3E93A

Crystal structure of p38 kinase in complex with a biaryl amide inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
350
structure length
346
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Kinase array design, back to front: Biaryl amides
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 346
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e93A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e93A01
3MIAA 5GJGA 1K9AA 2OU7A 3PP0A 1S9IA 3KCFA 3ZRKA 3ZEPA 3SG8A 2XEZA 3RHXA 5J7HA 1OKZA 3MA6A 5HE0A 2IW6A 3QBNA 2R3RA 5CEIA 4A4XA 3OT3A 5HBEA 3HMPA 2CJMA 3BE9A 5AIKA 3LFSA 4K1BA 3A60A 4DEGA 5CALA 1JSTA 3RPSA 4KWPA 3AC3A 4JQ7A 3U9CA 3V5JA 3FPQA 3C50A 4PMPA 5A9UA 4W4XA 4DT8A 1Q5KA 3KRXA 2JDOA 2JIIA 3FUPA 5LWNA 3FI4A 2YJRA 4R6VA 3MV5A 3CTHA 5GJDA 4OT6A 4RLLA 1TQPA 4FIHA 4RIWA 5HI2A 2BZKB 2XKCA 4C35A 2VTRA 4BR3A 3HDMA 2F7XE 1H8FA 3VJNA 4C38A 3SLSA 3MPTA 2E9UA 3FLSA 2WXVA 3E8NA 2R3FA 4I0SA 1UKHA 3OFMA 5BUIA 3KN5A 1YHWA 2PVRA 3E7OA 4RGJA 3NR9A 3PY0A 2PULA 3TUBA 3POZA 4MXYA 2JDSA 3GFWA 3FLQA 2DS1A 3UOKA 3TDWA 1F0QA 2FGIA 1UVRA 3SXSA 3WILA 5LJJA 4D2VA 2V7AA 5E1EA 4K0YA 4TY1A 4PDYA 1XQZA 4P5ZA 4DGOA 3NPCA 3QC9A 4HYUA 3C13A 1UNGA 3QRTA 2NP8A 4EKLA 5HG9A 3IG7A 3ENHA 4EQMA 1GZKA 4BGHA 4UYNA 2G2IA 2V0DA 2VTNA 5AV0A 4FYOA 3KVXA 3D7TB 3P79A 2PVJA 5CS6A 5AUTA 3DQXA 3CD3A 3BLHA 4D2SA 5B2MA 3BGZA 4MVFA 3JXWA 2F7EE 3FDNA 1ZWSA 4YPDA 2Y6MA 3IONA 3NUNA 4BIBA 3SG9A 2HZ4A 4YC3A 5IA1A 2CNVA 2PK9A 3RWQA 3A4PA 5AADA 5IDPA 4MD8E 4EONA 2BUJA 2GNIA 2RFSA 1NVSA 2WIHA 4C36A 4LOQA 2VO6A 3UZPA 4C37A 4HPUE 4C4HA 1Y57A 4L3LA 1W82A 3TUDA 2E9PA 4ALUA 4QMWA 2WTKB 3FL5A 2O64A 2P2HA 1FPUA 4JDKA 4PDOA 4XRJA 3GB2A 4AA4A 4FG9A 2C69A 1H1PA 4FC0A 4CCUA 5CXZA 4PMTA 4O1OA 1SYKA 3IDCA 3GC7A 2ESMA 2OFUA 3BELA 4KSPA 1W8CA 2UW8A 3QKKA 5K5XA 4X6RA 1STCE 3F3TA 2ZM4A 4H58A 2IZUA 3I7CA 3EQBA 5HX8A 3NYNA 4FX3A 3RJCA 3Q53A 3ZYAA 4I5MA 3NNUA 2YM3A 1OPKA 3COMA 4TW9A 3S2PA 3D2IA 2HWOA 3OW4A 3TWJA 4DEIA 3TNIA 4DG2E 2I0EA 1IA8A 3U87A 3P7BA 4RVKA 4WOVA 4DAWA 2Q0NA 3FY0A 3VQUA 3ZO3A 3LJ2A 4O7RA 2BZJA 2HK5A 3ZSGA 3B2TA 4JBVA 4C3PA 1CDKA 3KVWA 4BTKA 2VWIA 1Q8UA 5ITAA 3KF7A 3TM0A 2XRUA 1BI7A 3HUBA 4R7BA 4RIYA 2ITXA 3LXLA 5LMKA 4EBWA 4S34A 3ZLWA 3CE3A 2PYWA 1MQ4A 2VTHA 3TI1A 4QPMA 5HG8A 4TNDA 1UWJA 4O2PA 4QMVA 3SVVA 1J1BA 3JS2A 5J5SA 4OBQA 5EW9A 4RG0A 5AR8A 1ZXEA 3WF5A 4CKJA 1AQ1A 3ZHPC 4W9XA 1UU7A 4XG7A 2XK6A 3NRMA 3QTXA 3ACKA 4G34A 4LG4A 4DGNA 4L6QA 3KXMA 4M69A 4NM7A 4QP4A 3THBA 2OGVA 3G15A 4BCPA 5A6OA 5LOHA 3U6HA 2CNUA 1GNGA 3R1NA 5HVKA 3DXPA 5CSXA 5E91A 1KV2A 5BMSA 5C4KA 1V0OA 1P2AA 4A7CA 3FEGA 4AFJA 3NLBA 2GNFA 3V04A 2ZB1A 3FI3A 2VO0A 3QXPA 5FLFA 1PXMA 2ZB0A 3WYXA 4EOSA 5GINE 4LOOA 1T45A 2RKUA 3ZS5A 5KBRA 3NW5A 4AT3A 4L43A 2UZNA 5IA4A 4CEGA 5HBJA 4FV3A 4GCJA 2WMXA 5J5TA 5H9BA 4FOBA 1W98A 4L68A 1J1CA 4UZDA 3L8VA 3R2YA 5I5ZA 4JI9A 1RQQA 4W8EA 1A06A 2CLXA 2EUFB 3C51A 4Y5QA 4UALA 3V3VA 4CZTA 2Y9QA 5DHJA 2AUHA 4FSNA 4AGDA 4F9BA 4FSQA 3ULZA 1CKIA 2PSQA 1OPJA 3R9DA 4FEQA 5D7AA 2HELA 2GCDA 4RWLA 4ZSAA 4L01A 5DOSA 3QA0A 2UV2A 4QQCA 2GHMA 3COKA 5IQEA 2A4LA 3P78A 4D1SA 3IDBA 3K54A 3VF9A 3NNXA 2ITPA 5FXSA 3E92A 3G0EA 2HXLA 3LXNA 3TIYA 4ACDA 2WQEA 4BDIA 1WVYA 4J53A 3ZBFA 4O2ZA 4FEWA 4BDAA 4U41A 2YCRA 2W4OA 4AT5A 5CEKA 4PNKA 3TACA 4O7VA 3G6HA 3W2RA 3KK8A 5CAOA 2O8YA 4F09A 2IZRA 5AV2A 4H1MA 4E20A 3BLQA 1BI8A 4H39A 2IJMA 5F9EA 5KKRB 3PY1A 3VNTA 1A48A 1HCLA 3RM7A 2YA9A 4IB5A 5CEQA 3GU8A 4LV5A 2J0JA 4KS8A 4IWQA 1IEPA 5BYYA 4HGTA 5L6WL 4AS0A 2B55A 1FVVA 3BGPA 3EIDA 3FQHA 5EM6A 3ZBXA 3DK7A 3NMUF 4YGAA 3I1AA 4BWPA 2CSNA 2IWIA 3DY7A 2BR1A 4AOJA 3Q60A 3LIJA 3D83A 4FIGA 4YBJA 5B0XA 3GVUA 3OWJA 3ZMMA 2UW0A 3ITZA 5AP0A 5CAPA 1XH7A 4J95A 3NAXA 4CFFA 5HU3A 4MWIA 3PVUA 1YI3A 4LFIA 2BAKA 4AF3A 4BGQA 4CQGA 4RJ7A 2OLCA 4FKSA 5D1JA 4F7LA 5L8LA 4PTCA 4M12A 4Y85A 3REPA 3RTPA 2ZAZA 3EL7A 4RIOA 1U4DA 2JIVA 3D9VA 3QCQA 4X3JA 2CN5A 1G3NA 4FV7A 3M11A 1W83A 2BDFA 4NH1A 2XIYA 4EK6A 3UIXA 1OL1A 4OAUC 4DCAA 1JWHA 4ALVA 3PJ3A 3LOKA 3HZTA 3BHTA 3TL8A 5CF8A 1SMHA 4JQEA 4YNEA 3LXKA 1H27A 4H36A 1W84A 2B7AA 3HA6A 4FNYA 3A4OX 4JBPA 2RG6A 4HGLA 4M66A 5M44A 5IQIA 5IPJA 2OI4X 4BWKA 4UN0C 5CY3A 2F7ZE 1OKVA 3FZ1A 3QD3A 5M4IA 2GU8A 4EUTA 1KE6A 4LGGA 4ZOGA 3UNJA 3N4UA 5JQ8A 5CX9A 4F6UA 4CT2A 4KKEA 3ZZWA 3ZUUA 1GZ8A 5EKOA 1Q8TA 3Q5ZA 1UWHA 4M8TA 2CGWA 5FD2A 3BYSA 2VWZA 2PVNA 5G6VA 5A3XA 4DTKA 3UDBA 3VBXA 2KTYA 4IBMA 4C8BA 3WZJA 3LXPA 3Q9ZA 5HVYA 1NVQA 5LXMA 3QWKA 2IVVA 3EQDA 5M51A 5IKWA 3E3PA 3SOCA 4CG9A 4AA5A 2PMIA 3FHRA 3GCVA 2O2UA 1JKSA 4TYHB 2A0CX 2UZDA 3NW6A 3UP7A 5CVFA 5JEBA 4NTTA 3ZSHA 4KKGA 4JAIA 2X8EA 4XV3A 3O50A 2OXDA 4FOCA 4RX5A 1PJKA 4D0WA 4GYIA 3FXZA 3R01A 4GJ3A 1ZYDA 2HAKA 4NEUA 3UOJA 2G1TA 1PMEA 4C33A 4E1ZA 4FSUA 5J95A 4E5BA 3AC2A 2OZAA 4R5SA 5CNOA 2BMCA 3DLSA 3N51A 4JS8A 4QMZA 5FGKA 3SRVB 4ZTLA 4GSBA 5AEPA 4BIDA 2YAKA 3C9WA 4JVGA 3Q9WA 5IA5A 5IZFA 4LRJA 2JFMA 2YACA 3MPAA 5D11A 4WA9A 3A62A 2CKPA 2BRNA 4TL0A 3FMDA 3IK3A 3OS3A 1CKJA 2E9NA 2R3OA 2WMAA 5DEWA 4ORKA 1CKPA 4R3PA 2VWBA 4FV5A 3I6UA 1M7NA 4DEAA 2GTNA 2QODA 2RIOA 5AA8A 3QKLA 1Y91A 3JY0A 4YTCA 4X2NA 1V0PA 2WOTA 2QOFA 4ZMEA 2R3HA 3W55A 5IDNA 4H3QA 4BYJA 4MHAA 3D5VA 3VS0A 1BMKA 3BBWA 4EJNA 3RWPA 3U6JA 2UZLA 1BX6A 3W10A 4DGGA 3F7ZA 4NKAA 2BTSA 4FF8A 4Y5HA 2G2FA 1H01A 4K9YA 3MGYA 1H1SA 5IQGA 5A4EA 3ZEWA 3EKNA 4G31A 5HZNA 4BI0A 3W2OA 2F49A 2WQOA 3IW6A 4N70A 3VWAA 5HU9A 4AZWA 5IISA 2X6EA 3ZLYA 5E4HA 2W4KA 2C4GA 4I0TA 5L8JA 5EDPA 3KMUA 4CLIA 2W05A 4KABA 3FZTA 4FK3A 4P90A 2C6OA 3C5UA 4D9UA 5EKNA 4EC9A 3DJ6A 3A61A 4CSVA 4D1ZA 4E8AA 3HP2A 3A99A 4ACCA 4YJSA 3G2FA 4PL3A 3FLWA 2WMBA 3EL8A 4IIRA 4OBOA 4PTGA 1J7LA 2JGZA 3UOHA 5HQ0A 4WHZA 3BPRA 3NSZA 5LQFA 3QTZA 1IR3A 2J9MA 4HJOA 3BV2A 3EH9A 1M17A 4HGEA 4UXLA 3V5QA 4BWXA 1Y8GA 3KXZA 3CY2A 5AM7A 4F64A 2XBJA 4NUSA 5HO6A 2UZEA 3MIYA 2NRYA 3HMMA 1RE8A 1UNHA 3OCTA 5CLPA 4GJ2A 5M55A 4DEDA 4DFUA 3VS2A 3EKKA 4CMUA 3LVPA 3CPCA 4MXZA 1PKGA 3QA8A 4IM0A 3UVQA 1MRUA 2IN6A 4IVAA 4CZUA 2BRHA 2J90A 5CEMA 3LAUA 1JQHA 3W2PA 5HCYA 5IQBA 1P14A 2X81A 2JKQA 4RRVA 4FZ7A 5BVOA 1I44A 4MK0A 2PZYA 5CQUA 3TNPC 3AMYA 2VX1A 5JN2A 3QTRA 4NCTC 3RK9A 1H25A 4GW8A 3LMGA 3MY1A 3ZCLA 4USFA 3Q96A 1YQJA 3JR1A 3DJ7A 4W9WA 3IW5A 2Z7QA 3RM6A 4PY1A 2UZVA 4IZAA 3VUDA 5HX6A 2R0UA 4OGRA 5HICA 5A4CA 3DT1A 3BU3A 5AUYA 3L8XA 3TZMA 3VN9A 4BRXA 3FKOA 4ZLZA 2R4BA 2GNLA 4ZJVA 2GQGA 4GG7A 5IH6A 3PE2A 2PE2A 2YIWA 3AG9A 5B2KA 4D5HA 5HE1A 2P33A 2OO8X 2Y4IB 3ORXA 3QXOA 4D55A 3ENMA 5CZIA 2ITUA 2QOIA 4RFYA 2QU5A 4JRNA 3D7ZA 3TTIA 1H26A 2XK3A 2WD1A 4AN2A 1ZOGA 3QAME 3WOWA 3ZFXA 3L9PA 2RGPA 4RVLA 1R0PA 4WUAA 3UC3A 4G16A 4FKGA 3UQFA 4MCVA 5AR3A 3PYYA 2BILB 4AN9A 2PZRA 3Q4ZA 4S32A 5FQDC 2IW8A 3EQRA 4KIKB 1RJBA 5TF9A 2CCIA 2R3JA 3LKMA 4Y95A 5AAEA 5IU2A 1OUKA 4AZEA 2V22A 4CFMA 3F5GA 4FTRA 3QQFA 4XP0A 4FTLA 2F2UA 5EYKA 4B99A 5F94A 2PZPA 2C6IA 2VNWA 3VW6A 3U4WA 3LJ0A 4OTWA 3RAKA 2FSOX 3PPJA 2PUUA 2BTRA 2VWUA 4YJPA 3DAJA 3P7AA 4JG6A 3TXOA 5DN3A 3MVMA 1H0WA 2F2CB 3DOGA 1LP4A 2QOQA 4I4EA 2XNMA 4QO9A 4QOXA 5E8VA 3ZOSA 4V0GB 1XH6A 1H1WA 1L8TA 2F57A 3GEQA 1VZOA 1GIHA 4O96A 3WZEA 3K5VA 3ODYX 5IUIA 2GFCA 5AIRA 5FRIA 1X8BA 2X2MA 1P5EA 4PPCA 5J87A 2R3GA 4BIEA 5ANKA 4JNWA 3H9FA 3PVGA 1TVOA 4YZDA 4O84A 4ANNA 3LFFA 1VR2A 2I0VA 3ODZX 3NYOA 3PPZA 4WG3A 5BVKA 3CCNA 1K3AA 3D15A 3OZ6A 3OROA 4NW5A 2X0GA 5CU2A 1OVEA 2WIPA 3UO6A 3UYSA 2PUNA 2PY3A 4S31A 4U97A 4EZ3A 4V05A 2WMTA 4M15A 3QQHA 4TKSA 4WO5A 2WQNA 4DF3A 2J7TA 4O0VA 2EB3A 1JBPE 3Q04A 2XK9A 5HOAA 3QALE 2HY81 2I40A 3FLNC 2DUVA 3PG1A 2C5YA 4J98A 4GKHA 2NRUA 2UZWE 4EL9A 3O17A 1YI6A 4J71A 1OGUA 4ZSLA 2VGOA 1Q3DA 2WKMA 3BLRA 3BU6A 4BBFA 5JFVA 3KN6A 4XG4A 4OTGA 4HCTA 4IVCA 4PNIA 4XEYA 3KB7A 3F88A 3PIXA 3QTUA 4JIKA 5FWKK 4DH3A 5HTIA 2JITA 3KA0A 4YMJA 2NO3A 4QTAA 4CVAA 4FYNA 3QD0A 3BCEA 5DRBA 4R5YA 2BAJA 5M07A 4F6WA 4FNWA 5JGAA 5ANGA 2O5KA 2ITZA 2W1ZA 1YVJA 3QC4A 4CFUA 2C30A 1DS5A 4QNAA 3HL7A 4OTFA 3W2SA 3I4BA 5CTPA 2ZJWA 4AE6A 2WEIA 3QUEA 4IAYA 4KIOA 2WMSA 5DIAA 1IG1A 4TYHA 4EH9A 4I22A 2YM5A 3NZ0A 4JDJA 4K33A 4EJ7A 4KAOA 4WBBB 2ITQA 3E63A 3EQFA 4JG8A 1UU8A 4IX6A 2P0CA 3PA3A 4IC7A 3FMKA 3WIKA 4ERKA 1E9HA 4UB7A 3U6IA 4Z16A 4PV0A 2JKOA 5D7VA 4OTHA 3FMHA 3R8PA 3TT0A 3HUCA 5HO7A 5H8GA 3Q4TA 2CGXA 4OT5A 2OH4A 2PL0A 2WFYA 2VTOA 3EN6A 3R2BA 2GHLA 1ZYSA 2QOHA 3H0ZA 4EH6A 2J50A 3ZONA 3SRVA 1P4FA 4JR3A 5I9WA 3QHWA 4CXAA 1YOLA 3NNVA 5I9ZA 5ACKA 3QLFA 5E9EA 3SGCA 1OKWA 5EHOA 3ROYA 1U59A 3BYVA 5E8WA 4IZ5A 4FTAA 5EHYA 1JSVA 1ATPE 3K3IA 5CF6A 3UVRA 5LARA 2HW7A 2DYLA 4ANOA 4NWMA 2YM8A 1JSUA 3I7BA 2W1CA 2H6DA 2PHKA 4J8MA 4IW0A 3H10A 5EI2A 4DCEA 4GS6A 2GQRA 3O2MA 2YITA 3QCSA 4ITJA 3ZUTA 1IAJA 2J5EA 3TDVA 5H2UA 1NA7A 4IB3A 5BYLA 1PW2A 4JL9A 3UQGA 4HPTE 4FT7A 3OEZA 4TRLA 4Z55A 1F5QA 2R2PA 3KXGA 4EWHA 3HMIA 3GCQA 4H3BA 4O21A 3R8MA 3MH0A 5T3QA 4LL0A 2QOCA 3R30A 2UVXA 3IW4A 3NUSA 1F3MC 2FYSA 3WE4A 4M13A 3RKBA 4D2TA 3KXXA 1JAMA 1FBNA 5CI6A 3BHUA 4QQ5A 4JOAA 3TTJA 4QMQA 4F7NA 2P2IA 2WMWA 2UW6A 5JZJA 4O0YA 2BALA 2XK8A 4RJ3A 2GS6A 3RAIA 3UO4A 3K3JA 4IVDA 4EOKA 1YDSE 3QQUA 3S0OA 5DMZA 4KINA 3DV3A 2OIDA 4OLIA 4ERWA 3G6GA 5KMLA 3OOGA 4OTDA 3EN7A 3FXXA 1ZMWA 5CSVA 2XS0A 5M08A 1XWSA 4EHEA 3PA5A 3C0IA 3FSKA 2W99B 4TYJA 5C26A 3AOXA 5FDXA 3I79A 3QUPA 4S30A 2E2BA 3ORNA 4PP7A 5IMEA 4QYGA 4PL5A 2ERZE 5C27A 4YZCA 5DT4A 4I21A 2Y6OA 2UZUE 4U79A 4X21A 5FEEA 5TO8A 4D4VA 2CKOA 2I0HA 2ETMA 3CQWA 4XP2A 3TUCA 3RCJA 3MA3A 4QMLA 2UVYA 4TN6A 2J0IA 3Q3BA 5TE0A 3C4FA 3VUHA 3LFBA 4C0TA 1APME 5FXQA 1BLXA 4RBLA 1WBTA 1Q61A 2ITNA 3IW7A 3HECA 4W8DA 4X2JA 3VBYA 3HRFA 2GPHA 2KULA 1QPDA 2OSCA 4FK6A 4FL1A 4O0SA 2XJ0A 2AC3A 2YIRA 4WSYA 4F70A 2ITYA 4IAAA 3DPKA 3W2CA 4X0MA 2OZAB 3P7CA 2EVAA 3CXWA 3R8ZA 2OJ9A 5FP6A 3UODA 5J79A 5J9LA 4RX9A 3Q32A 3SAYA 2PE0A 4C4JA 2HCKA 2XIRA 4C02A 2OJIA 3MY0A 3Q2MA 3K5UA 1O6LA 2GHGA 4ASEA 4I93A 4BTMA 4ZY4A 5LVPA 1ZYCA 3R21A 2XNBA 3A7IA 5FM2A 2Y4PA 3S00A 2YIXA 4I23A 4MNEA 4LUEA 3Q9XA 4N0SA 4F6SA 5E8UA 4I3ZA 5FBOA 1PXPA 4O27B 1KUTA 2JFLA 4LMUA 5A4LA 4YZNA 2I1MA 5EDRA 3N9XA 1FVTA 3DTWA 4KB8A 2YHVA 4C4EA 4TWPA 3P4KA 3PJCA 3PDTA 3D5WA 4KBKA 1M14A 3OUKA 2VWYA 5BVDA 4ZS4A 5IG1A 4WRSA 3PSCA 4L7SA 4LRMA 5ETFA 3RPVA 4FMQA 3ROCA 2XH5A 5AM6A 3AD4A 2QG5A 4LOPA 3MB6A 2QO9A 3HX4A 4ZTNA 5H3QA 2UZBA 2YN8A 5CWZA 4KIKA 4LM5A 5IEXA 4EH3A 4XG6A 2UUEA 4ZTRA 1GY3A 2OF4A 2P4IA 4MQ2A 4J96A 4YJNA 3MY5A 4C34A 4DFZE 4DN5A 2Q83A 3PE1A 2BFXA 2WZJA 2O65A 4QMOA 3IGGA 5AWMA 3TKUA 1VYWA 2PUPA 4IM3A 3FMNA 3WI6A 4HVHA 3H9RA 1Q62A 2C5XA 3GU6A 4WD5A 1PXNA 4O81A 4IB1A 3TNHA 1XJDA 5EHLA 2ZV2A 4HVSA 3FKNA 4U40A 3MSSA 2XNNA 3GU5A 3L9NA 4QTDA 4E6CA 5HESA 2VTSA 3QQJA 2CDZA 2VTQA 4V0GA 3O96A 1YHVA 3DDPA 3FMEA 5IEYA 3DLZA 5EDQA 4IACA 3TCPA 3UNZA 2HZ0A 1PF8A 1FOTA 4U0IA 3CGOA 3RBWA 2XF0A 3H4JA 3D5XA 2BAQA 3EYHA 4D9TA 4AFEA 3CP9A 3OBGA 4WNMA 4RC4A 2WMUA 4F08A 1WMKA 5GZAA 4FZDB 5HLPA 3AMAA 4QMYA 2ZV7A 3U8WA 4XHKB 4GK3A 4QPSA 3W18A 2QKWB 2Z02A 1O6YA 5CEOA 3EFWA 1KSWA 4Q2AA 4QP1A 4YJUA 3OF0A 3PFQA 4EOQA 3QCYA 4BCOA 4FZ6A 5L6OA 4BY9E 5D10A 3NAYA 3LFEA 4BDJA 2YWVA 3QRJA 3F66A 3EN9A 5ETAA 4C58A 4BZDA 4XV2A 3HMNA 2IZSA 4JT3A 5T6KA 4XCUA 4OR5A 5HLNA 2QHMA 4UZHA 4YC8A 4GFGA 3MH1A 4XRLA 2CGUA 2ERKA 5CU3A 4CT1A 4D2WA 3OVVA 1YKRA 4EOPA 5K5NA 3WYYA 3UMXA 3VBWA 3TZ9A 3RPOA 5EYMA 4L67A 1OL5A 5DGZA 4FNZA 2YIQA 3Q52A 4B8LA 4CV8A 2W1IA 2XA4A 3E8CA 2WTKC 4N6ZA 4TZRA 2HXQA 3VS3A 4ZTMA 4CFNA 3DAKA 5J9ZA 5JSMA 4NT4A 1WBOA 2XKFA 3JVSA 1PRYA 2XYNA 2C3KA 1XKKA 2NPQA 2YEXA 3F5UA 4EQUA 4NFMA 2B9FA 3T8OA 5A6NA 5DT0A 2QCSA 3PJ2A 4O82A 3SC1A 4BDGA 3HV4A 5E1SA 5L2WA 3GGFA 2WAJA 1Y6AA 2W17A 2OXYA 3BHHA 3VUTA 1I09A 3A7JA 2VWVA 4GEOA 4FIFA 1SVGA 5ACBC 4MKCA 4FV4A 2W9FB 3S4QA 3F61A 3BEGA 4ZP5A 1YXVA 3E87A 3HVCA 4GT4A 1OBGA 4O0TA 4O6LA 4QMMA 5FP5A 1U54B 5EK7A 5KMJA 1ZZLA 3DNEA 2C6KA 2W9ZB 4Q9SA 4RA4A 1Z9XA 4GG5A 5EG3A 4ZXTA 1XBBA 5AP3A 4EH5A 4ZSEA 2VTPA 2Z7RA 3DAEA 2ZDUA 3OXIA 2W5AA 1REKA 4QNYA 4G6OA 4FNXA 1KE8A 3KRRA 4GFOA 2XJ1A 3DXNA 2R0IA 3EZRA 1UU3A 4ANSA 5IH4A 2VU3A 2SRCA 3VJOA 3AMBA 4FODA 3FC1X 2QQ7A 5CXHA 2GNHA 3BHVA 3HMOA 4A9YA 4ZZOA 4UMQA 4ALWA 5HTBA 4YZ9A 5IQDA 5C8KA 2ITTA 2CCHA 2W4JA 4G3EA 5GNKA 2RFNA 3DK6A 2ACXA 5DE2A 4APPA 4M3QA 4BCNA 3CJFA 3G9NA 5L3AA 2WPAA 4EH4A 2B54A 3I5NA 4YTHA 4EOLA 2ZMDA 2YAAA 2XK4A 4H3PA 5ETIA 3NIZA 3FV8A 2EWAA 4W4WA 1OL2A 5DT3A 2W5BA 3OUNB 4IFGA 4L3PA 2B0QA 1ZYJA 4GL9A 5GZ8A 2HY0A 1A9UA 2XIXA 2PVMA 4PTEA 5EM5A 4AZVA 2VTMA 1RW8A 3KQ7A 4U44A 3MS9A 4IWDA 5B2LA 2R3MA 1Y8YA 2QOOA 5EM7A 5IA0A 3LFCA 4LUDA 1ZARA 4FKRA 3VS5A 1YDRE 2P3GX 4U3ZA 4BZNA 1WBSA 1OIUA 4P4CA 4XLIA 4P5QA 4YJOA 4G3CA 3UJGA 4F1OA 4FT0A 2V62A 4GT5A 4Q9ZA 4FKOA 1ND4A 4BDHA 2YZLA 1SM2A 1ZYLA 2ITWA 3C4XA 3DS6A 5GIPE 3QTSA 4WSQA 3AQVA 2XP2A 4DH1A 2IG7A 5J7BA 4CYIA 5EOBA 2WU7A 4NK9A 4WBOA 3OWKA 5KHWA 3LMIA 5CENA 3Q2JA 4PDSA 2Y8OA 1MRYA 1K2PA 1PMVA 4UYAA 3TJDA 5CYIA 3ETAA 4IH8A 3EQCA 3JUHA 1FMOE 3Q6WA 4AU8A 5KKRC 4MX9A 4QQTA 3ALOA 3UYTA 3W32A 4DHFA 2DWBA 5CANA 5IQFA 4YJVA 1H08A 4EZ5A 2QO2A 2C5NA 3DXQA 3F69A 3UVPA 2C1AA 4O91A 3A7FA 4OTRA 4B9DA 4KRCA 3FZPA 4AW5A 5DPVA 3ERKA 4FL2A 5HLWA 4C4GA 2B52A 3OBJA 3I60A 1XH5A 3ALNA 3MVLA 4M84A 4KKHA 3R7VA 3DKFA 1KOBA 4F4PA 3M42A 4YUQA 1SVEA 4NM0A 1P4OA 2W1HA 1MQBA 2X7OA 3QZHA 4IAKA 4QD6A 5D12A 2E9VA 2PVLA 5C8NA 3KU2A 2WTJA 4XG9A 4R78A 5FUTA 3UNKA 3SA0A 3KCKA 3TKIA 4E3CA 4IAFA 2XCKA 5AUZA 3ACJA 3ANRA 3FHIA 3UPXA 4MYGA 2QO7A 2XB7A 3HA8A 3L9LA 4AZTA 2GS7A 4QYYA 1R1WA 5FM3A 3KRLA 3NUPA 5FG8A 1O6KA 2BROA 2JEDA 4O0WA 3QD2B 5K9IA 2QI8A 1J91A 3IO7A 2UZTA 4M0YA 3UBDA 5G1XA 2XNOA 1YOMA 2BHEA 5HEZA 5KMIA 3OY3A 4CFXA 4C4FA 3W8LA 1REJA 4IE9A 2WNTA 3MFSA 3BBTB 5A4TA 1OL6A 4UEUA 4ZTQA 2XM9A 3QQKA 4LL5A 3KMWA 4CKRA 2VGPA 3E8EA 4HOKA 3GC9A 1TKIA 3CY3A 4BCGA 3HYHA 5I9YA 2J0KA 5TT7A 4ASDA 3V5PA 4KSQA 5TKDA 5EYCA 4E6AA 4AUAA 4Z7GA 3TV4A 4ZZMA 4G2FA 4V04A 3G5DA 5ETCA 3VBTA 4PWNA 3H30A 2OJJA 3QZGA 4G5JA 4YNOA 2X2KA 5CT7A 3WZUA 4YSMA 5M53A 1GAGA 5BQ0A 3FWQA 5A46A 4NYEA 4XG2A 4CZYB 4DBNA 5JKGA 1R78A 3ZUVA 3O51A 4JDHA 3GT8A 3ATTA 2GNGA 3HNGA 4L46A 5EM8A 1JKKA 4U42A 4XMOA 4Z9LA 4QTEA 4EHZA 2CKEA 2G15A 2BRGA 5CT0A 3W16A 3F3VA 5HCXA 5AUVA 4MXAA 3TJCA 4FR4A 4JDIA 3FYKX 3ORPA 5AR7A 4IX5A 3EJ1A 3RK7A 3I0OA 4ZK5A 1PXIA 1YHSA 3ZO1A 3BV3A 4TWCA 5BVEA 5A54A 3GI3A 3FQEA 4IAZA 3WIGA 2IVTA 2J51A 4O38A 4F63A 4M67A 3VS1A 4O22A 3Q6UA 2YZAA 2R3KA 3L8SA 1WBPA 2J0MB 4CKIA 3R02A 4GMYA 5L4QA 3OTUA 1H4LA 1T46A 5AP1A 3WF9A 3DFAA 4LGDA 3RNIA 3WF6A 2H34A 4IADA 4IQ6A 4G6LA 4K77A 5DFPA 5DWRA 1J7IA 5M09A 3QX4A 5C03A 3R00A 3RINA 4FVRA 3FI2A 4C3FA 4EORA 5E92A 5BVWA 1FVRA 4NKSA 1QCFA 4FA2A 4IX3A 4IX4A 2XNPA 4BBMA 1YXSA 4BHNA 5AV3A 4HW7A 3R1YA 4USDA 4O7WA 5CI7A 4I5HA 3TIZA 3HV5A 2JDVA 4YO4A 4EEVA 2Z8CA 4G9RA 5CU4A 3MPMA 2UZOA 5CZHA 3OOMA 1GZOA 5LMAA 2QD9A 2OICA 3GC8A 3QHRA 3NS9A 3KY2A 3V5WA 2XJ2A 3GQIA 3OTVA 4MNEB 4BFMA 4C57A 3LHJA 4BKJA 4P2KA 1DAYA 4R3RA 1GIJA 4CRSA 4ENXA 2IW9A 1R3CA 4F99A 3GFEA 1XBAA 1LPUA 4IZ7A 5AP4A 3LMHA 4L44A 3MYGA 2R3PA 2X8DA 4I92A 5FDPA 4YHJA 3OWLA 4F0FA 2A19B 4A06A 5HNGA 3VC4A 3LE6A 5EYDA 3P86A 2RF9A 1FGIA 5EI6A 3QRKA 3ZDUA 5JFSA 3ZO2A 3MVHA 3MFRA 4JG7A 3T3VA 4DTBA 3P5KA 4UV0A 1HCKA 4E5AX 4ZTHA 3ZU7A 4GUEA 4X2KA 3C4EA 4PL4A 3KRWA 1GJOA 4U8ZA 4RLKA 3AC5A 2C6EA 4U7ZA 4FT5A 1KE5A 3FKLA 4GVJA 1Q3WA 2BKZA 4W4YA 3KXHA 5IA2A 1M2QA 5EI8A 4IEBA 3ZXZA 1U54A 1Q24A 4BCJA 3QF9A 4TT7A 4AGUA 3QCXA 4EOIA 4EOMA 3QZIA 2PZ5A 4DH7A 5AR4A 4R7HA 3NIEA 4W4VA 4O0RA 5BYZA 2ETKA 2YLFA 4HVDA 1KV1A 1YWRA 4EKKA 2WMRA 3R9NA 5BPYA 1XH9A 3D4QA 2Q0BA 4I41A 3QD4A 3IDPA 4NIFA 4BI1A 4D5KA 4FEVA 3UP2A 3TN8A 3R9RA 5BVNA 4FIIA 4X2FA 1NT2A 2YLEA 1M52A 2J2IB 4XOZA 3CSVA 1H24A 4KBCA 4WIHA 4O7TA 3R63A 4IAIA 2YWPA 4BN1A 1JLUE 3R22A 3PWYA 3II5A 4HGSA 1UKIA 1WBNA 4FVPA 4J97A 4C62A 3OG7A 2QOLA 1U5QA 2OXXA 4K6ZA 4BYIA 5AAGA 4BDBA 3RZBA 4OAVB 3NGAA 3BQCA 4O0UA 1YW2A 3V8WA 4CTBA 4MBIA 4QMUA 1IASA 5EW3A 2X9EA 2GFSA 2JKKA 3BEAA 4I20A 3O8TA 4AW2A 3OY1A 2FVDA 4EOJA 2W1EA 2X6DA 3ORKA 4F9YA 2YCSA 3V5TA 4F9CA 2RG5A 4QYFA 1OPLA 3KL8A 3GQLA 5AUWA 4E26A 4Q5HA 2Y4IC 4QMXA 4Y46A 4NU1A 1FINA 5AV1A 2QKRA 4UBAA 2V7OA 5I9UA 5L2IA 4KBAA 4GT3A 3R0TA 4OUCA 2VO3A 2VX3A 4FKTA 3V8TA 2CHLA 1JKTA 4G3FA 4O1PA 3C1XA 3FMMA 4XLVA 3F5XA 3NUUA 4EYMA 3CJGA 2JAVA 5HTCA 3S95A 2XKEA 1YDTE 3P9JA 2WB8A 3A7HA 4XNEA 3RPRA 4ITHA 4B6LA 3VUKA 4M0ZA 4YPSA 4U45A 3GC0A 4D28A 3FY2A 3V51A 5ANOA 3Q4UA 4RC3A 2WMQA 2JD5A 2XEYA 4JBQA 2VTAA 4RZVA 3LQ5A 1S9JA 4QT1A 1OIQA 2IZTA 5JRSA 1XH4A 3ANQA 2WGJA 3DK3A 3ZSIA 4RX7A 4DLIA 5I3RA 4A07A 2C6LA 4IANA 4QTCA 4BHZA 2X7FA 4CD0A 4D4RA 1SVHA 4EYJA 3U9NA 2VRXA 4G6NA 4LI5A 3O8PA 3QTQA 5HORA 3NCGA 3DBFA 3LM0A 3A8XA 3O23A 1H07A 1B38A 4GIHA 2QURA 4GRBA 4QP7A 3EQIA 4QPAA 4R7IA 5DVRA 1LEZA 1PYXA 4XP3A 4DG0E 5LMKC 4NSTA 4QMTA 2EB2A 4X3FB 3UG2A 3DU8A 4KUJA 2C0OA 1Q99A 4GVAA 1URCA 3EQPA 5DNRA 3BRBA 4BCMA 4HYHA 4N6YA 3EQGA 1VYZA 3ZFYA 5KMOA 4LYNA 3D5UA 2OKRA 4FE2A 4XV9A 3EB0A 3BZ3A 4MD7E 4AQCA 1XH8A 3PXFA 1WBVA 3IECA 2J6MA 4LGHA 5HBHA 3NUAA 2WOUA 5TR6A 2LGCA 3QL8A 2C1BA 4FKPA 4BCIA 5KHXA 4NL0A 2XMYA 3LQ3A 2WMVA 5EFQA 4RC2A 3PPKA 5DLSA 3AC1A 3D0EA 4H1JA 3ZDIA 3V8SA 2OJFE 5AR5A 1H1QA 3PJ8A 3OP5A 2OH0E 4FTIA 3QYZA 3LZBA 2JDRA 4KIQA 1IRKA 4CG8A 3UG1A 2WQBA 4I5PA 2FUMA 3VHKA 3C5IA 5AP5A 4MNFA 5CAVA 4U80A 4E73A 2BDJA 3P08A 1JPAA 4KD1A 5LVOA 2XM8A 5L6PA 1JKLA 1XO2B 4R8QA 4IJPA 4AOIA 3BYUA 1PXOA 5JT2A 4CGAA 1GZNA 2C3IB 3LQ8A 3NEWA 3PSBA 3PXQA 5KE0A 4A9UA 3RGFA 4CTCA 3FYJX 1SNUA 3AT3A 2EXMA 4M97A 4NTSA 4U9AA 4I6FA 4WRGA 4YJRA 1WZYA 4NCTA 2X1NA 4G9CA 5GIOE 3D2KA 3SQQA 3RP9A 4ARKA 2JKMA 3VF8A 4FZAB 3O7LB 3IS5A 3RNYA 1BUHA 4D1XA 4CLJA 4FTQA 4DFNA 2OW3A 2GS2A 2XIZA 3N4VA 4H05A 4FSZA 2HZIA 3GXLA 4HZSA 5KO1A 4M14A 4LMNA 1OECA 4IXPA 5KNJA 4GIIA 2BRMA 2W0JA 3CKWA 5I9VA 2YCFA 2QG7A 2HZNA 3FBVA 5CVGA 1BL7A 4MBJA 2C0TA 1QPEA 5JFWA 3OEFX 3GNIB 4XYFA 4JIAA 3LFDA 2DQ7X 5E8SA 4ZZNA 1RDQE 3I6WA 1MP8A 4TTHB 4FTMA 2XNEA 3E8DA 4IZYA 4BCHA 3C7QA 3VS6A 5HIEA 2UVZA 4FV9A 1ZY4A 3BWFA 3V6RA 4FEUA 2WTIA 5GZ9A 1Q8YA 3LFQA 4J8NA 3PVBA 4D4YA 4EI4A 1BL6A 3R7OA 1AD5A 3S3IA 4A9SA 5D9HA 3DNDA 5J1VA 3MJ2A 3QGYA 2V5QA 3UC4A 3DBQA 3VUGA 1NY3A 5EOLA 4BDDA 5M06A 5EW8A 4MAOA 1QL6A 3PWDA 2PU8A 4WKQA 1SNXA 1KOAA 1CSNA 4PMMA 2J4ZA 4BC6A 5M56A 1H0VA 4DH8A 5CEPA 2RFDA 4E7WA 3BHYA 3VO3A 3NVMB 3KC3A 1M2RA 3CC6A 4TXCA 4OW8A 1AGWA 4CCBA 5FBNC 5KMNA 4WUNA 3ZC6A 5K0XA 2QONA 3EZVA 4FKWA 1Y6BA 5FTOA 2WU6A 3FZSA 5KZIA 1OITA 3A7GA 4L00A 4ZIMA 3R9OA 4EHVA 4P7EA 3F3UA 5DA3A 4QMNA 5EQPA 4AWIA 5HHWA 2IPXA 5JH6A 4EK5A 4IC8A 1URWA 1LEWA 3BIZA 3EFLA 3S1HA 5I3OA 4UMRA 4BB4A 2JC6A 3OD6X 4YLLA 3QTWA 4YLKA 1V0BA 4U5JA 3KFAA 3QLGA 3T9IA 5LCKA 2CKQA 4GK4A 2A2AA 1IA9A 2CGVA 3AT2A 4FSYA 4YP8A 4O86A 2R7BA 3G0FA 3UZRA 1ZOEA 3SW7A 1J7UA 3R28A 2W1DA 4GKIA 4ZAUA 2FH9A 4DH5A 3GU4A 5HKMA 3OCGA 3W33A 4OTQA 3T9TA 3QRIA 2C68A 1ZAOA 3MDYA 3B8QA 4XV1A 3UE4A 3F5PA 1OUYA 3OXZA 4JX7A 4XBRA 3R9HA 2ZV8A 2VD5A 5HG5A 4EH2A 3UTOA 3AC4A 2W1FA 5C8MA 4G17A 4N4SA 3JY9A 4ZSGA 3UIBA 3SKCA 1DI8A 2WTDA 4AOTA 2YDJA 4F65A 1WBWA 3G9LX 5IUHA 5M4FA 4MWHA 2ETRA 3UOLA 3NVKI 1KE9A 2BCJA 4I6QA 2REIA 4QMSA 5GJFA 3E3BX 4AZFA 5ANIA 4RJ5A 2C6DA 2GTMA 3CEKA 3BWJA 4DYMA 3KEXA 3ZM9A 4DTAA 4XG8A 1JNKA 2H9VA 2ZOQA 2YFXA 2VNYA 4JXFA 1EH4A 3HP5A 3WF7A 4DE4A 4BCFA 4S2ZA 5AV4A 4EUUA 4BTJA 5IQAA 3ZXTA 4FKVA 4PDPA 1OL7A 3ZLXA 4TYGA 3ZLSA 2PTKA 5F4NA 1UV5A 3DBEA 3GENA 1LR4A 3R1QA 4YHTA 4AGWA 2PZIA 4U43A 3PTGA 4D4SA 3QU0A 3LW0A 4B0GA 3UGCA 3K2LA 2EXEA 3KXNA 3M1SA 5E8YA 4HVIA 1PYEA 3L8PA 3KULB 3PIYA 4ITIA 4HVGA 3FI8A 5C4LA 1OI9A 2UW4A 4O6EA 3QRUA 2BIYA 4ZSJA 4A4OA 4F1TA 4JBOA 4B4LA 1L3RE 2BDWA 2G01A 3HV3A 5FEQA 3SXFA 4BVUA 3QKMA 4F7SA 3LCDA 4RWKA 4FKQA 4MQ1A 2XNGA 4FSRA 4BDCA 4V01A 2GSFA 3TKHA 4R3CA 5E8TA 3FSFA 3WZKA 3ATSA 2C3LA 3KF4A 3PA4A 5L2SA 4FKJA 2ZM3A 3MFUA 2VTIA 5H8EA 3MW1A 2FB8A 3ORIA 5HGIA 3TG1A 3VUMA 3ZO4A 4ANQA 5AA9A 3ZTXA 4FTJA 2H8HA 3LCSA 3W2QA 4DFBA 3FZOA 3IOKA 4IHPA 2PMLX 4K2RA 5CAUA 2GMXA 2UW5A 3EFKA 4F0IA 2OFVA 4X7QA 5AX9A 2C6MA 2CN8A 3CGFA 3R8LA 2OG8A 4FICA 4YTFA 1J3HA 1O9UA 3UIMA 3OWPA 3FLYA 4AA0A 2AYPA 4FTCA 2YERA 1WCCA 4FT3A 5CQWA 3VQHA 3PXYA 5DEYA 3O71A 4U6RA 3SV0A 4C3RA 4BDEA 4TPTA 1HOWA 5H8BA 2X4FA 1CTPE 5AP6A 2A1AB 2ONLA 2YISA 3GUBA 4IFCA 4II5A 1PMNA 2JDTA 2XBAA 3T3UA 3ZZEA 4F7JA 2PMOX 2HENA 3GP0A 1NXKA 1YOJA 4NZWB 4F9AA 5CSPA 1YI4A 2ZVAA 4G5PA 1QPJA 2YDIA 3IPHA 3R73A 4TWOA 4CNHA 4HNIA 4WG4A 3A8WA 4EOOA 3U55A 4DEEA 3PXRA 3R8VA 3E5AA 3RAHA 2J0LA 2R7IA 4X6QC 4YHFA 4OTIA 5I9XA 2HIWA 1ZOHA 3DZQA 2H96A 2VTTA 3FL4A 3HKOA 2PE1A 2FSLX 4FV0A 4FSMA 3ORMA 4E6DA 5AUUA 3U54A 4DEBA 4PP9A 3GCSA 5JMSA 2GNJA 4X3FA 5KMKA 3PIZA 1QMZA 5BUJA 4IJ9A 1H1RA 3BI6A 1VEBA 3F6XA 4HCVA 4GU6A 3CTJA 2NNWB 1UA2A 4Y83A 5DI1A 4FV6A 4N57A 1DM2A 1Z5MA 4XS2A 5FTQA 2QNJA 3LM5A 3IKAA 2X8IA 4FGBA 4RT7A 2A27A 4PMSA 4FTUA 4TYEA 5AX3A 3O0GA 5HNBA 3V01A 4LQMA 3PXZA 4MH7A 5I4NA 4MF1A 4XUFA 3DFCB 4KNBA 3ORLA 4RWJA 5EH0A 2C5OA 1WVWA 3QGWA 4C2WA 2X7GA 3MVJA 3QUDA 4NIFB 4NM5A 3IW8A 2LAVA 3E62A 2W1GA 3PP1A 4IWOA 4DG3E 3PZEA 5DH3A 5J8IA 2VTLA 5CAQA 4ACMA 1XHAA 1JVPP 4FG8A 4L9IA 2XK7A 3UPZA 3F3WA 2BKKA 4PF4A 4U81A 4K18A 4NJ3A 4O0XA 3F2RA 4Q5EA 4Y73A 5BMMA 5KCVA 1KE7A 5AR2A 4IM2A 4IWPA 3R7UA 4CMOA 4ZTSA 3D14A 3O8UA 2ZMCA 4MXXA 3VRYA 1OIRA 3G90X 3R71A 3TNQB 4BF2A 3SXRA 2XIKA 2HW6A 3HV7A 1WFCA 4ZEGA 3RVGA 2O3PA 3GCPA 2UW7A 1OIYA 4MBLA 4UX9A 1BKXA 4BDKA 1NVRA 3F82A 2YIYA 4FKUA 4RQKA 3WF8A 3N4TA 3PXKA 4GV1A 1PXJA 4BDFA 4USEA 2ZYBA 4FZFB 4DFLA 4FT9A 2I7QA 4I1ZA 3EWHA 5FTGA 2R3NA 2OIQA 2OJGA 4JR7A 2W7XA 5CU6A 4KRDA 4NFNA 4AN3A 5IQCA 2F9GA 4MEDA 2BHHA 2CPKE 1DAWA 3GCUA 3NYXA 3RMFA 3FMJA 3FJQE 4MF0A 4DITA 2PVKA 5F1ZA 5AMNA 5DRDA 2PUIA 5AFVA 4EK3A 4L45A 4EQCA 5HCZA 5M4CA 1OBDA 4E4XA 3HDNA 4O7SA 4EH8A 5FEDA 1E1XA 4BI2A 5K4IA 5IH5A 5DR9A 2X4ZA 2JAMA 4I5CA 1DI9A 2C5VA 4JAJA 1PKDA 4PRJA 2VZ6A 3LCOA 2IVSA 5ANDA 2QR8A 3FQSA 4UMTA 4AE9A 4C59A 4FEXA 4A9RA 4K11A 2OF2A 4QYEA 1M7QA 1OMWA 3HRCA 3QZFA 3PZHA 5JGDA 3NW7A 4AGCA 3DKCA 4UXQA 2W96B 2Y7JA 3PY3A 2Z7SA 4FBXA 1JOWB 1NW1A 1TQIA 2CMWA 4XBUA 4A4LA 4MTAA 4EH7A 5HVJA 4ZS0A 3ZH8A 4DFYA 5M4UA 2OK1A 3VULA 1E1VA 2F4JA 3W8QA 2UW9A 1G5SA 2B9HA 5C01A 3EN5A 3HAMA 4WNOA 2B53A 4QYHA 5DBXA 2WTVA 3P1AA 3TV7A 3R04A 5B7VA 4IVBA 3PLSA 3RCDA 5BVFA 4U3YA 3DA6A 3POOA 4DGMA 4UWYA 3R7EA 4DBXA 4R1YA 3BX5A 4FKLA 3ZRMA 3P0MA 3FPMA 4GFMA 4YJTA 2YM7A 5IA3A 2HYYA 3EHAA 1CMKE 3CIKA 1GIIA 4QP6A 2BPMA 3NUXA 2WQMA 3ORZA 3IQ7A 2CNQA 1PHKA 3KRJA 3SX9A 3SD0A 4EC8A 3ID6C 4FV2A 3PSDA 1ZZ2A 4WG5A 4G1WA 2OBJA 1WVXA 4RA5A 2G9XA 4EBVA 2VTJA 1YXTA 2B1PA 3JPVA 1LUFA 4F1MA 4RSSA 3NCZA 5DYJA 1PXLA 5EQYA 2VUWA 4HNFA 4ACHA 1Q8ZA 3ORTA 5BNJA 4E4LA 4HYIA 3LLTA 4YLJA 5ANEA 1ERKA 5BX0A 3DZOA 3LPBA 3GBZA 3OHTA 3VAPA 3VIDA 2GDOA 1XBCA 3RHKA 2B4SB 3R7IA 4ZJIA 4L53A 3D7TA 3PG3A 2X9FA 3FLZA 3RAWA 3TEIA 3VBQA 3RI1A 1WAKA 2GQSA 4XOYA 3L9MA 3HAVA 2ITOA 4F0GA 3FMLA 3CKXA 1PY5A 3NX8A 3RZFA 3HRBA 4GU9A 3U4UA 5L2TA 3Q9YA 2HOGA 3U51A 5AAFA 4NJDA 3BYMA 1IAHA 4RJ6A 3MI9A 4RFMA 2QLQA 2RL5A 2YCQA 4QP8A 5K0KA 4G3DA 1ZLTA 4XH6A 5E8XA 1Q4LA 4RIXB 4FUYA 3ZM4A 4EZ7A 3UO5A 4HZRA 3KK9A 5HIBA 3VRZA 3QTIA 4ANBA 3DGKA 4EWQA 3AT4A 5TOZA 4ASXA 4MXOA 3CS9A 2C47A 4YURA 3SW4A 3BQRA 4DT9A 2PMNX 5AP7A 4I0RA 4HYSA 2QHNA 2VWWA 3TV6A 3P23A 3KULA 4A9TA 5AUXA 4GYGA 5HD7A 4PPBA 4D2RA 5LVMA 4DLJA 3DTCA 4L52A 3E7VA 2X39A 3LFAA 1CM8A 3PVWA 4FSWA 3BYOA 4R1VA 3ZC5A 4ASZA 1U5RA 1FQ1B 2VAGA 5KUPA 3OCBA 3GOKA 2BZHB 4I24A 2UW3A 4GK2A 5I0BA 3COIA 4CRLA 5DR2A 4J99A 3DBCA 3E88A 4FIJA 4OBPA 3I5ZA 3MH2A 2FSTX 3NDMA 1PXKA 4DC2A 2JLDA 4BCKA 4KA3A 1M2PA 4C61A 4DGLC 3MBLA 4BGGA 4B8MA 4E4MA 4ZMFA 2VO7A 4IDTA 4CFVA 3EN4A 3KMMA 2JBPA 3HV6A 3FZRA 3R7GA 4RVMA 5IQHA 2XKDA 1Q8WA 4WNKA 1MRVA 4L3JA 4QQJA 3FAAA 1G8AA 3MTLA 2WELA 3R6XA 5DR6A 3NYVA 4HCUA 5CVHA 5F95A 2ZM1A 3A2CA 4LV8A 4RFZA 4RIWB 3PJ1A 3MESA 5CASA 2QLUA 4GH2A 4RWIA 5CF4A 4FTOA 3DKGA 3QQLA 4CQEA 5IUGA 3DJ5A 3MTFA 4RQVA 5CNNA 3OC1A 4WNPA 5CF5A 3F3ZA 3BKBA 3BU5A 4KS7A 4L8MA 4YZBA 2FO0A 3CBLA 4EHGA 4AAAA 3CD8A 3RALA 5EQEA 1MUOA 4O7ZA 4D2PA 4IB0A 4I6BA 2QOKA 4QP3A 4FUXA 3NWWA 3TNWA 1H28A 3C0GA 4FTKA 4YR8A 1OM1A 3KKVA 3EMGA 2XRWA 4J1RA 2WEVA 2Y0AA 2R3QA 5LVLA 1TQMA 4BL1A 4DINA 1YXXA 4M7IA 4X2GA 4YJQA 4YTIA 5L2QA 1Z57A 2B9IA 2EXCX 2ZDTA 4Z3VA 3F9NA 3PRFA 4RPVA 4RVTA 4YZMA 3ZRLA 5L8KA 4E4NA 3RPYA 1U46A 3AD5A 4O7YA 4NW6A 3KGAA 4FI1A 4UY9A 4JQ8A 4D58A 3FXWA 4QP9A 3DCVA 2QU6A 3G51A 4FG7A 3R7YA 3R8UA 3CQUA 4RZWA 3IGOA 3BGQA 5C9CA 4BKZA 2HWPA 2BVAA 5IMXA 4E6QA 2VX0A 4S33A 3C0HA 4OTPA 4AT4A 3VHEA 4TNBA 4BKYA 5LWMA 3Q4CA 2OIBA 1R0EA 2YDKA 2YABA 1Q97A 5HE2A 2VV9A 3LCKA 3MB7A 3MH3A 4AZSA 3F2AA 3ULIA 4APCA 2ZV9A 3CTQA 4QTBA 2E9OA 4IMYA 3H3CA 1OZ1A 5JRQA 4FL3A 3EOCA 4XX9A 3EQHA 4G3GA 4DEHA 4YSJA 2R3LA 3SHEA 5CSWA 3NNWA 3LFNA 3AXWA 3ET7A 4AX8A 4PQNA 4FSTA 5IEVA 4IDVA 3QFVA 3PUPA 3LLAA 1ZMVA 3CR0A 1OKYA 3H0YA 3CPBA 3SDJA 1G8SA 2EU9A 4QRCA 3MN3A 4RIYB 4ZLOA 4AW0A 2YM6A 1QPCA 3OW3A 5LMBA 5GHVA 2X2LA 2J5FA 3OMVA 4TWNA 3GU7A 5C1QB 2JBOA 4PPAA 3O7LD 5HE3A 4ZJJA 4BTFA 3MJ1A 4JLCA 5KZ0A 2PPQA 4WT6A 3DBDA 4NM3A 5HG7A 3LJ1A 3ZFMA 3IOPA 2FA2A 3MFTA 3AD6A 4UMUA 1ZMUA 4ONAA 4RX8A 4M69B 3HLLA 5K3YA 4ANLA 4GUBA 5LCJA 1R39A 2RFEA 3C4ZA 4FVQA 3DB8A 4TYIA 4UWBA 2Z2WA 1GOLA 5HIDA 1Q41A 4AW1A 2C3JA 2O63A 3ELJA 5T68A 2O0UA 3TZ8A 4CV9A 2Z60A 2YJSA 4FTNA 4I4FA 4FV1A 5AP2A 3JYAA 4C2VA 5JGBA 5M57A 3F7WA 3EFJA 4BCQA 2QC6A 3VW8A 2I0YA 3M2WA 4MXCA 2FSMX 3OT8A 4YC6A 2BRBA 4BICA 5E8ZA 4PX6A 4O83A 3QWJA 3UZTA 1YXUA 2IVUA 2R9SA 5DG5A 1B6CB 4B7TA 2BZIB 5A14A 2XUUA 3D94A 3UIUA 4O7LA 3HEGA 3B2WA 3I81A 3QQGA 4XG3A 1YRPA 3AC8A 3OXTA 3DDQA 3F2NA 5IF1A 4AG8A 2P55A 4ZY5A 3G33A 2BFYA 5HNIX 1UNLA 1OB3A 1FGKA 3AGMA 3DB6A 4YO6A 2VN9A 3R83A 3KREA 4Y72A 2AC5A 1KWPA 2C0IA 3GOPA 2XZSA 3MWUA 2BIKB 4FGRA 3Q5IA 1YWVA 2PVFA 3R1SA 4ID7A 5LVNA 5E90A 4FIEA 1BYGA 3V6SA 3FE3A 5ICPA 4RJ4A 2I6LA 4BZOA 5HO8A 3OCSA 1UU9A 2R3IA 1YWNA 3B8RA 4I6HA 4C4IA 2PVHA 4D0XA 3WBLA 4YU2A 2QOBA 3H9OA 4RJ8A 3LCTA 3UQCA 2V55A 3SOAA 1W0XC 2W06A 4ZY6A 4ZLYA 4E5WA 3W1FA 5FXRA 3DKOA 5ANJA 5J9YA 4R77A 4QP2A 4BBEA 4FV8A 3PLAE 2B9JA 3FC2A 2PWLA 2VWXA 2WTCA 2W5HA 4JRVA 2G2HA 4Y8DA 3V5LA 3L1SA 3QX2A 5A4QA 2QR7A 5JZNA 3AGLA 4ANMA 4O7NA 4J7BA 1FMKA 5HD4A 3NUYA 4FKIA 5CU0A 5E7RA 1H00A 5J1WA 3HGKA 5KX8A 3VS7A 4JJRA 4CFWA 2CLQA 4EK4A 4DA5A 3EYGA 4JX3A 2ONLC 2R64A 3WE8A 3COHA 5JQ5A 5AJQA 4RMZA 4AP7A 1B39A 3WARA 2OWBA 1XR1A 2JIUA 2PVYA 4ACGA 4DFXE 3RK5A 3I0QA 1ZY5A 3E93A 2WHBA 2R5TA 5CSHA 5F20A 3VBVA 4CMTA 4L42A 3CQEA 2XCHA 5JK3A 4M68A 2Z7LA 3DQWA 4L7FA 1PMUA 2RSVA 5D41A 5KBQA 4PUZA 4QMPA 4MD9E 3C4WA 4KIPA 4RIXA 4XJ0A 3UMWA 4CYJA 3JVRA 2XYUA 2QVSE 1SZMA 3E64A 2WTWA 2C6TA 4I94A 4E93A 4UMPA 5JFXA 5KMMA 4ENYA 3PRIA 4EK8A 4UWCA 2OZOA 2IO6A 4LRKA 4YBKA 3VS4A 1W7HA 3TZ7A 4AACA 2ITVA 4K8AA 2YM4A 4AXAA 3VUIA 4Z7HA 3BE2A 1V1KA 2XVDA 1ZRZA 5K4JA 4F9WA 4FTTA 4X3FC 5BUEA 3CLYA 3WZDA 4J52A 2WO6A 3C4CA 3QYWA 4C7TA 1VJYA 3VVHA
chains in the Genus database with same CATH superfamily
3MIAA 5GJGA 1K9AA 2OU7A 3PP0A 1S9IA 3KCFA 3ZRKA 3ZEPA 3SG8A 2XEZA 3RHXA 5J7HA 1OKZA 3MA6A 5HE0A 2IW6A 3QBNA 2R3RA 5CEIA 4A4XA 3OT3A 5HBEA 3HMPA 2CJMA 3BE9A 5AIKA 3LFSA 4K1BA 3A60A 4DEGA 5CALA 1JSTA 3RPSA 4KWPA 3AC3A 4JQ7A 3U9CA 3V5JA 3FPQA 3C50A 4PMPA 5A9UA 4W4XA 4DT8A 1Q5KA 3KRXA 2JDOA 2JIIA 3FUPA 5LWNA 3FI4A 2YJRA 4R6VA 3MV5A 3CTHA 5GJDA 4OT6A 4RLLA 1TQPA 4FIHA 4RIWA 5HI2A 2BZKB 2XKCA 4C35A 2VTRA 4BR3A 3HDMA 2F7XE 1H8FA 3VJNA 4C38A 3SLSA 3MPTA 2E9UA 3FLSA 2WXVA 3E8NA 2R3FA 4AXFA 4I0SA 1UKHA 3OFMA 5BUIA 3KN5A 1YHWA 2PVRA 3E7OA 4RGJA 3NR9A 3PY0A 2PULA 3TUBA 3POZA 4MXYA 2JDSA 3GFWA 3FLQA 2DS1A 3UOKA 3TDWA 1F0QA 2FGIA 1UVRA 3SXSA 3WILA 5LJJA 4D2VA 2V7AA 5E1EA 4K0YA 4TY1A 4PDYA 1XQZA 4P5ZA 4DGOA 3NPCA 3QC9A 4HYUA 3C13A 1UNGA 3QRTA 2NP8A 4EKLA 5HG9A 3IG7A 3ENHA 4EQMA 1GZKA 4BGHA 4UYNA 2G2IA 2V0DA 2VTNA 5AV0A 4FYOA 3KVXA 3D7TB 3P79A 2PVJA 5CS6A 5AUTA 3DQXA 3CD3A 3BLHA 4D2SA 5B2MA 3BGZA 4MVFA 3TMOA 3JXWA 2F7EE 3FDNA 1ZWSA 4YPDA 2Y6MA 3IONA 3NUNA 4BIBA 3SG9A 2HZ4A 4YC3A 5IA1A 2CNVA 2PK9A 3RWQA 3A4PA 5AADA 5IDPA 4MD8E 4EONA 2BUJA 2GNIA 2RFSA 1NVSA 2WIHA 4C36A 4LOQA 2VO6A 3UZPA 4C37A 4HPUE 4C4HA 1Y57A 4L3LA 1W82A 3TUDA 2E9PA 4ALUA 4QMWA 2WTKB 3FL5A 2O64A 2P2HA 1FPUA 4JDKA 4PDOA 4XRJA 3GB2A 4AA4A 4FG9A 2C69A 1H1PA 4FC0A 4CCUA 5CXZA 4PMTA 4O1OA 1SYKA 3IDCA 4QEBA 3GC7A 2ESMA 2OFUA 3BELA 4KSPA 1W8CA 2UW8A 3QKKA 5K5XA 4X6RA 1STCE 3F3TA 2ZM4A 4H58A 1W2CA 2IZUA 3I7CA 3EQBA 5HX8A 3NYNA 4FX3A 3RJCA 3Q53A 3ZYAA 4I5MA 3NNUA 2YM3A 1OPKA 3COMA 4TW9A 3S2PA 3D2IA 2HWOA 3OW4A 3TWJA 4DEIA 3TNIA 4DG2E 2XANA 2I0EA 1IA8A 3U87A 3P7BA 4RVKA 4WOVA 4DAWA 2Q0NA 3FY0A 3VQUA 3ZO3A 3LJ2A 4I6LA 4O7RA 2BZJA 2HK5A 3ZSGA 3B2TA 1W2FA 4JBVA 4C3PA 1CDKA 3KVWA 4BTKA 2VWIA 1Q8UA 5ITAA 3KF7A 3TM0A 2XRUA 1BI7A 3HUBA 4R7BA 4RIYA 2ITXA 3LXLA 5LMKA 4EBWA 4S34A 3ZLWA 3CE3A 2PYWA 1MQ4A 2VTHA 3TI1A 4QPMA 5HG8A 4TNDA 1UWJA 4O2PA 4QMVA 3SVVA 4QDVA 1J1BA 3JS2A 5J5SA 4OBQA 5EW9A 1TFFA 4RG0A 5AR8A 1ZXEA 3WF5A 4CKJA 1AQ1A 3ZHPC 4W9XA 1UU7A 4XG7A 2XK6A 3NRMA 3QTXA 3ACKA 4G34A 4LG4A 4DGNA 4L6QA 3KXMA 4M69A 4NM7A 4QP4A 3THBA 2OGVA 3G15A 4BCPA 5A6OA 5LOHA 3U6HA 2CNUA 1GNGA 3R1NA 5HVKA 3DXPA 5CSXA 5E91A 1KV2A 5BMSA 5C4KA 1V0OA 1P2AA 4A7CA 3FEGA 4AFJA 3NLBA 2GNFA 3V04A 2ZB1A 3FI3A 2VO0A 3QXPA 5FLFA 1PXMA 2ZB0A 3WYXA 4EOSA 5GINE 4LOOA 1T45A 2RKUA 3ZS5A 5KBRA 3NW5A 4AT3A 4L43A 2UZNA 5IA4A 4CEGA 5HBJA 4FV3A 4GCJA 2WMXA 5J5TA 5H9BA 4FOBA 1W98A 4L68A 1J1CA 4UZDA 3L8VA 2NYAA 3R2YA 5I5ZA 4JI9A 1RQQA 4W8EA 1A06A 2CLXA 2EUFB 3C51A 4Y5QA 4UALA 3V3VA 4CZTA 2Y9QA 5DHJA 2AUHA 4FSNA 4AGDA 4F9BA 4FSQA 3ULZA 1CKIA 2PSQA 1OPJA 3R9DA 4FEQA 5D7AA 2HELA 2GCDA 4RWLA 4ZSAA 4L01A 5DOSA 3QA0A 2UV2A 4QQCA 2GHMA 3COKA 5IQEA 2A4LA 3P78A 4O4DA 3IDBA 3K54A 3VF9A 3NNXA 4D1SA 2ITPA 5FXSA 3E92A 3G0EA 2HXLA 3LXNA 3TIYA 4ACDA 2WQEA 4BDIA 1WVYA 4J53A 3ZBFA 4O2ZA 4FEWA 4BDAA 4U41A 2YCRA 2W4OA 2AQXA 4AT5A 5CEKA 4PNKA 3TACA 4O7VA 3G6HA 4AQKA 3W2RA 3KK8A 5CAOA 2O8YA 4F09A 2IZRA 5AV2A 4H1MA 4E20A 3BLQA 1BI8A 4H39A 2IJMA 5F9EA 5KKRB 3PY1A 3VNTA 1A48A 1HCLA 3RM7A 2YA9A 4IB5A 5CEQA 3GU8A 4LV5A 2J0JA 4KS8A 4IWQA 1IEPA 5BYYA 4HGTA 5L6WL 4AS0A 2B55A 1FVVA 3BGPA 3EIDA 3FQHA 5EM6A 3ZBXA 3DK7A 3NMUF 4YGAA 3I1AA 4BWPA 2CSNA 2IWIA 3DY7A 2BR1A 4AOJA 3Q60A 3LIJA 3D83A 4FIGA 4YBJA 5B0XA 3GVUA 3OWJA 3ZMMA 2UW0A 3ITZA 5AP0A 5CAPA 1XH7A 4J95A 3NAXA 4CFFA 5HU3A 4MWIA 3PVUA 1YI3A 4LFIA 2BAKA 4AF3A 4BGQA 4CQGA 4RJ7A 2OLCA 4FKSA 5D1JA 4F7LA 5L8LA 4PTCA 4M12A 4Y85A 3REPA 3RTPA 2ZAZA 3EL7A 4RIOA 1U4DA 2JIVA 3D9VA 3QCQA 4X3JA 2CN5A 1G3NA 4FV7A 3M11A 1W83A 2BDFA 4NH1A 2XIYA 4EK6A 3UIXA 1OL1A 4OAUC 4DCAA 1JWHA 4ALVA 3PJ3A 3LOKA 3HZTA 3BHTA 3TL8A 5CF8A 3W0MA 1SMHA 4JQEA 4YNEA 3LXKA 1H27A 3UDZA 4H36A 1W84A 2B7AA 3HA6A 4FNYA 3W0QA 3A4OX 4JBPA 2RG6A 4HGLA 4M66A 5M44A 5IQIA 5IPJA 2OI4X 4BWKA 4UN0C 5CY3A 2F7ZE 1OKVA 3FZ1A 3QD3A 5M4IA 2GU8A 4EUTA 1KE6A 4LGGA 4ZOGA 3UNJA 3N4UA 5JQ8A 5CX9A 4F6UA 4CT2A 4KKEA 3ZZWA 3ZUUA 1GZ8A 5EKOA 1Q8TA 3Q5ZA 1UWHA 3NFGB 4M8TA 2CGWA 5FD2A 3BYSA 2VWZA 2PVNA 5G6VA 5A3XA 4DTKA 3UDBA 3VBXA 2KTYA 4IBMA 4C8BA 3WZJA 3LXPA 3Q9ZA 5HVYA 1NVQA 5LXMA 3QWKA 2IVVA 3EQDA 5M51A 5IKWA 3E3PA 3SOCA 4CG9A 4AA5A 2PMIA 3FHRA 3GCVA 2O2UA 1JKSA 4TYHB 2A0CX 2UZDA 3NW6A 3UP7A 5CVFA 5JEBA 4NTTA 3ZSHA 4KKGA 4JAIA 2X8EA 4XV3A 3O50A 2OXDA 4FOCA 4RX5A 1PJKA 4D0WA 4GYIA 3FXZA 3R01A 4GJ3A 1ZYDA 2HAKA 4NEUA 3UOJA 2G1TA 1PMEA 4C33A 4E1ZA 4FSUA 5J95A 4E5BA 3AC2A 2OZAA 4R5SA 5CNOA 2BMCA 3DLSA 3N51A 4JS8A 4QMZA 5FGKA 3SRVB 4ZTLA 4AAYA 4GSBA 5AEPA 4BIDA 3BLAA 2YAKA 3C9WA 4JVGA 3Q9WA 5IA5A 5IZFA 4LRJA 2JFMA 2YACA 2X0QA 3MPAA 5D11A 4WA9A 3A62A 2CKPA 2BRNA 4TL0A 3AKKA 3FMDA 3IK3A 3OS3A 1CKJA 2E9NA 2R3OA 2WMAA 5DEWA 4ORKA 1CKPA 4R3PA 2VWBA 4FV5A 3I6UA 1M7NA 4DEAA 2GTNA 2QODA 2RIOA 5AA8A 3QKLA 1Y91A 3JY0A 4YTCA 4X2NA 1V0PA 2WOTA 2QOFA 4ZMEA 2R3HA 3W55A 5IDNA 4H3QA 4BYJA 4MHAA 3D5VA 3VS0A 1BMKA 3BBWA 4EJNA 3RWPA 3U6JA 2UZLA 1BX6A 3W10A 4DGGA 4JMQA 3F7ZA 4NKAA 2BTSA 4FF8A 4Y5HA 2G2FA 1H01A 4K9YA 3MGYA 1H1SA 5IQGA 5A4EA 3ZEWA 3EKNA 4G31A 5HZNA 4BI0A 3W2OA 2F49A 2WQOA 3IW6A 4N70A 3VWAA 5HU9A 4AZWA 5IISA 2X6EA 3ZLYA 5E4HA 2W4KA 2C4GA 4I0TA 5L8JA 5EDPA 3KMUA 4CLIA 2W05A 4KABA 3FZTA 4FK3A 4P90A 2C6OA 3C5UA 4D9UA 5EKNA 4EC9A 3DJ6A 3A61A 4CSVA 4D1ZA 4E8AA 3HP2A 3A99A 4ACCA 4YJSA 3G2FA 4PL3A 3FLWA 2WMBA 3EL8A 4IIRA 4OBOA 4PTGA 1J7LA 2JGZA 3UOHA 5HQ0A 4WHZA 3BPRA 3NSZA 5LQFA 3QTZA 1IR3A 2J9MA 4HJOA 3BV2A 3EH9A 1M17A 4HGEA 4UXLA 3V5QA 4BWXA 1Y8GA 3KXZA 3CY2A 5AM7A 4F64A 2A98A 2XBJA 4NUSA 5HO6A 2UZEA 3MIYA 2NRYA 3HMMA 1RE8A 1UNHA 3OCTA 5CLPA 4GJ2A 5M55A 4DEDA 4FJVA 3VS2A 3EKKA 4CMUA 3LVPA 5BV3A 3CPCA 4MXZA 1PKGA 3QA8A 4IM0A 3UVQA 1MRUA 2IN6A 4IVAA 4CZUA 2BRHA 2J90A 5CEMA 3LAUA 1JQHA 3W2PA 5HCYA 5IQBA 1P14A 2X81A 2JKQA 4RRVA 4FZ7A 5BVOA 1I44A 4MK0A 2PZYA 5CQUA 3TNPC 3AMYA 2VX1A 5JN2A 3QTRA 4NCTC 3RK9A 1H25A 4GW8A 3LMGA 3MY1A 3ZCLA 4USFA 3Q96A 1YQJA 3JR1A 3DJ7A 4W9WA 3IW5A 2Z7QA 3RM6A 4PY1A 2UZVA 4IZAA 3VUDA 5HX6A 2R0UA 4OGRA 5HICA 5A4CA 3DT1A 3BU3A 5AUYA 3L8XA 3TZMA 3VN9A 4BRXA 3FKOA 4ZLZA 2R4BA 2GNLA 4ZJVA 2GQGA 4GG7A 5IH6A 3PE2A 2PE2A 2YIWA 3AG9A 5B2KA 4D5HA 1OGYA 3TYKA 5HE1A 2P33A 2OO8X 2Y4IB 3ORXA 3QXOA 4QDEA 4D55A 3ENMA 5CZIA 2ITUA 2QOIA 4RFYA 2QU5A 4JRNA 3D7ZA 3TTIA 1H26A 2XK3A 2WD1A 4AN2A 1ZOGA 3QAME 3WOWA 3ZFXA 3L9PA 2RGPA 4RVLA 1R0PA 4WUAA 3UC3A 4G16A 4FKGA 3UQFA 4MCVA 5AR3A 3PYYA 2BILB 4AN9A 2PZRA 3Q4ZA 4S32A 5FQDC 2IW8A 3EQRA 4KIKB 1RJBA 5TF9A 2CCIA 2R3JA 3LKMA 4Y95A 5AAEA 5IU2A 1OUKA 4AZEA 2V22A 4CFMA 3F5GA 4FTRA 3QQFA 4XP0A 4FTLA 2F2UA 5EYKA 4B99A 5F94A 2PZPA 2C6IA 2VNWA 3VW6A 3U4WA 3LJ0A 4OTWA 3RAKA 2FSOX 3PPJA 2PUUA 2BTRA 2VWUA 4YJPA 3DAJA 3P7AA 4JG6A 3TXOA 5DN3A 3MVMA 1H0WA 2F2CB 3DOGA 1LP4A 2QOQA 4I4EA 2XNMA 4QO9A 4QOXA 5E8VA 3ZOSA 4V0GB 1XH6A 1H1WA 1L8TA 2F57A 3GEQA 1VZOA 1GIHA 4O96A 3WZEA 1XMLA 3K5VA 3ODYX 5IUIA 2GFCA 5AIRA 5FRIA 1X8BA 2X2MA 1P5EA 4PPCA 5J87A 2R3GA 4BIEA 5ANKA 4JNWA 3H9FA 3PVGA 1TVOA 4YZDA 4O84A 4ANNA 3LFFA 1VR2A 2I0VA 3ODZX 3NYOA 3PPZA 4WG3A 5BVKA 3CCNA 1K3AA 3D15A 3OZ6A 3OROA 4NW5A 2X0GA 5CU2A 1OVEA 2WIPA 3UO6A 3UYSA 2PUNA 2PY3A 4S31A 4U97A 4EZ3A 4V05A 2WMTA 4M15A 3QQHA 4TKSA 4WO5A 2WQNA 4DF3A 2J7TA 4O0VA 2EB3A 1JBPE 3Q04A 2XK9A 5HOAA 3QALE 2HY81 2I40A 3FLNC 2DUVA 3PG1A 2C5YA 4J98A 4GKHA 2NRUA 2UZWE 4EL9A 3O17A 1YI6A 4J71A 1OGUA 4ZSLA 2VGOA 1Q3DA 2WKMA 3BLRA 3BU6A 4BBFA 5JFVA 3KN6A 4XG4A 4OTGA 4HCTA 4IVCA 4PNIA 4XEYA 3KB7A 3F88A 3PIXA 3QTUA 4JIKA 5FWKK 4DH3A 5HTIA 2JITA 3KA0A 4YMJA 2NO3A 4QTAA 4CVAA 4FYNA 3QD0A 3BCEA 5DRBA 4R5YA 2BAJA 3NFFB 5M07A 4F6WA 4FNWA 5JGAA 5ANGA 2O5KA 2ITZA 2W1ZA 1YVJA 3QC4A 4CFUA 2C30A 1DS5A 4QNAA 3HL7A 4OTFA 3W2SA 3I4BA 5CTPA 2ZJWA 4AE6A 2WEIA 3QUEA 4IAYA 4DHIB 4KIOA 2WMSA 5DIAA 1IG1A 4TYHA 4EH9A 4I22A 2YM5A 3NZ0A 4JDJA 4K33A 4EJ7A 4KAOA 4WBBB 2ITQA 3E63A 3EQFA 4JG8A 1UU8A 4IX6A 2P0CA 3PA3A 4IC7A 3FMKA 3WIKA 4ERKA 1E9HA 4UB7A 3U6IA 4Z16A 4PV0A 2JKOA 5D7VA 4OTHA 3FMHA 3R8PA 3TT0A 3HUCA 5HO7A 5H8GA 3Q4TA 2CGXA 4OT5A 2OH4A 2PL0A 2WFYA 2VTOA 3EN6A 3R2BA 2GHLA 1ZYSA 2QOHA 3H0ZA 4EH6A 2J50A 3ZONA 3SRVA 1P4FA 4JR3A 5I9WA 3QHWA 4CXAA 1YOLA 3NNVA 5I9ZA 5ACKA 3QLFA 5E9EA 3SGCA 1OKWA 5EHOA 3ROYA 1U59A 3BYVA 5E8WA 4IZ5A 4FTAA 5EHYA 1JSVA 1ATPE 3K3IA 5CF6A 3UVRA 5LARA 2HW7A 2DYLA 4ANOA 4NWMA 2YM8A 1JSUA 3I7BA 2W1CA 2H6DA 2PHKA 4J8MA 4IW0A 3H10A 5EI2A 4DCEA 4GS6A 2GQRA 3O2MA 2YITA 3QCSA 4ITJA 3ZUTA 1IAJA 2J5EA 3TDVA 5H2UA 1NA7A 4IB3A 5BYLA 1PW2A 4JL9A 3UQGA 4HPTE 4FT7A 2XARA 3OEZA 4TRLA 4Z55A 1F5QA 2R2PA 3KXGA 4EWHA 3HMIA 3GCQA 4H3BA 4O21A 3R8MA 3MH0A 5T3QA 4LL0A 2QOCA 3R30A 2UVXA 3IW4A 3NUSA 1F3MC 2FYSA 3WE4A 4M13A 3RKBA 4D2TA 3KXXA 1JAMA 1FBNA 5CI6A 3BHUA 4QQ5A 4JOAA 3TTJA 4QMQA 4F7NA 2P2IA 2WMWA 2UW6A 5JZJA 4O0YA 2BALA 2XK8A 4RJ3A 2GS6A 3RAIA 3UO4A 3K3JA 4IVDA 4EOKA 1YDSE 3QQUA 3S0OA 5DMZA 4KINA 3DV3A 2OIDA 4OLIA 4ERWA 3G6GA 5KMLA 3OOGA 4OTDA 3EN7A 3FXXA 1ZMWA 5CSVA 2XS0A 5M08A 1XWSA 4EHEA 3PA5A 3C0IA 3FSKA 2W99B 4TYJA 5C26A 3AOXA 5FDXA 3I79A 3QUPA 4S30A 2E2BA 3ORNA 4PP7A 5IMEA 4QYGA 4PL5A 2ERZE 5C27A 4YZCA 5DT4A 4I21A 2Y6OA 2UZUE 4U79A 4X21A 5FEEA 5TO8A 4D4VA 2CKOA 2I0HA 2ETMA 3CQWA 4XP2A 3TUCA 3RCJA 3MA3A 4QMLA 2UVYA 4TN6A 2J0IA 3Q3BA 5TE0A 3C4FA 3VUHA 3LFBA 4C0TA 1APME 5FXQA 1BLXA 4RBLA 1WBTA 1Q61A 2ITNA 3IW7A 3HECA 4W8DA 4X2JA 3VBYA 3HRFA 2GPHA 2KULA 1QPDA 2OSCA 4FK6A 4FL1A 4O0SA 2XJ0A 2AC3A 2YIRA 4WSYA 4F70A 2ITYA 4IAAA 3DPKA 3W2CA 4X0MA 2OZAB 3P7CA 2EVAA 3CXWA 3R8ZA 2OJ9A 5FP6A 3UODA 5J79A 5J9LA 4RX9A 3Q32A 3SAYA 2PE0A 4C4JA 2HCKA 2XIRA 4O4CA 4C02A 2OJIA 3MY0A 3Q2MA 3K5UA 1O6LA 2GHGA 4ASEA 4I93A 4BTMA 4ZY4A 5LVPA 1ZYCA 3R21A 2XNBA 3A7IA 5FM2A 2Y4PA 3S00A 2YIXA 4I23A 4MNEA 4LUEA 3Q9XA 4N0SA 4F6SA 5E8UA 4I3ZA 5FBOA 1PXPA 4O27B 1KUTA 2JFLA 4LMUA 4O4EA 5A4LA 4YZNA 2I1MA 5EDRA 3N9XA 1FVTA 3DTWA 4KB8A 2YHVA 4C4EA 4TWPA 3P4KA 3PJCA 3PDTA 3D5WA 4KBKA 1M14A 3OUKA 2VWYA 5BVDA 4ZS4A 5IG1A 4WRSA 3PSCA 4L7SA 4LRMA 5ETFA 3RPVA 4FMQA 3ROCA 2XH5A 5AM6A 3AD4A 2QG5A 4LOPA 3MB6A 2QO9A 3HX4A 4ZTNA 5H3QA 2UZBA 2YN8A 5CWZA 4KIKA 4LM5A 5IEXA 4EH3A 1XMMA 4XG6A 2UUEA 4ZTRA 1GY3A 2OF4A 2P4IA 4MQ2A 4J96A 4YJNA 3MY5A 4C34A 4DFZE 4DN5A 2Q83A 3PE1A 2BFXA 2WZJA 2O65A 4QMOA 3IGGA 5AWMA 3TKUA 1VYWA 2PUPA 4IM3A 3FMNA 3WI6A 4HVHA 3H9RA 1Q62A 2C5XA 3GU6A 4WD5A 1PXNA 4O81A 4IB1A 3TNHA 1XJDA 5EHLA 2ZV2A 4HVSA 3FKNA 4U40A 3MSSA 2XNNA 3GU5A 3L9NA 4QTDA 4E6CA 5HESA 2VTSA 3QQJA 2CDZA 2VTQA 4V0GA 3O96A 1YHVA 3DDPA 3FMEA 5IEYA 3DLZA 5EDQA 4IACA 3TCPA 3UNZA 2HZ0A 1PF8A 1FOTA 4U0IA 3CGOA 3RBWA 2XF0A 3H4JA 3D5XA 2BAQA 3EYHA 4D9TA 4AFEA 1TZDA 3CP9A 3OBGA 4WNMA 4RC4A 2WMUA 4F08A 1WMKA 5GZAA 4FZDB 5HLPA 3AMAA 4QMYA 2ZV7A 3U8WA 4XHKB 4GK3A 4QPSA 3W18A 2QKWB 2Z02A 1O6YA 5CEOA 3EFWA 1KSWA 4Q2AA 4QP1A 4YJUA 3OF0A 3PFQA 4EOQA 3QCYA 4BCOA 4FZ6A 5L6OA 4BY9E 5D10A 3NAYA 3LFEA 4BDJA 2YWVA 3QRJA 3F66A 3EN9A 5ETAA 4C58A 4BZDA 4XV2A 3HMNA 2IZSA 4JT3A 5T6KA 4XCUA 4OR5A 5HLNA 2QHMA 4UZHA 4YC8A 4GFGA 3MH1A 4XRLA 2CGUA 2ERKA 5CU3A 4CT1A 4D2WA 3OVVA 1YKRA 4EOPA 5K5NA 3WYYA 3UMXA 3VBWA 3TZ9A 3RPOA 5EYMA 4L67A 1OL5A 5DGZA 4FNZA 2YIQA 3Q52A 4B8LA 4CV8A 2W1IA 2XA4A 3E8CA 2WTKC 4N6ZA 4TZRA 2HXQA 3VS3A 4ZTMA 4CFNA 3DAKA 5J9ZA 5JSMA 4NT4A 1WBOA 2XKFA 3JVSA 1PRYA 3AKLA 2XYNA 2C3KA 1XKKA 2NPQA 2YEXA 3F5UA 1W2DA 4EQUA 4NFMA 2B9FA 3T8OA 5A6NA 5DT0A 2QCSA 3PJ2A 4O82A 3SC1A 4BDGA 3HV4A 5E1SA 5L2WA 3GGFA 2WAJA 1Y6AA 2W17A 2OXYA 3BHHA 3VUTA 1I09A 3A7JA 2VWVA 4GEOA 4FIFA 1SVGA 5ACBC 4MKCA 4FV4A 2W9FB 3S4QA 3F61A 3BEGA 4ZP5A 1YXVA 3E87A 4DDGA 3HVCA 4GT4A 1OBGA 4O0TA 4O6LA 4QMMA 5FP5A 1U54B 5EK7A 5KMJA 1ZZLA 3DNEA 2X0OA 2C6KA 2W9ZB 4Q9SA 4RA4A 1Z9XA 4GG5A 5EG3A 4ZXTA 1XBBA 5AP3A 4EH5A 4ZSEA 2VTPA 2Z7RA 3DAEA 2ZDUA 3OXIA 2W5AA 1REKA 4QNYA 4G6OA 4FNXA 1KE8A 3KRRA 4GFOA 2XJ1A 3DXNA 2R0IA 3EZRA 1UU3A 4ANSA 5IH4A 2VU3A 2SRCA 3VJOA 3AMBA 4FODA 3FC1X 2QQ7A 5CXHA 2GNHA 3BHVA 3HMOA 4A9YA 4ZZOA 4UMQA 4ALWA 5HTBA 4YZ9A 5IQDA 5C8KA 2ITTA 2CCHA 2W4JA 4G3EA 5GNKA 3W0PA 2RFNA 3DK6A 2ACXA 5DE2A 4APPA 4M3QA 4BCNA 3CJFA 3G9NA 5L3AA 2WPAA 4EH4A 2B54A 3I5NA 4YTHA 4EOLA 2ZMDA 2YAAA 2XK4A 4H3PA 5ETIA 3NIZA 3FV8A 2EWAA 4W4WA 1OL2A 3W0SA 5DT3A 2W5BA 3OUNB 4IFGA 4L3PA 2B0QA 1ZYJA 4GL9A 5GZ8A 2HY0A 1A9UA 2XIXA 2PVMA 4PTEA 5EM5A 4AZVA 2VTMA 1RW8A 3KQ7A 4U44A 3MS9A 4IWDA 5B2LA 2R3MA 1Y8YA 2QOOA 5EM7A 5IA0A 3LFCA 4LUDA 1ZARA 4FKRA 3VS5A 1YDRE 2P3GX 4U3ZA 4BZNA 1WBSA 1OIUA 4P4CA 4XLIA 4P5QA 4YJOA 4G3CA 3UJGA 4F1OA 4FT0A 2V62A 4GT5A 4Q9ZA 4FKOA 1ND4A 4BDHA 2YZLA 1SM2A 1ZYLA 2ITWA 3C4XA 3DS6A 5GIPE 3QTSA 4WSQA 3AQVA 2XP2A 4DH1A 2IG7A 5J7BA 4CYIA 5EOBA 2WU7A 4NK9A 4WBOA 3OWKA 5KHWA 3LMIA 5CENA 3Q2JA 4PDSA 2Y8OA 1MRYA 1K2PA 1PMVA 4UYAA 4O4BB 3TJDA 5CYIA 3ETAA 4IH8A 3EQCA 3JUHA 1FMOE 3Q6WA 4AU8A 5KKRC 4MX9A 4QQTA 3ALOA 3UYTA 3W32A 4DHFA 2DWBA 5CANA 5IQFA 4YJVA 1H08A 4EZ5A 2QO2A 2C5NA 3DXQA 3F69A 3UVPA 2C1AA 3VONA 4O91A 3A7FA 4OTRA 4B9DA 3ML1A 4KRCA 3FZPA 4AW5A 5DPVA 3ERKA 4FL2A 5HLWA 4C4GA 2B52A 3OBJA 3I60A 1XH5A 3ALNA 3MVLA 4M84A 4KKHA 3R7VA 3DKFA 1KOBA 4F4PA 3M42A 4YUQA 1SVEA 4NM0A 1P4OA 2W1HA 1MQBA 2X7OA 3QZHA 4IAKA 4QD6A 5D12A 2E9VA 2PVLA 5C8NA 3KU2A 2WTJA 4XG9A 4R78A 5FUTA 3UNKA 3SA0A 3KCKA 3TKIA 4E3CA 4IAFA 2XCKA 5AUZA 3ACJA 3ANRA 3FHIA 3UPXA 4MYGA 2QO7A 2XB7A 3HA8A 3L9LA 4AZTA 2GS7A 4QYYA 1R1WA 5FM3A 3KRLA 3NUPA 5FG8A 1O6KA 2BROA 2JEDA 4O0WA 4O4FA 3QD2B 5K9IA 2QI8A 1J91A 3IO7A 2UZTA 4M0YA 3UBDA 5G1XA 2XNOA 1YOMA 2BHEA 5HEZA 5KMIA 3OY3A 4CFXA 4C4FA 3W8LA 1REJA 4IE9A 2WNTA 3MFSA 3BBTB 5A4TA 1OL6A 4UEUA 4ZTQA 2XM9A 3QQKA 4LL5A 3KMWA 4CKRA 2VGPA 3E8EA 4HOKA 3GC9A 1TKIA 3CY3A 4BCGA 3HYHA 5I9YA 2J0KA 5TT7A 4ASDA 3V5PA 4KSQA 5TKDA 5EYCA 4E6AA 4AUAA 4Z7GA 3TV4A 4ZZMA 4G2FA 4V04A 3G5DA 5ETCA 3VBTA 4PWNA 3W0RA 3H30A 2OJJA 3QZGA