5L6PA

Ephb3 kinase domain covalently bound to an irreversible inhibitor (compound 6)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
274
Chain Sequence
b'CVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNPASLKVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-B receptor 3
publication title Development of Specific, Irreversible Inhibitors for a Receptor Tyrosine Kinase EphB3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 274
sequence length 274
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l6pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l6pA01
5DLSA 4KIPA 4F63A 4ZZOA 5DYJA 2WQMA 4IEBA 2OXXA 1OMWA 4GRBA 1G8AA 1GZOA 5FXRA 4CCUA 4Z7HA 4O82A 2UZWE 2F7EE 2Z7QA 4N6ZA 3SX9A 3ZBFA 4F9WA 5I0BA 4J53A 3W2QA 2VZ6A 4FV9A 5C27A 5EQEA 5J8IA 3VJNA 3AXWA 2CGWA 2Z2WA 3UC4A 4M13A 1BI8A 3ZUVA 4S34A 1CM8A 1CDKA 3T8OA 3EQBA 2PTKA 3E8CA 3I7CA 4BCPA 3UPZA 4FGBA 2WTIA 3ZLWA 4B8MA 2UW7A 5AX3A 3BHVA 4HGEA 4QMSA 3KC3A 3GP0A 1ZYJA 3M1SA 4JBPA 5AFVA 1UV5A 2UZDA 4U44A 2PZRA 3OROA 4L6QA 2VX1A 3EQPA 5M53A 1Q8UA 1A9UA 3TEIA 5C1QB 2ITUA 2XNBA 5EKOA 2R9SA 4ZZMA 4FTKA 5CU2A 3E62A 3E8NA 4F6SA 4CEGA 2BHEA 2XP2A 1PW2A 5AUVA 3OWJA 4RLLA 2I40A 5LWMA 2XCKA 1WBPA 2ZVAA 2X6EA 4JJRA 3F5PA 4UN0C 4X3JA 3FZTA 2W1ZA 3BYOA 5DA3A 2V22A 3BHHA 2W4KA 4PDOA 3HMMA 4TPTA 3SHEA 5CI7A 3Q3BA 5LVLA 5HQ0A 4HW7A 3TUBA 3SC1A 1UU8A 2R4BA 3NLBA 5HE2A 3C0IA 5DG5A 4CG9A 2FA2A 2ITZA 5HHWA 3WF6A 5DRBA 3ZO2A 2W5HA 4M69B 2PL0A 2QOFA 4BCQA 3U9NA 3C4XA 1YDSE 4G3CA 3E63A 4ZY5A 3NMUF 4IJ9A 3UE4A 4BTJA 2IG7A 4HCVA 3PJ1A 2AYPA 4X0MA 1OBGA 3HV4A 5CT7A 1XH5A 4PRJA 3I60A 4NEUA 2XKDA 4MD9E 4O84A 3WE4A 4QPSA 3QQHA 4QQ5A 1Q3WA 3BYUA 4FF8A 1YOLA 4G5JA 2C6KA 2R3NA 1DS5A 2WU7A 3VIDA 4AS0A 3QRIA 3P4KA 4BCHA 4EH2A 2YABA 5I4NA 2C5XA 3ZZWA 4MNFA 4WO5A 4XG3A 3R7IA 3RALA 5CF8A 1W8CA 5K0XA 4ENYA 2XNGA 3R7EA 3V8TA 2WIPA 2Z7SA 3EN4A 2OIBA 5ETFA 4PDYA 5E8WA 2ZV8A 3VUMA 3N4TA 4TT7A 4Y83A 3WOWA 1WVYA 2OBJA 1KOBA 3N9XA 3A60A 3QWKA 3ZOSA 3FJQE 4UMQA 3LE6A 5C8KA 1T46A 4XX9A 2ZM4A 4X6RA 1J1BA 1PKDA 2B52A 4QTBA 3LQ3A 5M44A 4UYNA 4IW0A 3D5UA 2GHLA 2REIA 1TQPA 2YERA 2Y6OA 3QQLA 4FICA 5GJDA 5BVWA 3R22A 4O7LA 3CPBA 2UZEA 4IB3A 5JH6A 3CQEA 1IA9A 2UW9A 1SNXA 2YFXA 4DGOA 4DFXE 3JS2A 3GNIB 2QD9A 4QQTA 3O23A 3R00A 3COKA 4F99A 4XRLA 3SOCA 3IW6A 2E9VA 2BAQA 1OVEA 4HGSA 5A6OA 4H1JA 4MF0A 2X39A 1VEBA 3SLSA 2PU8A 4UMUA 4WUAA 1JBPE 3KRJA 3RVGA 4EQMA 1SMHA 3F7WA 1Q8TA 3CS9A 3TKUA 4NYEA 2BILB 3O8PA 2ITYA 4CMTA 1FINA 4E5WA 5LXMA 3KXHA 4LMUA 3VW8A 3FQEA 5JZNA 5LQFA 3LCSA 4FT9A 2XS0A 5IH4A 3V01A 3RAWA 2GQRA 4YO4A 4ZMEA 5J95A 3Q4ZA 2YM8A 2GNJA 1G8SA 3L1SA 3RAKA 3L8SA 1JSUA 2F4JA 2GTNA 2J0MB 3GVUA 1OIUA 5AV1A 5AMNA 3LVPA 4DFNA 1GNGA 2IW6A 3FMHA 4QOXA 5DH3A 3R7VA 5B7VA 4BDJA 2JBOA 4IX5A 4JXFA 4G3DA 3COHA 3SG8A 4FTMA 3RPVA 3IECA 2QCSA 3ALOA 2QC6A 4IAIA 1WVWA 2RFNA 4FNWA 3ZFMA 5IH6A 5L8KA 1Q5KA 2BAKA 2QOOA 2PZIA 3HP5A 3Q4UA 4EC8A 2Y4IC 3IG7A 3GU5A 4YJSA 3PSCA 4FK3A 3EQIA 2XYNA 4I22A 1S9IA 3ATSA 3QKKA 2B9IA 4EH3A 2ITNA 3DCVA 4P5ZA 1MUOA 4RJ5A 2VX0A 5HTCA 4BGGA 3I79A 4I6HA 3C5IA 4OT5A 1ND4A 3C9WA 4MXZA 4NSTA 4HPUE 4O0RA 4RVLA 2B0QA 3VHKA 3TV4A 3FKNA 3NS9A 4JNWA 1OI9A 3A61A 5JFSA 4TYHA 5L6WL 3C4WA 4GFMA 4MKCA 3E92A 3E5AA 4W8DA 1BLXA 2PMNX 1UU9A 3MTLA 4WUNA 4EH9A 5C26A 4GK3A 3ID6C 4FIIA 2R3QA 1JPAA 1Q8WA 2Z7LA 1ZRZA 5F20A 5BYYA 1I09A 4TRLA 5HU3A 4O0XA 4P90A 4PMMA 4W8EA 2R3LA 4XNEA 4U79A 1V0PA 2Y7JA 3DZQA 4QO9A 2XVDA 3MDYA 4AWIA 3V04A 5KNJA 3ZFYA 5LJJA 4YLLA 3IKAA 5HNGA 2BCJA 2ZB0A 1YXSA 2PUUA 3FMDA 3GCQA 4YUQA 2ZV7A 3MWUA 2BTSA 3PIYA 2J0KA 4EK3A 4JI9A 5JEBA 4BTKA 4C35A 4F7NA 5AAFA 3PRIA 5C01A 3C5UA 1M2PA 2GDOA 3U51A 1GIIA 4JBOA 4KAOA 3ZSGA 2PVHA 3A99A 2YA9A 3PLAE 4K8AA 3ZSHA 3DZOA 2PVJA 4XP3A 2QLUA 4ANOA 5B2LA 5IQAA 5EH0A 2BRHA 4D2RA 3PFQA 2OXDA 3LQ5A 4ITIA 3ZEWA 4U6RA 2UZBA 4GUEA 3GU4A 2A0CX 1H0WA 2P33A 3TCPA 2J90A 3AT3A 3VS1A 3DXQA 2QLQA 1PXIA 3RM6A 4M0YA 3UG2A 4UXQA 4RIXA 4EOKA 4ZAUA 4EL9A 3RI1A 3TKHA 4O1PA 4GFOA 1REKA 2ZV2A 3RNYA 4RIYB 3TZ7A 2JDTA 4FIFA 3DAEA 4TYJA 3T9TA 3FMKA 3RAHA 4PL4A 4S31A 5CXHA 3BX5A 5IMEA 5LVNA 4ACHA 4AT3A 4UWYA 5HX8A 4QMOA 4II5A 5E9EA 2YJSA 3NIEA 3JYAA 4MEDA 2P2IA 4XJ0A 3VS6A 5GIPE 5CYIA 4CVAA 4EOOA 5DFPA 3FMNA 3BELA 4D4YA 5HX6A 4UYAA 5AP7A 2XIYA 2BVAA 4DBNA 5TE0A 4PTGA 2ITVA 4L52A 4BIEA 1RDQE 3RPRA 1BL7A 5EHOA 4QTCA 2F2CB 3PVWA 4EOMA 2XK7A 2ESMA 2XJ0A 4R1VA 3SV0A 2XBAA 2OZAB 3O50A 3UDBA 1PMVA 3VBVA 4L42A 4ZLOA 2W1GA 3UYTA 2E9PA 3UNZA 3OXZA 4DINA 2HK5A 5IQCA 3I5NA 4F65A 3FBVA 2PHKA 4G6LA 4JQ7A 4AZEA 1HOWA 3VBWA 4M0ZA 3L8XA 2QOBA 3EQRA 2BDFA 4IIRA 4C8BA 5CF6A 3QRTA 2WB8A 2NNWB 4X21A 4E7WA 3HLLA 4I93A 4V0GA 1OPJA 3C4CA 3OT3A 4FKQA 5DT0A 5HG8A 2PZ5A 2WHBA 4D9UA 3E3PA 3UQCA 3D7TA 4YZBA 1H07A 4XG9A 4MYGA 2H6DA 5IF1A 2ZDUA 4C4JA 3QC4A 1JAMA 3ROYA 4E4XA 3BLRA 4I24A 4F64A 1SM2A 4FG7A 4NM7A 2HIWA 3KF4A 4YNEA 4GKHA 3CEKA 3S95A 4DGMA 4OAVB 5ANKA 2I6LA 2OH0E 3AOXA 3FPQA 3O8UA 2WTKC 3Q9ZA 2CNQA 4YTHA 5K5NA 3G33A 2IZTA 4U80A 5H8GA 5HTBA 4AZSA 3QD3A 2XK9A 3ORKA 3OW3A 4EH6A 4WRGA 4W4XA 4Y5QA 2X6DA 4H36A 2X8DA 4P7EA 2IW8A 3TWJA 1PYEA 2O5KA 5CF4A 5BYLA 1PXPA 4ZS0A 4F9YA 4XP0A 5FEQA 1JSTA 3LXNA 5CXZA 4C4IA 1MQ4A 5J7HA 2Y0AA 4QMQA 3NGAA 5FGKA 5B0XA 1YDTE 4ZMFA 3SDJA 4PUZA 3UIXA 3V5LA 2OLCA 2QR7A 5EDQA 1B6CB 3HMOA 3TL8A 2XMYA 3KVXA 4XV9A 4PDSA 5KMIA 2GHMA 2R3OA 2WZJA 1H24A 1V0OA 2PK9A 3BGZA 3BLHA 4S30A 4AFEA 4CV9A 4WG4A 4Q9ZA 5DR9A 5FXQA 3ZRKA 3VC4A 1OB3A 4HNIA 3OEFX 2OZOA 4JG7A 3HZTA 4L7SA 3PZEA 3ZO4A 2OI4X 4CZYB 4FEQA 4D2PA 4PL5A 4X2KA 5J1WA 3PY0A 4Y46A 4YBKA 3IDBA 4R7HA 2R2PA 1OKWA 3NNVA 4MX9A 4YZ9A 3IDCA 3TDWA 2WMTA 4E26A 5ICPA 4QYYA 3Q53A 3OWPA 4BTFA 2Z7RA 5IA0A 5LVMA 1GZNA 4F0IA 4IVBA 4PNKA 4Z55A 5F94A 2YZLA 4KUJA 2H9VA 3MA3A 4N6YA 4BBEA 4CMOA 5AEPA 3CD3A 4ERWA 5E4HA 2RIOA 2YISA 4LRMA 5EK7A 2NRUA 3JVSA 3D5XA 3L8PA 4QQCA 3UNKA 4FKOA 1KUTA 3FHRA 2XF0A 4KBKA 1YOMA 3TDVA 1BUHA 1UKIA 3Q32A 5HG5A 2PMIA 2XYUA 3D5WA 4XBRA 3WYXA 5IQIA 5CSXA 4JDJA 2IZSA 3PJCA 2FSOX 2C30A 4OT6A 4X3FB 4ZTLA 4CYIA 4ZY4A 3B8QA 4ZJIA 2I0VA 2VO7A 1M14A 2JFMA 4ZXTA 5CAOA 3D7ZA 5A4TA 2V5QA 4GIHA 1Y8GA 3GOKA 3CTJA 5J7BA 5K3YA 3DXPA 2J5FA 4D1SA 1YDRE 4J99A 3O51A 1F5QA 5T3QA 4BIBA 2HY0A 3A4PA 4FSYA 3SG9A 3CJGA 3VJOA 4C37A 4D28A 1H28A 3NW5A 4EH5A 2P3GX 1TKIA 4U7ZA 4M68A 3ITZA 4X2JA 4KD1A 1BL6A 2AC5A 4EQCA 3L9MA 2RFSA 3OP5A 4MXCA 5LCJA 3VRYA 1CMKE 4XG8A 1JKLA 2HWOA 3FE3A 4FV7A 2XK8A 4AZWA 3DKOA 4O1OA 1GZ8A 2QO7A 3CLYA 3R9OA 4B6LA 4FT5A 4QMNA 1AD5A 4I4FA 5KE0A 4FTCA 1YOJA 2XIRA 3FZOA 4LOQA 4D2WA 3LLAA 1CKPA 4E4MA 4RGJA 4TYGA 4CXAA 5M07A 4FKRA 3UQGA 1H27A 1ZYLA 3EB0A 4EJNA 3KULA 5I3OA 3BU5A 3NIZA 2OKRA 4E6DA 4BCNA 4GV1A 4QP1A 3L8VA 3NCGA 1KE9A 1XHAA 3O17A 5CQWA 5BVEA 1GOLA 3FZRA 2UW6A 4PTCA 3ORPA 4BYJA 2FGIA 4BCFA 2V7OA 4AN2A 4ZJVA 3Q9WA 1LR4A 4FV5A 4I4EA 1O6YA 4I0RA 4PP9A 2RG6A 3IGOA 5E8SA 5FM3A 3SXSA 5AA9A 3UG1A 3PA3A 4FSZA 4S32A 3AT4A 4ACCA 3LCOA 3PVBA 4BVUA 4PF4A 3ORMA 5CU4A 4LRJA 4ONAA 3R8UA 4FEUA 3IQ7A 4O7NA 1KOAA 4XV3A 2QOHA 3DDQA 4YJVA 3MH0A 5ACKA 3ULZA 3NYOA 3R2BA 2PMOX 4CFWA 4QTAA 2GQGA 3NNXA 3HYHA 4ZTRA 4H58A 1ZMWA 4O0YA 4OBOA 4BBFA 3OCBA 4DGLC 5AP3A 3AT2A 4C38A 2R3PA 2W96B 4IZYA 4B99A 4N70A 3F9NA 4BHZA 2KULA 3QU0A 4QPAA 3SVVA 1XH8A 5CEPA 2CMWA 3CY3A 2FH9A 1IR3A 3Q6UA 2GQSA 3BU6A 4OTHA 2ITXA 4BF2A 1H0VA 3P0MA 4YURA 4U0IA 4IVCA 3QD2B 5ANOA 2WIHA 4X2NA 5JZJA 4TWOA 4RLKA 4G9RA 5HE3A 4AN9A 4OBQA 3OBGA 4BRXA 2XIXA 3H30A 3PWDA 4U81A 2J0JA 4NJ3A 4R5SA 5BYZA 3C51A 3GCUA 3ORXA 4JBQA 4Z3VA 3CCNA 3NUAA 4BCKA 3FKLA 5KUPA 2HWPA 5IUIA 2RGPA 2PZYA 4AQCA 3CKXA 5KMLA 1UNLA 3OEZA 2PVKA 4FL2A 2X7OA 3F2RA 4TWPA 4AG8A 5FTOA 5HBHA 4I5CA 1ZYCA 4ALWA 2IWIA 2C6OA 3CQWA 4B0GA 2CCIA 3EFKA 4GW8A 3EIDA 3KFAA 3OUKA 2R3MA 1APME 5F1ZA 1PXOA 3POOA 4UEUA 4FZ6A 5AR7A 5EYMA 3ZYAA 1FVRA 4O7WA 4X6QC 1YHVA 3EN6A 2BDJA 4FX3A 5DEWA 5CX9A 4FG8A 3R7UA 4M7IA 2CSNA 3DBQA 3FC1X 3OOGA 4IDTA 3TACA 3F3WA 2HENA 4LI5A 2J9MA 4ZLZA 1GJOA 3IK3A 4ID7A 4DAWA 3HDMA 5KZ0A 3RKBA 1JLUE 3UOLA 3LFQA 4JR3A 1OUKA 3W2CA 5KCVA 2BFXA 5T68A 3F2AA 2B53A 5J79A 5BQ0A 4APPA 1E1VA 3DLSA 4W9WA 3ZBXA 2R7BA 3ZEPA 3KB7A 3OWLA 2FO0A 3NW7A 2VTJA 4OW8A 5AIKA 3U9CA 3F2NA 2B55A 3RCJA 4BICA 3IW8A 4NTTA 4YP8A 4BZDA 5LOHA 4AA5A 5IA4A 3EWHA 4NCTA 4QD6A 4H3QA 2QODA 5HESA 5FTQA 5K9IA 1YRPA 1KE8A 3SW7A 5FLFA 3QQJA 4QTDA 1H4LA 2OFUA 2YDJA 3E8DA 2UZTA 3BLQA 4IMYA 3R7YA 4EOJA 4HOKA 5E8VA 3F66A 4MCVA 5IDPA 4AP7A 2J4ZA 3QTZA 4UXLA 2ZM1A 3WYYA 4FIHA 5J5TA 2J51A 3AMBA 2BZJA 3FHIA 3ZXZA 5CU0A 2HAKA 3F61A 4QMPA 4RIYA 1NA7A 2H8HA 4RVKA 2JKOA 3QHRA 4IDVA 4BY9E 3D4QA 4R1YA 4F9CA 1Q8YA 2QHNA 3I81A 3CTHA 4RJ4A 5HKMA 4EKKA 5EFQA 4BTMA 3FLNC 4UMTA 3BHUA 3PXRA 4QP8A 1H08A 1YI3A 1KWPA 3VS2A 1FPUA 4I0SA 3NR9A 4EZ5A 5AR5A 3PDTA 3MH1A 4LG4A 4DGNA 3R1NA 3K2LA 5HO6A 2GS6A 2C3KA 3EZRA 3DTWA 2ERZE 2GPHA 3HRFA 3MY5A 5HLPA 4CSVA 5FDPA 5CAUA 2QOCA 1OM1A 3IW5A 3H9OA 1O6LA 4QNYA 5CSPA 2X4ZA 1PMNA 3QQFA 5CVFA 4A9TA 2VTIA 3ZTXA 3LMIA 3NWWA 2J0LA 4K6ZA 3V5WA 3D83A 2OZAA 1IA8A 5L6OA 2Y4PA 3FLQA 4IB0A 1NVQA 3MN3A 1FGIA 1W83A 3BHTA 1QCFA 4XLIA 4IXPA 4C34A 2J2IB 5JSMA 2IJMA 1Y6BA 3OG7A 2OJGA 1QPCA 2Q83A 3OY1A 4ALUA 4QP2A 3K5VA 1CKJA 2XNEA 1U5RA 2NPQA 3MSSA 3QL8A 2BMCA 4BCIA 4YJTA 1WFCA 3PG3A 3MY1A 5F95A 3ACJA 4EWQA 3P5KA 4FUXA 2VAGA 2PMLX 1BMKA 5HEZA 3R63A 4AGWA 3V5QA 5LCKA 4QYFA 2IW9A 5KKRB 4FV3A 3WIGA 1XJDA 4FTJA 4U45A 2QONA 1H1WA 2B9HA 2R5TA 2GTMA 3CQUA 4FOCA 4YJRA 3MGYA 4TY1A 1ZMVA 5A6NA 3MVHA 2PVLA 2R3KA 3OF0A 4RQVA 2YIQA 3RTPA 3V6RA 3BEAA 3ZC6A 4K0YA 2O64A 3B2WA 2E9OA 4CFVA 4DITA 4WG5A 3WF9A 4JRNA 4G5PA 1OECA 1OL1A 3PUPA 3DLZA 1XH9A 2GMXA 3C0HA 3C4ZA 4YJNA 3THBA 4IM2A 4V01A 5AUTA 4M84A 2WTJA 3KRXA 5H2UA 2PSQA 4KA3A 3BGQA 4GVJA 3LLTA 3D2KA 3O7LB 4FA2A 5EI2A 3Q2JA 3ZUTA 4L3LA 2PUPA 3UP2A 2XA4A 3QHWA 2PVMA 3HV6A 2GFSA 3F5UA 3PA4A 5I9ZA 2E9UA 4ZOGA 4CFNA 1YWNA 5BVFA 1PXKA 1J7UA 1Q4LA 3ENHA 2C5OA 2CLQA 5ANJA 2HCKA 1H1PA 4YTIA 2W1CA 2WELA 3TKIA 5DBXA 4FYNA 3R1QA 5FEDA 3TG1A 1E9HA 4YZMA 1YKRA 5EG3A 2BDWA 3R1SA 3NW6A 3KVWA 3TXOA 5HBJA 1P4OA 1XH7A 4EKLA 3JUHA 4E5BA 3UC3A 3MTFA 4UBAA 4JQ8A 2I1MA 4LFIA 3BWJA 4O6EA 1LP4A 1BI7A 4U43A 1SVEA 3KGAA 4PX6A 4TNDA 2ERKA 3F3UA 5J87A 4CFFA 4A9SA 3LMHA 3FWQA 4YLJA 2A19B 1MP8A 2Q0BA 3QKLA 1K2PA 5ITAA 3FAAA 1AQ1A 5FBOA 5D10A 4WT6A 4QYHA 2XK6A 2G15A 5HG9A 1DAWA 1R39A 2QURA 3JY9A 3MI9A 4L44A 4TKSA 4TYEA 3WZEA 1F0QA 3LXLA 4WIHA 4BZNA 2WD1A 4M12A 4XG2A 2CKPA 4JVGA 5KO1A 3O2MA 3U6JA 2Z02A 3HX4A 3Q2MA 3KRRA 3LM5A 3KL8A 3R9DA 5GZ8A 3DFCB 4H39A 1WMKA 3MIAA 4KBAA 1VYWA 1J1CA 5T6KA 4JG6A 5DHJA 1JVPP 5KMNA 4P5QA 4WBOA 4V05A 3C50A 1KE6A 4Q2AA 4A9UA 1LUFA 4XUFA 5HGIA 1PYXA 4Q5HA 3ZLSA 4EH8A 2I0HA 2WKMA 4YBJA 4XG6A 3ZU7A 4EHGA 4BKYA 2UVZA 4AA0A 1WVXA 2VTHA 3AD4A 4C58A 5CAPA 4Y8DA 5K4JA 4AFJA 1P5EA 4IH8A 2W1FA 3MVMA 4UX9A 5BNJA 4Y5HA 4RPVA 3OFMA 3HAVA 2V0DA 2QOLA 2R3IA 4O0VA 4GT5A 4IB5A 1H1RA 5FRIA 2ZYBA 3A7GA 4NK9A 2EUFB 3W55A 2QG7A 3G9LX 4XH6A 4D55A 4RJ7A 2C4GA 4QMLA 2UZUE 2XNOA 3BCEA 2LGCA 3SOAA 3NSZA 3OTUA 4G34A 4ITHA 5C9CA 3EL8A 2VO6A 1JKKA 2VWZA 3PVGA 2WQOA 3TN8A 5FEEA 4JS8A 4BDBA 3WF7A 3DOGA 5AM6A 3LJ0A 2PE2A 3QCQA 5DIAA 4MNEB 5BMMA 5LMKC 5LVPA 4LUEA 3VVHA 5CENA 3I6WA 4K77A 1IAJA 3PSBA 3W10A 3TZ9A 3UO4A 2ITQA 4R7IA 2GU8A 2RL5A 3JXWA 1Y57A 5E90A 3UIUA 3FQHA 4QP7A 4CKIA 4DH5A 5I9WA 5M4FA 3BIZA 5CS6A 3TJDA 3HEGA 4JG8A 3QQUA 4RA5A 4NJDA 2WMAA 4I0TA 4F0FA 3AGMA 4BGHA 5LWNA 1H00A 4USDA 2WU6A 3OZ6A 4ZTQA 4KIKB 4L46A 4PWNA 3RMFA 5GHVA 1PKGA 5M57A 5K0KA 4I5PA 3TNHA 1WCCA 2ZJWA 3ZUUA 4FR4A 5I9VA 1PXJA 2C6MA 2CKEA 5BPYA 4FVRA 3ORNA 3BE9A 3UVQA 5J9LA 5AA8A 3PZHA 3RAIA 3UJGA 4BR3A 2VTSA 4O0SA 4XYFA 3U87A 4QP9A 2JIIA 2C6EA 2VTAA 4FG9A 4ITJA 5ANIA 1QPJA 5FWKK 5JMSA 2W1IA 3PIXA 3E88A 3PXQA 2WMUA 5L6PA 4HPTE 5AV0A 4F70A 3V5JA 4JLCA 5AUUA 3E7VA 1YXUA 4L45A 4U97A 4XCUA 4AOIA 3AGLA 3QZIA 1ZXEA 4OUCA 2CPKE 3KCKA 1P14A 3PJ2A 4B8LA 4GJ3A 4CT2A 2VN9A 3PP1A 5GJGA 3D5VA 3KK8A 3A8XA 4NM0A 5CVGA 5EM5A 2IZUA 5KBQA 5HVKA 3ZDIA 3KU2A 4EK5A 5EQPA 4OLIA 3QF9A 3TNPC 3P7BA 3W2SA 2OH4A 2C0IA 5CU3A 4DHFA 4UMRA 2P55A 1H8FA 2ZMDA 4IVAA 3LIJA 3QRJA 4LOPA 3UGCA 3IO7A 2XJ1A 4YHTA 4AGCA 4L43A 4ANLA 3LFFA 2OW3A 4DCEA 4FOBA 4R8QA 3DKGA 3IPHA 4RRVA 4C3RA 2X2LA 1UNGA 5G6VA 4FKWA 4QQJA 4MXAA 4BDKA 5AR2A 3NCZA 3L9LA 3VF9A 1OPLA 3ORZA 2JDOA 1Z9XA 2OGVA 4CTCA 2W99B 5HOAA 1YI6A 4O7SA 4FVPA 4IB1A 3B8RA 2NO3A 3DFAA 4IJPA 4C3FA 3MJ1A 4Q5EA 4I6FA 2XZSA 3N51A 4Z16A 1XO2B 5TF9A 5JQ5A 3TTJA 2VNWA 4I92A 4NM3A 5HLWA 2C5VA 2O3PA 1H25A 2WEVA 3LXPA 3NNUA 1V0BA 4N57A 2BRBA 3VAPA 2F7XE 1YXVA 2F57A 4YSMA 3LMGA 3ZS5A 5IQEA 2WQNA 2W1EA 4U3ZA 2BFYA 3MESA 5TO8A 3FMJA 2O63A 1VYZA 4JQEA 3K5UA 5CSWA 4ARKA 3LFNA 3PXFA 2PVFA 4JX7A 3WZKA 3QTWA 4FT0A 4AE9A 4YNOA 2UZVA 3CKWA 4ANNA 3HRCA 4GT4A 2XKFA 4D2TA 4F7SA 4FODA 1UVRA 3HNGA 5HE1A 4MBJA 2V62A 2UZOA 3QTQA 2G9XA 4OTPA 5A9UA 1SVHA 2CGVA 4P4CA 1R0EA 2IVUA 2WTDA 2B7AA 4ASDA 5HBEA 3PLSA 5M55A 3OCTA 2E9NA 2QO9A 4JDHA 1XQZA 4XV1A 2C3JA 4KB8A 4A06A 2WQEA 3AC1A 4OR5A 4TW9A 3L9NA 4EQUA 3Q60A 2QU5A 4A4XA 5DOSA 4DLJA 5KMOA 2X4FA 3QUPA 3QYWA 3CP9A 3C7QA 3UBDA 1YVJA 4DEAA 3PY1A 3TJCA 3Q52A 3Q6WA 4RJ8A 2ETMA 4NWMA 3NPCA 2PUIA 3EQGA 5IEVA 5IQBA 2I7QA 1Q41A 3K3IA 3QTXA 5J9YA 3AD5A 4HVIA 4DEBA 5IDNA 5A4CA 3F3TA 4QMXA 3EQCA 3EZVA 2X9EA 2VX3A 3HMPA 2QVSE 5CVHA 3ORTA 3UVPA 2HY81 1IASA 4A4LA 5LMKA 1OIRA 2WOUA 2W4OA 2RF9A 3COIA 3UZRA 1YXTA 4HZSA 3ZC5A 5CF5A 5A14A 4OTIA 1ZZ2A 4BBMA 2QQ7A 3DNEA 5KX8A 1WBVA 3LFSA 3Q4CA 4YZCA 3U4UA 3F88A 3ODZX 5H8BA 5AIRA 3LAUA 3R28A 1Q8ZA 3H4JA 5DMZA 2WXVA 3AC5A 3RWPA 2B54A 3F82A 5IA1A 5AP5A 2HW7A 3ZZEA 5EM8A 4FIEA 5LMBA 5HCYA 4ZTMA 2VGPA 2YEXA 3F6XA 2J5EA 4GL9A 5G1XA 4JT3A 1U54B 2W4JA 3LCTA 1OBDA 3HVCA 3WI6A 5KMMA 4G3EA 1JQHA 5ANEA 3DU8A 4EYJA 4X2GA 2CKQA 3G2FA 3W1FA 5JGBA 2X8EA 5GNKA 2J50A 2Z60A 2FVDA 2WO6A 1NVRA 4BKZA 4LGDA 5AUWA 4L9IA 1A06A 2YM4A 4C0TA 4E20A 4DEEA 4DFYA 2JC6A 1XR1A 4DEDA 4CTBA 3MH2A 3LZBA 4BWKA 4UV0A 2B1PA 3G51A 4EZ3A 3M2WA 4MD7E 2VWXA 3DBCA 5IA5A 3KXZA 4FV1A 4FZ7A 5ANDA 4ACDA 4BYIA 2XIKA 5AP1A 5HICA 3A2CA 2XUUA 4IZAA 4LUDA 4GUBA 3R1YA 4MQ1A 4AN3A 3FSFA 4ZTSA 3A7IA 3BPRA 3T3VA 3RCDA 3AQVA 4DC2A 2C5NA 3SKCA 4BI1A 3Q04A 5AAEA 5L2QA 3QCXA 4L3JA 5HIBA 3VNTA 1ZAOA 2OF4A 2JKKA 3TIYA 4RJ6A 1M2QA 2UVYA 3NUXA 4FV4A 4H3PA 4C3PA 1JOWB 3R71A 4QYEA 5EI6A 3AG9A 3LFCA 5DR2A 2O2UA 4FSWA 2W05A 4RX5A 5F9EA 4OTWA 2ITTA 5BMSA 4WNOA 4C4FA 1O6KA 3A7HA 2RKUA 4I6QA 3VULA 5CQUA 3WF5A 3ZRLA 4NTSA 3I0QA 4FTRA 3LKMA 4EWHA 4IFGA 4O7ZA 4AUAA 1M17A 3ANQA 4D9TA 1DI8A 5J9ZA 1ZYSA 3ET7A 3WARA 5CEMA 5IQDA 3GUBA 2VWUA 4BWXA 3HECA 4DFLA 4FGRA 5AP0A 4PMPA 4F09A 5BX0A 4M69A 4NCTC 4FNYA 4IQ6A 4NFNA 2HXQA 3VS0A 3AC4A 3TT0A 4AAAA 3P78A 4RWLA 3N4VA 2VTRA 4FKIA 3GGFA 1DAYA 3ODYX 3P7AA 1Q62A 4O6LA 3UO6A 5DVRA 4AGDA 4FZDB 4O81A 4L53A 4EBWA 4OTRA 4EORA 4UB7A 3QA8A 4FKGA 4FKTA 3DXNA 3F3VA 4BCMA 4HYIA 1H1SA 2YZAA 3GFEA 1ZOEA 2GS7A 4MAOA 5EM7A 4EEVA 4HVHA 1RE8A 1JNKA 5CEKA 4KS8A 3E93A 3NUYA 3AMAA 4YPDA 3VUGA 1ZOGA 3O71A 1I44A 1UKHA 5M4UA 3D2IA 3CC6A 2I0EA 5FP6A 4GG7A 3MPTA 3QGYA 4C36A 4YGAA 4I23A 3EN7A 3FI3A 4QNAA 3EKKA 3VW6A 5HIEA 3OVVA 2R0UA 4TWNA 3ROCA 5I9UA 5IG1A 3P08A 3OY3A 5D11A 2QO2A 2QI8A 2VWBA 3P79A 4KSQA 2XK3A 2R3GA 5GZ9A 4ASZA 4CFXA 1QPDA 4AACA 4EUUA 4Z7GA 2ZM3A 2AUHA 2QG5A 2XH5A 3PPZA 3R0TA 4K18A 4HJOA 5EYDA 1X8BA 4YTCA 3HAMA 2C1AA 2FUMA 5CEQA 4GMYA 1OIQA 3LCKA 3SQQA 4YLKA 3UPXA 5EW3A 2BHHA 3DV3A 3Q4TA 1U59A 2BRNA 2ONLA 4JDIA 4G9CA 3UODA 4MNEA 5BVKA 5LVOA 1GIJA 2JAMA 3BV2A 2FSMX 3OW4A 2OICA 4I5HA 4YPSA 5TT7A 4D2VA 4QMVA 2C69A 3Q9XA 4RX8A 1J7IA 3QKMA 3FXZA 3IONA 3AC8A 3CTQA 4PP7A 4BFMA 3HV7A 2CLXA 2VRXA 5DT3A 4M8TA 4AW2A 3NX8A 3R6XA 3RK9A 3GQLA 2G01A 4IX6A 4I20A 5DWRA 1FQ1B 4IBMA 3PTGA 2C68A 3QUEA 4FKUA 5EOLA 4EUTA 1IAHA 3GQIA 3MVLA 5L3AA 3UIBA 3ZCLA 3A62A 2OIDA 3UNJA 5KBRA 2GFCA 2WEIA 4KIKA 2BZKB 3MS9A 4D58A 2F9GA 4IAFA 3MVJA 3ZDUA 5M4CA 3QRKA 3PWYA 5CZHA 1M7NA 3HUCA 3W18A 3K54A 2JD5A 2IN6A 4DTAA 4RVTA 3H10A 3R7GA 4RIWB 4C7TA 3W16A 3SGCA 3ZH8A 3HV3A 4GYIA 4A07A 3PXKA 4FV0A 2WAJA 3OHTA 4BCOA 2R0IA 2BTRA 3DJ5A 4MTAA 5ETAA 4RFYA 3QZGA 4KIQA 3V8WA 1PJKA 2JIUA 2WMQA 4J98A 4Y85A 4HNFA 5AP2A 1OZ1A 3DBFA 2YITA 4WG3A 3BWFA 2C3LA 4HZRA 5AJQA 3NEWA 4ORKA 3FKOA 3E8EA 3C1XA 4OBPA 4YHFA 3WIKA 4OAUC 1H26A 3BYMA 2XNPA 4Y73A 4FUYA 4WNPA 3CSVA 3ULIA 3JVRA 2WMXA 3MPMA 5IH5A 2R3JA 1M2RA 2Y8OA 2HZNA 1SVGA 2JDVA 3LCDA 4R6VA 3F5XA 4CKRA 5EDRA 4R78A 3G6HA 3U54A 5HVYA 3G5DA 5E91A 3HMNA 3RWQA 4D4VA 3BRBA 4KRDA 4NZWB 3R8ZA 2X9FA 1PHKA 4PMTA 4ACMA 5IQFA 5IU2A 5L4QA 3BE2A 4EH4A 2YIXA 2XJ2A 3I4BA 3VBTA 3UTOA 3PVUA 4LV8A 2RFEA 1YWRA 4DH7A 4XLVA 4DTKA 3HGKA 3U6HA 4L3PA 5C4LA 4RA4A 3OXIA 3NAXA 3PIZA 2FSLX 3EN5A 4RX7A 2XEYA 4A4OA 1ZY4A 3MH3A 3KEXA 1KV2A 1YI4A 4PPAA 2DQ7X 3CGOA 1ATPE 4B9DA 3ACKA 1UNHA 3DK3A 4QT1A 2CDZA 2Y9QA 2BAJA 3HP2A 1FVTA 3BQRA 3DGKA 3GC9A 3NYVA 4X3FC 5CSHA 5D1JA 3MIYA 5I9YA 1J7LA 5CEOA 4QMWA 5FTGA 2YIRA 5AUXA 3WBLA 1WAKA 2P0CA 3AD6A 2HOGA 1RJBA 3MFTA 4YSJA 1ZLTA 3UP7A 5E1EA 2HZIA 1MRYA 4NKSA 4OTQA 1Z57A 2UUEA 4X2FA 4BL1A 3ERKA 1PMEA 4BN1A 3HMIA 4C4EA 5FD2A 4F4PA 5JFVA 3S0OA 1WBSA 3EFWA 4XHKB 5DEYA 3RK7A 1OL5A 3CR0A 4MWHA 4XEYA 3R83A 1Y6AA 3DKFA 4FL1A 5E7RA 4TL0A 5IEXA 5E1SA 3DJ6A 3KA0A 1E1XA 2CKOA 2X8IA 2C6LA 3OOMA 5HLNA 3ZFXA 1M7QA 3IDPA 3RM7A 4DG2E 4ANSA 3HA6A 1YWVA 3R8VA 3DQXA 4W9XA 4YC8A 5K4IA 4PPBA 4ZSLA 5ETCA 4AZVA 2GNHA 5IA2A 5HU9A 3NUNA 4O21A 3N4UA 1PY5A 4J1RA 1URCA 1PXMA 3EKNA 4YC6A 1OL2A 4IX4A 2GNLA 4AZTA 5AAGA 4FZAB 2G2IA 4QMYA 4O86A 4ZEGA 3FZSA 4C02A 4OTFA 5LMAA 2Q0NA 2P2HA 3GFWA 5IQHA 4G16A 3QLFA 4F9AA 4MBLA 5JK3A 4GU9A 3KRLA 4DEIA 4G31A 1F3MC 3R9HA 3RNIA 1R78A 4MF1A 1J3HA 1ZYDA 4GU6A 4KNBA 4O0UA 4TXCA 3RPSA 2B9JA 2HXLA 3FI4A 3HRBA 3LHJA 4JL9A 3SW4A 5D41A 4KWPA 5LARA 2VTOA 3P1AA 3VN9A 3NVKI 4XG4A 3UIMA 4HGLA 4XOYA 4E73A 3E3BX 5A4QA 4FNZA 3G90X 4QYGA 5M56A 2QHMA 4PPCA 4O96A 5FXSA 1OGUA 5AR4A 5EW8A 5KMKA 4O7RA 4H05A 3S3IA 2HZ0A 4EZ7A 1PF8A 4EK8A 1QPEA 2VTTA 4K1BA 3P7CA 1CSNA 1KE5A 4I21A 3Q5IA 4G1WA 4ZSJA 4RX9A 4YJOA 3MY0A 3ETAA 3QTRA 4HVSA 3NDMA 4LRKA 2ETKA 3M11A 4YZDA 3GU7A 2UW4A 4I5MA 4W4WA 4ASXA 4CV8A 1HCKA 3ZO1A 3KKVA 4TZRA 4L67A 3NYXA 1S9JA 3V51A 4BCGA 1YHWA 2UVXA 3TUDA 2RG5A 3GC8A 1U54A 4NUSA 4UZHA 2CGUA 3R8LA 3PY3A 2EB2A 3FZ1A 3EJ1A 4R3RA 2PE0A 1UWHA 4FVQA 4AA4A 3II5A 4RG0A 1TQIA 5KHXA 1Q99A 4R3CA 4GYGA 3V3VA 1KV1A 5ACBC 3KXXA 2DS1A 1ZOHA 2JAVA 4BDIA 3P9JA 2VWWA 4FNXA 4AGUA 3BBWA 4JDKA 5EKNA 5L8LA 5DE2A 4UMPA 4GH2A 4ZP5A 5I9XA 3PP0A 5F4NA 4CMUA 3EHAA 4FI1A 4U9AA 4EHVA 3MYGA 5D9HA 3CD8A 3D14A 4LMNA 4FKVA 4ANMA 4NT4A 5IZFA 5IEYA 3SD0A 5KHWA 2J6MA 2W06A 2XIZA 1XBCA 3I6UA 4LQMA 2VNYA 2UW3A 2OXYA 5HZNA 3BHYA 3TUCA 3QQKA 4BHNA 3CXWA 1REJA 3TM0A 5BUEA 3QD4A 3REPA 3KQ7A 1ZMUA 2W9FB 3MFSA 1JKSA 5FBNC 4AXAA 1CTPE 1W98A 4IC7A 3LQ8A 1Q97A 3MFUA 3P23A 3PG1A 4J95A 2Y4IB 4JX3A 3FXWA 1FGKA 2LAVA 4RC3A 4S33A 2BRMA 4D5KA 3MBLA 1WBWA 3QYZA 3EYGA 4FT7A 5CY3A 4I94A 2YM6A 4TWCA 2X2KA 3ZM9A 4JAJA 4FSRA 5I3RA 3OUNB 1H01A 2CN8A 5JT2A 3ZSIA 2G1TA 4J8MA 4JIKA 3UOHA 2X1NA 2BIKB 3V5TA 2JIVA 2DYLA 3PSDA 4AOTA 4ZLYA 2JLDA 5JFWA 3QUDA 5JGDA 3HA8A 1W84A 5AM7A 4AX8A 4GJ2A 5JN2A 3PJ8A 3UYSA 1XBBA 4W4YA 3GB2A 4DBXA 1OKYA 3R02A 4IVDA 4F6UA 4DH8A 2ZOQA 4X3FA 4JIAA 2GSFA 4L8MA 3GU6A 2W9ZB 4BI2A 2A27A 2B9FA 3E87A 3KRWA 4XRJA 1R0PA 4ZSGA 3R7OA 2IVVA 3BV3A 2BROA 4RWJA 4XOZA 3SRVB 2BKKA 4NU1A 1XH6A 2Z8CA 3GCSA 3H3CA 3ORLA 2JDSA 3G9NA 5CASA 5A4EA 3QTUA 3RZBA 2EXCX 3F7ZA 3U8WA 3UO5A 2CNVA 4FE2A 4G17A 4CZUA 3EMGA 4R5YA 3PE1A 2ZV9A 5BVNA 3LOKA 4IE9A 3UVRA 3KCFA 4FTIA 1NY3A 3GI3A 4U5JA 3SXFA 4MXOA 2IO6A 4IHPA 3O7LD 4E6CA 4YU2A 2YCFA 3C13A 1GY3A 3R9RA 2R3FA 4H1MA 4D5HA 5IUHA 4DFBA 5AWMA 4CLJA 3QC9A 5EQYA 3VS3A 2OJIA 3KXMA 2PUNA 2EXEA 5JKGA 3HDNA 3EFLA 4JR7A 3VBYA 1ERKA 2F2UA 4BDGA 5IMXA 3NVMB 4L00A 1RW8A 4BGQA 2OO8X 2PULA 4O0TA 5L8JA 4YTFA 3FZPA 4RWIA 1K3AA 3U4WA 3W8LA 1LPUA 2PY3A 3G6GA 3KF7A 4EI4A 2RSVA 4WRSA 3UMWA 4O7TA 2EXMA 2BRGA 4IAKA 3GC0A 4J7BA 4QP6A 4GG5A 2PPQA 2PVNA 1JSVA 2O0UA 4FV6A 5C8NA 1LEZA 5IQGA 5J1VA 4MH7A 2JKMA 4RWKA 1OITA 3WF8A 4EBVA 3NZ0A 4FEVA 5FG8A 4BCJA 4Q9SA 5L2WA 2WOTA 1BKXA 3R01A 2QU6A 4KKGA 2EB3A 3ZONA 4GVAA 4MWIA 2UW0A 1XKKA 3VUTA 2JDRA 4OGRA 3QTIA 3KULB 5L2TA 3ATTA 4A9RA 4R77A 3OWKA 1R3CA 2C0TA 1WBNA 3KY2A 5KKRC 3VO3A 2GHGA 3NUUA 3R73A 3UOKA 3E64A 4CD0A 4F7LA 4KKEA 2HYYA 4CKJA 5L2IA 3G15A 3FPMA 3H9FA 4DFUA 3CE3A 3V8SA 2YM7A 3DBEA 4DA5A 4YJQA 5A54A 3W2RA 4U40A 1EH4A 2VTMA 3S1HA 3DS6A 4G6NA 4RIWA 2CHLA 2QNJA 3T9IA 4Y95A 1WBOA 3VS7A 5C03A 2BZIB 3ELJA 3LFBA 3OCSA 4LGHA 4NKAA 4IZ7A 2UZLA 4P2KA 4TYIA 4WSYA 3EQHA 3RHXA 4D0WA 3QCYA 4J71A 3LFAA 5H9BA 2YCQA 2YLFA 4L68A 5DR6A 1UU3A 3TIZA 1UA2A 5AR8A 3O0GA 3QFVA 1OUYA 2PVRA 4HYHA 1GZKA 4AW1A 2OJ9A 2E2BA 3QA0A 4EOLA 3MV5A 5HO8A 2HW6A 1GAGA 1WBTA 5HD4A 5L2SA 4FK6A 4HVDA 4HYUA 5AUZA 4KKHA 3MB6A 3WZJA 4I6BA 4DT8A 1W0XC 2OSCA 1ZY5A 3S00A 5FQDC 4QP3A 1LEWA 4QTEA 3O8TA 4ZK5A 3RZFA 2WTKB 3H0YA 5CI6A 3FL5A 4E1ZA 3IS5A 3LPBA 3K3JA 5EW9A 4C33A 4U41A 4C57A 4CQEA 4FTUA 4IWDA 4UWBA 5KMJA 1SNUA 2G2FA 4RQKA 3ZM4A 5CNNA 3PRFA 2C1BA 4FYOA 2VWVA 4BDAA 3KREA 3ENMA 1PXNA 3KN6A 1BYGA 5DGZA 2EVAA 4JOAA 3EYHA 4FTTA 5GJFA 4BWPA 3RPYA 2QKWB 3FMMA 2YHVA 4GIIA 3T3UA 3TNWA 1P2AA 1JWHA 1NVSA 3TTIA 2W17A 4XS2A 3FQSA 4MHAA 4UZDA 4ZZNA 2OJJA 2BZHB 4HCUA 2XNNA 4EHZA 3AMYA 3NYNA 3MJ2A 4MK0A 1B38A 3HUBA 4K9YA 3OS3A 3RBWA 5B2KA 4L7FA 3VUIA 1KE7A 3EH9A 4WNKA 3ZXTA 4ENXA 1W82A 4GEOA 3VS5A 4NL0A 3FY2A 3TNQB 3ALNA 1MQBA 3A4OX 2J7TA 3QRUA 3IW7A 4FC0A 3A7JA 4O0WA 4XBUA 3V6SA 3BQCA 4AW0A 4BI0A 4C4HA 2XB7A 5E92A 2I0YA 2A2AA 4NW5A 3FXXA 2JFLA 4DEHA 2VGOA 3R21A 3GT8A 2YIYA 2IVSA 3O96A 2ZB1A 4HVGA 3DNDA 3PA5A 2GNIA 1QL6A 4Y72A 4EJ7A 3VS4A 3KN5A 3VQUA 2V55A 2VD5A 3DB6A 3KK9A 5CWZA 4A7CA 4F0GA 3GENA 4GKIA 4U8ZA 3QLGA 4C61A 3S4QA 2GNGA 3VRZA 4YZNA 4U42A 3R8PA 4OTGA 2GS2A 1R1WA 2BIYA 2XM8A 4RSSA 5M09A 2WMBA 3QXPA 4UY9A 4RC4A 3OXTA 2VU3A 3TI1A 2BUJA 2XK4A 1FMOE 4GSBA 1SYKA 4PMSA 2A4LA 4C59A 5HORA 4O91A 4BDCA 3SA0A 4D1XA 4F1OA 2DWBA 1SZMA 2VUWA 2WNTA 4CCBA 4FV8A 5C8MA 4W4VA 2CJMA 2OU7A 4X7QA 3QQGA 5C4KA 4J8NA 1DI9A 2PVYA 4BC6A 5GIOE 1AGWA 4IWPA 4IZ5A 1XH4A 2ONLC 4IWQA 4RT7A 2XCHA 1OKZA 3GXLA 1NT2A 2YJRA 4IAAA 4FKJA 4IC8A 4RBLA 5AADA 3GU8A 3FV8A 5JFXA 3DDPA 3RINA 5CTPA 4WSQA 2XBJA 4NH1A 4DG0E 1PMUA 4ANBA 2J0IA 4O2ZA 1WZYA 5H8EA 5FUTA 3BU3A 3V5PA 2YLEA 3L9PA 4NIFB 2YDIA 5AX9A 5HE0A 2YM5A 2WMWA 5HCXA 2XNMA 2PWLA 3PE2A 3POZA 4C4GA 4MVFA 2OJFE 4CG8A 5FP5A 4O38A 3IW4A 3R04A 4S2ZA 3F3ZA 3VUKA 4WA9A 3IOKA 4E5AX 3FI8A 4AF3A 4DE4A 3GBZA 5FM2A 3MA6A 2IZRA 3RHKA 1A48A 3HL7A 3MPAA 4R3PA 3OC1A 4D2SA 4RJ3A 1OPKA 4EK6A 2R3HA 2P4IA 4M97A 3U55A 4FSNA 5IISA 3QBNA 5AV2A 5EOBA 5IA3A 2IPXA 2XM9A 3UQFA 4C62A 3ZRMA 1K9AA 4YJUA 3OD6X 2YN8A 4CQGA 4EOIA 2X7FA 3AC2A 2WFYA 4K33A 3D0EA 5IKWA 2WTVA 2VTLA 4ZTHA 2QOQA 1L3RE 4A9YA 2FB8A 4E4NA 1J91A 1IEPA 3DJ7A 5M51A 4CLIA 3FLSA 3FLWA 3OBJA 4F7JA 4WOVA 5IUGA 2X7GA 4O83A 4HYSA 3C0GA 5AP4A 3PXZA 4TTHB 4CYJA 4ZSAA 4DT9A 3I0OA 4AZFA 3BGPA 4IM0A 5HNBA 4AU8A 5AR3A 3MFRA 4WBBB 3DK7A 4K11A 5JQ8A 4RC2A 4E6AA 5CALA 1VZOA 4ALVA 2WPAA 4DH1A 4DH3A 4WD5A 2C6DA 3LJ2A 4YHJA 5TR6A 2JKQA 1O9UA 2XKEA 2YACA 4USEA 5CT0A 4G6OA 3F69A 5TOZA 5ANGA 3NRMA 2RFDA 5E8XA 3VBQA 2JBPA 1YXXA 3LFEA 3W32A 3CIKA 3JPVA 4RMZA 4BDHA 2ZAZA 2ACXA 2SRCA 5TKDA 4C2WA 5CANA 3CY2A 4CFUA 3R8MA 2UW8A 1TQMA 3FYJX 4IWOA 4DCAA 3D9VA 5H3QA 1UU7A 4FTOA 4LGGA 3Q5ZA 5J5SA 1YQJA 3UZPA 4FZFB 1URWA 3QAME 4RZWA 5HO7A 3ZLYA 2CCHA 4FSTA 4M66A 3DB8A 4PTEA 5EI8A 3EL7A 2VO3A 3D94A 1FBNA 5HG7A 1QMZA 4BDFA 4ERKA 4QMTA 5DNRA 3VUHA 1MRUA 5E8ZA 2WMVA 1FVVA 1U46A 2O8YA 4FKLA 2W0JA 4ZJJA 3SRVA 4B7TA 1TVOA 4EHEA 3HV5A 3QD0A 3GCVA 4FEWA 1Y8YA 4FL3A 4EK4A 3VUDA 2R64A 4I3ZA 2ZDTA 4DTBA 2BR1A 3ZLXA 4PV0A 4TN6A 4KIOA 2JEDA 4BDDA 4O7YA 5JGAA 3M42A 2WMRA 3NUPA 4J96A 5FDXA 2YAKA 4EOPA 4PQNA 3QALE 4KS7A 3OTVA 1CKIA 5IPJA 3SAYA 4V04A 5HVJA 4FIJA 3FDNA 3UMXA 1V1KA 2GNFA 3WZDA 4AT4A 3DK6A 2O65A 5BVOA 4IADA 4JRVA 4QMZA 1GIHA 4JBVA 4UALA 3I1AA 4RVMA 1FMKA 3ZO3A 5CU6A 5CEIA 4ZY6A 4AOJA 3NUSA 3PJ3A 3LM0A 4QMUA 2QKRA 1YHSA 3CPCA 5HTIA 5CSVA 3QXOA 5DT4A 4EOQA 4DF3A 2X2MA 4E93A 4E3CA 5A3XA 4DN5A 3GCPA 4FTAA 3VBXA 4EYMA 3KMUA 2C5YA 2GCDA 4FSUA 4BIDA 3HKOA 4XV2A 1MRVA 2W1DA 2WQBA 3B2TA 4I1ZA 4G2FA 1U4DA 2WGJA 4D4RA 5HI2A 4GFGA 3DAJA 5ETIA 4RFMA 1ZZLA 5JRSA 4AW5A 4QP4A 1PRYA 1OKVA 2VTNA 5M06A 4CRSA 3DAKA 4YO6A 3MW1A 2W5BA 4DGGA 5I5ZA 2JITA 2QOKA 4GS6A 2YDKA 5D12A 2CN5A 2X0GA 3W33A 4LOOA 4IANA 5HNIX 4FEXA 1OL6A 5EYCA 3LJ1A 1Q61A 3ANRA 3PYYA 5EYKA 3ZMMA 3DKCA 5B2MA 3FI2A 2BPMA 4O22A 4AE6A 5M08A 4Z9LA 4IAYA 3VF8A 3GC7A 2ITPA 3OCGA 4YC3A 2XRWA 5AP6A 3UOJA 4BDEA 4E6QA 4E8AA 3BI6A 3WILA 4RFZA 5AV3A 3CJFA 3QX4A 2ZMCA 2UV2A 3BBTB 4IACA 4MD8E 5BUIA 1OL7A 4WHZA 4FSMA 4USFA 4IX3A 2VTQA 4HGTA 3NAYA 4LYNA 4LV5A 4AT5A 3I7BA 3G0FA 4FBXA 5BUJA 3G0EA 2KTYA 4M67A 3RPOA 4M3QA 2OIQA 3ZHPC 2VO0A 3MB7A 5DRDA 5CAQA 4C2VA 1ZWSA 3IGGA 2W5AA 4XG7A 3D15A 4K2RA 1G5SA 1DM2A 3F5GA 3OT8A 3EFJA 4FKSA 3H0ZA 2FSTX 2OG8A 2C0OA 5A4LA 4PNIA 2BALA 3QZHA 2EWAA 2V7AA 3KXNA 1VJYA 4QRCA 3ORIA 3QGWA 2XRUA 2UW5A 4CNHA 4MQ2A 2H34A 4OTDA 3IOPA 4ACGA 3QX2A 1B39A 4QPMA 4XP2A 5GZAA 1XBAA 1PXLA 4GK4A 3BEGA 4GCJA 3BYVA 2BKZA 4B4LA 4CRLA 4BB4A 1Y91A 3R2YA 3W2OA 3C4FA 4J97A 4F9BA 4CGAA 3VWAA 5EHYA 2H96A 2CNUA 3WE8A 3U6IA 1H1QA 3RK5A 3BZ3A 3FLYA 4FT3A 2OF2A 3FUPA 3A7FA 4TYHB 4TNBA 2QR8A 4FV2A 4JAIA 4O2PA 5DI1A 5E8UA 3DQWA 4ZS4A 2EU9A 2XEZA 4EC9A 1NW1A 5HD7A 4F6WA 1STCE 3WZUA 3GEQA 3W8QA 3QTSA 5AUYA 3LFDA 5M4IA 4KABA 3R9NA 3QZFA 1OIYA 2Y6MA 5EM6A 2ETRA 4EOSA 4KBCA 4BZOA 2A1AB 3EQDA 4UWCA 3KXGA 2VV9A 4RZVA 3EOCA 4ZTNA 2F49A 3JR1A 2JGZA 4IFCA 2YWVA 4U3YA 3FL4A 3AC3A 3EN9A 3KMWA 4ASEA 3DPKA 4D4SA 2C6TA 2VTPA 5DPVA 1M52A 2C3IB 3NNWA 4O27B 3TZMA 1FOTA 4NFMA 2QOIA 3FLZA 3FEGA 1UWJA 5D7AA 2C6IA 3FMLA 5E8TA 5E8YA 3DT1A 2PE1A 4RIOA 3FMEA 1P4FA 1G3NA 3TNIA 3R30A 2YCRA 3RGFA 1BX6A 1Q24A 2OWBA 3SXRA 2NP8A 4LM5A 2PZPA 3W2PA 1IRKA 3CBLA 3E7OA 5EDPA 1VR2A 2WTCA 4FMQA 4YMJA 2AC3A 1IG1A 2VWYA 2DUVA 3DA6A 4FTNA 2YAAA 3FY0A 5CAVA 2R3RA 3GOPA 4GT3A 4D0XA 1HCLA 2YIWA 4KSPA 1ZARA 4FSQA 2G2HA 4RIXB 3UZTA 4F08A 3JY0A 4GK2A 1KSWA 2FYSA 3A8WA 1RQQA 2ITWA 4ZSEA 4NM5A 4F1MA 3DY7A 2VWIA 2W7XA 4L01A 3VHEA 2YM3A 1W7HA 4APCA 4YR8A 5AV4A 3S2PA 4HCTA 4XMOA 4D1ZA 5GINE 3TV6A 4MBIA 4FTQA 5EHLA 4CFMA 2X81A 4WNMA 4ANQA 2CGXA 1Q3DA 2WMSA 2UZNA 3FYKX 4M14A 2F7ZE 3BYSA 3OMVA 4DEGA 3CGFA 4F1TA 5KZIA 5BVDA 4WKQA 2OFVA 3VQHA 3TZ8A 4PY1A 3P86A 4FIGA 4NIFA 2R7IA 3PPKA 1T45A 2NRYA 3Q9YA 1Z5MA 3RJCA 4IM3A 4MXYA 4BKJA 4E4LA 3COMA 3LXKA 4KRCA 4ZIMA 4DG3E 1L8TA 1YW2A 4R7BA 5D7VA 3C4EA 3TV7A 4N4SA 3H9RA 2YCSA 2HZ4A 4DYMA 3EQFA 4O7VA 2OK1A 5CZIA 5A46A 4LL5A 4PDPA 3I5ZA 5JRQA 3FC2A 3DTCA 4FKPA 3Q96A 1U5QA 4CT1A 2C47A 4DLIA 4N0SA 4DFZE 4M15A 3QCSA 2B4SB 4V0GB 5DN3A 2HELA 5CNOA 3LW0A 4CZTA 5CLPA 1NXKA 3D7TB 4EH7A 3PPJA 4G3GA 3PXYA 4QMMA 2WTWA 2IVTA 4G3FA 2ITOA 4LL0A 4YJPA 5HCZA 4EONA 3FSKA 3QWJA 4H3BA 4KINA 4NW6A 5HIDA 1JKTA 4IAZA 3DBDA 2XKCA 4FTLA 1XWSA 2W1HA 3KMMA 4I41A 2PYWA 4MXXA 3RP9A 3BKBA 4J52A 4PL3A 2YWPA 5K5XA
chains in the Genus database with same CATH superfamily
5DLSA 4KIPA 4F63A 4ZZOA 5DYJA 4DDGA 2WQMA 4IEBA 2OXXA 1OMWA 4GRBA 1G8AA 1GZOA 5FXRA 4CCUA 4Z7HA 4O82A 2UZWE 2F7EE 1W2CA 2Z7QA 4N6ZA 3SX9A 3ZBFA 4F9WA 5I0BA 4J53A 3W2QA 2VZ6A 4FV9A 5C27A 5EQEA 5J8IA 3VJNA 3AXWA 2CGWA 2Z2WA 3UC4A 4M13A 1BI8A 3ZUVA 4S34A 1CM8A 1CDKA 3T8OA 3EQBA 2PTKA 3E8CA 3I7CA 4BCPA 3UPZA 4FGBA 2WTIA 3AKJA 3ZLWA 4B8MA 2UW7A 5AX3A 3BHVA 4HGEA 4QMSA 3KC3A 3GP0A 1ZYJA 3M1SA 4JBPA 5AFVA 1UV5A 2UZDA 4U44A 2PZRA 3OROA 4L6QA 2VX1A 3EQPA 5M53A 1Q8UA 1A9UA 3TEIA 5C1QB 2ITUA 2XNBA 5EKOA 2R9SA 4ZZMA 4FTKA 5CU2A 3E62A 3E8NA 4F6SA 4CEGA 2BHEA 2XP2A 1PW2A 5AUVA 3OWJA 4RLLA 2I40A 5LWMA 2XCKA 1WBPA 2ZVAA 2X6EA 4JJRA 3F5PA 4UN0C 4X3JA 3FZTA 2W1ZA 3BYOA 5DA3A 2V22A 3BHHA 2W4KA 4PDOA 3HMMA 4TPTA 3SHEA 5CI7A 3Q3BA 5LVLA 5HQ0A 4HW7A 3TUBA 3SC1A 1UU8A 2R4BA 3NLBA 5HE2A 3C0IA 5DG5A 4CG9A 2FA2A 2ITZA 5HHWA 3WF6A 5DRBA 3ZO2A 2W5HA 4M69B 2PL0A 2QOFA 4BCQA 3U9NA 3C4XA 1YDSE 4G3CA 3E63A 4ZY5A 3NMUF 4IJ9A 3UE4A 4BTJA 2IG7A 4HCVA 3PJ1A 2AYPA 4X0MA 1OBGA 3HV4A 5CT7A 1XH5A 4PRJA 3I60A 4NEUA 2XKDA 4MD9E 4O84A 3WE4A 4QPSA 3QQHA 4QQ5A 1Q3WA 3BYUA 4FF8A 1YOLA 4G5JA 2C6KA 2R3NA 1DS5A 2WU7A 3VIDA 4AS0A 3QRIA 3P4KA 4BCHA 4EH2A 2YABA 5I4NA 2C5XA 3ZZWA 4MNFA 4WO5A 4XG3A 3R7IA 3RALA 5CF8A 1W8CA 5K0XA 4ENYA 2XNGA 3R7EA 3V8TA 2WIPA 2Z7SA 3EN4A 2OIBA 5ETFA 4PDYA 5E8WA 2ZV8A 3VUMA 3N4TA 4TT7A 4Y83A 3WOWA 1WVYA 2OBJA 1KOBA 3N9XA 3A60A 3QWKA 3ZOSA 3FJQE 4UMQA 3TMOA 3LE6A 5C8KA 1T46A 4XX9A 2ZM4A 4X6RA 1J1BA 1PKDA 2B52A 4QTBA 3LQ3A 5M44A 4UYNA 4IW0A 3D5UA 2GHLA 2REIA 1TQPA 2YERA 2Y6OA 3QQLA 4FICA 5GJDA 5BVWA 3R22A 4O7LA 3CPBA 2UZEA 4IB3A 5JH6A 3CQEA 1IA9A 2UW9A 1SNXA 2YFXA 4DGOA 4DFXE 3JS2A 3GNIB 2QD9A 4QQTA 3O23A 3R00A 3COKA 4F99A 4XRLA 3SOCA 3IW6A 2E9VA 2BAQA 1OVEA 4HGSA 5A6OA 4H1JA 4MF0A 2X39A 1VEBA 3SLSA 2PU8A 4UMUA 4WUAA 1JBPE 3KRJA 3RVGA 4EQMA 1SMHA 3F7WA 1Q8TA 3CS9A 3TKUA 4NYEA 3BL9A 2BILB 3O8PA 2ITYA 4CMTA 1FINA 4E5WA 5LXMA 3KXHA 4LMUA 3VW8A 3FQEA 5JZNA 5LQFA 3LCSA 4FT9A 2XS0A 5IH4A 3V01A 3RAWA 2GQRA 4YO4A 3UDSA 4ZMEA 5J95A 3Q4ZA 2YM8A 2GNJA 1G8SA 3L1SA 3RAKA 3L8SA 1JSUA 2F4JA 2GTNA 2J0MB 3GVUA 1OIUA 5AV1A 5AMNA 3LVPA 4DFNA 1GNGA 2IW6A 3FMHA 4QOXA 5DH3A 3R7VA 5B7VA 4BDJA 2JBOA 4IX5A 4JXFA 4G3DA 3COHA 3SG8A 4FTMA 3RPVA 3IECA 2QCSA 3ALOA 1TFFA 2QC6A 4IAIA 1WVWA 2RFNA 4FNWA 3ZFMA 5IH6A 5L8KA 1Q5KA 2BAKA 2QOOA 2PZIA 3HP5A 3Q4UA 4EC8A 2Y4IC 3IG7A 3GU5A 4YJSA 3PSCA 4FK3A 3EQIA 2XYNA 4I22A 1S9IA 3ATSA 3QKKA 2B9IA 4EH3A 2ITNA 3DCVA 4P5ZA 1MUOA 4RJ5A 2VX0A 5HTCA 4BGGA 3I79A 4I6HA 3C5IA 4OT5A 1ND4A 3C9WA 4MXZA 4NSTA 4HPUE 4O0RA 4RVLA 2B0QA 3VHKA 3TV4A 3FKNA 3NS9A 4JNWA 1OI9A 3A61A 5JFSA 4TYHA 5L6WL 3C4WA 4GFMA 4MKCA 3E92A 3E5AA 4W8DA 1BLXA 2PMNX 1UU9A 3MTLA 4WUNA 4EH9A 5C26A 4GK3A 3ID6C 4FIIA 2R3QA 1JPAA 1Q8WA 2Z7LA 1ZRZA 5F20A 5BYYA 1I09A 4TRLA 5HU3A 4O0XA 4P90A 4PMMA 4W8EA 2R3LA 4XNEA 4U79A 1V0PA 2Y7JA 3DZQA 4QO9A 2XVDA 3MDYA 4AWIA 3V04A 5KNJA 3ZFYA 5LJJA 4YLLA 3IKAA 4JMQA 5HNGA 2BCJA 2ZB0A 1YXSA 2PUUA 3FMDA 3GCQA 4YUQA 2ZV7A 3MWUA 2BTSA 3PIYA 2J0KA 4EK3A 4JI9A 5JEBA 4BTKA 4C35A 4F7NA 5AAFA 3PRIA 5C01A 3C5UA 1M2PA 2GDOA 3U51A 1GIIA 4JBOA 4KAOA 3ZSGA 2PVHA 3A99A 2YA9A 3PLAE 4K8AA 4BJJA 3ZSHA 3DZOA 2PVJA 4XP3A 2QLUA 4ANOA 5B2LA 5IQAA 5EH0A 2BRHA 4D2RA 3PFQA 2OXDA 3LQ5A 4ITIA 3ZEWA 4U6RA 2UZBA 4GUEA 3GU4A 2A0CX 1H0WA 2P33A 3TCPA 2J90A 3AT3A 3VS1A 3DXQA 2QLQA 1PXIA 3RM6A 4M0YA 3UG2A 4UXQA 4RIXA 4EOKA 4ZAUA 4EL9A 3RI1A 3TKHA 4O1PA 3W0OA 4GFOA 1REKA 2ZV2A 3RNYA 4RIYB 3TZ7A 2JDTA 4FIFA 3DAEA 4TYJA 3T9TA 3FMKA 3RAHA 4I6LA 4PL4A 4S31A 5CXHA 3BX5A 5IMEA 5LVNA 4ACHA 4AT3A 4UWYA 5HX8A 4QMOA 4II5A 5E9EA 2YJSA 3NIEA 3JYAA 4MEDA 2P2IA 4XJ0A 3VS6A 5GIPE 5CYIA 4CVAA 4EOOA 5DFPA 3FMNA 3BELA 4D4YA 5HX6A 4UYAA 5AP7A 2XIYA 2BVAA 4DBNA 5TE0A 4PTGA 2ITVA 4L52A 4BIEA 1RDQE 3RPRA 1BL7A 5EHOA 4QTCA 2F2CB 3PVWA 4EOMA 2XK7A 2ESMA 2XJ0A 4R1VA 3SV0A 2XBAA 2OZAB 3O50A 3UDBA 1PMVA 3VBVA 4L42A 4ZLOA 2W1GA 3UYTA 2E9PA 3UNZA 3OXZA 4DINA 2HK5A 5IQCA 3I5NA 4F65A 3FBVA 2PHKA 4G6LA 4JQ7A 4AZEA 1HOWA 3VBWA 4M0ZA 3L8XA 2QOBA 3EQRA 2BDFA 4IIRA 4C8BA 5CF6A 3QRTA 2WB8A 2NNWB 4X21A 4E7WA 3HLLA 4I93A 4V0GA 1OPJA 3C4CA 3OT3A 4FKQA 5DT0A 5HG8A 2PZ5A 2WHBA 4D9UA 3E3PA 3UQCA 3D7TA 4YZBA 1H07A 4XG9A 4MYGA 2H6DA 5IF1A 2ZDUA 4C4JA 3QC4A 1JAMA 3ROYA 4E4XA 3BLRA 4I24A 4F64A 1ST4A 1SM2A 4FG7A 4NM7A 2HIWA 3KF4A 4YNEA 4DDIA 4GKHA 3CEKA 3S95A 4DGMA 4OAVB 5ANKA 2I6LA 2OH0E 3AOXA 3FPQA 3O8UA 2WTKC 3Q9ZA 2CNQA 4YTHA 5K5NA 3G33A 2IZTA 4U80A 5H8GA 5HTBA 4AZSA 3QD3A 2XK9A 3ORKA 3OW3A 4EH6A 4WRGA 4W4XA 4Y5QA 2X6DA 4H36A 2X8DA 4P7EA 2IW8A 3TWJA 1PYEA 2O5KA 5CF4A 5BYLA 1PXPA 4ZS0A 4F9YA 4XP0A 5FEQA 1JSTA 3LXNA 5CXZA 4C4IA 1MQ4A 4O4EA 5J7HA 2Y0AA 4QMQA 3NGAA 5FGKA 5B0XA 1YDTE 4ZMFA 3SDJA 4PUZA 3UIXA 3V5LA 2OLCA 2QR7A 5EDQA 1B6CB 3HMOA 3TL8A 2XMYA 3KVXA 4XV9A 4PDSA 5KMIA 2GHMA 2R3OA 2WZJA 1H24A 1V0OA 2PK9A 3BGZA 3BLHA 4S30A 4AFEA 4CV9A 4WG4A 4Q9ZA 5DR9A 5FXQA 3ZRKA 3VC4A 1OB3A 4HNIA 3OEFX 2OZOA 4JG7A 3HZTA 4L7SA 3PZEA 3ZO4A 2OI4X 4CZYB 4FEQA 4D2PA 4PL5A 4X2KA 5J1WA 3PY0A 4Y46A 4YBKA 3IDBA 4R7HA 2R2PA 1OKWA 3NNVA 4MX9A 4YZ9A 3IDCA 3TDWA 2WMTA 4E26A 5ICPA 4QYYA 3Q53A 3OWPA 4BTFA 2Z7RA 5IA0A 5LVMA 1GZNA 4F0IA 4IVBA 4PNKA 4Z55A 5F94A 2YZLA 4KUJA 3VONA 2H9VA 3MA3A 4N6YA 4BBEA 4CMOA 5AEPA 3CD3A 4ERWA 5E4HA 2RIOA 2YISA 4LRMA 5EK7A 2NRUA 3JVSA 3D5XA 3L8PA 4QQCA 3UNKA 4FKOA 1KUTA 3FHRA 2XF0A 4KBKA 1YOMA 3TDVA 1BUHA 1UKIA 3Q32A 5HG5A 2PMIA 2XYUA 3D5WA 4XBRA 3WYXA 5IQIA 5CSXA 4JDJA 2IZSA 3PJCA 2FSOX 2C30A 4OT6A 4X3FB 4ZTLA 4CYIA 4ZY4A 3B8QA 4ZJIA 2I0VA 2VO7A 1M14A 2JFMA 4ZXTA 5CAOA 3D7ZA 5A4TA 2V5QA 4GIHA 1Y8GA 3GOKA 3CTJA 5J7BA 5K3YA 3DXPA 2J5FA 4D1SA 1YDRE 4J99A 3O51A 1F5QA 5T3QA 4BIBA 2HY0A 3A4PA 4FSYA 3SG9A 3CJGA 3VJOA 4C37A 4D28A 1H28A 3NW5A 4EH5A 2P3GX 1TKIA 4U7ZA 4M68A 3ITZA 4X2JA 4KD1A 1BL6A 2AC5A 4EQCA 3L9MA 2RFSA 3OP5A 4MXCA 5LCJA 3VRYA 3KIOC 1CMKE 4XG8A 1JKLA 2HWOA 3FE3A 4FV7A 2XK8A 4AZWA 3DKOA 4O1OA 1GZ8A 2QO7A 3CLYA 3R9OA 4B6LA 4FT5A 4QMNA 1AD5A 4I4FA 5KE0A 4FTCA 1YOJA 2XIRA 3FZOA 4LOQA 4D2WA 3LLAA 1CKPA 4E4MA 4RGJA 4TYGA 4CXAA 5M07A 4FKRA 3UQGA 1H27A 1ZYLA 3EB0A 4EJNA 3KULA 5I3OA 3BU5A 3NIZA 2OKRA 4E6DA 4FRFA 4BCNA 4GV1A 4QP1A 3L8VA 3NCGA 1KE9A 1XHAA 3O17A 5CQWA 5BVEA 1GOLA 3FZRA 2UW6A 4PTCA 3ORPA 4BYJA 2FGIA 4BCFA 2V7OA 4AN2A 4ZJVA 3Q9WA 1LR4A 4FV5A 4I4EA 1O6YA 4I0RA 4PP9A 2RG6A 3IGOA 5E8SA 5FM3A 3SXSA 5AA9A 3UG1A 3PA3A 4FSZA 4S32A 4LDTA 3AT4A 4ACCA 3LCOA 3PVBA 4BVUA 4PF4A 3ORMA 5CU4A 4LRJA 4ONAA 3R8UA 4FEUA 3IQ7A 4O7NA 1KOAA 4XV3A 2QOHA 3DDQA 4YJVA 3MH0A 5ACKA 3ULZA 3NYOA 3R2BA 2PMOX 4CFWA 4QTAA 2GQGA 3NNXA 3HYHA 4ZTRA 4H58A 1ZMWA 4O0YA 4OBOA 4BBFA 3OCBA 4DGLC 5AP3A 3AT2A 4C38A 2R3PA 2W96B 4IZYA 4B99A 4N70A 3F9NA 4BHZA 2KULA 3QU0A 4QPAA 3SVVA 1XH8A 5CEPA 2CMWA 3CY3A 2FH9A 1IR3A 3Q6UA 2GQSA 3BU6A 4OTHA 2ITXA 4BF2A 1H0VA 3P0MA 4YURA 4U0IA 4IVCA 3QD2B 5ANOA 2WIHA 4X2NA 5JZJA 4TWOA 4RLKA 4G9RA 5HE3A 4AN9A 4OBQA 3OBGA 4BRXA 2XIXA 3H30A 3PWDA 4U81A 2J0JA 4NJ3A 4R5SA 5BYZA 3C51A 3GCUA 3ORXA 4JBQA 4Z3VA 3CCNA 3NUAA 4BCKA 3FKLA 5KUPA 2HWPA 5IUIA 2RGPA 2PZYA 4AQCA 3CKXA 5KMLA 1UNLA 3OEZA 2PVKA 4FL2A 2X7OA 3F2RA 4TWPA 4AG8A 5FTOA 5HBHA 4I5CA 1ZYCA 4ALWA 2IWIA 2C6OA 3CQWA 4B0GA 2CCIA 3EFKA 4GW8A 3EIDA 3KFAA 3OUKA 2R3MA 1APME 5F1ZA 1PXOA 3POOA 4UEUA 4FZ6A 5AR7A 5EYMA 3ZYAA 1FVRA 4O7WA 4X6QC 1YHVA 3EN6A 2BDJA 4FX3A 5DEWA 5CX9A 4FG8A 3R7UA 4M7IA 2CSNA 3DBQA 3FC1X 3OOGA 4IDTA 3TACA 3F3WA 2HENA 4LI5A 2J9MA 4ZLZA 1GJOA 3IK3A 4ID7A 4DAWA 3HDMA 4AXCA 5KZ0A 3RKBA 1JLUE 3UOLA 3LFQA 4JR3A 1OUKA 3W2CA 5KCVA 2BFXA 5T68A 3F2AA 2B53A 5J79A 5BQ0A 4APPA 1E1VA 3DLSA 4W9WA 3ZBXA 2R7BA 3ZEPA 3KB7A 3OWLA 2FO0A 3NW7A 2VTJA 4OW8A 5AIKA 3U9CA 3F2NA 2B55A 3RCJA 4BICA 3IW8A 4NTTA 4YP8A 4BZDA 5LOHA 4AA5A 5IA4A 2AEGA 3EWHA 4NCTA 4QD6A 4H3QA 2QODA 5HESA 5FTQA 5K9IA 1YRPA 1KE8A 3SW7A 5FLFA 3QQJA 4QTDA 1H4LA 2OFUA 2YDJA 3E8DA 2UZTA 3BLQA 4IMYA 3R7YA 4EOJA 4HOKA 5E8VA 3F66A 4MCVA 5IDPA 4AP7A 2J4ZA 3QTZA 4UXLA 2ZM1A 3WYYA 4FIHA 5J5TA 2J51A 3AMBA 2BZJA 3FHIA 3ZXZA 5CU0A 2HAKA 3F61A 4QMPA 4RIYA 1NA7A 2H8HA 4RVKA 2JKOA 3QHRA 4IDVA 4F78A 3D4QA 4BY9E 4R1YA 4F9CA 1G8JA 1Q8YA 2XANA 2QHNA 3I81A 3CTHA 4RJ4A 5HKMA 4EKKA 5EFQA 4BTMA 3FLNC 4UMTA 3BHUA 3PXRA 4QP8A 1H08A 1YI3A 1KWPA 3VS2A 1FPUA 4I0SA 3NR9A 4EZ5A 5AR5A 3PDTA 3MH1A 4LG4A 4DGNA 3R1NA 3K2LA 5HO6A 2GS6A 2C3KA 3EZRA 3DTWA 2ERZE 2GPHA 3HRFA 3MY5A 5HLPA 4CSVA 5FDPA 4DHZA 5CAUA 2QOCA 1OM1A 3IW5A 3H9OA 1O6LA 4QNYA 5CSPA 2X4ZA 1PMNA 3QQFA 5CVFA 4A9TA 2VTIA 3ZTXA 3LMIA 3NWWA 2J0LA 4K6ZA 3V5WA 3D83A 2OZAA 1IA8A 5L6OA 2Y4PA 3FLQA 4IB0A 1NVQA 3MN3A 1FGIA 1W83A 3BHTA 1QCFA 4XLIA 4IXPA 4C34A 2J2IB 5JSMA 2IJMA 1Y6BA 3OG7A 2OJGA 1QPCA 2Q83A 3OY1A 4ALUA 4QP2A 3K5VA 1CKJA 2XNEA 1U5RA 2NPQA 3MSSA 3QL8A 2BMCA 4BCIA 4YJTA 1WFCA 3PG3A 3MY1A 5F95A 3ACJA 4EWQA 3P5KA 4FUXA 2VAGA 2PMLX 1BMKA 5HEZA 3R63A 4AGWA 3V5QA 5LCKA 4QYFA 2IW9A 5KKRB 4FV3A 3WIGA 1XJDA 4FTJA 4U45A 2QONA 1H1WA 2B9HA 2R5TA 2GTMA 3CQUA 4FOCA 4YJRA 3MGYA 4TY1A 1ZMVA 5A6NA 3MVHA 2PVLA 2R3KA 3OF0A 4RQVA 2YIQA 3RTPA 3V6RA 3BEAA 3ZC6A 4K0YA 2O64A 3B2WA 2E9OA 4CFVA 4DITA 4WG5A 3WF9A 4JRNA 4G5PA 1OECA 1OL1A 3PUPA 3DLZA 1XH9A 2GMXA 3C0HA 3C4ZA 4YJNA 3THBA 3BL7A 4IM2A 4V01A 5AUTA 4M84A 2WTJA 3KRXA 5H2UA 2PSQA 4KA3A 3BGQA 4GVJA 3LLTA 3D2KA 3O7LB 4FA2A 5EI2A 3Q2JA 3ZUTA 4L3LA 2PUPA 3UP2A 2XA4A 3QHWA 2PVMA 3HV6A 2GFSA 3F5UA 3PA4A 5I9ZA 2E9UA 4ZOGA 4CFNA 1YWNA 5BVFA 1PXKA 1J7UA 1Q4LA 3ENHA 2C5OA 2CLQA 5ANJA 2HCKA 1H1PA 4YTIA 2W1CA 2WELA 3TKIA 5DBXA 4FYNA 4QDVA 3R1QA 5FEDA 3TG1A 1E9HA 4YZMA 1YKRA 5EG3A 2ZFYA 2BDWA 3R1SA 3NW6A 3KVWA 3TXOA 5HBJA 1P4OA 1XH7A 4EKLA 3JUHA 4E5BA 3UC3A 3MTFA 4UBAA 4JQ8A 2I1MA 4LFIA 3BWJA 4O6EA 1LP4A 1BI7A 4U43A 1SVEA 3KGAA 4PX6A 4TNDA 2ERKA 3F3UA 5J87A 4CFFA 4A9SA 3LMHA 3FWQA 4YLJA 2A19B 1MP8A 2Q0BA 3QKLA 1K2PA 5ITAA 3FAAA 1AQ1A 5FBOA 5D10A 4WT6A 4QYHA 2XK6A 2G15A 5HG9A 1DAWA 1R39A 2QURA 3JY9A 3MI9A 4L44A 4TKSA 4TYEA 3WZEA 1F0QA 3LXLA 4WIHA 4BZNA 2WD1A 4M12A 4XG2A 2CKPA 4JVGA 5KO1A 3O2MA 3U6JA 2Z02A 3HX4A 3Q2MA 3KRRA 3LM5A 3KL8A 3R9DA 5GZ8A 3DFCB 4H39A 1WMKA 3MIAA 4KBAA 1VYWA 1J1CA 5T6KA 4JG6A 5DHJA 1JVPP 5KMNA 4P5QA 4WBOA 4V05A 3C50A 1KE6A 4Q2AA 4A9UA 1LUFA 4XUFA 5HGIA 1PYXA 4Q5HA 3ZLSA 4EH8A 2I0HA 2WKMA 4YBJA 4XG6A 3ZU7A 4EHGA 4BKYA 2UVZA 4AA0A 1WVXA 2VTHA 3AD4A 4C58A 5CAPA 2XAMA 4Y8DA 5K4JA 4AFJA 1P5EA 4IH8A 2W1FA 3MVMA 4UX9A 5BNJA 4Y5HA 4RPVA 3OFMA 3HAVA 2V0DA 2QOLA 2R3IA 4O0VA 4GT5A 4IB5A 1H1RA 5FRIA 2ZYBA 3A7GA 4NK9A 2EUFB 3W55A 2QG7A 3G9LX 4XH6A 4D55A 4RJ7A 2C4GA 4QMLA 2UZUE 3UDTA 2XNOA 3BCEA 2LGCA 3SOAA 3NSZA 3OTUA 4G34A 4ITHA 5C9CA 3EL8A 2VO6A 1JKKA 2VWZA 3PVGA 2WQOA 3TN8A 5FEEA 4JS8A 4BDBA 3WF7A 3DOGA 5AM6A 3LJ0A 2PE2A 3QCQA 5DIAA 4MNEB 5BMMA 5LMKC 5LVPA 4LUEA 3VVHA 5CENA 3I6WA 4K77A 1IAJA 3PSBA 3W10A 3TZ9A 3UO4A 2ITQA 4R7IA 2GU8A 2RL5A 3JXWA 1Y57A 5E90A 3UIUA 3FQHA 4QP7A 4CKIA 4DH5A 5I9WA 5M4FA 3BIZA 5CS6A 3TJDA 3HEGA 4JG8A 3QQUA 4RA5A 4NJDA 2WMAA 4I0TA 4F0FA 3AGMA 4BGHA 5LWNA 1H00A 4USDA 2WU6A 3OZ6A 4ZTQA 4KIKB 4L46A 4PWNA 3RMFA 5GHVA 1PKGA 5M57A 5K0KA 4I5PA 3TNHA 1WCCA 2ZJWA 3ZUUA 4FR4A 5I9VA 1PXJA 2C6MA 2CKEA 5BPYA 4FVRA 3ORNA 3BE9A 3UVQA 5J9LA 5AA8A 3PZHA 3RAIA 3UJGA 4BR3A 2VTSA 4O0SA 4XYFA 3U87A 4QP9A 2JIIA 2C6EA 2VTAA 4FG9A 4ITJA 5ANIA 1QPJA 5FWKK 5JMSA 2W1IA 3PIXA 3E88A 3PXQA 2WMUA 5L6PA 4HPTE 5AV0A 4F70A 3V5JA 4JLCA 5AUUA 3E7VA 1YXUA 4L45A 4U97A 4XCUA 4AOIA 3AGLA 3QZIA 1ZXEA 4OUCA 2CPKE 3KCKA 1P14A 3PJ2A 4B8LA 4GJ3A 4CT2A 2VN9A 3PP1A 5GJGA 3D5VA 3KK8A 3A8XA 4NM0A 5CVGA 5EM5A 2IZUA 5KBQA 5HVKA 3ZDIA 3KU2A 4EK5A 5EQPA 4OLIA 3QF9A 3TNPC 3P7BA 3W2SA 2OH4A 2C0IA 5CU3A 4DHFA 4UMRA 2P55A 1H8FA 2ZMDA 4IVAA 3LIJA 3QRJA 4LOPA 3UGCA 3IO7A 2XJ1A 4YHTA 4AGCA 4L43A 4ANLA 3LFFA 2OW3A 4DCEA 4FOBA 4R8QA 3DKGA 3IPHA 4RRVA 4C3RA 2X2LA 1UNGA 5G6VA 4FKWA 4QQJA 4MXAA 4BDKA 5AR2A 3NCZA 3L9LA 3VF9A 1OPLA 3ORZA 2JDOA 1Z9XA 2OGVA 4CTCA 2W99B 5HOAA 1YI6A 4O7SA 4FVPA 4QDEA 4IB1A 3B8RA 2NO3A 3DFAA 4IJPA 4C3FA 3MJ1A 4Q5EA 4I6FA 2XZSA 3N51A 4Z16A 1XO2B 5TF9A 5JQ5A 3TTJA 2VNWA 4I92A 4NM3A 5HLWA 2C5VA 2O3PA 1H25A 2WEVA 3LXPA 3NNUA 1V0BA 4N57A 2BRBA 3VAPA 2F7XE 1YXVA 2F57A 4YSMA 3LMGA 3ZS5A 5IQEA 2WQNA 2W1EA 4U3ZA 2BFYA 3MESA 5TO8A 3FMJA 2O63A 1VYZA 4JQEA 3K5UA 5CSWA 4ARKA 3LFNA 3PXFA 2PVFA 4JX7A 3WZKA 3QTWA 4FT0A 4AE9A 4YNOA 2UZVA 3CKWA 4ANNA 3HRCA 4GT4A 2XKFA 4D2TA 4F7SA 4FODA 1UVRA 3HNGA 5HE1A 4MBJA 2V62A 2UZOA 3QTQA 2G9XA 4OTPA 2AQXA 5A9UA 1SVHA 2CGVA 4P4CA 1R0EA 2IVUA 2WTDA 2B7AA 4ASDA 5HBEA 3PLSA 5M55A 3OCTA 2E9NA 2QO9A 4JDHA 1XQZA 4XV1A 2C3JA 4KB8A 4A06A 2WQEA 3AC1A 4OR5A 4TW9A 3L9NA 4EQUA 3Q60A 2QU5A 4A4XA 5DOSA 4DLJA 5KMOA 2X4FA 3QUPA 3QYWA 3CP9A 3C7QA 3UBDA 1YVJA 4DEAA 3PY1A 3TJCA 3Q52A 3Q6WA 4RJ8A 2ETMA 4NWMA 3NPCA 2PUIA 3EQGA 5IEVA 5IQBA 2I7QA 1Q41A 3K3IA 3QTXA 5J9YA 3AD5A 4HVIA 4DEBA 5IDNA 5A4CA 3F3TA 4QMXA 3EQCA 3EZVA 2X9EA 2VX3A 3HMPA 2QVSE 5CVHA 3ORTA 3UVPA 2HY81 1IASA 4A4LA 5LMKA 1OIRA 2WOUA 2W4OA 2RF9A 3COIA 3UZRA 1YXTA 4HZSA 3ZC5A 1W2FA 5CF5A 5A14A 4OTIA 1ZZ2A 4BBMA 2QQ7A 3DNEA 5KX8A 1WBVA 3LFSA 3Q4CA 4YZCA 3U4UA 3F88A 3ODZX 5H8BA 5AIRA 3LAUA 3R28A 1Q8ZA 3H4JA 5DMZA 2WXVA 3AC5A 3RWPA 2B54A 3F82A 5IA1A 5AP5A 2HW7A 3ZZEA 5EM8A 4FIEA 5LMBA 5HCYA 4ZTMA 2VGPA 2YEXA 3F6XA 2J5EA 4GL9A 5G1XA 4JT3A 1U54B 4MUQA 2W4JA 3LCTA 1OBDA 1TZDA 3HVCA 3WI6A 5KMMA 4G3EA 1JQHA 5ANEA 3DU8A 4EYJA 4X2GA 2CKQA 3G2FA 3W1FA 5JGBA 2X8EA 5GNKA 2J50A 2Z60A 2FVDA 2WO6A 1NVRA 4BKZA 4LGDA 5AUWA 4L9IA 1A06A 2YM4A 4C0TA 4E20A 4DEEA 4DFYA 2JC6A 1XR1A 4DEDA 4CTBA 3MH2A 3LZBA 4BWKA 4UV0A 2B1PA 3G51A 4EZ3A 3M2WA 4MD7E 2VWXA 3DBCA 5IA5A 3KXZA 4FV1A 4FZ7A 5ANDA 4ACDA 4BYIA 2XIKA 5AP1A 5HICA 3A2CA 2XUUA 4IZAA 4LUDA 5BV3A 4GUBA 3R1YA 4MQ1A 4AN3A 3FSFA 4ZTSA 3A7IA 3BPRA 3T3VA 3RCDA 2A98A 3AQVA 4DC2A 2C5NA 3SKCA 4BI1A 3Q04A 5AAEA 5L2QA 3QCXA 4L3JA 5HIBA 3VNTA 1ZAOA