5L6PA

Ephb3 kinase domain covalently bound to an irreversible inhibitor (compound 6)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
274
Chain Sequence
CVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNPASLKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-B receptor 3
publication title Development of Specific, Irreversible Inhibitors for a Receptor Tyrosine Kinase EphB3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 274
sequence length 274
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l6pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l6pA01
3R8UA 4C4IA 2VTPA 2EVAA 4FKIA 5HU9A 1KOAA 3K3IA 2QOQA 3SDJA 1OL2A 4AOTA 2ZMDA 3DK3A 4YHJA 3JS2A 3TNHA 4CT1A 4Y8DA 3UP7A 2UZOA 3R63A 2QO7A 3KN6A 1M7QA 4YTCA 3F3UA 3ZS5A 5EHYA 4C3PA 2LGCA 4UMUA 4I94A 2ZDTA 1SVEA 2J51A 3CJFA 2IW6A 4XRJA 2BRGA 3VF8A 4L52A 4EC9A 3LFDA 2QG7A 1JSVA 3RBWA 1YHVA 3TXOA 3FMDA 3PIYA 2G01A 3M2WA 5FBOA 3QXOA 3QD3A 4A9TA 2YN8A 4HVIA 2XP2A 4HGSA 5IEYA 1IG1A 1U59A 3EQFA 1VYZA 2VWYA 2WMBA 4KIQA 3IONA 2HENA 3I81A 4D5HA 2QURA 2OIDA 4AP7A 4RA5A 4EH2A 5I9WA 3HP5A 5K9IA 3I4BA 3A4PA 3ACKA 2OH4A 4K1BA 5J5TA 3GENA 4CTBA 5K0XA 2AYPA 4PNIA 2XCHA 4GVJA 1JWHA 2C47A 4PWNA 5LCJA 4UZDA 5GZ9A 4XLIA 3PA3A 4DA5A 4B8MA 2GFCA 1MRYA 3H30A 4S33A 4F64A 2XRUA 1XH4A 2UZEA 3ZFXA 3RPYA 4ZZOA 4BGHA 2ITVA 1OBDA 2P3GX 1M17A 1L3RE 3ZZWA 4WG3A 2X9EA 4WBBB 4D0XA 4M69A 4BCMA 3D94A 5DWRA 4KINA 3HUCA 4FSTA 2W5AA 4C57A 4W4WA 1PYXA 4BCGA 1JKLA 4TZRA 1PJKA 3GI3A 4RVKA 4I92A 4XG8A 4YBJA 4AW5A 4BHZA 4FTTA 5FTQA 2JD5A 3F2RA 4S30A 3RAWA 1U46A 3CGOA 3HECA 4TN6A 3COKA 4B6LA 3PPKA 4QP4A 2O0UA 4BCIA 3IOKA 2BHEA 4FK3A 4IJPA 4GYIA 3OG7A 4FT9A 4KKGA 5LVOA 4NW5A 4OTPA 3R8MA 3W2RA 2NO3A 4BIBA 3T9TA 2Q0NA 3UC3A 3KFAA 4AZWA 3BYUA 3ORZA 3LFNA 4NFMA 5CVGA 1KV2A 4M69B 4C2VA 4YMJA 5JRQA 2WTWA 1VJYA 3NYVA 3RWQA 4DFLA 1LPUA 2WOTA 1REJA 3GU7A 4FL2A 2DYLA 3COMA 5HO8A 1WVXA 3COHA 4C2WA 3UO4A 4QQTA 4M97A 1PRYA 2FYSA 3MJ1A 3DXQA 4B9DA 2HAKA 2CNUA 3CTJA 3MFSA 3PRFA 3KEXA 2X8DA 4Q5HA 4BTKA 4BTMA 1Y57A 3QZGA 4TNBA 3ZONA 4KWPA 2PPQA 3MVMA 4GG7A 3O8UA 4O2ZA 3V5TA 1AQ1A 3AGLA 2VWZA 1IA8A 3MVJA 4O82A 1UKIA 2C4GA 4BN1A 2BTRA 1KSWA 5KMLA 3Q52A 5ANOA 5KNJA 5HG9A 2ETKA 2F4JA 4J52A 4O1PA 2VUWA 3UOLA 4C4JA 4FV1A 4IVDA 5CI7A 4CZYB 3NVKI 3ZLYA 4IACA 4DH8A 1Y6AA 2W1EA 5M06A 4OTIA 3B2TA 4JDKA 3LKMA 3ZRLA 2QKRA 4F1TA 4IAIA 4F9WA 4E6CA 3G9NA 2HIWA 2W1IA 3NIZA 4YPSA 4RX5A 3UO5A 3ZBXA 4U40A 1O6YA 5F4NA 3W55A 4FNWA 4E4NA 1Y6BA 2UZUE 4ZTQA 3V8TA 4YHTA 2OJJA 2P33A 3ITZA 3NGAA 3DAKA 4JNWA 3GUBA 3UNKA 3FLYA 4G6LA 4CFXA 3LOKA 2ZDUA 4I5PA 4ZZMA 5JFSA 2E9PA 4IVAA 3V8SA 2HXQA 4C3FA 5AFVA 2UVZA 2YM6A 2Q0BA 4P5ZA 1OL7A 4RBLA 5F1ZA 4NJDA 1H26A 1IRKA 3CC6A 2YIWA 3FDNA 4UBAA 4NTTA 4IX3A 5C8KA 3HKOA 2QU6A 4RJ7A 5IZFA 2YZLA 2VGOA 2HZ4A 2X8EA 5L2TA 1ZARA 3CQEA 3CJGA 5D1JA 3PXQA 4AQCA 2C30A 4DT9A 2VTRA 3EN5A 4H3QA 2WELA 3MY0A 3VBYA 4J96A 2CGUA 1X8BA 4BCNA 2VU3A 2OI4X 4KD1A 5IMEA 1FQ1B 3LJ1A 3DBEA 3SG9A 5CQUA 3R9HA 1Y8YA 4YJVA 3VULA 3GP0A 4M0YA 4NM0A 4XP0A 4FT0A 3FZSA 4H3BA 1GJOA 3OY3A 3O23A 5BYZA 4B8LA 4YJSA 5E8UA 5CYIA 2XCKA 3TZ8A 3OD6X 4WBOA 3V6SA 4D2TA 3SOCA 4LUEA 1PXIA 3F6XA 3SA0A 4GL9A 2YM3A 3MPTA 4PRJA 5HI2A 4U7ZA 3TTJA 4E6DA 3U55A 3P4KA 4I1ZA 4G3DA 4AZEA 3ACJA 2R3QA 4FL3A 3COIA 4BICA 4RA4A 4J8MA 5DH3A 5M56A 1TQIA 3DT1A 3VHKA 4AW2A 3IK3A 3RK5A 3UVPA 4NIFA 4YJUA 5AR4A 4FTIA 2O65A 5B0XA 4ZLYA 4FKTA 3GBZA 4MXYA 4EOLA 2UZDA 2V22A 5IMXA 5KZ0A 4O7SA 4MXXA 1Q8UA 3P7CA 4IIRA 4BCFA 2YCRA 2RIOA 3VQUA 4BCJA 5IDNA 5T68A 4ZEGA 4DEEA 2WMTA 3F3VA 2X2LA 4CCUA 5KHWA 3JY9A 5AM7A 3PTGA 1OITA 5EG3A 1XH7A 3E8CA 4BDKA 3MIAA 4RG0A 2NNWB 4FEWA 4CGAA 2QLUA 2W4KA 2XA4A 4NIFB 3SC1A 3GNIB 3LFAA 5K4JA 4N4SA 4LUDA 4JX3A 3AQVA 4O1OA 5DT3A 3IO7A 4Q2AA 3UOJA 3FQEA 2ITUA 3G5DA 4ZY6A 2IZTA 3LW0A 3R83A 4AN9A 1ZOGA 4DBXA 3NNVA 5EQPA 3UBDA 3IGGA 4LGGA 3QCXA 4DHFA 3POZA 1P14A 3TNIA 3BPRA 4K8AA 4LOPA 5AUTA 1WFCA 2QHNA 1OKVA 5HE2A 5IQAA 3D2KA 4E4LA 5HIEA 4DFNA 3FMMA 3QA8A 4RIXA 2WTDA 4EH3A 2NP8A 3NUPA 4H1MA 3R8LA 2HZ0A 3FXZA 4G5JA 2XEYA 4YTFA 4O7TA 3NW7A 5EM6A 3R1QA 3QFVA 4W9XA 2OLCA 1Q8YA 4FSRA 4AGCA 4QTDA 3N9XA 3R2YA 3OCSA 4O6EA 2YEXA 3Q4UA 4FTOA 4PQNA 3A7HA 1UU9A 3MTFA 3W2CA 4OTWA 4YJPA 2WU7A 5EM7A 2QCSA 4QRCA 4WD5A 2X81A 1QPCA 3T3UA 1ZYJA 5HBEA 1JKSA 3A62A 5C8MA 4FV8A 4ZSAA 3RAKA 4RIXB 3CEKA 5IQFA 3KXGA 2W1FA 2X2KA 3I7BA 3EL7A 5ANGA 1ZMUA 4IM3A 1A9UA 3MESA 4RIOA 3TV6A 3IS5A 1UU3A 4EJ7A 3II5A 2J0KA 4AN2A 4IQ6A 2PVHA 5CF6A 5JQ8A 3ORPA 3DPKA 3OY1A 5FDXA 4YUQA 4DEDA 4R7IA 4H1JA 3ID6C 1LEZA 4QYHA 2DWBA 3DFCB 2IVTA 4FTAA 1S9IA 1WVWA 4FTMA 3U9NA 2X4ZA 3NNWA 3D7TA 3OXTA 3QRIA 4I23A 4BBMA 3Q2MA 3BQRA 3KF7A 4IZ5A 1WZYA 3R71A 2XS0A 1KWPA 3CE3A 3VRZA 5M44A 1NW1A 3DDPA 3HA6A 5AA8A 2H34A 4O7WA 2Y4PA 4Z16A 5HTCA 2YJRA 3QAME 4FTKA 2R3JA 1H25A 1ZYDA 4RSSA 1RE8A 2W1CA 3GVUA 2DQ7X 5AX3A 2ITOA 4IC8A 2ITWA 3E3BX 2X6DA 4QTCA 5CZHA 4YJQA 4BVUA 2J4ZA 3AC5A 1JKKA 2XBJA 3QD4A 3KA0A 3KVWA 4R6VA 2V0DA 4IB5A 5TKDA 2KTYA 5AAEA 3D7TB 2XKDA 2XYNA 2VTLA 4CQGA 4OTHA 3QLFA 4IX6A 2R3RA 2IPXA 1PYEA 5D7AA 2CN5A 3TT0A 4BY9E 3ZSIA 3D4QA 3BGQA 3NWWA 1CSNA 4MHAA 1JKTA 2F7EE 1SM2A 2FUMA 4U80A 5HU3A 3VC4A 4D58A 3L8SA 4RWKA 2UZBA 2BPMA 2H8HA 4IZAA 4IM2A 5BUIA 1KUTA 2FO0A 2GHLA 1M14A 4PPBA 3UZTA 2C6DA 2WGJA 4EQMA 3R02A 3DY7A 4NTSA 3DKGA 1OI9A 1OL5A 4CFVA 4EBWA 2IZSA 2WQOA 3EQDA 3LM5A 4FVQA 3ANRA 1ZXEA 4O27B 5JKGA 4FKSA 2QQ7A 3E64A 4U3ZA 2PSQA 3S3IA 3ZSHA 1FVRA 4RIYA 4C02A 5AP0A 1U5QA 3E7OA 4YZDA 4QQ5A 4W4YA 2GNHA 3K5VA 4GVAA 3QCQA 3KXHA 2I1MA 4WT6A 3ROCA 3C0HA 2A0CX 2C6OA 4A9YA 3EN6A 1YWVA 4IAFA 3PA4A 4NT4A 4U44A 2VWWA 2R5TA 3PRIA 2YM4A 3P86A 1HCKA 4JBQA 4O0XA 5AUVA 3CD8A 4FYOA 2BKZA 3PJ3A 4YJTA 5IQCA 3QTIA 5IA3A 2C3KA 4AU8A 3FZRA 3MB7A 4IB3A 4ZJIA 3PIZA 5LMKA 1MRUA 5EW8A 3AXWA 2OFUA 1YI3A 2B1PA 2WEIA 4RIYB 5DEWA 3PLAE 2W4OA 3CSVA 4KIPA 2WQNA 5EOBA 4D1ZA 4EONA 4IFCA 2R3MA 2PUUA 2XJ1A 2PVNA 3LFFA 4L46A 5HEZA 4LMNA 2ITNA 1L8TA 2X6EA 4I0RA 4E3CA 1DI9A 3NCZA 4X6QC 3IPHA 2YZAA 3ZUVA 5G1XA 5GJFA 4EHGA 4YU2A 4YO6A 4FT3A 2YA9A 4HJOA 1IASA 5CEIA 3OXZA 3R28A 4FIHA 2QU5A 1F3MC 2J0MB 1W0XC 3C4EA 3WE4A 5HE3A 4ZTMA 2GS7A 2YISA 3R0TA 1FMKA 1SYKA 5DHJA 1M7NA 3FSKA 3R7IA 4YURA 3LFQA 2XK9A 4HVHA 5I9XA 5CF5A 3SXRA 4MX9A 4OTQA 4RLLA 5AV0A 3QWKA 3RTPA 3R8PA 1XBCA 3CCNA 3PVBA 5IA5A 5CU3A 2VX3A 1WBSA 4KSQA 4GUBA 3RM6A 1YOMA 4ASXA 3VAPA 3LPBA 4E1ZA 1OMWA 3BBWA 1WBPA 1OKYA 4QPAA 3R22A 4H3PA 4DH7A 5CAPA 5E8YA 1BI8A 3FJQE 2OJ9A 3F5GA 4FIGA 2BILB 2VTJA 2PVLA 3QU0A 1OPKA 1YVJA 2XKEA 5AP3A 3THBA 1Q61A 2BCJA 4APCA 4R1YA 4EUTA 3SW7A 2R0UA 3BYMA 2C1BA 4AWIA 4FF8A 1PXMA 4LV5A 5EDQA 3ORNA 4BRXA 3LFEA 5C4LA 5E8ZA 1YWRA 3QRKA 3VVHA 4E4MA 4EK3A 4G16A 2JDSA 3W1FA 4XNEA 2W9ZB 4BDFA 4KSPA 1UVRA 4K77A 5FQDC 4FUXA 3EQRA 4OUCA 2CCHA 4AG8A 2E9NA 4O7YA 3C4FA 4OT5A 1PHKA 4UALA 3KXMA 4FT7A 4ZK5A 1NXKA 3S00A 5CQWA 5GJGA 3R7OA 4NZWB 4AGDA 5HTBA 2HK5A 3IW4A 3MW1A 5TT7A 4ZAUA 4X0MA 4E6AA 4I4FA 1BUHA 4WOVA 4MXOA 3SAYA 1IA9A 3ZRMA 3EQGA 4AOIA 2PU8A 3LJ2A 2OIQA 3O7LB 3E8DA 3SRVA 5EM5A 5EK7A 4BTFA 1LUFA 3S4QA 4GIHA 4RLKA 1YXXA 5GNKA 1LP4A 2QODA 3AG9A 3FWQA 4RIWA 4WO5A 4G3EA 4DLIA 4EOPA 5AR5A 3UQFA 1YW2A 3ORTA 3WBLA 4PDYA 5C8NA 3IW6A 5JEBA 5L2IA 4LL0A 4U0IA 4AE9A 2PL0A 5D12A 5IH6A 4OLIA 4F65A 4DYMA 4O91A 4QT1A 4FV9A 5D10A 3TDWA 2UV2A 4BDAA 1F0QA 4D1XA 4RVTA 5I3OA 5C26A 3LXPA 3SRVB 2OBJA 2ETRA 4J98A 2Z7QA 4EYMA 4QP9A 5AP1A 5CSPA 3PVUA 5GJDA 2VD5A 3HV6A 1Q97A 2WKMA 4G3GA 5DN3A 3T9IA 5HD7A 5HCXA 3MPAA 3TG1A 3OWJA 2CKOA 2FA2A 3E62A 3KMWA 2R3FA 3SQQA 4YLLA 2CDZA 3M42A 3MV5A 3VWAA 3V5PA 4CMOA 4ENXA 5FTGA 3PXYA 3PG1A 3CIKA 3R04A 5AIKA 3EFJA 2JBOA 4BI0A 3QQUA 4HCUA 4PDOA 3AD4A 4Z9LA 1URCA 5FXSA 3Q96A 3P0MA 4IX4A 4ZSLA 3U4UA 2ZOQA 2QLQA 4D9TA 2BDJA 3OWPA 1CTPE 1OKZA 3CQWA 2ITQA 3BHUA 4WRSA 4GFGA 5AP4A 4A9SA 3SKCA 2ZYBA 3ATTA 4D28A 3DLZA 4IZ7A 3FMEA 3I60A 3W8LA 4EOIA 3SGCA 4CLJA 4M15A 4GIIA 3QQJA 3CPCA 4LRKA 5BUEA 1MQBA 3LCSA 3W18A 4D0WA 4II5A 4X3JA 5I3RA 2CSNA 4DN5A 4QMVA 1JPAA 5AV1A 5CEKA 1GIIA 4OTFA 4CEGA 3MVLA 3O8PA 3WF9A 5E7RA 5M55A 3O8TA 4ITIA 4P7EA 1PXJA 4N70A 3ULIA 3OHTA 2A27A 4MBJA 1KE9A 4TYGA 2WTJA 5BMMA 3VQHA 4RPVA 5C9CA 3MN3A 4H58A 3P9JA 4QP2A 4DGGA 2CKEA 2G2HA 2BZKB 1Q41A 2G2IA 2XRWA 4ACMA 2QC6A 3LAUA 2WNTA 2YCQA 3A99A 4BDIA 3HV4A 2PZIA 3VBVA 3UQCA 4C3RA 4IAYA 3U8WA 1J91A 2JIVA 4JRVA 3QKLA 5DFPA 4FV4A 3HV7A 2VTIA 3FPQA 2R9SA 2YDJA 3RJCA 4CFMA 1E9HA 3D2IA 4WRGA 3BV2A 2VTQA 2IO6A 5CSWA 3QKMA 3ZFMA 3FMNA 4UXLA 3ENMA 3PJCA 5AM6A 2IG7A 3FMHA 5HCZA 3EZVA 3MVHA 2OF2A 2BZJA 3SXFA 3PPZA 1GNGA 1ZOHA 3PE1A 4YNOA 4A4XA 3Q3BA 1PXNA 3C5IA 3E3PA 2CLQA 1GOLA 3LCKA 2Z8CA 4KKHA 2G2FA 3ZDUA 3BLQA 4PY1A 5CLPA 5KMNA 1JOWB 3ZEPA 2FSTX 2EU9A 2J90A 2WB8A 4FSMA 5D9HA 5ANEA 1OIYA 4CYJA 3N4TA 4WUNA 4YZ9A 2A1AB 4ZS4A 3DS6A 4L44A 4BYIA 4LOOA 5TOZA 4LV8A 3F2NA 1YXTA 4BF2A 4TYHA 4BKZA 4DAWA 2ITTA 4XV2A 4DCEA 4MF0A 4DFUA 3DV3A 4MQ2A 5FGKA 5CU4A 3D83A 4F7SA 2IWIA 4RFYA 2AC5A 3AT2A 5EHOA 3OW3A 3RNYA 4FKLA 2J9MA 3NW5A 3QGWA 4KNBA 5AMNA 4HW7A 3B8RA 4FTNA 4MQ1A 3LCDA 1Z5MA 2JAVA 3KN5A 2GNIA 4ENYA 2C0IA 5A46A 3BEGA 3QQGA 2SRCA 3KY2A 3F82A 2WMRA 2W17A 3TM0A 4CV9A 4TYHB 4ZSJA 5FWKK 5JFXA 3H0YA 3VS4A 1Q8WA 3R00A 5DG5A 3RCDA 4DGOA 3LCTA 3UO6A 4O0TA 3RALA 4LGDA 4F7JA 2KULA 2CN8A 2UZVA 5HCYA 2Z7LA 2BROA 3ORLA 3QTZA 2CKPA 4IDVA 2EB2A 2WTIA 3HL7A 4BDDA 2JIIA 5CEMA 1IAHA 4ZIMA 3TZ9A 4Q9ZA 2O63A 4OTDA 2W7XA 3UMXA 3R7UA 3KRRA 3P23A 3QZFA 4X2NA 4CRSA 3HAMA 2C5XA 3WZJA 3UIXA 3UZRA 3K54A 5EI2A 3TV7A 5KKRC 5M51A 3UG1A 2XK4A 4O0SA 3OBGA 4PL4A 3CTQA 4FKVA 3VRYA 2C6IA 2G15A 2UZWE 4JDIA 4KA3A 1YKRA 3D0EA 3DJ5A 4U6RA 3QHWA 2YAKA 5HGIA 4FYNA 2BVAA 2RKUA 4YJRA 5A4LA 2J5EA 3FQHA 4G9RA 4WSYA 4K11A 3FI3A 4G5PA 4C61A 1KE8A 4MD7E 3NS9A 4KS8A 3V5QA 2XNNA 4AA5A 4ZS0A 2OK1A 2VV9A 3SX9A 2REIA 4FV3A 2C5VA 3ROYA 2WIPA 3SG8A 4GFOA 3TNPC 2BTSA 4AUAA 3TKHA 2VX0A 4KRDA 4WNKA 3RWPA 2OG8A 3MH2A 4X21A 4BKJA 5JMSA 4EC8A 3ORIA 2JIUA 2QOKA 4D55A 4Z7HA 4BDCA 4USFA 3LHJA 3IECA 3Q9XA 4OTRA 3RNIA 2GHGA 3GC0A 3ORXA 1PXOA 5BQ0A 4DG2E 1W82A 4ZOGA 5FEDA 5A4CA 4AGUA 4ASEA 2R64A 3GC8A 1RW8A 3FZPA 2P2IA 3PY0A 2OJIA 5DA3A 2UUEA 3WYYA 3H0ZA 2A4LA 4QMUA 5FP5A 3FC1X 2CGVA 5ANDA 2RG5A 5E8TA 4MBLA 2J0LA 4A4LA 4GMYA 4JIAA 4GH2A 5IA2A 2JLDA 4WKQA 1Q24A 3HEGA 5FM2A 4BHNA 4DEBA 4UWCA 1O6KA 3MS9A 3CKXA 1R1WA 3NYXA 3ZDIA 2HYYA 1ZMVA 3RAHA 2ZM1A 4EEVA 3AD5A 3UYSA 3PSCA 1J3HA 1YWNA 4NWMA 4XHKB 4C7TA 4EYJA 4D1SA 2WHBA 2YCSA 4CFFA 1OUYA 3WOWA 4ZTRA 4GKIA 1T45A 4QP3A 3R1NA 2Z7SA 4XRLA 5M53A 5DGZA 2VO3A 2WO6A 3QX2A 4A06A 3LMIA 4NK9A 3FC2A 4FC0A 3FKNA 2I40A 3HGKA 4PL5A 4IE9A 4C62A 1WAKA 3O17A 2GS2A 4LQMA 3TNWA 4AW0A 1E1XA 4ASZA 4FTUA 3HV5A 1H24A 3LLTA 3KRWA 3MH0A 3NCGA 3UDBA 1XJDA 3QUEA 1NVRA 4EH7A 4O7VA 2FGIA 1UNGA 2X1NA 2C6EA 2G1TA 3A2CA 3B2WA 1G8AA 2PVJA 3PFQA 3NAXA 2R4BA 3RZFA 2XUUA 3LFBA 3QA0A 3ZO3A 3KXZA 4HYHA 5JSMA 5CI6A 2FVDA 4XOYA 3VUGA 4RZVA 5M4UA 4J8NA 4E20A 3DU8A 4NJ3A 4ZSEA 2X2MA 2FSLX 4O0RA 3W16A 4UWYA 4X2FA 5L6PA 4ZMFA 3FYKX 5I9UA 5A4EA 4N0SA 4IMYA 4MD9E 4EK8A 3BYSA 4TKSA 2C5OA 3C1XA 4X2KA 1Q8TA 5LVPA 4TYJA 3BV3A 2C68A 4IM0A 1MP8A 4XG9A 5DOSA 2E9OA 1KE5A 3DJ6A 3I7CA 4H39A 2XZSA 4RWIA 4QMQA 1ZRZA 4HCVA 4BCOA 4IX5A 3QD2B 4HCTA 4X2GA 4FGRA 4BYJA 4GG5A 1PMEA 2ZV2A 5FRIA 1SMHA 1XWSA 4DGLC 2J2IB 2QOFA 3NX8A 2B9FA 5FUTA 3EN4A 4PTCA 3OCTA 3ODZX 3R21A 2GQGA 4L8MA 4E5AX 3EN7A 3SOAA 2F49A 3TTIA 4M66A 1BL6A 3QTWA 4KIKA 1VR2A 4ARKA 2OXXA 4JQ7A 3HUBA 5ANIA 3BU5A 4L3PA 4F08A 5M08A 1OM1A 3HVCA 2OH0E 2XK7A 4MK0A 5IQEA 4ORKA 4XX9A 5LCKA 3A7IA 4MH7A 4L53A 5IF1A 1JVPP 3EMGA 2YIYA 3H9RA 4O7LA 2I0YA 4JQEA 4J99A 5HD4A 3LIJA 4O86A 3QBNA 4JL9A 1JLUE 3FZTA 3PUPA 5EYKA 5HVYA 5E4HA 3NUSA 1WCCA 5A6OA 2CGWA 4BGGA 4BWPA 4E5BA 3RHKA 4EWQA 5AAGA 3OT8A 4KIKB 4CZTA 2OWBA 1ZYSA 3UOHA 4IW0A 4XOZA 3DDQA 3DBDA 3FL4A 5JZJA 2O2UA 4YPDA 1BYGA 3DKFA 1UA2A 1IAJA 4NEUA 5C03A 2UW4A 4G6OA 4GYGA 4X2JA 4XG2A 5BVDA 4YJNA 4UX9A 2PUPA 3VJNA 4AT4A 1H27A 1H1RA 4HGEA 2XIKA 3EQHA 2QOBA 4UZHA 5KMKA 2C3IB 3IW8A 4R77A 3E63A 2WMAA 3A4OX 3FEGA 2GMXA 4DFZE 1FMOE 3PSDA 2C6MA 3HX4A 4RFZA 4L6QA 3CKWA 4YJOA 3QHRA 4KIOA 5FEQA 1WBNA 4FKRA 4OBOA 5CVFA 4QMPA 5IUIA 3BBTB 3FZ1A 4KKEA 2RSVA 2W06A 3R1YA 4OBPA 4TWNA 3UP2A 4M8TA 1OBGA 4CCBA 4EOSA 4EORA 1Q8ZA 4DITA 4QMYA 3QQFA 5KMOA 1A06A 4N6ZA 5J1VA 4YZBA 4NYEA 3FXWA 1PXKA 2BAJA 2XIXA 2ITYA 4J95A 5E92A 2Z7RA 2YWPA 3DCVA 5L8LA 3NLBA 2YIQA 4UYAA 5DIAA 5C4KA 4PL3A 1G8SA 5BVWA 3QYWA 2QG5A 4HPUE 4IAKA 1ZZLA 5CS6A 5I9YA 5JFVA 3C4WA 5FXQA 3SV0A 2XNPA 1YXUA 3L9NA 5FTOA 4O22A 5IQHA 2BFXA 3RZBA 1SNXA 4JXFA 4AFEA 5HNIX 3WZDA 2BRMA 4M14A 4PMTA 3MH3A 1PKGA 2XK6A 3C13A 3Q6UA 1TKIA 1PMVA 3QD0A 3QL8A 5K0KA 3VS3A 3WF8A 4C4GA 2H6DA 5GZAA 4JR7A 1CKPA 5I9ZA 5CU6A 3BIZA 3UTOA 5DMZA 4EOKA 5L6OA 4XBRA 3FXXA 5CNOA 4G1WA 2PZ5A 2HW6A 3L8VA 3H9FA 4G17A 3SHEA 4PMPA 4FKGA 4ASDA 5BVNA 2QR7A 5KHXA 1OGUA 1Q5KA 5T6KA 2I0VA 4O21A 3OEZA 4DE4A 3O51A 3ZOSA 1ZMWA 3PVGA 2OZOA 1Q62A 2VWBA 4NKAA 4RFMA 4AX8A 4BI2A 3UVRA 3DAEA 3OVVA 4MXZA 2ERZE 2QOIA 4MXAA 3R7YA 3ELJA 2Y9QA 1YOJA 3FZOA 4FTQA 2P4IA 2RG6A 3HDNA 4I41A 5BMSA 4V04A 3VUKA 2VO6A 4XG4A 3OWLA 2XNGA 2WEVA 3OEFX 5HIDA 5BVFA 1UU7A 3PP1A 4A9UA 4ITHA 4BZOA 4ZY4A 2HZIA 4K9YA 4XG7A 4JVGA 5HNBA 1ZAOA 3DJ7A 3TEIA 4IWOA 4BGQA 1J1BA 3BI6A 5AUUA 3QF9A 4EH5A 3F5XA 4FZFB 3C4CA 3RK7A 5K5XA 3FY0A 3TUCA 5IQDA 2R3IA 2CHLA 3HV3A 1CMKE 1P5EA 1P4OA 3DQXA 1KV1A 3AD6A 5EDRA 3F5UA 2ZB1A 3Q4ZA 3PSBA 4I3ZA 4KABA 4ZTSA 1IEPA 3RPSA 4F0FA 4E7WA 4QQJA 3RAIA 4FSUA 4TWCA 2OKRA 2BDFA 3O96A 4S31A 5LVLA 4F09A 2F9GA 5EKNA 2GDOA 2VWUA 3QALE 3TKIA 2JAMA 4O0UA 4EBVA 5BNJA 2AUHA 4RX8A 4EZ3A 4EK6A 3GB2A 2ZV7A 4JQ8A 2YERA 4PUZA 1MQ4A 1Q4LA 3OTVA 3DZOA 3H10A 3RP9A 1R0EA 4IHPA 2X0GA 3KKVA 3BLRA 4G6NA 3GC9A 5CY3A 4Z3VA 5KMIA 1AGWA 2C3JA 3E5AA 4JBOA 3EKNA 2B4SB 4EOQA 4ANSA 3OZ6A 4JS8A 3BHVA 3KREA 4RJ6A 4MVFA 4L7SA 3D5WA 3KK8A 3REPA 4CD0A 4OBQA 1W7HA 3PJ2A 3OTUA 3UYTA 2PVYA 2I0HA 5F20A 4XMOA 2HCKA 4K33A 2C6KA 2BIKB 2YJSA 3JPVA 3PJ1A 3QTUA 4FKQA 1ND4A 3MGYA 5AV3A 2DUVA 3POOA 3KVXA 4O7RA 1CM8A 1REKA 2OFVA 3DKCA 2R3PA 3KGAA 3KMUA 5D41A 4ALWA 5JT2A 5IH5A 3R9RA 3QCSA 3HRBA 4FIFA 4HNIA 3WF6A 3OCBA 4AS0A 3ULZA 5LOHA 1KE7A 2F7ZE 1GZOA 1OIQA 3FPMA 4Y5HA 5DBXA 2IVVA 3ET7A 4TXCA 1XKKA 2B54A 3AGMA 3NMUF 4AZFA 1YXSA 2LAVA 3W33A 3OMVA 3QC9A 3QTQA 4E5WA 3K5UA 4D4VA 2Y8OA 5E9EA 4DEIA 4FTCA 2XF0A 3ANQA 5CF8A 2QR8A 2QO2A 5ANJA 1G5SA 4CG9A 1XBAA 4L00A 3E92A 2ZM3A 4KBCA 5IKWA 2W4JA 4YO4A 2UVXA 3D15A 4F6SA 4BDEA 5GZ8A 4A7CA 4FV0A 4O96A 5I9VA 3E7VA 1QPDA 3RMFA 4XLVA 2QNJA 2VWIA 3ZXZA 1GZKA 4AW1A 4DFBA 4C58A 4XV3A 5IG1A 3L8PA 3L9PA 3H3CA 3DK7A 4R7BA 5FD2A 1OIUA 2WFYA 4R8QA 4M13A 3F61A 3WF7A 4DC2A 4ALUA 4GT5A 3GC7A 4MNEA 4QP8A 3V5WA 4NM7A 4IANA 4G3FA 4JG7A 4HNFA 3V5JA 4NKSA 4JG8A 5H8EA 5A4QA 2EB3A 4GKHA 5E8VA 5ACBC 4LRJA 3R2BA 4PX6A 4L67A 1DM2A 2X7OA 5E90A 4YZMA 3LQ3A 4Y72A 4F6UA 1TQMA 3AMBA 4G34A 5J95A 2XNOA 4ANOA 3CS9A 3LCOA 4EUUA 1Q3WA 4EWHA 4F9BA 3ZO1A 2Q83A 4I6BA 4HVSA 1O9UA 2W99B 5LMBA 4D2PA 5HBHA 5A9UA 4NM5A 3F5PA 2WMUA 3ZZEA 1J1CA 2I0EA 3Q9YA 4MNEB 4QMNA 4BBEA 3BCEA 3IOPA 4AT5A 4GK3A 1PXLA 4E93A 3G0FA 1W84A 3DTWA 5IUGA 4JBPA 5KBQA 3TDVA 3ZHPC 1CKJA 4B99A 3AC1A 5EYCA 5J7BA 3TV4A 3OC1A 2AC3A 3F3WA 1HCLA 4KBAA 5CTPA 2ITXA 4QMXA 5CAUA 1FINA 5EQYA 3PVWA 4QMSA 3JR1A 5AIRA 4U5JA 1YI4A 4D4RA 3IDBA 4F0IA 5B7VA 4XBUA 3MSSA 4YZNA 4NSTA 1SVGA 3GCQA 3PY3A 4CKJA 3IW7A 4CT2A 2WXVA 1H01A 4FV2A 1U4DA 2W9FB 4P5QA 2XYUA 5AEPA 3FHIA 3L1SA 3N51A 4PV0A 3BU6A 3IQ7A 2C5YA 1FPUA 2FSMX 3W10A 2BFYA 1Y91A 4YSMA 4CMUA 3QTXA 2WU6A 4RT7A 3FL5A 3MIYA 3D9VA 4D4SA 4F63A 4D2SA 1XH9A 4PDSA 3KRXA 1PMNA 3ALOA 1URWA 4NH1A 4CQEA 4M84A 4USDA 2JGZA 4C33A 3A60A 2HY0A 3NDMA 2V5QA 1XHAA 2QOLA 5HG8A 1BI7A 3IGOA 4YZCA 4FMQA 4CKRA 1V0OA 3I5ZA 1U54B 3QC4A 5EW9A 5J9ZA 5KX8A 4AA0A 3G90X 2WMVA 3MDYA 1WMKA 3KF4A 3MTLA 1ZY4A 3FLSA 1JSUA 2EWAA 4RX9A 3ODYX 2JBPA 4FEUA 1FOTA 3JVSA 2HY81 3DXNA 3P5KA 1H1QA 3DFAA 3WIGA 5HLWA 5IU2A 5EM8A 3GU4A 3UOKA 2PY3A 2PTKA 2OW3A 2YWVA 4Y73A 3P7AA 1YOLA 3D14A 5IQGA 3P79A 3DZQA 2C1AA 3I5NA 3P78A 2P55A 1H8FA 2XNBA 5DR6A 4EKKA 4YNEA 1PKDA 3TIYA 2P2HA 4ZSGA 1W8CA 1QMZA 2ONLC 4D2WA 3HZTA 5B2LA 5LWNA 4XG3A 4ANMA 3WE8A 3S1HA 3GFEA 3I6WA 3AC2A 1STCE 3E88A 3OBJA 1H0WA 3G6HA 4JX7A 4EH6A 4NCTC 4GU6A 1BMKA 1A48A 5JZNA 4TY1A 3JUHA 2F2UA 3OOGA 3QUDA 4IJ9A 2BKKA 4ERKA 2GU8A 4C37A 1XR1A 2X7FA 3FBVA 1XH6A 3FMJA 1I44A 4MBIA 5EKOA 4U8ZA 2HWPA 1I09A 2YLFA 4EK5A 1GIHA 5B2MA 3KXXA 3MYGA 5K3YA 3H4JA 1FGIA 1H07A 3ZUTA 3NPCA 3VO3A 4Q9SA 3TACA 3HDMA 2PVMA 2A19B 3UMWA 5CAVA 3R7VA 4P2KA 3EJ1A 5TE0A 4ANNA 5BPYA 3MI9A 5JGBA 5J1WA 4O81A 5AR3A 1PMUA 4LYNA 4RC3A 4N6YA 2YITA 3DK6A 3OP5A 4JAJA 1YDSE 4MD8E 4QD6A 3BGPA 4QMOA 4PMMA 4RQVA 3GT8A 4XG6A 5AUZA 5CENA 3R7GA 5IISA 2JKMA 5HLNA 4CRLA 4QYEA 2IN6A 4F6WA 3N4UA 1M2RA 3OUNB 3AMAA 3DAJA 3IW5A 3A7GA 4LG4A 4MNFA 1XH5A 1M52A 4JG6A 5ETIA 2B0QA 3QRJA 3K3JA 3TZ7A 2QD9A 1WBTA 4FZDB 2R3NA 5L4QA 3Q6WA 2F2CB 2QHMA 3RPRA 5EQEA 1W83A 2OF4A 2WOUA 3F69A 3JXWA 4F1OA 4QTEA 3UNJA 4F99A 5J5SA 1NVSA 4L45A 3VBWA 4I6FA 4AZSA 1JAMA 5IDPA 1OIRA 5CEQA 4KUJA 2WQEA 2UVYA 2VWXA 4QQCA 1Q99A 4PTEA 4BIEA 3PYYA 3LFSA 5HQ0A 3MB6A 5LARA 5T3QA 3V3VA 2ESMA 1T46A 5JH6A 5DNRA 3O7LD 4FT5A 4W4XA 4TPTA 3LXLA 3BWFA 4CTCA 4D2VA 4R5SA 2WIHA 5IA4A 2WTKC 4YBKA 5K4IA 5L2SA 4XP2A 1PXPA 5KCVA 3D5VA 1GZ8A 2C3LA 3O71A 4XV9A 2UW5A 4YTHA 1GY3A 5EYDA 3ZO2A 4J97A 4TTHB 2EXCX 2UW0A 4OT6A 4ZTLA 4BZDA 2Z2WA 4DTKA 4UN0C 2JDRA 1YHWA 4RZWA 2ZAZA 4AF3A 3WARA 2J0JA 2B9HA 2CGXA 3UGCA 3OW4A 3TCPA 4S2ZA 3F7WA 1OB3A 2FB8A 4DFXE 3FAAA 4G2FA 3KCFA 4U41A 4L9IA 3H9OA 2O5KA 2GSFA 4W8EA 3FYJX 2BMCA 4HZSA 4P4CA 3DNEA 2ZJWA 2PULA 3R01A 4EOMA 2BHHA 3I0OA 3ZH8A 2GNLA 4QMZA 3Q32A 3TNQB 2XMYA 3GCUA 2PVFA 2ZM4A 5K5NA 5KMJA 2BZHB 3GU6A 5H8BA 5EW3A 3EB0A 1NVQA 2H96A 4GUEA 4C4FA 2ONLA 5KZIA 1AD5A 5CX9A 2Y6MA 5HHWA 3DXPA 2RFNA 5AJQA 3R9OA 1H28A 2C0OA 2GTMA 2UW8A 3NIEA 3AC4A 1H4LA 5KUPA 3VJOA 3V5LA 3TUBA 5M4CA 3U9CA 4IZYA 3GCVA 4GFMA 4XCUA 4I5CA 3VF9A 2BRNA 4CFNA 2WMWA 3W32A 5HVJA 4UY9A 4ZY5A 2E2BA 2OGVA 1H1WA 3KCKA 4AGWA 1V0PA 5DRBA 5DRDA 4HYIA 3UIBA 2VTAA 2Z02A 5J7HA 3VW6A 5JQ5A 4XH6A 4K6ZA 3EFWA 5HOAA 5HO6A 1PW2A 5DE2A 3IDCA 4K2RA 3TUDA 4XUFA 5G6VA 3MJ2A 3NZ0A 5C27A 4FEVA 4Z7GA 3KULA 2EXMA 2OJFE 3QTRA 1DS5A 1OUKA 3MFRA 2IVSA 5BYLA 4AFJA 5AP2A 4ITJA 4OR5A 5CSVA 1J7LA 4HPTE 5KMMA 5AADA 2C6LA 1OPLA 4QNYA 4B7TA 3V01A 3O2MA 5IPJA 4O84A 4CZUA 2C0TA 3SW4A 3PY1A 5E8SA 1V0BA 3LFCA 4FE2A 2YFXA 4FKOA 1JSTA 5CAOA 3VW8A 4GCJA 5CWZA 3D5XA 4JDJA 3VNTA 3NSZA 4ANBA 2BZIB 4H05A 3A7JA 4I6HA 3PG3A 3VUTA 4MTAA 3V51A 2XM9A 4HYUA 3KULB 4RWLA 3C9WA 3TN8A 2CNVA 3LLAA 2NRUA 3GGFA 3MFTA 4J7BA 4HVGA 1MUOA 1PY5A 4CXAA 2QI8A 4BKYA 2Y4IC 3FI2A 4FNYA 1NA7A 3ZMMA 4CMTA 2JC6A 2GHMA 3DQWA 3HMMA 4F9YA 5C1QB 3BE2A 4BZNA 4F1MA 3ZXTA 2IZUA 4U45A 4YLKA 2XJ0A 5CSXA 1RJBA 3DOGA 5FEEA 2WZJA 3FSFA 5F9EA 2QOCA 4C38A 3ORKA 3QGYA 1R3CA 5HESA 4GW8A 2W05A 1FVVA 3DB8A 4F9CA 4U42A 3ZEWA 4A07A 1WBOA 4EQCA 4HYSA 4ONAA 4BWKA 3BYVA 4IXPA 3BLHA 4CG8A 3Q5IA 4FV5A 4WG5A 5DLSA 5A6NA 3WZUA 5HE1A 4KRCA 5BX0A 2V7AA 2JEDA 2UW7A 4G31A 4FIJA 4DFYA 4CFUA 3KC3A 1YQJA 4YLJA 2UZNA 2RF9A 3QRTA 2CKQA 2X4FA 2ITZA 5DR2A 3ZCLA 4GSBA 3FQSA 2ACXA 3C50A 4IWPA 5IH4A 5FDPA 2VX1A 3DBCA 4DCAA 3G0EA 1GIJA 2VGPA 3D7ZA 2WTKB 4R3PA 4MWIA 4V01A 4ZP5A 4Y46A 3R8ZA 2CLXA 1P4FA 1Z57A 3AC8A 4I21A 5LXMA 5LMAA 3NR9A 2OJGA 1E1VA 1H0VA 2VO7A 3Q9ZA 2X39A 2YIRA 3NNXA 2PE0A 4QTBA 3DNDA 4U97A 2YM8A 5F94A 1HOWA 4FKUA 3JYAA 4I20A 2W5HA 4KBKA 2O64A 2R0IA 1V1KA 2B9IA 3DA6A 3CQUA 3FHRA 1ERKA 4PTGA 4M68A 5DT0A 2BIYA 3BYOA 2OXYA 4ZLOA 5AV4A 2VTTA 3SLSA 4AE6A 3GU8A 3S0OA 3CP9A 4BC6A 2HW7A 3HYHA 4BR3A 2R2PA 2W1ZA 3U6IA 5BYYA 2B55A 3QCYA 4I0TA 3TJCA 1UNHA 4EZ7A 4M7IA 5ETCA 3GFWA 2GQSA 4BDJA 5H3QA 1YHSA 5LQFA 3PXZA 3VUDA 4FBXA 5CVHA 3Q9WA 4BCHA 3GQIA 4X3FC 4GK4A 4XEYA 5DPVA 2W96B 2ZV9A 3HMNA 4O83A 4GU9A 3QQLA 3LJ0A 4IB0A 4Z55A 5A14A 2CJMA 1MRVA 2XIZA 4ZMEA 4EK4A 2J7TA 4JI9A 3KK9A 3EOCA 4FTLA 4M0ZA 3QRUA 2OO8X 1QPJA 3NUAA 2WTCA 5BVKA 2XB7A 2OXDA 2PWLA 4IAAA 4YHFA 5FP6A 1BX6A 3BX5A 3U54A 2VN9A 2QO9A 3BZ3A 5BVOA 2VNYA 4AN3A 2GTNA 2YCFA 2V55A 3UNZA 2PE1A 2VTOA 3D5UA 3M1SA 3ZYAA 4EQUA 2PK9A 1ZLTA 5KKRB 2NRYA 3FMKA 3G6GA 2PUNA 1G3NA 4FEXA 4E6QA 3TL8A 2YDIA 3CD3A 2R3HA 4G9CA 3R1SA 5HNGA 4Y85A 2OIBA 5CASA 3PZHA 4O2PA 3WI6A 2VWVA 5D7VA 2XM8A 2Y0AA 4QYYA 3WIKA 4FODA 3BELA 4Y95A 5CAQA 3C51A 4IAZA 4L43A 3A7FA 4RQKA 4QNAA 5CT7A 2ZMCA 2CPKE 3CR0A 4FNXA 2O3PA 1UWJA 5EI6A 4ANLA 4TT7A 4R5YA 4FGBA 2PE2A 5I4NA 4QYGA 5L8JA 2UZTA 4J1RA 1ZOEA 4RJ8A 3PZEA 3CXWA 3P08A 3NYNA 2WMQA 3PJ8A 5ICPA 3RKBA 4A9RA 2ZV8A 5DR9A 4PNKA 1WBVA 4FL1A 4USEA 4UV0A 3V04A 4BFMA 1OL1A 4E8AA 3GXLA 5CSHA 2V62A 4OW8A 4CV8A 4YR8A 5M09A 4EHVA 4I93A 4TRLA 3F9NA 3TIZA 4HVDA 4DT8A 3EL8A 1YI6A 2WAJA 4FSWA 4B4LA 2IW8A 3FUPA 3QZIA 5CXZA 2Y4IB 3LQ8A 4N57A 4YC8A 3GEQA 5HORA 4NM3A 3VN9A 5HO7A 2B9JA 4FG8A 3TKUA 1TVOA 3VUIA 5ACKA 4C0TA 3F3ZA 1WBWA 5E1EA 4W4VA 1UU8A 1OL6A 1VYWA 3E8EA 5LJJA 1DI8A 3Q4TA 4NUSA 3RVGA 4F70A 4F7NA 2OICA 3FY2A 4QMMA 5IEVA 5ITAA 3PPJA 1QCFA 4GRBA 4V0GA 5ETFA 2JDOA 1SVHA 2OZAA 2R3OA 1CKIA 5ANKA 4DINA 1YXVA 4FSNA 3RM7A 5A54A 3AC3A 3BQCA 4PPCA 4U43A 2F57A 3EQIA 4RC4A 1OZ1A 3G9LX 2CCIA 4PMSA 2VZ6A 2YACA 4ERWA 4C36A 4GJ2A 5EYMA 4UEUA 2GNJA 2XK3A 3QXPA 5EFQA 5AR8A 2UW6A 3VBXA 2QONA 3FLWA 4QPMA 3NAYA 4CSVA 2H9VA 5J79A 2VTNA 4FKJA 3CY2A 3NNUA 4JDHA 2C6TA 4TWPA 4V0GB 4FSYA 3JY0A 3QX4A 4FG7A 2OZAB 4I0SA 4DH3A 4EH4A 2WQMA 4L7FA 3AT4A 5J9YA 5LWMA 4I4EA 3ZRKA 5JRSA 3G15A 4DF3A 1OKWA 3BEAA 1IR3A 4O7NA 2XVDA 3ALNA 3QTSA 4H36A 5FBNC 4F7LA 5TO8A 3RPVA 4V05A 4JR3A 4RX7A 4X3FA 3ZU7A 2PVKA 4HZRA 2PZRA 3QQKA 4DH1A 4FA2A 4S34A 2Y7JA 4LM5A 1QPEA 4QYFA 4WG4A 4XYFA 4PP7A 4BDBA 1LEWA 3ZTXA 3Q53A 4NL0A 2J0IA 1GAGA 4G3CA 5A4TA 5AR7A 2OSCA 5E1SA 4FKPA 3C0GA 3QLGA 2ERKA 2YABA 3EIDA 3PXRA 2GPHA 5JN2A 5CEOA 5CANA 3HMOA 3ZFYA 5GIOE 1NY3A 4F0GA 4UMPA 4L3LA 3PLSA 4YC6A 3BE9A 4PP9A 4X3FB 4C34A 4TL0A 4I24A 4X7QA 3LZBA 4LGHA 5M07A 1B39A 2V7OA 4IVBA 2W0JA 3ETAA 1XH8A 2YAAA 4RVLA 4AA4A 4BCQA 4EOJA 3KQ7A 5CU0A 2GQRA 4K0YA 5LMKC 5JK3A 4PDPA 2HZNA 3CTHA 4FOBA 3ZM4A 3O0GA 3KXNA 4FZ7A 3RHXA 1BL7A 5EDPA 3RCJA 2ZVAA 4Q5EA 4AT3A 4QO9A 3HMIA 4JJRA 3ORMA 2R3LA 3T3VA 5LVNA 4QP7A 4UMTA 4EHEA 4C8BA 5AAFA 3U4WA 3DLSA 2C5NA 3QKKA 3MY1A 4MCVA 4O6LA 4IWDA 1XO2B 2UW3A 4BCPA 3BU3A 3OS3A 5KBRA 3V6RA 3SVVA 2PMOX 2VAGA 3OROA 1BLXA 1H1PA 1YDTE 4IC7A 4JRNA 3SD0A 5CEPA 4U9AA 2W5BA 3IKAA 3DBFA 5M4IA 4L68A 4C35A 3CBLA 3HLLA 3L9LA 4MWHA 4TYEA 5B2KA 3FI8A 3A61A 1K3AA 2I7QA 3F66A 3F3TA 4QMLA 4DG3E 1S9JA 4DBNA 2R7BA 1H00A 2GNGA 3BHYA 4F4PA 1PF8A 2XNEA 4GV1A 4K18A 4ZLZA 4WNMA 4IEBA 3OWKA 3Q4CA 4NU1A 5E8WA 5FLFA 4YSJA 2WQBA 3CGFA 5DI1A 5AP6A 4L3JA 3U87A 3WZKA 3IDPA 5CU2A 4FICA 4JIKA 1Q3DA 3ZLWA 4ANQA 4D2RA 3S95A 3KU2A 4GT3A 5JGAA 3U6JA 4R3CA 3FE3A 5HVKA 4C4HA 4TNDA 3ZUUA 2J5FA 5AUXA 4BL1A 4DG0E 2YLEA 2XNMA 3PP0A 3TI1A 3QQHA 2IW9A 3A8WA 3DBQA 2QVSE 4EKLA 4AZVA 3TJDA 3F88A 2JKQA 4LI5A 4WNPA 5AV2A 4BTJA 5KE0A 2WPAA 4W9WA 4BWXA 2C69A 4HOKA 4QP1A 5AP7A 3KMMA 4I5HA 2UW9A 3MH1A 4C59A 3PIXA 2QKWB 3MA3A 3R7EA 2CNQA 5CT0A 1Z9XA 4BIDA 3P7BA 2R3KA 2VTHA 5L2WA 4B0GA 3BWJA 4FR4A 2VO0A 4TWOA 2FH9A 2IJMA 5CALA 2WMSA 2PMLX 4ZJJA 3WYXA 4DLJA 3HP2A 1OPJA 2UZLA 2YM7A 3I1AA 3PWYA 4BB4A 4ZJVA 4O0WA 4DEAA 3LE6A 5EH0A 4FI1A 4J53A 3UE4A 3OCGA 2P0CA 3AOXA 4JT3A 4OTGA 3VS2A 4UB7A 3G33A 3PA5A 5J87A 4MXCA 4GS6A 4YP8A 4AACA 3DGKA 3ATSA 3EQPA 4FG9A 3PWDA 3E87A 1O6LA 3W2OA 5HBJA 2PZYA 5HTIA 2R7IA 4BDGA 3NUYA 3MA6A 5IUHA 2E9UA 4MKCA 2BUJA 3GU5A 4KB8A 3W2SA 3ENHA 3I0QA 2VTMA 4C4EA 3W2QA 1M2PA 3R9DA 2O8YA 4EHZA 4RVMA 1RDQE 2BAKA 2GCDA 5FG8A 4WIHA 3VUMA 3ZBFA 2WTVA 3EH9A 3MY5A 3HNGA 2VRXA 3MFUA 3EQBA 4PF4A 4QTAA 4U3YA 3ZLXA 2X7GA 4FV6A 2JDTA 4U81A 2GFSA 3G2FA 1APME 3G51A 1UWHA 1VZOA 2J6MA 2EUFB 1LR4A 3VS1A 1UV5A 3WF5A 3WILA 4UWBA 4YC3A 3DB6A 4P90A 1DAYA 2PHKA 2IZRA 2NPQA 3UIUA 2Z60A 5C01A 2B52A 4DEGA 4CKIA 3GOKA 4F9AA 1RQQA 4AAAA 2B7AA 2W1HA 1ZZ2A 4LMUA 5HG5A 4TW9A 4WUAA 3NRMA 3ZC6A 4DGMA 1U5RA 2R3GA 3ZSGA 4CFWA 3EN9A 4OGRA 4GT4A 1F5QA 3RGFA 1EH4A 3RK9A 3BHTA 3MPMA 5E91A 4YTIA 4XJ0A 4I5MA 5J8IA 5IQBA 3VIDA 3BHHA 1R78A 2OU7A 2JKKA 3KRJA 3LXNA 4FVRA 2BR1A 2HWOA 2PYWA 4FV7A 4KAOA 4MAOA 4CNHA 3VS5A 3NEWA 3VBTA 2G9XA 5D11A 2JFLA 3K2LA 3LMGA 4ZTNA 4RC2A 1J7IA 1NT2A 2YIXA 3F2AA 3W8QA 1U54A 4R7HA 4NFNA 4UYNA 3HRFA 1KE6A 4W8DA 3S2PA 4FZAB 4O38A 4TYIA 5DEYA 5GIPE 4O0YA 5GHVA 4I22A 3UVQA 3L9MA 3KB7A 1ZY5A 4LFIA 4EH8A 4JBVA 4IB1A 2FSOX 5JFWA 3NYOA 4ZTHA 1FVTA 4WSQA 3EFKA 3FKLA 3UG2A 3ZO4A 3Q04A 3PDTA 4RGJA 2BALA 1YRPA 2XJ2A 5CF4A 4LOQA 5HICA 3Q60A 1P2AA 3RI1A 4IVCA 1SZMA 3FLQA 4HGTA 5J9LA 1JNKA 3GCPA 4QMWA 4IWQA 2RFEA 4ZXTA 4ALVA 3W2PA 5AA9A 4LRMA 3UPXA 3CLYA 3OUKA 4L01A 3BKBA 3BRBA 4RRVA 2BRBA 4UMQA 1JBPE 1TQPA 2B53A 2JKOA 3SXSA 4BCKA 5IEXA 4YGAA 3C0IA 4EI4A 4FIEA 3PE2A 1K9AA 3EQCA 4U79A 5CZIA 3NUUA 2HXLA 3UC4A 3NVMB 5I0BA 4WHZA 5CNNA 2ITPA 5ETAA 4ACDA 4AXAA 1CDKA 2W1DA 4ZZNA 5AR2A 5AWMA 4O7ZA 3HMPA 5M4FA 3L8XA 2A2AA 3I79A 4FTJA 4HGLA 5GINE 4Y83A 4R78A 2QOHA 4PPAA 5FM3A 3P1AA 1ZYCA 4A4OA 2RL5A 3QYZA 3UZPA 4ACHA 1Y8GA 4JOAA 3FV8A 5AX9A 3WZEA 4R1VA 5FXRA 3FI4A 4M12A 4FSQA 3RPOA 3TWJA 3FLNC 3TZMA 1B38A 1SNUA 2BDWA 4MYGA 5F95A 3CPBA 3ZC5A 4WNOA 2EXEA 5H8GA 5KO1A 3VS6A 3LQ5A 1YDRE 2XK8A 3VUHA 4E4XA 4M3QA 3F7ZA 5AUYA 2PZPA 3V8WA 4RIWB 1R39A 3UQGA 4LL5A 1VEBA 4FIIA 4J71A 5HX6A 3OXIA 4EJNA 1K2PA 4NW6A 4IBMA 4BDHA 3Q2JA 5AP5A 5L3AA 2JITA 2HELA 2PVRA 5HE0A 2XEZA 5IA1A 5JGDA 1W98A 1UNLA 4JLCA 2ETMA 3R9NA 3EZRA 4AZTA 4DTAA 4FNZA 3C4ZA 3R8VA 3UJGA 4IH8A 2GNFA 4RJ5A 3R73A 2W1GA 5E8XA 4E73A 4FUYA 5TR6A 2DS1A 3GQLA 5EHLA 2J50A 1FGKA 4XP3A 2XIRA 3LVPA 5IQIA 1GZNA 5H9BA 2I6LA 4GK2A 3R6XA 3R30A 2IVUA 3QWJA 1ATPE 4ACGA 3LM0A 4QMTA 3UPZA 5I5ZA 4FKWA 2XKCA 3ZM9A 3Q5ZA 3HRCA 3PXKA 3MWUA 3VS7A 4XS2A 3FKOA 1FBNA 4IDTA 4EL9A 3DTCA 4I6QA 3UIMA 5EI8A 3VHEA 2XKFA 1QL6A 3AMYA 5H2UA 3FLZA 5TF9A 5HG7A 4UMRA 4FOCA 3NW6A 5HIBA 4RJ4A 4FX3A 2YHVA 4CYIA 5L2QA 2BAQA 3AT3A 3LXKA 3OOMA 4QP6A 2HOGA 4FSZA 3LMHA 3B8QA 5DVRA 1ZYLA 4EH9A 1BKXA 3RINA 3I6UA 4FTRA 2XBAA 3KL8A 4O0VA 2JDVA 3GCSA 1KOBA 4XV1A 4IFGA 2E9VA 3C4XA 5HX8A 3BGZA 5BUJA 3KRLA 1H1SA 1OECA 3T8OA 3M11A 2RFDA 3PXFA 3EYHA 1R0PA 2YM5A 4UXQA 1OVEA 3EYGA 2YDKA 5HKMA 3NUXA 3U51A 5IA0A 4D9UA 4CLIA 2RFSA 3HA8A 4FVPA 3C7QA 3OT3A 4RWJA 2JFMA 3VBQA 2GS6A 4RJ3A 5M57A 3C5UA 3EWHA 2ZB0A 3O50A 4QOXA 3E93A 5DYJA 2CMWA 3OFMA 4D5KA 1H08A 3UODA 3A8XA 3E8NA 3GOPA 4GEOA 2BRHA 4FK6A 4ACCA 4S32A 1B6CB 3DKOA 5BVEA 5EOLA 2Y6OA 3OF0A 3QUPA 5DT4A 4OAUC 3EHAA 3QZHA 4E26A 4DGNA 4EOOA 4AOJA 4DEHA 2QOOA 2VNWA 3EFLA 4KS7A 4OAVB 4FZ6A 2PUIA 3IG7A 2XH5A 3NUNA 4Y5QA 5L6WL 1XQZA 4NCTA 4RMZA 4WA9A 2WD1A 4DTBA 4MEDA 4BBFA 3MBLA 3FMLA 3VS0A 1UKHA 1WVYA 3JVRA 2RGPA 4MF1A 4DH5A 4GJ3A 1DAWA 4IADA 5L8KA 3U6HA 2XIYA 4D4YA 4QPSA 4M67A 3N4VA 2PMIA 5A3XA 1ZWSA 1JQHA 2X9FA 1XBBA 1M2QA 2WMXA 4JAIA 5CXHA 1J7UA 3HAVA 5HZNA 4R3RA 2F7XE 4L42A 4BI1A 3ERKA 2VTSA 5HLPA 4X6RA 5LVMA 2PMNX 4APPA 3EKKA 3CY3A 4FEQA 4ID7A 5AUWA 3ZLSA 4EZ5A 2X8IA 4CVAA
chains in the Genus database with same CATH superfamily
3R8UA 4C4IA 2VTPA 2EVAA 4FKIA 5HU9A 1KOAA 3K3IA 2QOQA 3SDJA 1OL2A 4AOTA 2ZMDA 3DK3A 4YHJA 3JS2A 3TNHA 4CT1A 4Y8DA 3UP7A 2UZOA 3R63A 2QO7A 3KN6A 1M7QA 4YTCA 3F3UA 3ZS5A 5EHYA 4C3PA 2LGCA 4UMUA 4I94A 2ZDTA 1SVEA 2J51A 3CJFA 2IW6A 4XRJA 2BRGA 3VF8A 4L52A 4EC9A 3LFDA 2QG7A 1JSVA 3RBWA 1YHVA 3TXOA 3FMDA 3PIYA 2G01A 3M2WA 5FBOA 3QXOA 3QD3A 4A9TA 2YN8A 4HVIA 2XP2A 4HGSA 5IEYA 1IG1A 1U59A 3EQFA 1VYZA 2VWYA 2WMBA 4KIQA 3IONA 2HENA 3I81A 4D5HA 2QURA 2OIDA 4AP7A 4RA5A 4EH2A 5I9WA 3HP5A 5K9IA 3I4BA 3A4PA 3ACKA 2OH4A 4K1BA 5J5TA 3GENA 4CTBA 5K0XA 2AYPA 4PNIA 2XCHA 4GVJA 1JWHA 2C47A 4PWNA 5LCJA 4UZDA 5GZ9A 4XLIA 3PA3A 4DA5A 4B8MA 2GFCA 1MRYA 3H30A 4S33A 4F64A 2XRUA 1XH4A 2UZEA 3AKJA 3ZFXA 3RPYA 4ZZOA 4BGHA 2ITVA 1OBDA 2P3GX 1M17A 1L3RE 3ZZWA 4WG3A 2X9EA 4WBBB 4D0XA 4M69A 4BCMA 3D94A 5DWRA 4KINA 3HUCA 4FSTA 2W5AA 4C57A 4W4WA 1PYXA 4BCGA 1JKLA 4TZRA 1PJKA 3GI3A 4RVKA 4I92A 4XG8A 4YBJA 4AW5A 4BHZA 4FTTA 5FTQA 2JD5A 3F2RA 4S30A 3RAWA 1U46A 3CGOA 3HECA 4TN6A 3COKA 4B6LA 3PPKA 4QP4A 2O0UA 4BCIA 3IOKA 2BHEA 4FK3A 4IJPA 4GYIA 3OG7A 4FT9A 4KKGA 5LVOA 4NW5A 4OTPA 3R8MA 3W2RA 2NO3A 4BIBA 3T9TA 2Q0NA 3UC3A 3KFAA 4AZWA 3BYUA 3ORZA 3LFNA 4NFMA 5CVGA 1KV2A 4M69B 4C2VA 4YMJA 5JRQA 2WTWA 1VJYA 3NYVA 3RWQA 4DFLA 1LPUA 2WOTA 1REJA 3GU7A 4FL2A 2DYLA 3COMA 5HO8A 1WVXA 3COHA 4C2WA 3UO4A 4QQTA 4M97A 1PRYA 2FYSA 3MJ1A 3DXQA 4B9DA 2HAKA 2CNUA 3CTJA 3MFSA 3PRFA 3KEXA 2X8DA 4Q5HA 4BTKA 4BTMA 1Y57A 3QZGA 4TNBA 3ZONA 4KWPA 2PPQA 3MVMA 4GG7A 3O8UA 4O2ZA 3V5TA 1AQ1A 3AGLA 2VWZA 1IA8A 3MVJA 4O82A 1UKIA 2C4GA 4BN1A 2BTRA 1KSWA 5KMLA 3Q52A 5ANOA 5KNJA 5HG9A 2ETKA 2F4JA 4J52A 4O1PA 2VUWA 3UOLA 4C4JA 4FV1A 4IVDA 5CI7A 4CZYB 3NVKI 3ZLYA 4IACA 4DH8A 1Y6AA 2W1EA 5M06A 4OTIA 3B2TA 4JDKA 3LKMA 3ZRLA 2QKRA 4F1TA 4IAIA 4F9WA 4E6CA 3G9NA 2HIWA 2W1IA 3NIZA 4YPSA 4RX5A 3UO5A 3ZBXA 4U40A 1O6YA 5F4NA 3W55A 4FNWA 4E4NA 1Y6BA 2UZUE 4ZTQA 3V8TA 4YHTA 2OJJA 2P33A 3ITZA 3NGAA 3DAKA 4JNWA 3GUBA 3UNKA 3FLYA 4G6LA 4CFXA 3LOKA 2ZDUA 4QDVA 4I5PA 4ZZMA 5JFSA 2E9PA 4IVAA 3V8SA 2HXQA 4C3FA 5AFVA 2UVZA 2YM6A 2Q0BA 4P5ZA 4LV7A 1OL7A 4RBLA 5F1ZA 4NJDA 1H26A 1VLRA 1IRKA 3CC6A 2YIWA 3FDNA 4UBAA 4NTTA 4IX3A 5C8KA 3HKOA 2QU6A 4RJ7A 5IZFA 2YZLA 2VGOA 2HZ4A 2X8EA 5L2TA 1ZARA 3CQEA 3CJGA 5D1JA 3PXQA 4AQCA 2C30A 4DT9A 2VTRA 3EN5A 4H3QA 2WELA 3MY0A 3VBYA 4J96A 2CGUA 1X8BA 4BCNA 2VU3A 2OI4X 4KD1A 5IMEA 1FQ1B 3LJ1A 3DBEA 3SG9A 5CQUA 3R9HA 1Y8YA 4YJVA 3VULA 3GP0A 4M0YA 4NM0A 4XP0A 4FT0A 3FZSA 4H3BA 1GJOA 3OY3A 3O23A 5BYZA 4B8LA 4YJSA 5E8UA 5CYIA 2XCKA 3TZ8A 3OD6X 4WBOA 3V6SA 4D2TA 3SOCA 4LUEA 1PXIA 3F6XA 3SA0A 4GL9A 2YM3A 3MPTA 4PRJA 5HI2A 4U7ZA 3TTJA 4E6DA 3U55A 3P4KA 4I1ZA 4G3DA 4AZEA 3ACJA 2R3QA 4FL3A 3COIA 4BICA 4RA4A 4J8MA 5DH3A 3UDZA 5M56A 1TQIA 3DT1A 3VHKA 4AW2A 3IK3A 3RK5A 3UVPA 4NIFA 4YJUA 5AR4A 4FTIA 2O65A 5B0XA 4ZLYA 4FKTA 3GBZA 4MXYA 4EOLA 2UZDA 2V22A 5IMXA 5KZ0A 4O7SA 4MXXA 1Q8UA 3P7CA 4IIRA 4BCFA 2YCRA 2RIOA 3VQUA 4BCJA 5IDNA 5T68A 4ZEGA 4DEEA 2WMTA 3F3VA 2X2LA 4CCUA 5KHWA 3JY9A 5AM7A 3PTGA 1OITA 5EG3A 1XH7A 3E8CA 4BDKA 3MIAA 4RG0A 2NNWB 4FEWA 4I6LA 4CGAA 2QLUA 2W4KA 2XA4A 4NIFB 3SC1A 3GNIB 3LFAA 5K4JA 4N4SA 4LUDA 4JX3A 3AQVA 4O1OA 5DT3A 3IO7A 4Q2AA 3UOJA 3FQEA 2ITUA 3G5DA 4ZY6A 2IZTA 3LW0A 3R83A 4AN9A 1ZOGA 4DBXA 3NNVA 5EQPA 3UBDA 2ZFYA 3IGGA 4LGGA 3W0MA 3QCXA 3AKKA 4DHFA 3POZA 1P14A 3TNIA 3BPRA 4K8AA 4LOPA 5AUTA 1WFCA 2QHNA 1OKVA 5HE2A 5IQAA 3D2KA 4E4LA 5HIEA 4DFNA 3FMMA 3QA8A 4RIXA 2WTDA 4EH3A 2NP8A 3NUPA 4H1MA 3R8LA 2HZ0A 3FXZA 4G5JA 2XEYA 4YTFA 4O7TA 3NW7A 5EM6A 3R1QA 3QFVA 4W9XA 2OLCA 1Q8YA 4FSRA 4AGCA 4QTDA 3N9XA 3R2YA 3OCSA 4O6EA 2YEXA 3Q4UA 4FTOA 4PQNA 3A7HA 1UU9A 3MTFA 3W2CA 4OTWA 4YJPA 2WU7A 5EM7A 2QCSA 4QRCA 4WD5A 2X81A 1QPCA 3T3UA 1ZYJA 5HBEA 1JKSA 3A62A 5C8MA 4FV8A 4ZSAA 3RAKA 4RIXB 3CEKA 5IQFA 3KXGA 2W1FA 2X2KA 3I7BA 3EL7A 5ANGA 1ZMUA 4IM3A 1A9UA 3MESA 4RIOA 3TV6A 3IS5A 1UU3A 4EJ7A 3II5A 2J0KA 4AN2A 4IQ6A 2PVHA 5CF6A 5JQ8A 3ORPA 3DPKA 3OY1A 5FDXA 4YUQA 4DEDA 4R7IA 4H1JA 3ID6C 1LEZA 4QYHA 2DWBA 3DFCB 2IVTA 4FTAA 1S9IA 1WVWA 4FTMA 3U9NA 2X4ZA 3NNWA 3D7TA 3OXTA 3QRIA 4I23A 4BBMA 3Q2MA 3BQRA 3KF7A 4IZ5A 1WZYA 3R71A 2XS0A 3UDTA 1KWPA 3CE3A 3VRZA 5M44A 1NW1A 3DDPA 3HA6A 5AA8A 2H34A 4O7WA 2Y4PA 4Z16A 5HTCA 2YJRA 3QAME 4FTKA 2R3JA 1H25A 1ZYDA 4RSSA 1RE8A 2W1CA 3GVUA 2DQ7X 5AX3A 2ITOA 4IC8A 2ITWA 3E3BX 2X6DA 4QTCA 5CZHA 4YJQA 4BVUA 2J4ZA 3AC5A 1JKKA 2XBJA 3QD4A 3KA0A 3KVWA 4R6VA 2V0DA 4IB5A 5TKDA 2KTYA 5AAEA 3D7TB 2XKDA 2XYNA 2VTLA 4CQGA 4OTHA 3QLFA 4IX6A 2R3RA 2IPXA 1PYEA 2XAMA 5D7AA 2CN5A 3TT0A 4BY9E 3ZSIA 3D4QA 3BGQA 3NWWA 1CSNA 4MHAA 1JKTA 2F7EE 1SM2A 2FUMA 4U80A 5HU3A 3VC4A 4D58A 3L8SA 4RWKA 2UZBA 2BPMA 2H8HA 4IZAA 4IM2A 5BUIA 1KUTA 2FO0A 2GHLA 1M14A 4PPBA 3UZTA 2C6DA 2WGJA 4EQMA 3R02A 3DY7A 4NTSA 3DKGA 1OI9A 1OL5A 4CFVA 4EBWA 2IZSA 2WQOA 3EQDA 3LM5A 4FVQA 3ANRA 1ZXEA 4O27B 5JKGA 4FKSA 3W0NA 2QQ7A 3E64A 4U3ZA 2PSQA 3S3IA 3ZSHA 1FVRA 4RIYA 4C02A 5AP0A 1U5QA 3E7OA 4YZDA 4QQ5A 4W4YA 2GNHA 3K5VA 4GVAA 3QCQA 3KXHA 2I1MA 4WT6A 3ROCA 3C0HA 2A0CX 2C6OA 4A9YA 3EN6A 1YWVA 4IAFA 3PA4A 4NT4A 4U44A 2VWWA 2R5TA 3PRIA 2YM4A 3P86A 1HCKA 4JBQA 4O0XA 5AUVA 3CD8A 4FYOA 2BKZA 3PJ3A 4YJTA 5IQCA 3QTIA 5IA3A 2C3KA 4AU8A 3FZRA 3MB7A 4IB3A 4ZJIA 3PIZA 5LMKA 1MRUA 5EW8A 3AXWA 2OFUA 1YI3A 2B1PA 2WEIA 4RIYB 5DEWA 3PLAE 2W4OA 3CSVA 4KIPA 2WQNA 5EOBA 4D1ZA 4EONA 4IFCA 2R3MA 2PUUA 2XJ1A 2PVNA 3LFFA 4L46A 5HEZA 4LMNA 2ITNA 1L8TA 2X6EA 4I0RA 4E3CA 1DI9A 3NCZA 4X6QC 3IPHA 2YZAA 3ZUVA 5G1XA 5GJFA 4EHGA 4YU2A 4YO6A 4FT3A 2YA9A 4HJOA 4BJJA 1IASA 5CEIA 3OXZA 3R28A 4FIHA 2QU5A 1F3MC 3W0PA 2J0MB 1W0XC 3C4EA 3WE4A 5HE3A 4ZTMA 2GS7A 2YISA 3R0TA 1FMKA 1SYKA 5DHJA 1M7NA 3FSKA 3R7IA 4YURA 3LFQA 2XK9A 4HVHA 5I9XA 5CF5A 3KIOC 3SXRA 4MX9A 4OTQA 4RLLA 5AV0A 3QWKA 3RTPA 3R8PA 1XBCA 3CCNA 3PVBA 5IA5A 5CU3A 2VX3A 1WBSA 4KSQA 4GUBA 3RM6A 1YOMA 4ASXA 3VAPA 3LPBA 4E1ZA 1OMWA 3BBWA 4BJJB 1WBPA 1OKYA 4QPAA 3R22A 4H3PA 4DH7A 5CAPA 5E8YA 1BI8A 3FJQE 2OJ9A 3F5GA 4FIGA 2BILB 2VTJA 2PVLA 3QU0A 1OPKA 1YVJA 2XKEA 5AP3A 3THBA 1Q61A 2BCJA 4APCA 4R1YA 4EUTA 3SW7A 4DDGA 3TYKA 2R0UA 3BYMA 2C1BA 4AWIA 4FF8A 1PXMA 4LV5A 5EDQA 3ORNA 4BRXA 3LFEA 3PFYA 5C4LA 5E8ZA 1YWRA 3QRKA 3VVHA 4E4MA 4EK3A 4G16A 2JDSA 3W1FA 4XNEA 2W9ZB 4BDFA 4KSPA 1UVRA 4K77A 5FQDC 4FUXA 3BLAA 3EQRA 4OUCA 2CCHA 4AG8A 2E9NA 4O7YA 3C4FA 4OT5A 1PHKA 4UALA 3KXMA 4FT7A 4ZK5A 1NXKA 3S00A 5CQWA 5GJGA 3R7OA 4NZWB 4AGDA 5HTBA 2HK5A 3IW4A 3MW1A 5TT7A 4ZAUA 4X0MA 4E6AA 4I4FA 1BUHA 4WOVA 4MXOA 3SAYA 1IA9A 3ZRMA 3EQGA 4AOIA 2PU8A 3LJ2A 4AAYA 2OIQA 3O7LB 3E8DA 3SRVA 5EM5A 5EK7A 4BTFA 1LUFA 3S4QA 4GIHA 4RLKA 3AKLA 1YXXA 5GNKA 1LP4A 2QODA 3AG9A 3FWQA 4RIWA 4WO5A 4G3EA 4DLIA 4EOPA 5AR5A 3UQFA 1YW2A 3ORTA 3WBLA 4PDYA 5C8NA 3IW6A 5JEBA 5L2IA 4LL0A 4U0IA 4AE9A 2PL0A 5D12A 5IH6A 4OLIA 4F65A 4DYMA 4O91A 4QT1A 4FV9A 5D10A 3TDWA 2UV2A 4BDAA 1F0QA 4D1XA 4RVTA 5I3OA 5C26A 3LXPA 3SRVB 2OBJA 2ETRA 4J98A 2Z7QA 4EYMA 4QP9A 5AP1A 5CSPA 3PVUA 5GJDA 2VD5A 3HV6A 1Q97A 2WKMA 4G3GA 5DN3A 3T9IA 5HD7A 5HCXA 3MPAA 3TG1A 3OWJA 2CKOA 2FA2A 3E62A 3KMWA 2R3FA 3SQQA 4YLLA 2CDZA 3M42A 3MV5A 3VWAA 3V5PA 4CMOA 4ENXA 5FTGA 3PXYA 3PG1A 3CIKA 3R04A 5AIKA 3EFJA 2JBOA 4BI0A 3QQUA 4HCUA 4PDOA 3AD4A 4Z9LA 1URCA 5FXSA 3Q96A 3P0MA 4IX4A 4ZSLA 3U4UA 2ZOQA 2QLQA 4D9TA 4AQKA 2BDJA 3OWPA 1CTPE 1OKZA 3CQWA 2ITQA 3BHUA 4WRSA 4GFGA 5AP4A 4A9SA 3SKCA 2ZYBA 3ATTA 4D28A 3DLZA 4IZ7A 3FMEA 3I60A 3W8LA 4EOIA 3SGCA 4CLJA 4M15A 4GIIA 3QQJA 3CPCA 4LRKA 5BUEA 1MQBA 3LCSA 3W18A 4D0WA 4II5A 4X3JA 5I3RA 2CSNA 4DN5A 4QMVA 1JPAA 5AV1A 5CEKA 1GIIA 4OTFA 4CEGA 3MVLA 3O8PA 3WF9A 5E7RA 5M55A 3O8TA 4ITIA 4P7EA 1PXJA 4N70A 3ULIA 3OHTA 2A27A 4MBJA 1KE9A 4TYGA 2WTJA 5BMMA 3VQHA 4RPVA 5C9CA 3MN3A 4H58A 3P9JA 4QP2A 4DGGA 2CKEA 2G2HA 2BZKB 1Q41A 2G2IA 2XRWA 4ACMA 2QC6A 3LAUA 2WNTA 2YCQA 3A99A 4BDIA 3HV4A 2PZIA 3VBVA 3UQCA 4C3RA 4IAYA 3U8WA 1J91A 2JIVA 4JRVA 3QKLA 5DFPA 4FV4A 3HV7A 2VTIA 3FPQA 2R9SA 2YDJA 3RJCA 4CFMA 1E9HA 3D2IA 4WRGA 3BV2A 2VTQA 2IO6A 5CSWA 3QKMA 3ZFMA 3FMNA 4UXLA 3ENMA 3PJCA 5AM6A 2IG7A 3FMHA 5HCZA 3EZVA 3MVHA 2OF2A 2BZJA 3SXFA 3PPZA 1GNGA 1ZOHA 3PE1A 4YNOA 4A4XA 3Q3BA 1PXNA 3C5IA 3E3PA 2CLQA 1GOLA 3LCKA 2Z8CA 4KKHA 2G2FA 3ZDUA 3BLQA 4PY1A 5CLPA 5KMNA 1JOWB 3ZEPA 2FSTX 2EU9A 2J90A 2WB8A 4FSMA 5D9HA 5ANEA 1OIYA 4CYJA 3N4TA 4WUNA 4YZ9A 2A1AB 4ZS4A 3DS6A 4L44A 4BYIA 4LOOA 5TOZA 4LV8A 3F2NA 1YXTA 4BF2A 4TYHA 4BKZA 4DAWA 2ITTA 4O4DA 4XV2A 4DCEA 4MF0A 4DFUA 3DV3A 4MQ2A 5FGKA 5CU4A 3D83A 4F7SA 2IWIA 4RFYA 2AC5A 3AT2A 5EHOA 3OW3A 3RNYA 2XALA 4FKLA 2J9MA 3NW5A 3QGWA 4KNBA 5AMNA 4HW7A 3B8RA 4FTNA 4MQ1A 3LCDA 1Z5MA 2JAVA 3KN5A 2GNIA 4ENYA 2C0IA 5A46A 3BEGA 3ML1A 3QQGA 2SRCA 3KY2A 3F82A 2WMRA 2W17A 4O4EA 3TM0A 4CV9A 4TYHB 4ZSJA 5FWKK 5JFXA 3H0YA 3VS4A 1Q8WA 3R00A 5DG5A 3RCDA 4DGOA 3LCTA 3UO6A 4O0TA 3RALA 4LGDA 4F7JA 2KULA 2CN8A 2UZVA 5HCYA 2Z7LA 2BROA 3ORLA 3QTZA 2CKPA 4IDVA 2EB2A 2WTIA 3HL7A 4BDDA 2JIIA 5CEMA 1IAHA 4ZIMA 3TZ9A 4Q9ZA 2X0PA 2O63A 4OTDA 2W7XA 3UMXA 3R7UA 4QEBA 3KRRA 3P23A 3QZFA 4X2NA 4CRSA 3HAMA 2C5XA 3WZJA 3UIXA 3UZRA 3K54A 5EI2A 4O4BB 3TV7A 5KKRC 3UG1A 2XK4A 4O0SA 3OBGA 4PL4A 5M51A 4AXDA 4FJVA 1ST4A 3CTQA 4FKVA 3VRYA 2C6IA 2G15A 2UZWE 4JDIA 4KA3A 4DHIB 1YKRA 3D0EA 3DJ5A 4U6RA 3QHWA 2YAKA 5HGIA 4FYNA 2BVAA 2RKUA 4YJRA 5A4LA 2J5EA 3FQHA 4G9RA 4WSYA 4K11A 3FI3A 4G5PA 4C61A 1KE8A 4MD7E 3NS9A 4KS8A 3V5QA 2XNNA 4AA5A 4ZS0A 2OK1A 2VV9A 3SX9A 2REIA 4FV3A 2C5VA 3ROYA 2WIPA 3SG8A 4GFOA 3TNPC 2BTSA 4AUAA 3TKHA 2VX0A 4KRDA 4WNKA 3RWPA 2OG8A 3MH2A 4X21A 4BKJA 5JMSA 4EC8A 3ORIA 2JIUA 2QOKA 4D55A 4Z7HA 4BDCA 4USFA 3LHJA 3IECA 3Q9XA 4OTRA 3RNIA 2GHGA 3GC0A 3ORXA 1PXOA 2IF8A 5BQ0A 4DG2E 1W82A 4ZOGA 5FEDA 5A4CA 4AGUA 4ASEA 2R64A 3GC8A 1RW8A 3FZPA 2P2IA 3PY0A 2OJIA 5DA3A 2UUEA 3WYYA 3H0ZA 2A4LA 4QMUA 5FP5A 3FC1X 2CGVA 5ANDA 2RG5A 5E8TA 4MBLA 2J0LA 4A4LA 4GMYA 4JIAA 4GH2A 5IA2A 2JLDA 4WKQA 1Q24A 3HEGA 5FM2A 4BHNA 4DEBA 4UWCA 1O6KA 3MS9A 3CKXA 1R1WA 3NYXA 3ZDIA 2HYYA 1ZMVA 3RAHA 2ZM1A 4EEVA 3AD5A 3UYSA 3PSCA 1J3HA 1YWNA 4NWMA 4XHKB 4C7TA 4EYJA 4D1SA 2WHBA 2YCSA 4CFFA 1OUYA 3WOWA 2AEGA 5BV3A 4ZTRA 4GKIA 1T45A 4QP3A 3R1NA 2Z7SA 4XRLA 5M53A 5DGZA 2VO3A 2WO6A 3QX2A 4A06A 3LMIA 4NK9A 3W0RA 3FC2A 4FC0A 3FKNA 2I40A 3HGKA 4PL5A 4IE9A 4C62A 1WAKA 3O17A 2GS2A 4LQMA 3TNWA 4AW0A 1E1XA 4ASZA 4FTUA 3HV5A 1H24A 3LLTA 3KRWA 3MH0A 3NCGA 3UDBA 1XJDA 3QUEA 1NVRA 4EH7A 4O7VA 2FGIA 1UNGA 2X1NA 2C6EA 2G1TA 3A2CA 3B2WA 1G8AA 3W0OA 2PVJA 3PFQA 3W0QA 3NAXA 2R4BA 3RZFA 2XUUA 1TZDA 3LFBA 3QA0A 3ZO3A 3KXZA 4HYHA 5JSMA 5CI6A 2FVDA 4XOYA 3VUGA 4RZVA 5M4UA 4J8NA 4E20A 3DU8A 4NJ3A 4ZSEA 2X2MA 2FSLX 4O0RA 3W16A 4UWYA 4X2FA 5L6PA 4ZMFA 3FYKX 5I9UA 5A4EA 4N0SA 4IMYA 4MD9E 4EK8A 3BYSA 4TKSA 2C5OA 3C1XA 4X2KA 1Q8TA 5LVPA 4TYJA 3BV3A 2C68A 4IM0A 1MP8A 4XG9A 5DOSA 2E9OA 1KE5A 3DJ6A 3I7CA 4H39A 2XZSA 4RWIA 4QMQA 1ZRZA 4HCVA 4BCOA 4IX5A 3QD2B 4HCTA 4X2GA 4FGRA 4BYJA 4GG5A 1PMEA 2ZV2A 5FRIA 1SMHA 1XWSA 4DGLC 2J2IB 2QOFA 3NX8A 2B9FA 5FUTA 3EN4A 4PTCA 3OCTA 3ODZX 3R21A 2GQGA 4L8MA 4E5AX 3EN7A 3SOAA 2F49A 3TTIA 4M66A 1BL6A 3QTWA 4KIKA 1VR2A 4ARKA 2OXXA 4JQ7A 3HUBA 5ANIA 3BU5A 4L3PA 4F08A 5M08A 1OM1A 3HVCA 2OH0E 2XK7A 4MK0A 5IQEA 4ORKA 4XX9A 5LCKA 3A7IA 4MH7A 4L53A 5IF1A 1JVPP 3EMGA 2YIYA 3H9RA 4O7LA 2I0YA 4JQEA 4J99A 5HD4A 3LIJA 4O86A 3QBNA 4JL9A 1JLUE 3FZTA 3PUPA 5EYKA 5HVYA 5E4HA 3NUSA 1WCCA 5A6OA 2CGWA 4BGGA 4BWPA 4E5BA 3RHKA 4EWQA 5AAGA 3OT8A 4KIKB 4CZTA 2OWBA 1ZYSA 3UOHA 4IW0A 4XOZA 3DDQA 3DBDA 3FL4A 5JZJA 2O2UA 4YPDA 1BYGA 3DKFA 1UA2A 1IAJA 4NEUA 5C03A 2UW4A 4G6OA 4GYGA 4X2JA 4XG2A 5BVDA 4YJNA 4UX9A 2PUPA 3VJNA 4AT4A 1H27A 1H1RA 4HGEA 2XIKA 3EQHA 2QOBA 4UZHA 5KMKA 2C3IB 3IW8A 4R77A 3E63A 2WMAA 3A4OX 3FEGA 2GMXA 4DFZE 1FMOE 3PSDA 2C6MA 3HX4A 4RFZA 4L6QA 3CKWA 4YJOA 3QHRA 4KIOA 5FEQA 1WBNA 4FKRA 4OBOA 5CVFA 4QMPA 5IUIA 3BBTB 3FZ1A 4KKEA 2RSVA 2W06A 3R1YA 4OBPA 4TWNA 3UP2A 4M8TA 1OBGA 4CCBA 4EOSA 4EORA 1Q8ZA 4DITA 4QMYA 3QQFA 5KMOA 1A06A 4N6ZA 5J1VA 4YZBA 4NYEA 3FXWA 1PXKA 2BAJA 2XIXA 2ITYA 4J95A 5E92A 2Z7RA 2YWPA 3DCVA 5L8LA 3NLBA 2YIQA 4UYAA 5DIAA 5C4KA 4PL3A 1G8SA 5BVWA 3QYWA 2QG5A 4HPUE 4IAKA 1ZZLA 5CS6A 1G8JA 5I9YA 5JFVA 3C4WA 5FXQA 3SV0A 2XNPA 1YXUA 3L9NA 5FTOA 4O22A 5IQHA 2BFXA 3RZBA 1SNXA 4JXFA 4AFEA 5HNIX 3WZDA 2BRMA 4M14A 4PMTA 3MH3A 1PKGA 2XK6A 3C13A 3Q6UA 1TKIA 1PMVA 3QD0A 3QL8A 5K0KA 3VS3A 3WF8A 4C4GA 2H6DA 5GZAA 4JR7A 1CKPA 5I9ZA 5CU6A 3BIZA 3UTOA 5DMZA 4EOKA 5L6OA 4XBRA 3FXXA 5CNOA 4G1WA 2PZ5A 2HW6A 3L8VA 3H9FA 4G17A 3SHEA 4PMPA 4FKGA 4ASDA 5BVNA 2QR7A 5KHXA 1OGUA 1Q5KA 5T6KA 2I0VA 4O21A 3OEZA 4DE4A 3O51A 3ZOSA 1ZMWA 3NFGB 3PVGA 2OZOA 1Q62A 2VWBA 4NKAA 4RFMA 4AX8A 4BI2A 3UVRA 3DAEA 3OVVA 2IEWA 4MXZA 2ERZE 2QOIA 4MXAA 3R7YA 3ELJA 2Y9QA 1YOJA 3FZOA 4FTQA 2P4IA 2RG6A 3HDNA 4I41A 5BMSA 4V04A 3VUKA 2VO6A 4XG4A 3OWLA 2XNGA 2WEVA 3OEFX 5HIDA 5BVFA 1UU7A 3PP1A 4A9UA 4ITHA 4BZOA 4ZY4A 2HZIA 4K9YA 4XG7A 4JVGA 5HNBA 1ZAOA 3DJ7A 3TEIA 4IWOA 4BGQA 1ST0A 1J1BA 3BI6A 5AUUA 3QF9A 4EH5A 4AXCA 3F5XA 4FZFB 3C4CA 3RK7A 5K5XA 3FY0A 3TUCA 5IQDA 3W0SA 2R3IA 1W2CA 2CHLA 3HV3A 1CMKE 1P5EA 1P4OA 3DQXA 1KV1A 3AD6A 5EDRA 3F5UA 2ZB1A 3Q4ZA 3PSBA 4I3ZA 4KABA 4ZTSA 1IEPA 3RPSA 4F0FA 4E7WA 4QQJA 3RAIA 4FSUA 4TWCA 2OKRA 2BDFA 3O96A 4S31A 5LVLA 4F09A 2F9GA 5EKNA 4AXEA 2GDOA 2VWUA 3QALE 4O4FA 2JAMA 4O0UA 3TKIA 4EBVA 5BNJA 2AUHA 4RX8A 4EZ3A 4EK6A 3GB2A 2ZV7A 4JQ8A 2YERA 4DDIA 4PUZA 1MQ4A 1Q4LA 3OTVA 3DZOA 3H10A 3RP9A 1R0EA 4IHPA 2X0GA 3KKVA 3BLRA 4G6NA 3GC9A 5CY3A 4Z3VA 5KMIA 1AGWA 2C3JA 3E5AA 4JBOA 3EKNA 2B4SB 4EOQA 4ANSA 3OZ6A 4JS8A 3BHVA 3KREA 4RJ6A 4MVFA 4L7SA 3D5WA 3KK8A 3REPA 4CD0A 4OBQA 1W7HA 3PJ2A 3OTUA 3UYTA 2PVYA 2I0HA 5F20A 4XMOA 2HCKA 4K33A 2C6KA 2BIKB 2YJSA 3JPVA 3PJ1A 3QTUA 4FKQA 1ND4A 3MGYA 5AV3A 2DUVA 3POOA 3KVXA 4O7RA 1CM8A 1REKA 2OFVA 3DKCA 2R3PA 3KGAA 3KMUA 5D41A 4ALWA 5JT2A 5IH5A