8A 1IASA 2W96B 4F64A 3UP2A 4IVDA 4AQCA 2YERA 2X4FA 3IGGA 4D28A 1ZOGA 4EBWA 4NU1A 3I5NA 1J7LA 3F5UA 4O1OA 2W5AA 4WUAA 4FEWA 3SVVA 4DITA 1A48A 4PDSA 3C1XA 3ORLA 1O6KA 3K54A 1XH5A 2HZ0A 2XK9A 2WTKC 4C57A 3ELJA 4GT4A 4NUSA 3GOKA 2BPMA 1Q62A 3MB6A 4HNIA 4IFGA 3RNYA 3VBYA 4CFNA 2BAQA 5EG3A 4EBVA 4R5YA 4EONA 4HVIA 4Y72A 1AQ1A 2Z8CA 1H26A 5AUTA 2QI8A 1JSVA 3A99A 4UWYA 4YO6A 5M4UA 3BGQA 3VW8A 5ANEA 3Q6WA 4FIEA 3ZZWA 3SD0A 2PVKA 5M08A 1NVRA 2W5BA 3RAKA 4EQUA 2G01A 4ZP5A 3IECA 3Q53A 5E1SA 2CKPA 4BCJA 3LMIA 4O0WA 3UODA 3IOPA 4YZNA 3E3PA 5EI2A 2YACA 4HGEA 2EXMA 1JSTA 2QG7A 1ZYJA 5CXHA 5ETFA 1GZKA 3OEZA 3HA6A 5AR3A 3U9CA 5IDNA 3RPVA 5KKRC 3KA0A 1OBGA 3MA3A 4CG8A 5FTQA 2OXDA 3RK9A 1KOAA 3ZTXA 4BCQA 2PVLA 2O3PA 4EKKA 1DS5A 3OXZA 3BBTB 4AAAA 4ASXA 2ITNA 3UP7A 4FVRA 4YPDA 4DINA 3SRVB 3DLSA 5CEKA 4Q9ZA 3ZDUA 4EH7A 3QTQA 4TWPA 3AMBA 3VF9A 2XA4A 4L3JA 2YCQA 1FVRA 4FYNA 2CSNA 5JQ8A 1GNGA 2GNIA 3WE8A 5CF6A 5GIOE 5TKDA 3T9TA 2HZ4A 4ZSAA 5IF1A 3K5VA 3SDJA 3DKFA 2W9ZB 5DA3A 1YXTA 3LFCA 3JY0A 3GQIA 2CPKE 3R8PA 4G31A 5FXSA 2WGJA 3CGFA 4DH8A 4TPTA 2B7AA 4BCKA 4YZ9A 1DI9A 4ZTNA 4AW1A 5IA2A 3KRLA 4YP8A 3RK7A 4JG6A 5H3QA 3DXNA 3V5WA 4AOTA 2WQEA 2UW3A 3FY2A 2PHKA 3U54A 3O51A 4NTTA 3ACKA 5EHLA 4D9UA 2WD1A 3BWFA 2RF9A 4DEHA 2X6DA 2IZRA 4IX6A 2CLXA 5DE2A 5HX6A 4BRXA 5CEOA 1ZOHA 5K0XA 2UZVA 3E92A 5LMAA 5JEBA 3AD6A 3E64A 2UW9A 4ID7A 3UNJA 3BYOA 4FSUA 5AR8A 5CNOA 4C02A 2XS0A 3E63A 4O38A 5M51A 5GIPE 3LE6A 4YTCA 4PNKA 2ZDUA 3HMMA 3MSSA 2CCHA 4FK6A 4TNBA 5D7AA 2XYNA 3ZEWA 3A8WA 3EQFA 4KIKA 4RLKA 3UNKA 2J9MA 4EQMA 4DTBA 2CMWA 3KC3A 3MGYA 4Q9SA 4V04A 5FEDA 3T9IA 3GP0A 2YLFA 1WVWA 3BQCA 1M2RA 3UDBA 1XH8A 2WMBA 4FBXA 3R1QA 3OS3A 1OPKA 4QQJA 3B2WA 4EH6A 5I9YA 3DS6A 4OGRA 4EH4A 3ZRLA 4CFFA 1J91A 4QP1A 3HYHA 3EQDA 3QA8A 4NSTA 2CLQA 5JN2A 4X6QC 2JIUA 5EM6A 4F7JA 4EH5A 4I6QA 5AP7A 2E9PA 5HE0A 5IH5A 3PJ8A 3NCGA 3QWJA 2J0IA 2BR1A 4EH9A 4RX5A 4FODA 4EZ3A 5M4CA 4RC3A 4FTTA 3LZBA 4F1TA 3T3VA 4ZTLA 1PMVA 4UN0C 2CDZA 4PPCA 4PDPA 2OF2A 4GKHA 4H3BA 5D11A 5HCZA 4JIAA 4Y73A 1XHAA 3R00A 5CALA 4O7ZA 5C4LA 4J52A 2EB2A 4K2RA 3VS7A 2GNGA 5E4HA 2KTYA 4FEXA 2WTIA 2A4LA 2QVSE 4LQMA 1GOLA 4LYNA 1P2AA 2XNNA 3BEAA 4HOKA 3I6UA 5ANDA 1HCKA 3FKNA 3V6RA 3PP1A 2FUMA 3IONA 3UG1A 4NH1A 3PIXA 3H30A 4FUYA 2QKRA 4U79A 4C3PA 2C6OA 2IWIA 3GENA 3HV6A 4TWNA 4FEVA 2JITA 4C2VA 3R2BA 3QKKA 5LVPA 4MEDA 2IZTA 2J5FA 2JFLA 5ANGA 4N6YA 5IEVA 4J96A 4GFOA 2ZB1A 4WIHA 5BVWA 4F70A 2FA2A 3DFCB 4XP2A 2R3NA 3EJ1A 3C9WA 4FIFA 3ZLYA 1IRKA 4I41A 5HNGA 3KXGA 3QQUA 4IAAA 3NUPA 1YRPA 4YC6A 5GHVA 5A46A 1VYZA 2CNQA 3CQUA 3C50A 3KMWA 4FSWA 2QU5A 4YLKA 1HOWA 3C4EA 4OR5A 3FKOA 4NJ3A 2YM7A 4CZYB 4FOCA 1YXUA 2WMAA 3F3VA 4U9AA 5I4NA 1JNKA 3ROCA 2GCDA 4BCMA 5AV1A 5L2TA 1M17A 2VTSA 3QTRA 4XEYA 5HU3A 1TKIA 5F1ZA 4ZXTA 4XG6A 3HZTA 2X1NA 3RPOA 1OBDA 2HYYA 4I3ZA 5BYLA 2B9HA 5DMZA 1B38A 3DKCA 4NJDA 1K9AA 1RQQA 5J5TA 1YHSA 5JRQA 5HEZA 2JKOA 2WFYA 3NWWA 3EL7A 5FM2A 3F7ZA 4FSYA 3PVBA 4ORKA 4TT7A 3M1SA 2OXXA 2JDRA 4IMYA 3FMDA 4XH6A 3BHYA 4IANA 4WO5A 1W82A 4CKRA 2UW0A 5I9VA 4ANQA 5KNJA 4J1RA 1WBWA 3S00A 1JAMA 3LVPA 3NYXA 4HVGA 5A54A 3GU5A 4B6LA 5HTIA 1FBNA 3GU7A 3PDTA 2I0EA 4FTNA 3QRIA 2E9NA 3O96A 4JIKA 5M07A 2P2IA 5EI6A 1JWHA 3O50A 5AUWA 1VEBA 1OM1A 2X0GA 3ULIA 4PUZA 4F0GA 3HV5A 2HXLA 4FG7A 4DF3A 2QOFA 2PUNA 2ESMA 1ERKA 3UO4A 4F9YA 2ZM3A 2PZRA 2OWBA 4LFIA 3VBQA 3QKLA 2PZYA 5JH6A 4CFUA 4W9XA 1PYEA 4GFGA 3LXNA 1OL1A 4DEAA 5AUYA 3UOLA 5JGDA 2GQRA 4DBXA 3W2PA 4WNPA 5EW3A 3NUAA 3LJ2A 5BMMA 4KS8A 4F6WA 2X7FA 2W05A 3JPVA 2QOIA 4R3CA 5CQUA 5IUHA 4DG3E 4AA5A 3EHAA 3QF9A 3DAEA 1JKTA 1H07A 4RSSA 4JQ7A 4XUFA 3RNIA 4EHGA 2W99B 4EKLA 4O1PA 3II5A 4E7WA 3AD4A 4OTFA 4PL3A 4NKAA 4XOYA 2GNFA 4ZLZA 4EJNA 4HJOA 4IAIA 4AGWA 1UA2A 3QAME 4S32A 4S2ZA 5CSVA 4H3PA 3FHIA 1LPUA 1PRYA 3FL5A 4D5KA 3DPKA 1TQMA 4NCTC 3PJ1A 4BHNA 3U55A 3QUEA 5JFSA 3BLQA 5AV0A 1GZOA 2W4KA 4L44A 3C4CA 2VV9A 1WMKA 2C5OA 4NM7A 4DH1A 3FV8A 2BZJA 1IG1A 1HCLA 4LGGA 4TXCA 3MTFA 3WOWA 4F7LA 1A06A 5DG5A 4KSQA 3NR9A 3U4UA 2X8EA 3ZC6A 3HX4A 4AW5A 3TUBA 3ZFYA 5BVFA 4ENXA 1O6YA 2XK7A 3NIZA 4FTCA 1NVSA 5GZ8A 4DFZE 5KMJA 3DCVA 4DT9A 5FD2A 2XJ1A 3WI6A 2JKKA 3HUBA 3Q9WA 3GFEA 4FL3A 3Q9XA 1G8SA 1YXVA 2QOCA 4QQCA 4EZ5A 2PMLX 4UMPA 4GU9A 5CVFA 1LR4A 2PUUA 2QHNA 5FBOA 3TNQB 3H4JA 4MXOA 3UYTA 3FZOA 4C4HA 4O86A 3SLSA 4B4LA 3C51A 2B1PA 4O0TA 5CEPA 5HTCA 3FUPA 2Y8OA 4R7IA 5B7VA 3OCGA 2IN6A 4CZTA 4JAJA 4V0GB 5FG8A 5LWNA 2AYPA 4FNYA 3UIMA 4ANSA 4HYUA 4S30A 5K5XA 4RIXB 3PZHA 2C6KA 4FTMA 2FH9A 2GFSA 5JT2A 1NXKA 2CN8A 1PW2A 3BZ3A 1VR2A 2F7XE 1CKPA 5HNBA 3FLQA 3ZZEA 3L9MA 1IA9A 4I0RA 4IXPA 3EKNA 5K4JA 5A3XA 5JGBA 2C47A 3CTHA 3FEGA 4CFXA 3OUNB 4M13A 1GIJA 3JVSA 4CKIA 2ITWA 4M8TA 1XH7A 2PVYA 3KXMA 4IM0A 4JBVA 4R7HA 5EM8A 3WF7A 2ZM1A 3HDNA 4KD1A 2VWWA 5FRIA 5ACKA 2OKRA 4HGTA 1ZMWA 3OTVA 1R0EA 3CKXA 3NGAA 5CVHA 3QXOA 3TDWA 3E8CA 3ORXA 3OOMA 5HO6A 4RIWA 4O6LA 2JIIA 2GQGA 4U40A 3QCYA 4JX3A 4XYFA 1G8AA 3BU3A 3W1FA 1JBPE 3KN5A 4WNKA 1KUTA 1WVXA 4EYJA 2UZNA 2OLCA 2WTWA 3W8QA 2BALA 3AC5A 3OY1A 4BCPA 2C3JA 2Y9QA 4MBLA 3OCTA 2GMXA 4KIQA 4IB1A 3SXRA 2H6DA 3MVHA 4JG8A 3MIYA 4FVPA 4NT4A 4EOOA 4Y8DA 4O7SA 2GNHA 4TRLA 2UW6A 3ZLXA 4C0TA 2QG5A 4C3FA 5JRSA 3RMFA 3TV7A 1UWJA 3DBEA 4C4FA 2XNMA 3F2RA 3ALOA 3QD4A 3QKMA 3P1AA 5C1QB 5D12A 5L2QA 4FNZA 2GFCA 2QCSA 4M0ZA 2OFUA 4G34A 5JFXA 2QOHA 2C5VA 5KO1A 1JOWB 2JKQA 4ZSGA 4KSPA 5BVDA 4DCEA 2VGOA 4UY9A 2Z60A 3BWJA 3QHRA 3QQFA 4IX3A 4ALWA 4LRJA 1XBCA 3CJGA 4PL5A 4RWIA 3BHTA 2GSFA 2BRBA 5IEYA 3ATSA 4QNAA 3CTJA 2PZPA 3R71A 4OTGA 4Y46A 5GZ9A 3HGKA 5I9ZA 5EK7A 3BKBA 4L9IA 4WT6A 3DBCA 3JY9A 4J99A 2QODA 2PMOX 2BAJA 1CKJA 4ZTRA 3MB7A 3NW5A 4AXAA 2GS2A 4RJ7A 4EWHA 2GDOA 1B6CB 1ZYSA 3IGOA 2PZ5A 2UZUE 2YDKA 3KXNA 4W4YA 4RG0A 1RJBA 5IQBA 3JUHA 2QD9A 1H01A 4J71A 5DR2A 5J1VA 3P9JA 4J7BA 1J1BA 2FB8A 5HBEA 2V5QA 4BIEA 2F9GA 4GMYA 2XK8A 5E8XA 4CSVA 4H3QA 1PHKA 1PMEA 2OH0E 1G3NA 4YJRA 5FQDC 3SRVA 4BVUA 3VQHA 5JKGA 3TNPC 4QYYA 2GHGA 1T45A 3FZ1A 1H25A 4X2FA 4BYJA 1Q8YA 3Q9YA 3W16A 1OL7A 2JFMA 3HUCA 5EYMA 3CLYA 4QQTA 1H1RA 4F1MA 3OBJA 4AZWA 4OTHA 1T46A 1G5SA 2VX3A 4USFA 4PRJA 4R1YA 5HO7A 4U8ZA 3UPZA 5LARA 4GW8A 3HECA 2VTQA 3KU2A 4FYOA 3IOKA 1U59A 3QC4A 4O7RA 4KIKB 3DXQA 1YOMA 3ZBFA 2OFVA 4D4VA 1H1QA 5IPJA 4NK9A 1PXNA 5KBRA 3AOXA 4FVQA 4YJTA 4GCJA 3GC9A 5F94A 1ZZ2A 2B9JA 3D7TB 3FI4A 3O8UA 1XBAA 3OMVA 2I0YA 3P0MA 3RVGA 3ZM4A 4IC8A 3LLTA 4QT1A 2YWVA 1XH6A 4JI9A 4M69A 5AJQA 3ZLWA 1H00A 3UMXA 1Q3WA 4ZEGA 2BIYA 2QO7A 3AG9A 3UYSA 3C13A 4K0YA 4L67A 4YTIA 4XNEA 3NRMA 5EH0A 5IQHA 4RVMA 1Q8TA 3U6IA 2FYSA 5CS6A 2XIZA 2W1EA 4D1ZA 4IFCA 4JS8A 4OBOA 2WZJA 4QTAA 2OG8A 5F4NA 4EOIA 4O96A 3B8QA 3KN6A 4AGCA 4FMQA 1QPJA 3OT8A 4PP9A 4IAYA 1MRVA 4FICA 2IVUA 4RX7A 3C0IA 4IDVA 4P7EA 2YIXA 4NIFA 4PL4A 4AT4A 4L8MA 5K3YA 2OIDA 2WTDA 3KCKA 1WAKA 1DAYA 3B8RA 2YABA 3F61A 3ZFMA 2B0QA 4DH3A 4IAFA 4LL5A 4ZK5A 2V7AA 1JKKA 4E20A 2C5YA 4F7NA 1XKKA 2DYLA 2WNTA 4ASDA 4MAOA 4HVHA 5BMSA 4PPBA 4QMNA 4L3PA 3PXRA 1MRYA 3V8TA 3GCUA 5L2SA 3DAKA 4N6ZA 2XKEA 2ZV2A 3REPA 2UZTA 4GYGA 5HIBA 3EFLA 5K0KA 5B2KA 2QOLA 1OL2A 2YITA 3RINA 4H05A 3GFWA 3QUDA 2C5XA 1QPDA 3MY0A 3BGZA 3PXYA 2O64A 2J90A 4CFVA 4FA2A 2YISA 4XX9A 2J0JA 4YC8A 5IQIA 3HV7A 1OL5A 2UW8A 4UMTA 5EDPA 1H27A 1F3MC 3BCEA 2BFYA 4EHZA 3EQRA 2J4ZA 2GU8A 4PP7A 5AR4A 5LCKA 4BI2A 1PY5A 4GK3A 2OW3A 5CI7A 3F5PA 1S9JA 3R7GA 4YPSA 3I0OA 4MXZA 5IQEA 3IDBA 5M57A 5TR6A 3JVRA 4E6CA 1GY3A 4RFZA 2WKMA 2AC5A 2R3LA 3FPMA 4G6OA 4BHZA 5CAUA 4HZSA 3TNWA 4FV6A 3LJ0A 4J97A 3HEGA 3UJGA 3TZ7A 4JVGA 3WILA 4DH7A 4KABA 2XKFA 2PVJA 2WELA 4BIDA 1OIUA 2W1CA 5CT7A 5DEYA 4EOLA 5I9WA 2J50A 4QMPA 4XV1A 4ZSLA 4EH3A 2XH5A 1YI4A 4NFMA 1MQBA 3RPYA 3VWAA 4FOBA 4BCIA 4KA3A 2O65A 4PMSA 1ZAOA 3KCFA 5AM6A 5ETIA 3QBNA 5C03A 4EL9A 3G9NA 4FV4A 4OAVB 4I0TA 3COKA 4L00A 4U7ZA 3TM0A 1GIHA 2X8DA 4N57A 4JX7A 2PWLA 5AADA 3SAYA 3FQHA 2G2FA 4QP4A 3KULB 3DAJA 3R9RA 4LOOA 5E8UA 4WNMA 3CIKA 4CNHA 3GBZA 5IA4A 1UWHA 4RVKA 2YHVA 3NAXA 4OTQA 1DAWA 4EK3A 1YHVA 3ZMMA 3RALA 5E7RA 2B9IA 3FHRA 4FK3A 3W32A 3TT0A 1OGUA 3ZRKA 3OHTA 5G6VA 3QZHA 4HGLA 4LOQA 4QMOA 2XJ0A 4X2JA 4MWIA 3OOGA 3IDCA 2XEYA 2R3KA 3QTIA 4MHAA 4OUCA 1QPCA 2R3PA 2C6LA 5CNNA 3DLZA 5GJGA 1BI8A 4F9BA 1IR3A 3F3ZA 4XCUA 4JRNA 3COMA 4FV7A 1Z57A 4RVLA 4V01A 5J7BA 5E8ZA 2VNWA 4XV9A 3FMJA 3P23A 3W2QA 4XV3A 3Q60A 4XHKB 2FSOX 4IJ9A 5AA9A 4X3FC 1H1PA 2WIHA 4QOXA 4Z16A 2OIQA 5KZ0A 2V7OA 2ITZA 2ZMCA 3BGPA 3QYWA 3WF8A 4DT8A 4RLLA 4FKLA 3G0EA 1P5EA 3CD8A 4CMUA 3FZSA 3TZ8A 2Q0BA 3TV4A 4C2WA 4N0SA 3ERKA 4MD8E 4N70A 4JBQA 5ANIA 4JQEA 2HOGA 4GK2A 2PVFA 3EFKA 5ANJA 4X3FB 4TYEA 4O7YA 4U81A 4WSQA 2UV2A 3NS9A 2QR8A 4K8AA 5HG9A 4FTLA 2PU8A 5LMKC 1RDQE 4YJSA 2PMNX 4RIWB 5HHWA 4J95A 1O9UA 2CGXA 5AV3A 5FDPA 3Q2JA 2PSQA 3ALNA 3ZFXA 2BKZA 3PP0A 3RM7A 3QZIA 3OROA 4QP3A 3MH0A 4XMOA 3RKBA 3SC1A 4D55A 2R3FA 3FBVA 1CTPE 3Q96A 3ZM9A 1QPEA 3L1SA 3TNIA 1Q8UA 3V04A 3C5IA 1LEWA 3AQVA 5IA5A 1J3HA 3ORPA 3DU8A 1QL6A 2E2BA 2QLUA 2VTRA 4O84A 4U44A 4GVAA 3ZUUA 3R28A 4LRKA 3EN9A 3S2PA 2PPQA 2FGIA 4R1VA 4QPMA 4APCA 4AW2A 3PJ2A 3OFMA 3HMPA 4EOQA 4JDJA 1H08A 2YAKA 4EK5A 3E8NA 3I79A 3MBLA 5EYCA 3CY2A 4E6DA 5EKNA 4B8LA 3FC1X 2CGVA 3POOA 4RIXA 4CYIA 1M7NA 3WF9A 4ZAUA 4Q5EA 3SG8A 5JSMA 2NPQA 3GEQA 5FM3A 4ANNA 3CS9A 4ONAA 5H8EA 4R6VA 3V5LA 4O22A 4R7BA 5CSHA 5K9IA 3CTQA 3KMMA 3SHEA 3AC4A 3HV4A 4ITHA 2PK9A 2UZOA 2Y4IB 2Z2WA 4FSRA 1ATPE 3C7QA 4D2RA 2CKOA 3M42A 3KQ7A 2GS6A 4C33A 4AZEA 1YXSA 4ZLOA 1JKSA 2ITOA 5DPVA 2QU6A 2VWUA 3LFSA 3NNUA 3NW7A 4ZJIA 2QC6A 3BRBA 4BGGA 2P4IA 4DEIA 5DI1A 3VS1A 4MF0A 2J0KA 4RZWA 1UKIA 4AA4A 4BKJA 4ITIA 5HLNA 2QURA 3ZO2A 3D83A 4GIIA 5DR6A 2QONA 5KE0A 2F7EE 3VVHA 4E6AA 4BY9E 2A1AB 4FT5A 3TN8A 5GJFA 3P08A 3MS9A 3MH1A 3VUIA 4HVSA 3DY7A 3FL4A 3QYZA 3QGYA 5LJJA 2YDIA 3BV3A 4C8BA 2W1FA 3AT4A 3N9XA 4MBIA 2C30A 3R21A 1PXMA 4FKUA 2ZVAA 2QOOA 4JDKA 3DZOA 2YCSA 3GT8A 4QMZA 3NAYA 3H3CA 4EOPA 4RA5A 3A61A 3ZO1A 3FQEA 3TJDA 5A4TA 5KBQA 4GS6A 4BWPA 4P4CA 4ZY5A 1P14A 2ZV9A 2VGPA 4FTAA 4G16A 4KIPA 3VS3A 1XBBA 1TQPA 3QX2A 4O2ZA 5A4EA 4F09A 4IX5A 3D2IA 3RTPA 3VHKA 4I92A 3PSCA 4IQ6A 4DFYA 3ZS5A 5CVGA 3WZUA 2BAKA 3COHA 4AUAA 5HCXA 3Q5IA 2XNGA 5DVRA 3UMWA 2QO9A 2W7XA 3ID6C 3NUNA 4FKIA 5KMNA 3ZDIA 4DFBA 1H28A 4U3YA 4BDIA 5L8LA 2ETRA 4HW7A 4AU8A 3PIYA 4YO4A 2XP2A 2ZV7A 4D4YA 1YDSE 3D4QA 3P7AA 4O0RA 1LEZA 4AN2A 1PF8A 3S1HA 3S95A 3R9NA 4AOIA 4MXXA 3EN5A 3EN4A 4FZ6A 3LCKA 2E9UA 2OBJA 4M66A 4NWMA 4R8QA 2PUPA 3PSDA 3A60A 3OZ6A 5AA8A 4CT1A 3FZTA 3KVWA 4KBAA 3CXWA 3GB2A 3BU6A 4IVCA 5F20A 4XOZA 3BYUA 1OL6A 5HVYA 4A4LA 3MPTA 2P55A 4UMQA 5EQYA 4LMUA 2IVSA 2YM8A 5ETAA 4BCHA 4DFLA 3FXXA 3WIKA 4ZSEA 4ENYA 4ASEA 2IPXA 4WA9A 2YA9A 3HMNA 5DRBA 1NW1A 2LGCA 2RGPA 3FMKA 3O23A 4EJ7A 3VF8A 3DKGA 5L3AA 2P2HA 2BHEA 4MD7E 1M2QA 1UU8A 2WHBA 3DDPA 2X2KA 2RG6A 4ITJA 3H0ZA 3SOAA 4C7TA 2VWVA 4AZVA 5DBXA 4CTBA 4IC7A 5I5ZA 3RHKA 3KXZA 5T3QA 5AAFA 4JNWA 3OWPA 2PL0A 1XR1A 4FSMA 2E9OA 2C6EA 2P33A 4IWPA 4RJ4A 3TKIA 3O8PA 1XO2B 5LOHA 4H36A 3QCSA 5A4QA 2BILB 2XK4A 3PJCA 4KKGA 4A4XA 2IW9A 4UALA 5AUZA 3WYXA 3NEWA 5AX9A 1BYGA 4FR4A 5E92A 2OXYA 3PRFA 4F99A 4FT9A 2OH4A 4M67A 3FXZA 2ITUA 2G15A 2QNJA 3KMUA 4BDDA 3G6HA 4L01A 3N4TA 3OWLA 4FL1A 5ETCA 2OGVA 3AC8A 4IB3A 5G1XA 1FMOE 3EOCA 4LRMA 4DFNA 4FV1A 4B0GA 4X6RA 3DJ6A 2ETMA 1W84A 4NM3A 3PPJA 2XNBA 4W8DA 1L3RE 2YLEA 5DWRA 4FE2A 2H9VA 4ZJVA 3Q6UA 4G5JA 2I1MA 4D1XA 4M97A 3UC4A 3ULZA 2XRUA 3R01A 2B9FA 3HRBA 3VBXA 3EB0A 3QQKA 3F3TA 4KNBA 4OTPA 4UMRA 4Z9LA 5LVNA 4AS0A 2VTLA 5E8VA 4A9YA 3QLFA 1CKIA 4IX4A 4FT7A 1KOBA 4KUJA 3IW5A 1Q99A 5C01A 3WZJA 2WO6A 3NNVA 4QTDA 2R3OA 3GC0A 5FLFA 3HP2A 3W18A 4YZBA 1JQHA 4FTOA 1IAJA 4HCVA 3LCDA 3P78A 4GUEA 4L43A 1SM2A 1NY3A 3B2TA 5DHJA 4U3ZA 1GZNA 3LCSA 5A6NA 5IMXA 3NUSA 1Q8ZA 3QFVA 1Y57A 1Q8WA 3PFQA 5LCJA 2XVDA 3OUKA 3LFAA 4BGHA 3L9LA 4XJ0A 4DFUA 2YWPA 1SNXA 4TYJA 3RBWA 4R78A 3BHVA 3FMHA 3ODYX 3FDNA 4UX9A 4QYFA 4R77A 4XG9A 4BKZA 1SVEA 1ZLTA 1ZMVA 2R3RA 2JDTA 2XK3A 1A9UA 4ACHA 3LQ5A 3O7LD 4RZVA 3F3WA 3QD0A 4E4LA 2P3GX 3R04A 4QYHA 4AE6A 3NX8A 2I7QA 2EVAA 1TVOA 2CCIA 4NM5A 3U87A 3JYAA 3VRYA 2QR7A 4MQ2A 3ODZX 1ZARA 4BWXA 2Y7JA 5E90A 2ITVA 3SA0A 2G2HA 3FZPA 2FVDA 2IZUA 2WTVA 3KF4A 3P5KA 4X3JA 3ZXTA 5L8KA 4YBJA 1YXXA 1AGWA 4L68A 1M7QA 3P7CA 4L52A 5M09A 2RFDA 5TF9A 2WTKB 4F08A 4ZMFA 4FSTA 2X9EA 4GT3A 4RT7A 2YEXA 4FKQA 5HX8A 3RCJA 4TYIA 4TY1A 1ZY5A 3O0GA 1U46A 2R3HA 3UOKA 2YM6A 3FC2A 4NEUA 1ND4A 2IVTA 2W06A 4FV8A 2JLDA 4BDCA 5HBJA 5FWKK 3VJOA 4AOJA 1NT2A 3G6GA 2XZSA 2R9SA 3FY0A 5HE1A 4AE9A 1GJOA 2C69A 3U51A 3R8LA 5IKWA 2VTHA 3F3UA 4BDFA 2PULA 4CV9A 4FV2A 2VTIA 4I94A 3LPBA 3LCOA 4NW5A 4FNXA 4HGSA 1E1XA 2EXEA 3ZU7A 4YHTA 4IE9A 4ZY6A 4TL0A 5IUGA 1YI6A 3DZQA 3PE1A 5FGKA 5FTGA 3TJCA 1XJDA 3D9VA 3GC7A 4M84A 3LXLA 1KE7A 3JS2A 5EW9A 5BYZA 3QX4A 4C58A 1PXPA 1UV5A 2VO3A 2BCJA 5AP4A 1VJYA 4CD0A 4D2SA 5IG1A 1MQ4A 5HI2A 4LGDA 5JZJA 3NDMA 1XWSA 1GAGA 5EKOA 1OI9A 3H9FA 2J0MB 3QTXA 2Z7RA 1Z9XA 4E3CA 4GVJA 4FF8A 4ZSJA 4OTIA 1NA7A 3ZOSA 1WBVA 3R7UA 3VC4A 4DGNA 4G17A 1U54A 4V05A 1FOTA 3FLZA 5M4IA 4AACA 4FKJA 4UV0A 3VAPA 2HCKA 3GCVA 5CQWA 4TTHB 5B2MA 5HOAA 1APME 1UNHA 1IEPA 4X2GA 2XCKA 3D94A 1ZY4A 5JMSA 1OZ1A 3KXXA 5KKRB 5EI8A 2RFEA 5TT7A 5KZIA 4UYAA 3R8UA 3ZRMA 3QD2B 5HESA 3QQGA 4A4OA 5J7HA 3UZRA 4FL2A 2HY81 4FZDB 3LFEA 3NUXA 3FJQE 2XNOA 4E4XA 2JEDA 5KHWA 3VBTA 1SYKA 4JDIA 2W0JA 3V5TA 4ERWA 4O82A 4EC9A 4FTIA 3KF7A 5HE3A 5F9EA 4ZIMA 3KGAA 5C27A 4XV2A 3M2WA 4DEDA 4RWJA 4FX3A 4CXAA 3R8MA 3MH2A 3ORMA 4BWKA 2X9FA 4I1ZA 4JDHA 4RJ6A 2NRYA 4QYGA 5IH4A 1YWVA 2ZDTA 1Q4LA 2EB3A 4L6QA 1V0OA 4FIIA 4O0YA 4U42A 5IQDA 3R7YA 3EKKA 3TACA 3ATTA 5HBHA 3UE4A 5KMMA 2B53A 4G5PA 3V5QA 4EHEA 3CCNA 4L42A 4WG3A 2B4SB 2YM3A 5AAEA 4RMZA 5EOBA 3GCSA 3BU5A 4DAWA 4IVBA 4JT3A 3GCPA 3AXWA 4GYIA 2J2IB 4TYHB 2WMVA 4FZAB 4UWCA 5HGIA 3ENHA 4P90A 1YDRE 1OUYA 3VN9A 5DYJA 3A8XA 2ZJWA 4I4EA 4IWOA 5CASA 4CKJA 3MFTA 4MVFA 3HP5A 4A9TA 5KMLA 2OZOA 3VO3A 5LWMA 2PVMA 3OTUA 2REIA 1SMHA 3FE3A 3WYYA 4A9RA 5JQ5A 1SZMA 1ZWSA 5E9EA 4D2WA 4U5JA 3W8LA 5A4LA 5C4KA 4QP2A 2XK6A 4FT0A 4BTFA 4TYGA 3FQSA 5AMNA 2W1HA 3A7JA 3UNZA 4OT5A 4C38A 3EQBA 5IQFA 4IZYA 2ZYBA 3TTIA 3O17A 3OVVA 3A62A 2QOBA 3BX5A 3R1NA 3RAWA 5M55A 5CTPA 3F66A 3GC8A 5KMOA 3U4WA 4FV5A 2XM8A 2ZOQA 3O7LB 3UQCA 1YWRA 2O0UA 3VS6A 3FLWA 3I1AA 2XCHA 4S31A 4BCOA 3EYHA 4XS2A 2F7ZE 4E5BA 4BZDA 3ORIA 4RRVA 3V01A 4EC8A 3CEKA 3CQWA 5DGZA 4D1SA 2J7TA 1U5QA 4M3QA 2OIBA 4YSMA 3ZSGA 4EK6A 3QGWA 5A4CA 4CQGA 3MVMA 4HYSA 4IJPA 2Z7QA 2ITYA 2R3JA 4K33A 4KBKA 1JSUA 4G3DA 2R3QA 5HIDA 3U9NA 4WBBB 4E93A 3HKOA 1OPJA 3HA8A 4QP9A 4XBUA 4QMTA 5AP3A 3IS5A 3VIDA 2QKWB 4PX6A 3R7EA 3Q04A 2UUEA 2G1TA 3EWHA 4IEBA 4MD9E 2JC6A 2CNUA 3DDQA 5H8BA 2HK5A 4OLIA 1P4FA 1OECA 3ORNA 2H8HA 3KY2A 3RPRA 3DQXA 2O2UA 3EQCA 4QO9A 4XRJA 2XIYA 1URCA 4M69B 5LMKA 3FMMA 3BIZA 5DT0A 4DH5A 4O7VA 1JKLA 3VRZA 4KIOA 4C4GA 4MNEA 3QLGA 4IWQA 4O0VA 5CYIA 5E91A 2HW6A 5AFVA 1JLUE 2XBAA 4CT2A 1CDKA 2CJMA 2HWOA 5HD7A 4UWBA 1BL7A 3F5GA 4MWHA 2JDVA 5J9LA 5GNKA 3R8VA 5FDXA 5I9XA 4CLIA 5EM5A 2CN5A 1SNUA 3QTSA 2X39A 3NZ0A 4X3FA 4RJ3A 5EHYA 4APPA 4G3EA 4O7NA 2C3KA 2AUHA 3RAHA 4Q5HA 3BEGA 2VUWA 4CEGA 1X8BA 5JFWA 2DS1A 4KWPA 3RWQA 4AT5A 3BLHA 3ROYA 4BCGA 5LVLA 3OXTA 3RZBA 3PIZA 3LXKA 2WU6A 3PVGA 4L3LA 4LV5A 4XG2A 2BZHB 2JAVA 5EYKA 3TG1A 4EH2A 3K3IA 5AR7A 3W2SA 2VU3A 1UU9A 1I09A 2PTKA 2WMRA 4C62A 4YR8A 1J7IA 1Z5MA 1H24A 3MFUA 4KB8A 4KRCA 5FBNC 3SXSA 4YJNA 3W2RA 3QRKA 3VS4A 1QCFA 5L6PA 2PY3A 1KE5A 5CWZA 3VHEA 4DN5A 4IBMA 3D7ZA 2WMTA 1NVQA 3HNGA 3NNXA 3PA5A 3HRFA 3MW1A 4BBFA 3FKLA 2O5KA 3MDYA 3SOCA 4CYJA 3OG7A 2WTCA 4FKVA 4IB5A 3H9RA 2H96A 3ZH8A 2VN9A 1E9HA 2CKEA 3RK5A 2I40A 3DK6A 2Y6OA 3DOGA 4WNOA 4G6LA 4DC2A 5HVJA 5EM7A 2PVRA 4MXCA 2XB7A 2ONLA 4FUXA 5FXQA 4UYNA 2RKUA 2Q83A 3SGCA 2XM9A 2XIXA 3F82A 3SW4A 5AIRA 1PXIA 2EU9A 4U6RA 1WBPA 2ZAZA 3MJ2A 3QRTA 3FI2A 3KRWA 3FYKX 4FKRA 2VO6A 3GOPA 3OT3A 3UPXA 2G2IA 2GHMA 3QTUA 1YDTE 4QPSA 4Z7GA 4J8MA 5KMIA 3DBFA 3RZFA 4DFXE 3EQGA 4GL9A 1J7UA 4MNEB 4ANLA 3LAUA 4Y85A 4C4JA 4Z7HA 4OW8A 4CMTA 3N4VA 1H1SA 1OUKA 1WCCA 3Q9ZA 3PY0A 4R3RA 3UIBA 2G9XA 4EOSA 5CF5A 2XJ2A 2DWBA 2J51A 4ZTHA 4G3GA 2A19B 4M7IA 4QMYA 4GV1A 4UZDA 5DRDA 2I0HA 2QOQA 3R73A 3ORKA 2JDOA 4I5PA 4IZ5A 4RC4A 3IW4A 4BDKA 4YMJA 2IJMA 5C8NA 3G9LX 4YU2A 3E8EA 5CXZA 3C0GA 4O91A 4D4SA 2VWXA 3L8PA 2NNWB 3A2CA 2R2PA 5CAPA 3DB8A 3EZRA 4C34A 4O21A 3PRIA 3PY3A 4JQ8A 3PXFA 4HYHA 5HG7A 4IH8A 4EOJA 4CFMA 4E5WA 1ZYLA 3MVJA 3N51A 4U80A 1ZXEA 2BIKB 3PE2A 1M14A 3DA6A 4LUDA 2BRMA 2WB8A 4GJ2A 4OT6A 5JK3A 5TE0A 2C0IA 4XRLA 1BX6A 4FNWA 3F6XA 4I21A 1M52A 4H58A 4EQCA 5CU0A 2BHHA 1OKWA 4PMMA 2X4ZA 4Y5HA 5EHOA 1W8CA 3G90X 3I7CA 4H1JA 5J8IA 4WG5A 4ACGA 4ALUA 2HZNA 3L9PA 2YDJA 4FC0A 1FQ1B 4IDTA 4X2NA 3P86A 3ANQA 3UC3A 1KE9A 4RJ8A 4WOVA 4PF4A 2ITQA 5IDPA 1FINA 2XBJA 3EQIA 2NRUA 4DA5A 4C36A 2YZAA 4KBCA 2PYWA 4WRGA 4HZRA 4IB0A 2ZM4A 4LMNA 4QMWA 4F9WA 4UXLA 4DYMA 3Q32A 1UNLA 4BKYA 3BELA 3IW8A 1U5RA 3TTJA 3KRJA 3V6SA 4JRVA 4RFMA 3ZSHA 1R1WA 3LOKA 3ACJA 5HLWA 3LFBA 3Q5ZA 3HAMA 3BHUA 4YZMA 4QTEA 3HMOA 3WZKA 1WVYA 4FT3A 4GG7A 3ZUTA 1B39A 4C4EA 5T68A 5B2LA 3D5WA 5IA3A 4FV9A 2OJGA 3BPRA 2FSLX 3E5AA 4ASZA 4OBQA 4XP3A 2XEZA 5GJDA 5C8MA 3UOHA 4CFWA 4ZOGA 3RCDA 4D9TA 3TKHA 3D5XA 4N4SA 4UBAA 4AZTA 2BRHA 3OCSA 1MRUA 4RPVA 5CZHA 1O6LA 3BE2A 3NPCA 4UEUA 4BTMA 5KCVA 3QTWA 3W10A 2ETKA 4DHFA 5C26A 1UU7A 2UZWE 2XUUA 2AC3A 2QQ7A 5CI6A 4YJOA 2C68A 4LGHA 2WMXA 4U43A 1Y6AA 4NKSA 2PMIA 4DGGA 5A14A 1Q61A 2WMWA 3E88A 4O27B 2C3LA 2C0TA 4I6BA 3FSFA 1W0XC 3DBDA 3WIGA 3WF5A 3PUPA 1ZOEA 3QHWA 2ERZE 3ET7A 4D2PA 3NCZA 5AP0A 3FPQA 2RFSA 1BKXA 2W1IA 3AD5A 3VUDA 3EH9A 2VWYA 3BE9A 4BBEA 3F5XA 1WBOA 3LFDA 5CANA 3EQPA 3WARA 1XH4A 2B52A 2OJFE 1TQIA 4WKQA 3FMLA 4KAOA 3MN3A 4YJPA 4QRCA 4F6SA 3IO7A 1CSNA 5FEEA 2DUVA 3GGFA 1REKA 2JDSA 4RIYB 2EXCX 3R63A 2NP8A 5D1JA 1R0PA 2E9VA 2Q0NA 1KE8A 5I0BA 4FKGA 3R83A 3UTOA 1YW2A 2CKQA 2RG5A 4MK0A 2X6EA 5DR9A 2R0IA 3I81A 4BCFA 1LUFA 3LFNA 4O81A 4RBLA 1URWA 3NYOA 4XG8A 2OZAB 4PMTA 4FKSA 4FTKA 4BTKA 1Q41A 4QYEA 5BUIA 1U54B 2XMYA 3QQJA 1YOJA 4IW0A 5IUIA 4DGLC 1Q5KA 3IQ7A 2C5NA 3EFWA 2VTJA 3F9NA 5FEQA 4DGOA 1PKGA 2C0OA 4Z3VA 4QTCA 5K5NA 3TUDA 3C5UA 4Y95A 3PJ3A 5AP6A 5IQAA 4USDA 4IIRA 3DXPA 3I7BA 2EWAA 2BFXA 4AFJA 4DTAA 3G33A 1BMKA 3Q4ZA 3GNIB 2GNLA 3VW6A 5AAGA 5BVNA 3CR0A 5CSWA 2C6DA 2YCFA 3V5PA 4WD5A 4IHPA 4FSZA 4F9CA 3CJFA 1FVTA 4AF3A 2YZLA 3ORTA 4PNIA 2A0CX 2YJRA 3Q3BA 3L8XA 4GH2A 4CZUA 4FIGA 2VZ6A 4DLIA 2A2AA 2J6MA 4II5A 3TNHA 3UG2A 3KK8A 4K11A 4K1BA 2VWBA 2YCRA 5DH3A 3I5ZA 3QCXA 2WU7A 3SV0A 3VBWA 3NW6A 3BI6A 5EW8A 3DT1A 2GNJA 2OICA 3OWJA 5DOSA 4PY1A 3ETAA 1PJKA 3ZSIA 3COIA 4Y83A 2I0VA 4HNFA 5CAQA 3UZTA 4JL9A 1UKHA 2R7BA 4F1OA 3WZDA 2R0UA 4IAZA 4MXAA 4E4NA 5HD4A 4E73A 4YJQA 3DB6A 1RE8A 3EFJA 3ZHPC 3LHJA 3U6HA 3VJNA 5KX8A 3LQ3A 4L45A 4M15A 3LJ1A 4BBMA 1KSWA 4MNFA 2HELA 2X81A 1H1WA 3GQLA 4GRBA 3DJ7A 4X21A 2KULA 4XLVA 2VO0A 4YLJA 4FGBA 4EI4A 5HCYA 2WOTA 4U97A 4NYEA 4ANOA 3CD3A 3HVCA 2YJSA 2BRGA 5HG5A 3K3JA 4BDEA 5L4QA 5C9CA 2VTOA 2IW6A 3GCQA 4FGRA 1Q97A 3R9OA 5CX9A 3ZONA 5IA1A 2C1BA 4AA0A 5ANOA 3NYVA 2F57A 4YHFA 5EQPA 3BHHA 4AP7A 2WOUA 4KKHA 3UQFA 4EEVA 4AG8A 3R2YA 3CQEA 4RQVA 4B9DA 5IISA 4DEGA 3FMEA 3QZGA 3R7OA 4OTWA 5L6OA 4RX9A 3DK7A 3FYJX 5CAOA 1YOLA 4GK4A 4JR7A 4P2KA 3VS2A 1IAHA 3VUTA 3L8SA 4RIYA 4FEQA 3ZBXA 2XNEA 4Q2AA 4QMVA 4I5MA 3V3VA 5HNIX 4FI1A 5AV4A 4GG5A 4O6EA 3I0QA 2HY0A 4F0FA 3LFFA 3MYGA 4AN9A 1ZMUA 5JZNA 4BDAA 4YTFA 5BUEA 2BDJA 2HWPA 4G1WA 4TW9A 4EWQA 5BUJA 5BX0A 3GU4A 1Q24A 5LMBA 1OIQA 5AIKA 4CLJA 3TDVA 3K5UA 4PPAA 4F0IA 5FXRA 1H8FA 4ZTMA 5HORA 1DM2A 1V0PA 4IADA 4BF2A 1OPLA 4I6HA 4I5HA 1GZ8A 4CMOA 2O63A 1IA8A 3W2CA 3AMYA 2OO8X 3A7GA 1M2PA 2BMCA 3TZ9A 2Y4IC 3KRXA 3D5UA 4W4VA 4M14A 2Y6MA 4BN1A 3PTGA 4A06A 3AMAA 3DKOA 1VZOA 2V22A 3OWKA 4TNDA 3UO5A 1Y6BA 3GVUA 3CPBA 5KUPA 3H9OA 3LQ8A 1OB3A 4A9SA 2W4OA 4XG7A 4Z55A 3BQRA 3AC3A 4ANMA 4A9UA 5CT0A 3R02A 3U8WA 4LG4A 2B54A 2GS7A 1R3CA 2UW5A 4WBOA 5AUXA 3UIUA 3JR1A 4BYIA 2IW8A 2YM5A 5IMEA 5J79A 4O83A 4F63A 1XH9A 3DQWA 5M53A 3PA3A 3MH3A 5HE2A 4ANBA 1WZYA 1R39A 3PWDA 4M0YA 5C8KA 2JKMA 2ZV8A 3EN6A 3PZEA 4FTJA 4U45A 4OAUC 2R3GA 3MPMA 2XKCA 1CM8A 5AP5A 4JBOA 3CY3A 4DCAA 1FGKA 1BL6A 1YKRA 2ERKA 4I93A 3ZEPA 2VTPA 4YURA 3KVXA 3W33A 2V62A 4C35A 4B99A 3OXIA 2XRWA 5BVOA 3FMNA 2BZIB 2F49A 3IW6A 4PTGA 4TN6A 2UVZA 4LUEA 4YC3A 5M4FA 5AUVA 3CPCA 5AP2A 3DK3A 2VWIA 3TI1A 3LMHA 4KS7A 4TWCA 4NZWB 4OTDA 4NFNA 2HENA 2Y0AA 5E8TA 4ZLYA 4BDGA 5K4IA 4EUTA 3LMGA 2W17A 2XIKA 4R3PA 4YTHA 2YM4A 5CU6A 3VULA 4AN3A 4HCTA 2QHMA 4G9RA 4RX8A 5L2WA 3PG3A 3DGKA 4FV0A 3SQQA 4BI1A 4C4IA 2VWZA 2ITPA 1BI7A 3I4BA 3HMIA 3THBA 3UOJA 1AD5A 1YWNA 3AC2A 4YJUA 4BCNA 4ZS4A 2R4BA 3W55A 3BLRA 4CG9A 3EN7A 4C61A 5GZAA 5E8SA 5J5SA 4RIOA 5CY3A 5D7VA 1W83A 5AM7A 3V8WA 4I23A 1FGIA 4ACMA 3FSKA 3D0EA 4AWIA 3R7VA 2BKKA 3NMUF 3KKVA 3RPSA 2Z7SA 3POZA 4ERKA 3QXPA 5GINE 2X7GA 1U4DA 4FKTA 3R7IA 5LVOA 2XKDA 5FP6A 1UVRA 2HAKA 3OBGA 2X2LA 4MKCA 4IZAA 4CV8A 2ACXA 2JBPA 3TWJA 2RFNA 4AZFA 4O7LA 3AGLA 4MQ1A 4I24A 1JVPP 4GU6A 3DV3A 4AX8A 5D9HA 3AC1A 2WAJA 4CRLA 4OTRA 2UVYA 3MFRA 4I5CA 2WMSA 5H9BA 5A9UA 4RWKA 5DFPA 3NVMB 2XNPA 3QTZA 5LVMA 5DIAA 3NYNA 5CU2A 2HZIA 2X2MA 4IACA 2BVAA 1YVJA 2YAAA 3L8VA 3QU0A 3T3UA 3TZMA 3PYYA 4RA4A 5HG8A 3ZC5A 3H10A 5AP1A 4S34A 4ZJJA 3CGOA 3QCQA 3OEFX 1PMNA 2PE2A 2UZDA 4MTAA 4X0MA 3R1YA 3PSBA 4JOAA 3N4UA 2VTNA 3Q4CA 3IW7A 4BDBA 3C4XA 1W98A 2WQOA 3GXLA 3UO6A 3MJ1A 3KB7A 4EORA 4DEBA 3E87A 4QMUA 5AR5A 4D2VA 3MY5A 4BC6A 5CF8A 4WG4A 4QPAA 3P79A 1KE6A 4CVAA 2W1DA 2FSMX 3D7TA 4FIHA 4AW0A 4W8EA 2CNVA 3HAVA 4C37A 4I0SA 2C6IA 4FZFB 5TOZA 4KINA 3F88A 3TEIA 4UXQA 3ZCLA 3UZPA 1BUHA 3QC9A 2QOKA 2W4JA 3QALE 3D5VA 4FG8A 1OMWA 2CHLA 3QWKA 3UVRA 4I4FA 1PXOA 2YN8A 4MXYA 3PLSA 2UZEA 3KXHA 3CSVA 2JBOA 2WEVA 5DLSA 2BUJA 3EMGA 2OI4X 3R8ZA 2WQBA 3KRRA 5H8GA 1RW8A 4O0SA 5ANKA 4QQ5A 3M11A 3BBWA 4E6QA 3I60A 1FPUA 1ZZLA 3OW4A 4I20A 3P7BA 2BRNA 4L7SA 4BIBA 3KREA 2R7IA 3Q2MA 4G3CA 4X2KA 1PYXA 3EQHA 4UB7A 3SKCA 3KK9A 1OVEA 4EK8A 4P5ZA 3QQLA 4P5QA 3OY3A 3ZYAA 3TV6A 3ZO4A 3A4PA 4U41A 3OCBA 4FSNA 4ZMEA 3D15A 4JXFA 5AR2A 2O8YA 4I6FA 5D41A 4EOKA 5IH6A 1J1CA 2VO7A 5LXMA 3MPAA 2IVVA 4RQKA 2WPAA 2GTNA 1ZRZA 4I22A 3QQHA 3T8OA 4E5AX 5CAVA 1BLXA 1F0QA 3KEXA 5F95A 5KMKA 2WIPA 3IKAA 1QMZA 4K6ZA 2OJIA 3I6WA 5EQEA 4XP0A 1VYWA 2R3IA 3PPKA 4XG4A 3SW7A 2RIOA 4JJRA 2JIVA 5BVKA 4IAKA 3G51A 3MTLA 3BYSA 2BTSA 4UZHA 4E1ZA 3SX9A 5ITAA 4JBPA 3WZEA 4CCBA 3RGFA 1PXLA 1Y91A 3CE3A 3O2MA 3ORZA 3UVQA 3FLSA 3PVUA 5HU9A 4AZSA 4F4PA 3PLAE 4WHZA 5J95A 4W4WA 4YLLA 4ZZOA 4WSYA 5L8JA 5I3RA 1ZYCA 4GT5A 4MBJA 4NIFB 3RJCA 3ENMA 2IO6A 3H0YA 3QRJA 3TCPA 2BZKB 2C4GA 3EYGA 1OIYA 5EFQA 4IVAA 4RJ5A 3RP9A 2FSTX 2DQ7X 5FTOA 1XQZA 4JAIA 4CGAA 5EDQA 4FKPA 2UW4A 2OU7A 3MV5A 3LLAA 5AX3A 4R5SA 4WUNA 4GKIA 3TUCA 2W1ZA 4PQNA 2UW7A 4FKOA 2HW7A 4YJVA 5FUTA 4AFEA 2VD5A 2ITXA 3DTWA 4ZTQA 3U6JA 2RL5A 3BYVA 2YIWA 3QUPA 3S0OA 3G15A 1MUOA 4F6UA 3JXWA 3E93A 5E1EA 3C4ZA 4MX9A 5CEMA 1Q3DA 5AWMA 4B8MA 3DJ5A 5A6OA 4O0XA 2P0CA 4BICA 3KULA 3F2AA 5CF4A 4XBRA 4G2FA 4PV0A 4NM0A 2XYUA 4NCTA 4D0WA 5BPYA 4JR3A 1PXKA 1R78A 4USEA 2GTMA 3CBLA 4LM5A 4EH8A 4OBPA 4CTCA 3AGMA 4F7SA 1K2PA 3E62A 3LW0A 3OD6X 4NTSA 4GUBA 2A27A 3MI9A 1KWPA 2YIYA 4D2TA 4A07A 2V55A 2VTAA 2C1AA 2HXQA 1OITA 4DLJA 2Z7LA 4O0UA 4BZOA 3V51A 4PWNA 5CEQA 4M68A 3IPHA 4DEEA 4K18A 4BL1A 4PDOA 5DT3A 4O7TA 4ARKA 5E8YA 2C3IB 5CZIA 5HZNA 4QP7A 3DNDA 3S3IA 3R1SA 2I6LA 3Q4TA 3RHXA 4F65A 5HTBA 4FV3A 2EUFB 4AT3A 4FTQA 5DEWA 3F7WA 1YQJA 2PVNA 4H1MA 3F69A 3E3BX 3VNTA 4DG0E 4HPUE 4MCVA 4FZ7A 1WBSA 3HLLA 4AGDA 5L2IA 1YI3A 3KL8A 1I44A 3G0FA 3K2LA 4L53A 5M06A 2UZLA 3RI1A 4FIJA 1H4LA 1UU3A 2WMQA 4W9WA 3R30A 4X7QA 3UVPA 3RM6A 2WQMA 4G6NA 2WXVA 4O2PA 4QMMA 4ZS0A 5FP5A 4NW6A 4YHJA 2UVXA 3TKUA 3ZUVA 2PVHA 3UGCA 3C0HA 3PG1A 5IZFA 2J0LA 4YZCA 3RAIA 1K3AA 4XG3A 4ZZMA 4PDYA 3A7IA 3PWYA 3VUGA 1SVHA 1KV1A 4YUQA 3NLBA 3FAAA 4FSQA 5D10A 5L6WL 4XLIA 3VUMA 5DN3A 5JFVA 2YFXA 3DFAA 5EOLA 3EZVA 4FTRA 3RWPA 4BDHA 4D4RA 3SXFA 3NVKI 5EDRA 4O7WA 4G3FA 3UBDA 3R0TA 1CMKE 3CKWA 3O8TA 2PE1A 4D5HA 4GEOA 3UIXA 4TKSA 5AV2A 3MFSA 5AEPA 1WFCA 4FG9A 2OSCA 1H0WA 4M12A 3FZRA 2CGUA 3HDMA 3QD3A 3R9DA 2UZBA 2PZIA 3AT2A 1GIIA 4S33A 3OF0A 5DT4A 3QRUA 3O71A 3R9HA 3IG7A 1EH4A 4HCUA 4J8NA 2GPHA 4QMXA 3G2FA 3GU8A 5CEIA 1LP4A 3FXWA 3VBVA 5JGAA 2C6MA 5ACBC 3SG9A 1PMUA 4HPTE 3EL8A 5I9UA 3FI3A 2OK1A 2RSVA 3CC6A 3F2NA 5EYDA 4EUUA 5DNRA 3L9NA 5CSPA 4BB4A 2B55A 4DG2E 2OF4A 5M44A 2JGZA 4K77A 3D2KA 2XF0A 4GJ3A 4DBNA 5HO8A 3BV2A 5BVEA 5HICA 4TZRA 4TWOA 4E8AA 4LL0A 4ZTSA 4D58A 4IM2A 2W5HA 3V5JA 4DGMA 4BR3A 3OP5A 4GIHA 2Y4PA 3KFAA 4PMPA 2WQNA 3NUYA 2BTRA 1OKZA 3TIYA 3R22A 4EYMA 3LCTA 3DTCA 2IZSA 3VS0A 3PA4A 4C59A
chains in the Genus database with same CATH superfamily
2X7OA 2C6TA 1H0VA 3C4WA 3DBQA 3NUUA 3OC1A 3LIJA 4YNEA 4F9AA 4JLCA 4C3RA 4BZNA 2Z02A 1L8TA 4QMSA 1W7HA 4MF1A 3V8SA 3WBLA 3MWUA 4QTBA 4TYHA 4IM3A 4DTKA 1REJA 3E7OA 3A7HA 3C4FA 4B7TA 3GI3A 3BYMA 4K9YA 1S9IA 2BDFA 5J1WA 4V0GA 3W0MA 1W2DA 2YIRA 1WBTA 1WBNA 2GHLA 3LM5A 3LKMA 5ICPA 3Q52A 3NSZA 2NO3A 5CENA 2JAMA 1P4OA 4HVDA 4ALVA 3VS5A 4PTEA 1OIRA 3NNWA 5I3OA 3W2OA 2F2CB 4G9CA 4RWLA 2LAVA 4FEUA 4BI0A 4HYIA 3QZFA 2J5EA 5H2UA 5J87A 2WMUA 2JD5A 3HRCA 3MY1A 5CSXA 3EIDA 2HIWA 4AGUA 2VX1A 4JG7A 4RGJA 1F5QA 2ONLC 3MA6A 3A7FA 2CGWA 2F2UA 3ZXZA 2X8IA 5BQ0A 2ITTA 2OJ9A 4NL0A 3P4KA 1SVGA 3VUHA 4CQEA 4D0XA 5CU4A 2WTJA 1PKDA 5HVKA 2W1GA 3G5DA 4BDJA 2BROA 2XIRA 5CLPA 4L46A 2F4JA 2ZB0A 4ACDA 1FVVA 3NIEA 1KV2A 2VNYA 4YZDA 4EOMA 4IWDA 2IG7A 5KHXA 4GSBA 3ANRA 2R5TA 3CP9A 3IDPA 3Q4UA 2VTMA 5BYYA 1V1KA 1OKVA 3OW3A 4A7CA 4L7FA 2SRCA 3PPZA 3VQUA 2VRXA 2FO0A 3WF6A 3S4QA 4YBKA 3LXPA 3GU6A 4FRFA 5IQGA 4EK4A 2QO2A 3HV3A 3FWQA 5IA0A 3PXQA 3BL7A 4MYGA 3TL8A 3PXZA 4YGAA 1E1VA 4EHVA 3AT3A 4RC2A 5LQFA 3HL7A 3LM0A 3E7VA 4J53A 5HIEA 2BDWA 2OJJA 5AUUA 5J9YA 2YIQA 3LFQA 3ZO3A 3PVWA 5B0XA 4PTCA 3UQGA 4UMUA 3E8DA 1STCE 3R6XA 4LOPA 4BGQA 4QD6A 5M56A 4WRSA 1Y8GA 5HKMA 2XALA 1JPAA 3GUBA 3PXKA 4ZY4A 1Y8YA 5IQCA 4Y5QA 1UNGA 3MIAA 5T6KA 5E8WA 4QNYA 5IU2A 4IZ7A 3VUKA 3TIZA 3IK3A 4LI5A 4LV8A 4BFMA 2OZAA 4J98A 4W4XA 4KRDA 3MESA 3PY1A 4EZ7A 5BNJA 4QMQA 2WEIA 2VTTA 2R3MA 2V0DA 4BTJA 4CCUA 1YHWA 1ZYDA 4FKWA 4H39A 4FJVA 3WE4A 1FMKA 3FLYA 4RFYA 4FTUA 4MH7A 2GQSA 3D14A 3FLNC 2R64A 5HLPA 3TXOA 3A4OX 1PXJA 4YSJA 4RVTA 1OKYA 1V0BA 4YNOA 4CRSA 2PE0A 4DE4A 4DHIB 2ZMDA 4QMLA 1MP8A 5CU3A 4QP6A 3ZLSA 2H34A 4ZZNA 2VX0A 4GFMA 5J9ZA 4E4MA 5HQ0A 3DNEA 4E26A 2PUIA 3MVLA 3FI8A 5IEXA 1DI8A 4ACCA 2QLQA 4KKEA 2W9FB 3ITZA 3QL8A 4U0IA 3QA0A 5TO8A 2VAGA 4QP8A 1IASA 2W96B 4F64A 3UP2A 4IVDA 4AQCA 2YERA 2X4FA 3IGGA 4D28A 1ZOGA 4EBWA 4MUQA 4NU1A 3I5NA 1J7LA 3F5UA 4O1OA 2W5AA 4WUAA 4FEWA 3SVVA 4DITA 1A48A 4PDSA 3C1XA 3ORLA 1O6KA 3K54A 1XH5A 2HZ0A 2XK9A 2WTKC 4C57A 3ELJA 4GT4A 4NUSA 3GOKA 3AKLA 2BPMA 1Q62A 4AQKA 3MB6A 4HNIA 4IFGA 3RNYA 3VBYA 4CFNA 2BAQA 5EG3A 4EBVA 4R5YA 4EONA 4HVIA 4Y72A 1AQ1A 2Z8CA 4BJJA 1H26A 5AUTA 2QI8A 1JSVA 3A99A 4UWYA 4YO6A 5M4UA 3BGQA 3VW8A 5ANEA 3UDSA 3Q6WA 4FIEA 3ZZWA 3SD0A 2PVKA 5M08A 1NVRA 2W5BA 3RAKA 4EQUA 2G01A 4ZP5A 3IECA 3Q53A 5E1SA 2CKPA 4BCJA 3LMIA 4O0WA 1G8JA 3UODA 3IOPA 4YZNA 3E3PA 5EI2A 2YACA 4HGEA 2EXMA 1JSTA 2QG7A 1ZYJA 5CXHA 5ETFA 1GZKA 3OEZA 3HA6A 5AR3A 3U9CA 5IDNA 3RPVA 5KKRC 3KA0A 1OBGA 3MA3A 4CG8A 5FTQA 2OXDA 3RK9A 1KOAA 3ZTXA 4BCQA 2PVLA 2O3PA 4EKKA 1DS5A 3OXZA 3BBTB 4AAAA 4ASXA 2ITNA 3UP7A 4FVRA 4YPDA 4DINA 3SRVB 3DLSA 5CEKA 4Q9ZA 3ZDUA 4EH7A 3QTQA 4TWPA 3AMBA 3VF9A 2XA4A 4L3JA 2YCQA 1FVRA 4FYNA 2CSNA 5JQ8A 1GNGA 2GNIA 3WE8A 5CF6A 5GIOE 5TKDA 3T9TA 2HZ4A 4ZSAA 5IF1A 3K5VA 3SDJA 3DKFA 2W9ZB 5DA3A 1YXTA 3LFCA 3JY0A 3GQIA 2CPKE 3R8PA 4G31A 5FXSA 2WGJA 3CGFA 4DH8A 4TPTA 2B7AA 4BCKA 4YZ9A 1DI9A 4ZTNA 4AW1A 5IA2A 3KRLA 4YP8A 3RK7A 4JG6A 5H3QA 3DXNA 3V5WA 4AOTA 2WQEA 2UW3A 3FY2A 2PHKA 3U54A 3O51A 4NTTA 3ACKA 5EHLA 4D9UA 2WD1A 3BWFA 2RF9A 4DEHA 2X6DA 2IZRA 4IX6A 2CLXA 5DE2A 5HX6A 4BRXA 4AAYA 5CEOA 1ZOHA 5K0XA 3O5AA 2UZVA 3E92A 5LMAA 5JEBA 3AD6A 3E64A 2UW9A 4ID7A 3UNJA 3BYOA 4FSUA 5AR8A 5CNOA 4C02A 2XS0A 3E63A 4O38A 5M51A 5GIPE 3LE6A 3AKKA 4YTCA 4PNKA 2ZDUA 3HMMA 3MSSA 2CCHA 4FK6A 4TNBA 5D7AA 2XYNA 3ZEWA 3A8WA 3EQFA 4KIKA 4RLKA 3UNKA 2J9MA 4EQMA 4DTBA 2CMWA 3KC3A 3MGYA 4Q9SA 4V04A 5FEDA 3T9IA 3GP0A 2YLFA 1WVWA 3BQCA 1M2RA 3UDBA 1XH8A 2WMBA 4FBXA 3R1QA 3OS3A 1OPKA 4QQJA 3B2WA 4EH6A 5I9YA 3DS6A 4OGRA 4EH4A 3ZRLA 4CFFA 1J91A 4QP1A 3HYHA 3EQDA 3QA8A 4NSTA 2CLQA 5JN2A 4X6QC 2JIUA 5EM6A 4F7JA 4EH5A 4I6QA 5AP7A 2E9PA 5HE0A 5IH5A 3PJ8A 3NCGA 3QWJA 2J0IA 2BR1A 4EH9A 4RX5A 4FODA 4EZ3A 5M4CA 4RC3A 4FTTA 3LZBA 4F1TA 3T3VA 4ZTLA 1PMVA 4UN0C 2CDZA 4PPCA 4PDPA 2OF2A 4GKHA 4H3BA 5D11A 5HCZA 4JIAA 4Y73A 1XHAA 3R00A 5CALA 4O7ZA 5C4LA 4J52A 2EB2A 4K2RA 3VS7A 2GNGA 5E4HA 2KTYA 4FEXA 2WTIA 2A4LA 2QVSE 4LQMA 1GOLA 4LYNA 1P2AA 2XNNA 3BEAA 4HOKA 3I6UA 5ANDA 1HCKA 3FKNA 3V6RA 3PP1A 2FUMA 3IONA 3UG1A 4NH1A 3PIXA 3H30A 4FUYA 2QKRA 4U79A 4C3PA 2C6OA 2IWIA 3GENA 3HV6A 4TWNA 4FEVA 2JITA 4C2VA 4F78A 3R2BA 3QKKA 5LVPA 4MEDA 2IZTA 2J5FA 2JFLA 5ANGA 4N6YA 5IEVA 4J96A 4GFOA 2ZB1A 4WIHA 5BVWA 4F70A 2FA2A 3DFCB 4XP2A 2R3NA 3EJ1A 3C9WA 4FIFA 3ZLYA 1IRKA 4I41A 5HNGA 3KXGA 3QQUA 4IAAA 3NUPA 1YRPA 4YC6A 5GHVA 5A46A 1VYZA 2CNQA 2A98A 3C50A 3CQUA 3KMWA 4FSWA 2QU5A 4YLKA 1HOWA 3C4EA 4OR5A 3FKOA 3NFGB 4NJ3A 2YM7A 4CZYB 4FOCA 1YXUA 2WMAA 3F3VA 4U9AA 5I4NA 1JNKA 3ROCA 2GCDA 4BCMA 5AV1A 5L2TA 1M17A 2VTSA 3QTRA 4XEYA 5HU3A 2XAOA 1TKIA 5F1ZA 4ZXTA 4XG6A 3HZTA 2X1NA 3RPOA 1OBDA 2HYYA 4I3ZA 5BYLA 2B9HA 5DMZA 1B38A 3DKCA 4NJDA 1K9AA 1RQQA 5J5TA 1YHSA 5JRQA 5HEZA 2JKOA 2WFYA 3NWWA 3EL7A 5FM2A 3F7ZA 4FSYA 3PVBA 4ORKA 4TT7A 3M1SA 2OXXA 2JDRA 4IMYA 3FMDA 4XH6A 3BHYA 4IANA 4WO5A 1W82A 4CKRA 2UW0A 5I9VA 4ANQA 5KNJA 4J1RA 1WBWA 3S00A 1JAMA 3LVPA 3NYXA 4HVGA 5A54A 3GU5A 4B6LA 5HTIA 1FBNA 3GU7A 3PDTA 2I0EA 4FTNA 3QRIA 2E9NA 3O96A 4JIKA 5M07A 2P2IA 5EI6A 1JWHA 3O50A 5AUWA 1VEBA 1OM1A 2X0GA 3ULIA 4PUZA 4F0GA 3HV5A 2HXLA 4FG7A 4DF3A 2QOFA 3BLAA 2PUNA 2ESMA 1ERKA 3UO4A 4F9YA 2ZM3A 2PZRA 2OWBA 4LFIA 3VBQA 3QKLA 2PZYA 5JH6A 4CFUA 4W9XA 1PYEA 4GFGA 3LXNA 1OL1A 4DEAA 5AUYA 3UOLA 5JGDA 2GQRA 4DBXA 3W2PA 4WNPA 5EW3A 3NUAA 3LJ2A 5BMMA 4KS8A 4F6WA 2X7FA 2W05A 3JPVA 2QOIA 4R3CA 5CQUA 5IUHA 4DG3E 4AA5A 3EHAA 3QF9A 3DAEA 1JKTA 1H07A 4RSSA 4JQ7A 4XUFA 3RNIA 4EHGA 2W99B 4EKLA 4DHZA 4O1PA 3II5A 4E7WA 3AD4A 4OTFA 4PL3A 4NKAA 4XOYA 2GNFA 4ZLZA 4EJNA 4HJOA 4IAIA 4AGWA 1UA2A 3QAME 4S32A 4S2ZA 5CSVA 4H3PA 3FHIA 1LPUA 1PRYA 3FL5A 4D5KA 3DPKA 1TQMA 4NCTC 3PJ1A 4BHNA 3U55A 3QUEA 5JFSA 3BLQA 5AV0A 1GZOA 2W4KA 4L44A 3C4CA 2VV9A 1WMKA 2C5OA 4NM7A 4DH1A 3FV8A 2BZJA 4I6LA 1IG1A 1HCLA 4LGGA 4TXCA 3MTFA 3WOWA 4F7LA 1A06A 5DG5A 4KSQA 3NR9A 3U4UA 2X8EA 3ZC6A 3HX4A 4AW5A 3TUBA 3ZFYA 5BVFA 4ENXA 1O6YA 2XK7A 3NIZA 4FTCA 1NVSA 5GZ8A 4DFZE 5KMJA 3DCVA 4DT9A 5FD2A 2XJ1A 3WI6A 2JKKA 3HUBA 3Q9WA 3GFEA 4FL3A 3Q9XA 1G8SA 1YXVA 2QOCA 4QQCA 4EZ5A 2PMLX 4UMPA 4GU9A 5CVFA 1LR4A 2PUUA 2QHNA 5FBOA 3TNQB 3H4JA 4MXOA 3UYTA 3FZOA 4C4HA 4O86A 3SLSA 4B4LA 3C51A 2B1PA 4O0TA 5CEPA 5HTCA 3FUPA 2Y8OA 4R7IA 5B7VA 3OCGA 2IN6A 4CZTA 4JAJA 4V0GB 5FG8A 5LWNA 2AYPA 4FNYA 3UIMA 4ANSA 4HYUA 4S30A 5K5XA 4RIXB 3PZHA 2C6KA 4FTMA 2FH9A 2GFSA 5JT2A 1NXKA 2CN8A 1PW2A 3BZ3A 1VR2A 2F7XE 1CKPA 5HNBA 3FLQA 3ZZEA 3L9MA 1IA9A 4I0RA 4IXPA 3EKNA 5K4JA 5A3XA 5JGBA 2C47A 3CTHA 3FEGA 4CFXA 3OUNB 4M13A 1GIJA 3JVSA 4CKIA 2ITWA 4M8TA 1XH7A 2PVYA 3KXMA 4IM0A 4JBVA 4R7HA 5EM8A 3WF7A 2ZM1A 3HDNA 4KD1A 2VWWA 5FRIA 5ACKA 2OKRA 4HGTA 1ZMWA 3OTVA 1R0EA 3CKXA 3NGAA 5CVHA 3QXOA 3TDWA 3E8CA 3ORXA 3OOMA 5HO6A 4RIWA 4O6LA 2JIIA 2GQGA 4U40A 3QCYA 4JX3A 4XYFA 1G8AA 3BU3A 3W1FA 1JBPE 3KN5A 4WNKA 1KUTA 1WVXA 4EYJA 2UZNA 2OLCA 2WTWA 4O4BB 2BALA 3W8QA 3AC5A 3OY1A 4BCPA 2C3JA 2Y9QA 4MBLA 3OCTA 2GMXA 4KIQA 4IB1A 3SXRA 2H6DA 3MVHA 4JG8A 3MIYA 4FVPA 4NT4A 4EOOA 4Y8DA 4O7SA 2GNHA 4TRLA 2UW6A 3ZLXA 4C0TA 2QG5A 4C3FA 5JRSA 3RMFA 3TV7A 1UWJA 3DBEA 4C4FA 2XNMA 3F2RA 3ALOA 4DHJA 3QD4A 3QKMA 3P1AA 5C1QB 5D12A 5L2QA 4FNZA 2GFCA 2QCSA 4M0ZA 2OFUA 4G34A 5JFXA 2QOHA 2C5VA 5KO1A 1JOWB 2JKQA 4ZSGA 4KSPA 5BVDA 4DCEA 2VGOA 4UY9A 2Z60A 3BWJA 3QHRA 3QQFA 4IX3A 4ALWA 4LRJA 1XBCA 3CJGA 4PL5A 4RWIA 3BHTA 2GSFA 2BRBA 5IEYA 3ATSA 4QNAA 3CTJA 2PZPA 3R71A 4OTGA 4Y46A 5GZ9A 3HGKA 5I9ZA 5EK7A 3BKBA 4L9IA 4WT6A 3DBCA 3JY9A 4J99A 2QODA 2PMOX 2BAJA 1CKJA 4ZTRA 3MB7A 3NW5A 4AXAA 2GS2A 4RJ7A 4EWHA 2GDOA 1B6CB 1ZYSA 3IGOA 2PZ5A 2UZUE 2YDKA 3KXNA 4W4YA 4RG0A 2IF8A 1RJBA 5IQBA 3JUHA 2QD9A 1H01A 4J71A 5DR2A 5J1VA 3P9JA 4J7BA 1J1BA 2FB8A 5HBEA 2V5QA 3TMOA 4BIEA 2F9GA 4GMYA 2XK8A 5E8XA 4CSVA 4H3QA 1PHKA 1PMEA 2OH0E 1G3NA 4YJRA 5FQDC 3SRVA 4BVUA 3VQHA 5JKGA 3TNPC 4QYYA 2GHGA 1T45A 3FZ1A 1H25A 4X2FA 4BYJA 1Q8YA 3Q9YA 3W16A 1OL7A 2JFMA 3HUCA 5EYMA 3CLYA 4QQTA 1H1RA 4F1MA 3OBJA 4AZWA 4OTHA 1T46A 1G5SA 2VX3A 4USFA 4PRJA 4R1YA 5HO7A 4U8ZA 3UPZA 5LARA 4GW8A 3HECA 2VTQA 3KU2A 4FYOA 3IOKA 1U59A 3QC4A 4O7RA 4KIKB 3DXQA 1YOMA 3ZBFA 2OFVA 4D4VA 1H1QA 5IPJA 4NK9A 1PXNA 5KBRA 3AOXA 4FVQA 4YJTA 4GCJA 2X0OA 3GC9A 5F94A 3KIOC 1ZZ2A 2B9JA 3D7TB 3FI4A 3O8UA 1XBAA 3OMVA 2I0YA 3P0MA 3RVGA 3ZM4A 4IC8A 3LLTA 4QT1A 2YWVA 1XH6A 4JI9A 4M69A 5AJQA 4AXFA 3ZLWA 1H00A 3UMXA 1Q3WA 4ZEGA 2BIYA 2QO7A 3AG9A 3UYSA 3C13A 4K0YA 4L67A 4YTIA 4XNEA 3NRMA 5EH0A 5IQHA 4RVMA 1Q8TA 3U6IA 2FYSA 5CS6A 2XIZA 2W1EA 4D1ZA 4IFCA 4JS8A 4OBOA 2WZJA 4QTAA 2OG8A 5F4NA 4EOIA 4O96A 3B8QA 3KN6A 4AGCA 4FMQA 1QPJA 3OT8A 4PP9A 4IAYA 1MRVA 4FICA 2IVUA 4RX7A 3C0IA 4IDVA 4P7EA 2YIXA 4NIFA 4PL4A 4AT4A 4L8MA 5K3YA 2OIDA 2WTDA 3KCKA 1WAKA 1DAYA 3B8RA 2YABA 3F61A 3ZFMA 2B0QA 4DH3A 4IAFA 4LL5A 4ZK5A 2V7AA 1JKKA 4E20A 2C5YA 4F7NA 1XKKA 2DYLA 2WNTA 4ASDA 4MAOA 4HVHA 5BMSA 4PPBA 4QMNA 4L3PA 3PXRA 1MRYA 3V8TA 3GCUA 5L2SA 3DAKA 4N6ZA 2XKEA 2ZV2A 3REPA 2UZTA 4GYGA 5HIBA 3EFLA 5K0KA 5B2KA 2QOLA 1OL2A 2YITA 3RINA 4H05A 3GFWA 3QUDA 2C5XA 1QPDA 3MY0A 3BGZA 3PXYA 2O64A 2J90A 4CFVA 4FA2A 2YISA 4XX9A 2J0JA 4YC8A 5IQIA 3HV7A 1OL5A 2UW8A 4UMTA 5EDPA 1H27A 1F3MC 3BCEA 2BFYA 4EHZA 3EQRA 2J4ZA 2GU8A 4PP7A 4LV7A 5AR4A 5LCKA 4BI2A 1PY5A 4GK3A 2OW3A 5CI7A 3F5PA 1S9JA 3R7GA 4YPSA 3I0OA 4MXZA 5IQEA 3IDBA 5M57A 5TR6A 4BJJB 3JVRA 4E6CA 1GY3A 4RFZA 2WKMA 2AC5A 2R3LA 3FPMA 4G6OA 4BHZA 5CAUA 4HZSA 3TNWA 4FV6A 3LJ0A 4J97A 3HEGA 3UJGA 3TZ7A 4JVGA 3WILA 4DH7A 4KABA 2XKFA 2PVJA 2WELA 4BIDA 1OIUA 2W1CA 5CT7A 5DEYA 4EOLA 5I9WA 2J50A 4QMPA 4XV1A 4ZSLA 4EH3A 2XH5A 1YI4A 4NFMA 1MQBA 3RPYA 3VWAA 4FOBA 4BCIA 4KA3A 2O65A 4PMSA 1ZAOA 3KCFA 5AM6A 5ETIA 3QBNA 5C03A 4EL9A 3G9NA 4FV4A 4OAVB 4I0TA 3COKA 4L00A 4U7ZA 3TM0A 1GIHA 2X8DA 4N57A 4JX7A 2PWLA 5AADA 3SAYA 3FQHA 2G2FA 4QP4A 3KULB 3DAJA 3R9RA 4LOOA 5E8UA 4WNMA 3CIKA 4CNHA 3GBZA 5IA4A 1UWHA 4RVKA 1VLRA 2YHVA 3NAXA 4OTQA 1DAWA 4EK3A 1YHVA 3ZMMA 3RALA 5E7RA 2B9IA 3FHRA 4FK3A 3W32A 3TT0A 1OGUA 3ZRKA 3OHTA 5G6VA 3QZHA 4HGLA 4LOQA 4QMOA 2XJ0A 4X2JA 4MWIA 3OOGA 3IDCA 2XEYA 2R3KA 3QTIA 4MHAA 4OUCA 1QPCA 2R3PA 2C6LA 5CNNA 3DLZA 3NFFB 5GJGA 1BI8A 4F9BA 1IR3A 3F3ZA 4XCUA 4JRNA 3COMA 4FV7A 1Z57A 4RVLA 4V01A 5J7BA 5E8ZA 2VNWA 4XV9A 3FMJA 3P23A 3W2QA 4XV3A 3Q60A 4XHKB 2FSOX 4IJ9A 5AA9A 4X3FC 1H1PA 2WIHA 4QOXA 4Z16A 2OIQA 5KZ0A 2V7OA 2ITZA 2ZMCA 3BGPA 3QYWA 3WF8A 4DT8A 4RLLA 4FKLA 3G0EA 1P5EA 3CD8A 4CMUA 3FZSA 3TZ8A 2Q0BA 3TV4A 4C2WA 4N0SA 3ERKA 4MD8E 4N70A 4JBQA 5ANIA 4JQEA 2HOGA 4GK2A 2PVFA 3EFKA 5ANJA 4X3FB 4TYEA 4O7YA 4U81A 4WSQA 2UV2A 3NS9A 2QR8A 4K8AA 5HG9A 4FTLA 2PU8A 5LMKC 1RDQE 4YJSA 2PMNX 4RIWB 5HHWA 4J95A 1O9UA 2CGXA 5AV3A 5FDPA 3Q2JA 2PSQA 3ALNA 3ZFXA 2BKZA 3PP0A 3RM7A 3QZIA 3OROA 4QP3A 3MH0A 4XMOA 3RKBA 3SC1A 4D55A 2R3FA 3FBVA 1CTPE 3Q96A 3ZM9A 1QPEA 3L1SA 3TNIA 1Q8UA 3V04A 3C5IA 1LEWA 3AQVA 5IA5A 1J3HA 3ORPA 3DU8A 1QL6A 2E2BA 2QLUA 2VTRA 4O84A 4U44A 4GVAA 3ZUUA 3R28A 4LRKA 3EN9A 3S2PA 2PPQA 2FGIA 4R1VA 3PFYA 4QPMA 4APCA 4AW2A 3PJ2A 3OFMA 3HMPA 4EOQA 4JDJA 1H08A 2YAKA 4EK5A 3E8NA 3I79A 3MBLA 5EYCA 3CY2A 4E6DA 5EKNA 4B8LA 3FC1X 2CGVA 3POOA 4RIXA 4CYIA 1M7NA 3WF9A 4ZAUA 4Q5EA 3SG8A 5JSMA 2NPQA 3GEQA 5FM3A 4ANNA 3CS9A 4ONAA 5H8EA 4R6VA 3V5LA 4O22A 4R7BA 5CSHA 5K9IA 3CTQA 3KMMA 3SHEA 3AC4A 3HV4A 4ITHA 2PK9A 2UZOA 2Y4IB 2Z2WA 4FSRA 1ATPE 3C7QA 4D2RA 2CKOA 3M42A 3KQ7A 2GS6A 4C33A 4AZEA 1YXSA 4ZLOA 1JKSA 2ITOA 5DPVA 2QU6A 2VWUA 3LFSA 3NNUA 3NW7A 4ZJIA 2QC6A 3BRBA 4BGGA 3AKJA 2P4IA 4DEIA 5DI1A 3VS1A 4MF0A 2J0KA 4RZWA 1UKIA 4AA4A 4BKJA 4ITIA 5HLNA 2QURA 3ZO2A 3D83A 4GIIA 5DR6A 2QONA 5KE0A 2F7EE 3VVHA 4E6AA 1XMLA 4BY9E 2A1AB 4FT5A 3TN8A 5GJFA 3P08A 3MS9A 3MH1A 3VUIA 4HVSA 3P5JC 3DY7A 3FL4A 3QYZA 3QGYA 5LJJA 2YDIA 3BV3A 4C8BA 2W1FA 3AT4A 3N9XA 4MBIA 2C30A 3R21A 1PXMA 4FKUA 2XAMA 2ZVAA 2QOOA 4JDKA 3DZOA 2YCSA 3GT8A 4QMZA 3NAYA 3H3CA 4EOPA 4RA5A 3A61A 3ZO1A 3FQEA 3TJDA 5A4TA 5KBQA 4GS6A 4BWPA 4P4CA 4ZY5A 1P14A 2ZV9A 2VGPA 4FTAA 4G16A 4KIPA 3VS3A 2AEGA 1XBBA 1TQPA 3QX2A 4O2ZA 5A4EA 4F09A 4IX5A 3D2IA 3RTPA 3VHKA 4I92A 3PSCA 4IQ6A 4DFYA 3ZS5A 5CVGA 3WZUA 2BAKA 3COHA 4AUAA 5HCXA 3Q5IA 2XNGA 5DVRA 3UMWA 2QO9A 2W7XA 3ID6C 3NUNA 4FKIA 5KMNA 3ZDIA 4DFBA 1H28A 4U3YA 4BDIA 5L8LA 2ETRA 4HW7A 4AU8A 3PIYA 4YO4A 2XP2A 2ZV7A 4D4YA 1YDSE 3D4QA 3P7AA 4O0RA 1LEZA 4AN2A 1PF8A 3S1HA 3S95A 3R9NA 4AOIA 4MXXA 3EN5A 3EN4A 4FZ6A 3LCKA 3PUFC 2E9UA 2OBJA 4M66A 4NWMA 4R8QA 2PUPA 3PSDA 3A60A 3OZ6A 5AA8A 4CT1A 3FZTA 3KVWA 4KBAA 3CXWA 3GB2A 3BU6A 4IVCA 5F20A 4XOZA 3BYUA 1OL6A 5HVYA 4A4LA 3MPTA 2P55A 4UMQA 5EQYA 4LMUA 2IVSA 2YM8A 5ETAA 4BCHA 4DFLA 3FXXA 3WIKA 4ZSEA 4ENYA 4ASEA 2IPXA 4WA9A 2YA9A 3HMNA 5DRBA 1NW1A 2LGCA 2RGPA 3FMKA 3O23A 4EJ7A 3VF8A 3DKGA 5L3AA 2P2HA 2BHEA 4MD7E 1M2QA 1UU8A 2WHBA 3DDPA 2X2KA 2RG6A 4ITJA 3H0ZA 3SOAA 4C7TA 2VWVA 4AZVA 5DBXA 4CTBA 4IC7A 5I5ZA 3RHKA 3KXZA 5T3QA 5AAFA 4JNWA 3OWPA 2PL0A 1XR1A 4FSMA 2E9OA 2C6EA 2P33A 4IWPA 4RJ4A 3TKIA 3O8PA 1XO2B 5LOHA 4H36A 3QCSA 5A4QA 2BILB 2XK4A 3PJCA 4KKGA 4A4XA 2IW9A 4UALA 5AUZA 3WYXA 3NEWA 5AX9A 1BYGA 4FR4A 5E92A 2OXYA 3ML1A 3PRFA 4F99A 4FT9A 2OH4A 4M67A 3FXZA 2ITUA 2G15A 2QNJA 3KMUA 4BDDA 3G6HA 4L01A 3N4TA 3OWLA 4FL1A 5ETCA 2OGVA 3AC8A 4IB3A 5G1XA 1FMOE 3EOCA 4LRMA 4DFNA 4FV1A 4B0GA 4X6RA 3DJ6A 2ETMA 1W84A 4NM3A 3PPJA 2XNBA 4W8DA 1L3RE 2YLEA 5DWRA 4FE2A 2H9VA 4ZJVA 3Q6UA 4G5JA 2I1MA 4D1XA 4M97A 3UC4A 3ULZA 2XRUA 3R01A 2B9FA 3HRBA 3VBXA 3EB0A 3QQKA 3F3TA 4KNBA 4OTPA 4UMRA 4Z9LA 5LVNA 4AS0A 2VTLA 5E8VA 4A9YA 3QLFA 1CKIA 4IX4A 4FT7A 1KOBA 4KUJA 3IW5A 1Q99A 5C01A 3WZJA 2WO6A 3NNVA 4QTDA 2R3OA 3GC0A 5FLFA 3HP2A 3W18A 4LDTA 4YZBA 1JQHA 4FTOA 1IAJA 4HCVA 3LCDA 3P78A 4GUEA 4L43A 1SM2A 1NY3A 3B2TA 5DHJA 4U3ZA