5L6PA

Ephb3 kinase domain covalently bound to an irreversible inhibitor (compound 6)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
274
Chain Sequence
CVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNPASLKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-B receptor 3
publication title Development of Specific, Irreversible Inhibitors for a Receptor Tyrosine Kinase EphB3.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 274
sequence length 274
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l6pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l6pA01
3R7OA 3VAPA 2WU6A 3BYSA 3POOA 5HCZA 4CV9A 2OK1A 4NM7A 5K4IA 4UMTA 5EI2A 3EZRA 3HVCA 3NUPA 4OTGA 4FOBA 1UNHA 2Y9QA 3HMPA 4ZTNA 5M07A 5HTIA 2W1DA 3K3IA 3IGGA 4FKRA 4JNWA 4XG6A 2C1BA 3KREA 4MXYA 4ORKA 4IB1A 4O91A 5CAVA 5AJQA 3NEWA 4W9WA 1UU3A 4O7WA 1J1CA 3QHRA 4MBLA 4ALWA 5A14A 2WNTA 3OXTA 3PXRA 4WSQA 3VS5A 5HBHA 4C3RA 2X6EA 2Q0BA 2VGPA 5FLFA 4TYHA 3HYHA 2JD5A 2I0HA 2R0UA 2ZMCA 3DV3A 4TXCA 4QTEA 5I9VA 4FEWA 4O86A 2XA4A 4ZJIA 3NCGA 2CKEA 4MWIA 3O23A 2UZUE 3FQSA 2OG8A 4O81A 4HPUE 4KINA 1I09A 3UVQA 3ZRMA 5AP3A 1ZOHA 3V6SA 4DHFA 3QZIA 3OG7A 5HO8A 5HD7A 4TT7A 2XBAA 4ZK5A 3LCDA 5A6OA 3AC3A 1WBOA 3AOXA 2PE1A 3F9NA 3H30A 4EK4A 4UY9A 5C4KA 3O7LB 4WG3A 4CFUA 2FA2A 3ORXA 3OW4A 4JIKA 4M15A 4NUSA 5CT0A 4GK2A 5HLPA 1YXXA 3GCVA 3RPSA 3BX5A 4RZWA 3FLSA 4IC7A 1Q24A 3PRIA 3RAIA 4D2WA 4LGGA 3HNGA 1U5RA 3P9JA 1WBPA 4AQCA 4YMJA 3GU7A 3MY1A 4TYEA 4J99A 3FLYA 3IKAA 4QP9A 4TWOA 3UO5A 4FK6A 4FKLA 3PLSA 3C9WA 4XUFA 4DH5A 4BR3A 3H9FA 2VWXA 4I4EA 5CXZA 3PSDA 2C0IA 4M3QA 4AZVA 2Z7QA 4YNOA 4BC6A 1UNGA 3QF9A 4FK3A 4M67A 3GGFA 3T8OA 3UQGA 5TO8A 1QPEA 3OWKA 4ZSAA 3HDNA 1P4OA 5HORA 3EN7A 3Q04A 3CPBA 3NNWA 3RKBA 1Q8WA 1ZZLA 2OBJA 2PMLX 4C4JA 5FTOA 3DKGA 4WG5A 4GUEA 4WD5A 2YITA 3D83A 3ORNA 5ANGA 5A3XA 3ZFXA 1OBGA 4FKTA 1PRYA 4FIHA 4EHZA 2IG7A 4CMOA 2UZOA 4P5ZA 3F66A 4KRDA 4PL5A 2VTSA 4DH7A 3FI8A 4O84A 3P86A 3QRKA 3T3UA 3F69A 3H4JA 3AC5A 4MD9E 4NW5A 3I6UA 2WZJA 3KB7A 4OTDA 2H96A 3R1QA 1BI7A 5J87A 1SZMA 5A46A 4D1ZA 5I9WA 3A8XA 2WELA 3PJCA 4F63A 3DU8A 3EFWA 4F7JA 5LARA 4BN1A 4NL0A 4FTJA 2CGXA 2PVHA 5D7VA 4FTOA 2E9OA 4TWCA 4CV8A 3VHEA 4YJUA 3CEKA 4FT0A 5HVJA 4WHZA 3Q4UA 3HKOA 4RT7A 5C8KA 3GFWA 5IA5A 5HVKA 3DB8A 2P2IA 3MFTA 4NCTC 4R3RA 4MXZA 5CSWA 1YI3A 4CFMA 3BCEA 3DA6A 2C5VA 5HO6A 5I9UA 3WZKA 4CCBA 2XNMA 4HGTA 1WVWA 4XV2A 3CKXA 4FVRA 2AC5A 4FEVA 4KA3A 5CX9A 3R8UA 4J8MA 2C6DA 4N70A 3NNXA 4NWMA 4OUCA 5F1ZA 3CKWA 5J9LA 5TOZA 3FL4A 5HX8A 3Q32A 2WO6A 4DITA 3CJGA 4YC6A 4WSYA 3CY3A 2OJFE 2F2CB 3CGOA 4PTEA 3H9OA 3MI9A 5F20A 4EI4A 5B2MA 4PL3A 4XV1A 4BCHA 2J5FA 3FQEA 3HV7A 2CKPA 4ASXA 3ZO3A 2GNHA 3F3WA 2BMCA 3E63A 3O8TA 4GT4A 1LR4A 2ETKA 3GCPA 2X1NA 2FH9A 4HCVA 5E1SA 3ZFMA 4A9TA 4XH6A 3QUDA 4D5KA 4D2PA 3IONA 3B8QA 4EOKA 3QQFA 4O27B 5G6VA 3U6IA 4K11A 5KKRC 3PY1A 3A99A 4X2KA 4FTKA 1PJKA 3UQFA 5F9EA 3RNIA 1ZYJA 4YPSA 5CZHA 2H6DA 5FUTA 5KE0A 3VBXA 3BE2A 1FVTA 4GYGA 1X8BA 4EQUA 1R39A 4XEYA 5BX0A 2A0CX 3ZH8A 1Z57A 1ZY4A 4R7HA 4YHJA 3IDBA 4IX5A 5J1VA 4ZSJA 4XG4A 3LCTA 4L7FA 1H1WA 4RX7A 2W1FA 1P2AA 2J50A 2PY3A 2RFSA 3KL8A 3R2YA 4ZS0A 4KKHA 3UOKA 2UW9A 3VUHA 3R1SA 4W8EA 3W18A 2BZJA 3KCFA 4BHZA 5IEVA 1SMHA 2OF2A 2QLQA 3BIZA 4GFMA 4U5JA 1F0QA 2BHEA 2XK6A 3MY5A 5JQ5A 4RIYB 2XNPA 4ANOA 3QX4A 3SVVA 1BL6A 4HZRA 1JKTA 3BYVA 4EBWA 3P7AA 3R9NA 3PPKA 4FTNA 3NUXA 3O8UA 3EWHA 1OITA 2UW0A 3FHIA 1Y8YA 3E8DA 4ZMEA 3MVMA 4CZYB 4IMYA 2ITNA 4YSMA 4FT5A 3CS9A 4E26A 3D7ZA 2ZOQA 1HCKA 4O0UA 2C6OA 4JDIA 1RQQA 4RIWA 3E7VA 3QQLA 2HXQA 2XEZA 3QWJA 5AV4A 1NXKA 4XJ0A 1H27A 1UA2A 4CZUA 5AP5A 2W17A 3RPVA 4GVJA 4KSPA 3P08A 4RBLA 3IW6A 2XIZA 2YCQA 3QD3A 4YPDA 3PA4A 5E8VA 3HV5A 4G5PA 5D1JA 2VWUA 4YP8A 1YWNA 4QQ5A 4EONA 4C57A 2W7XA 5LMBA 3BLQA 3HZTA 4U40A 3O7LD 4EH9A 4DG2E 3GU8A 3WILA 1KE8A 2ZM3A 4FV9A 5EHYA 5L6WL 4OBQA 4APCA 3PA5A 4IADA 2XYUA 4LMUA 1OL1A 4O22A 4ZOGA 3G6GA 3S2PA 4AOTA 5EI6A 2YIRA 3W2RA 3ZC5A 4UN0C 3SXSA 4ZSGA 3C0IA 2UZBA 4WBOA 2XP2A 3U6JA 2NNWB 2JDTA 3FHRA 4U9AA 3VF8A 4O7TA 4GFGA 3DBEA 3KXMA 4GIIA 3PIYA 4M12A 3LLAA 3MH3A 5D41A 3FMLA 4BTJA 1BUHA 1H25A 2XF0A 5CTPA 1OIRA 4AZWA 4AGUA 3FMNA 3C13A 3Q9ZA 4B9DA 5BUEA 3A61A 3H3CA 4M69B 3F88A 2P3GX 4TYGA 4ASDA 4YZCA 5KBQA 1JBPE 2WTVA 2XCHA 4LOPA 3VNTA 4O7VA 4GVAA 4L9IA 2YHVA 4DGMA 3C7QA 3ZC6A 2YM8A 3UC4A 3FEGA 2CCIA 4ACHA 1OKZA 2YM5A 1OIQA 3COKA 1OGUA 4JDKA 3E3PA 3OMVA 4RGJA 5AV2A 1RDQE 1CSNA 4FSNA 4AACA 4ANSA 4XP2A 5FBNC 3RP9A 5HE2A 5HG9A 4F6SA 5J7HA 2XUUA 4RJ6A 3IQ7A 2W4JA 2F2UA 3HAVA 1L3RE 3NAXA 2ZDTA 2GS7A 2PVKA 3KY2A 4QO9A 2BAKA 2UW7A 4X6QC 4FIEA 4QTAA 4EZ3A 3HDMA 4LM5A 4HVIA 5CAOA 3K5UA 2PK9A 4QMNA 5KHXA 4JDJA 4M8TA 4O1PA 2O63A 2WTKC 3GC9A 4GYIA 2JBOA 3NUNA 1E9HA 2OW3A 3A60A 5DEWA 1OBDA 4W4XA 4FICA 3QUPA 2AUHA 3UZRA 3V8WA 3RGFA 4K8AA 3OFMA 5L6OA 4JDHA 4UBAA 1SVEA 3TUDA 4AW5A 2QO2A 3UPZA 4LRMA 5M09A 3G90X 4XG2A 2WAJA 4FTCA 4DYMA 2XZSA 5AIKA 1XWSA 2OSCA 3REPA 5C8NA 4F0FA 4CTBA 5ANIA 2R3PA 1Y6BA 4QP8A 1H8FA 4AFEA 2WKMA 3NCZA 4FL3A 3P23A 4BGQA 4O2PA 3VS2A 1PMNA 3ALOA 4BDIA 3OXIA 3DFCB 4BDKA 3VS0A 3TACA 4FODA 2VTRA 4LOQA 1ZMVA 5E9EA 4DTKA 3OY3A 2BIYA 4JXFA 5E8UA 4AZTA 3FSFA 3MFRA 3SG9A 5DI1A 2C6LA 1REKA 2WQEA 4NT4A 4G17A 5DGZA 4C33A 4C4HA 3D5WA 4MXOA 3A7HA 5EW8A 3PWDA 4OBOA 5CENA 4USDA 3I0OA 5JEBA 3ROYA 4I94A 4EK3A 3V04A 4D4VA 3ETAA 2G2HA 5L2SA 2FSMX 3BLHA 3WF7A 4CSVA 2KULA 3P78A 3UODA 4KNBA 3UNZA 2BROA 3UZTA 4NKAA 5BVWA 1GZKA 4DEGA 3L9PA 5DMZA 4IBMA 4BDHA 2R3QA 2GTNA 2W1ZA 2WU7A 4EKKA 2E9UA 4FYNA 3ZM9A 1V0PA 3LM5A 4QYYA 4RQKA 3RM6A 3W2PA 5I3RA 3PTGA 5F4NA 5HIDA 3V5LA 3MGYA 3PUPA 3CQUA 4JL9A 3TN8A 1IAJA 3LAUA 3MPTA 1I44A 2C3LA 4A4XA 1PKDA 5EQEA 4E6DA 4U97A 3ULZA 5HIEA 3TDVA 5CF4A 2XB7A 4G6NA 3WZEA 5LVOA 3D2IA 4AN9A 4AW1A 4ZXTA 5GZ9A 5CEIA 3ZO4A 4BCKA 5HNGA 3TKUA 2W4OA 3G9LX 3KULA 3PE1A 1JNKA 5LVLA 3GEQA 2BR1A 3ZBFA 2GPHA 3OVVA 2BIKB 2JIIA 4R7BA 3DK6A 3QCSA 3PSCA 5IUIA 5DHJA 3UGCA 1XH6A 3JY0A 3S95A 4DFLA 5DEYA 4F7SA 1NVQA 2C6IA 3WYYA 4QMQA 5K5XA 2ETMA 3BQCA 1GZ8A 3LFDA 2VTPA 4QYGA 3OCGA 3C5UA 5ACKA 3TDWA 3HGKA 2PMOX 5AUXA 4YJQA 3NDMA 3R8VA 3Q4ZA 2FUMA 4C3PA 1OB3A 5A9UA 4U45A 3MJ2A 3PY0A 4CEGA 1BX6A 4FTRA 3ROCA 4DEAA 4BVUA 3MB6A 3M11A 3BPRA 3FWQA 3BI6A 4FEQA 4BF2A 1WBTA 2PHKA 2VTHA 1BMKA 4O6LA 3BZ3A 4ZTSA 5KO1A 4J52A 3PZEA 1GZNA 3D14A 3IDCA 4JBPA 2YIWA 4K0YA 4ZTHA 5M4UA 3Q5ZA 2I6LA 4BDGA 3PJ2A 2XJ2A 4BBMA 1Y8GA 3S00A 1PXKA 1H01A 3G0FA 4EJ7A 5CWZA 3FSKA 3OCTA 4MWHA 2UW8A 1GZOA 3R7EA 3JPVA 4DH3A 1G8SA 5CAPA 3IK3A 4I24A 2X6DA 4KKGA 4U81A 2GNIA 1YOJA 2QOQA 4DFYA 5CNNA 5L8LA 1J7LA 2IZUA 2YEXA 3GCQA 3K3JA 5HE0A 4H05A 3MH2A 2YISA 4D5HA 4R6VA 3BGZA 4RWJA 4ACGA 1SYKA 5EDRA 2ZM4A 3NYNA 3R8ZA 2GFCA 2BPMA 4DFBA 4YJVA 2WD1A 5CI7A 4DLIA 4QMXA 4GKIA 4FTUA 1Q3DA 2VUWA 3JVRA 1XR1A 2VTTA 5EDPA 4G6OA 3ZRKA 5G1XA 1Q99A 4PDOA 1M52A 4F1TA 1GIIA 3CD3A 4KS8A 5LWMA 4FKVA 3R9DA 2VWIA 5E1EA 3R1YA 4FTAA 4NJ3A 3L1SA 4EH5A 5BVOA 4XP3A 3NUSA 1PMEA 4J97A 4HOKA 2YDIA 3GP0A 4Q5HA 5J95A 2DWBA 2A19B 2ITUA 2Y4IC 1JLUE 3NLBA 5JMSA 4DEHA 4K9YA 1YDRE 2RL5A 2FGIA 3D2KA 4F7LA 2BFXA 4X3FA 4FIGA 5FG8A 5H8BA 4F0IA 4GH2A 4N57A 1FOTA 3ENMA 4ANQA 4NFNA 3PSBA 2XRWA 3QRTA 2VX0A 3D5VA 5FXSA 2J4ZA 4A9UA 5EM7A 5LQFA 3DBQA 4S31A 4A07A 4O82A 5GZAA 5AUYA 3W32A 2IW8A 4KB8A 4UX9A 5EOLA 4FEXA 1MP8A 3F7WA 3LXPA 1QPDA 3NPCA 3BYMA 4FTTA 4XBUA 3EQBA 1PKGA 1ZMWA 3VO3A 5BMSA 2G15A 4YHFA 1YWVA 4KRCA 4BCMA 3Q5IA 2OIQA 4P2KA 3DXNA 3S3IA 3PXYA 4IWOA 4N4SA 5D12A 3OEFX 4QRCA 5IA2A 4H3QA 4XG9A 1YXTA 3KN5A 2X2MA 1U54B 1WBWA 3GC8A 1VYWA 3C51A 3L9MA 5M4IA 4EH8A 4YLLA 3OY1A 4QMZA 1OECA 2WIPA 1YXSA 5A4CA 4EOIA 5BVFA 3N4UA 2PUIA 4D2TA 3E8CA 3CTQA 5IQHA 1Y6AA 2O5KA 5HCYA 4FZAB 5GNKA 2BAQA 4QP2A 2J0LA 3KQ7A 4AGCA 4BIEA 4I0TA 2EXMA 4M68A 5AA8A 2RF9A 4K2RA 2UZVA 2WTCA 4QMLA 3WOWA 2V62A 4UYAA 2JFMA 4DAWA 2NRYA 2YJRA 3LXKA 2X2KA 4OTQA 4OW8A 4UALA 1IA8A 5AFVA 4FZDB 3FC2A 3AMYA 2B4SB 2CN5A 2YZLA 2YZAA 3ORTA 5ANOA 5C26A 3CIKA 1Z9XA 3QC4A 4U0IA 4AWIA 3LVPA 4BICA 4CZTA 5F94A 1B38A 4UWCA 2OWBA 2QONA 5ETCA 5J8IA 3SRVA 4ZAUA 2XK4A 5FDXA 5CXHA 4IB0A 5E8XA 4EOLA 4ZY4A 2QHNA 1JSTA 3BU6A 4QPSA 4F9CA 3CPCA 5IISA 4IH8A 4IVCA 4E5BA 3LM0A 4ANMA 2PVMA 3MW1A 2PMNX 2RFDA 4PX6A 4M13A 4HGEA 4N6ZA 3TI1A 2BALA 4A4LA 4PNKA 2VWWA 2ONLC 2IZTA 1ZLTA 2R5TA 4F9BA 4CG8A 3FC1X 5CU3A 3F3ZA 4EOMA 4D2RA 2QR8A 2JBPA 3E92A 3NYVA 3HV4A 3RAWA 3MJ1A 4MBJA 5LWNA 3CJFA 4IWQA 2IJMA 2IO6A 5A54A 3UQCA 5IQEA 1J7UA 3VBQA 4RWKA 4RVLA 3GB2A 3LE6A 4IC8A 3K2LA 4OTIA 4F6UA 5JN2A 4YTIA 2B9HA 3ORPA 2IVSA 5IPJA 1H4LA 3COHA 3QU0A 1H0WA 2XKCA 4JBVA 4RVMA 4K18A 3NZ0A 2UW4A 2RG6A 4UV0A 4RIOA 4RPVA 1Q3WA 3CE3A 4CXAA 4L3LA 4USFA 3DK3A 5JQ8A 5A6NA 5DLSA 1O6KA 1GIJA 5JKGA 4M14A 2EXEA 2P4IA 5ANJA 3V01A 5HG7A 3V8TA 4QQCA 3RVGA 1FVRA 4GK3A 4CT2A 3FXWA 5CAQA 3ZTXA 2H34A 2VTMA 3GOKA 3SXFA 3NGAA 4FZ6A 2JDOA 4NH1A 2JLDA 5HVYA 3QTIA 1OPJA 2UVZA 2VTNA 2ZB0A 3PZHA 4O0XA 3CXWA 4FSYA 5E8ZA 3V8SA 4DE4A 2R0IA 4IM0A 4CFXA 3DB6A 4FV6A 5HNIX 5B2KA 4IW0A 4JR3A 4E1ZA 2ERZE 2HY0A 4CFFA 5CEMA 4BWKA 3E5AA 1QMZA 1XHAA 1YDSE 3FKNA 1FGIA 1QCFA 4HNFA 5BVEA 3RZFA 4WNOA 5DOSA 4X6RA 3QTUA 5CQWA 2W9ZB 4NM0A 3OW3A 4H58A 4U7ZA 5IA3A 4MK0A 2RG5A 3E3BX 5EH0A 3ZSIA 3CBLA 1FMOE 3DGKA 3PVBA 4IWDA 4OLIA 4Q5EA 2J0JA 4YBJA 4W8DA 1Q62A 4FVPA 4IWPA 2HXLA 4WBBB 5IDNA 2QG7A 1XQZA 2R7BA 2WQNA 3ZSGA 1WVXA 3FY0A 4RVTA 2FSLX 4BFMA 4PTCA 3MIYA 3TL8A 1QPCA 4AA5A 3QRJA 5DRDA 3DJ6A 1CDKA 1JWHA 1T46A 3PPJA 3POZA 4HW7A 3AMAA 4UZDA 5L2IA 2XK9A 5HESA 2YDJA 5CEQA 5HLNA 4IX3A 1FINA 3RMFA 5FBOA 4I1ZA 3KN6A 3FYJX 4F0GA 3H0ZA 3UE4A 4R5SA 2C6KA 3ZUTA 2V7AA 4GT3A 5J79A 4HGLA 4EOOA 2ITXA 4BCOA 2OJ9A 3AD5A 4Z7HA 3CD8A 2OJIA 3U87A 3M1SA 2HY81 3IPHA 3MFSA 2G1TA 2XIYA 1T45A 3R04A 3RCJA 1G5SA 4D4YA 3NVKI 4PV0A 4Y5HA 4IAYA 5KMNA 3W2QA 2Y6OA 5ACBC 4BZNA 4BI2A 3VUTA 5IA1A 3CGFA 4KS7A 5BYLA 3FMJA 1WMKA 4AOJA 2NP8A 5K3YA 3TUBA 2OO8X 4I0SA 4QNYA 4I93A 2CMWA 2JGZA 4YTFA 4BGGA 4UYNA 5LVMA 3LXLA 3NYXA 4JLCA 1DAWA 3CQEA 3Q3BA 4XNEA 5EW9A 3I5NA 2DS1A 3U51A 5HU3A 4L3JA 5IH4A 3B8RA 5IEXA 4FTMA 3I81A 3PXFA 4BHNA 4L67A 5CYIA 3R73A 2GSFA 1PW2A 2R3IA 5H9BA 1WBNA 3V5WA 1M2PA 3Q6UA 2HYYA 1NA7A 5EI8A 4E73A 5HTCA 5IEYA 3EQFA 4JG7A 2V5QA 5L8JA 3NWWA 5EW3A 4BKYA 3LQ8A 4OTPA 2B0QA 3DTWA 4QMSA 2Y4PA 2ITPA 1CTPE 2JIUA 2R3NA 3D0EA 3DQWA 3PG1A 4FBXA 4FL1A 2QNJA 5CSXA 3TNWA 3VRZA 3UIMA 2CNQA 3FBVA 4CVAA 3WF8A 3EKNA 2C3IB 5IH5A 4MCVA 3AT3A 4RWLA 5K9IA 2YCSA 1A48A 3NUUA 3EHAA 4Z3VA 3WF9A 3SD0A 3QTWA 2Z2WA 4LGHA 4PP7A 2Y4IB 3GCUA 1H1QA 1STCE 4DCEA 2CKQA 2PZ5A 5M44A 1PYEA 3FLQA 5J7BA 1IEPA 2R3KA 5D10A 5HIBA 3TNQB 3HL7A 2ZV9A 3JVSA 4E4LA 3LZBA 3MA3A 4IM3A 2QURA 4MNFA 5HLWA 4ZZOA 3VJOA 3UP7A 3WF6A 2BCJA 3ATTA 4G3DA 2PVYA 5CVFA 1ZXEA 3EQGA 2ETRA 4RX5A 4D1SA 5FXRA 3R8MA 2A2AA 1DAYA 4BBEA 1W8CA 4RJ7A 1CKPA 2BRGA 3QD2B 5LXMA 4I5MA 3UNKA 5BVKA 3RCDA 4O7ZA 4AE9A 3HLLA 5DG5A 4EH2A 2VTOA 3ZXTA 3KXXA 1TQPA 3BU3A 3KF7A 3MN3A 4I21A 4P5QA 5E92A 4DTBA 3R0TA 3R8PA 2W1EA 3MESA 4I22A 4G9CA 3DT1A 4BDEA 3AT4A 2W06A 3G51A 4RX8A 4GG5A 4CFNA 3ULIA 5AP0A 4ZLOA 4AN3A 2VWZA 5TR6A 5KCVA 5T6KA 3TNHA 3FZRA 2B53A 4I6BA 4ASEA 3EQCA 3QLGA 3RM7A 4Z55A 4G16A 4CFVA 5LMKA 3QLFA 4O7RA 4N6YA 4WIHA 5KZ0A 4WOVA 4DG0E 5BVDA 1XH4A 5IH6A 1YOMA 3OUNB 1L8TA 4TWNA 3NNUA 4MF1A 1KUTA 3F5XA 4CKIA 4MQ1A 1M17A 4EK5A 3VS4A 1M2QA 3NW5A 4ERWA 3COMA 1LP4A 1H1SA 1OMWA 1KE7A 4K6ZA 4QYEA 3OUKA 2B9IA 3DPKA 3R9OA 4EOQA 5CSPA 3LHJA 5E7RA 4NK9A 3OZ6A 5L2QA 3QQUA 1QPJA 3QGWA 4UWYA 3DKOA 3QGYA 5DE2A 5FTQA 3U54A 3LFQA 3UJGA 3KRWA 4FSRA 3KEXA 4TNDA 5KX8A 2C4GA 5C4LA 2CN8A 4O0VA 3PWYA 5GJGA 1Y91A 4G3FA 4XG8A 3DBDA 4OAVB 4S32A 5FP5A 4ZIMA 3TG1A 1DS5A 4EHVA 4ZEGA 2OFVA 5KUPA 2YCRA 4DA5A 3DNDA 4ACCA 3NIZA 2P2HA 2BAJA 3G0EA 1CM8A 5DT4A 4UXQA 4FSZA 3PIXA 4U79A 3IG7A 4FKIA 4EH3A 3TV4A 4EC9A 2C1AA 1WBSA 2O0UA 4DGGA 1PHKA 3HMOA 4FTLA 1URCA 2P55A 4JAIA 3ZEPA 3CR0A 4GMYA 3IOKA 5EYDA 2VX1A 3FUPA 5TKDA 3UDBA 4ALVA 3AGLA 3AMBA 2FYSA 4O83A 5KMKA 5L2TA 4R77A 2VN9A 1ZARA 4PP9A 4ZTQA 2IVUA 5CY3A 1QL6A 3KKVA 4XRLA 1ZWSA 3CSVA 4BDCA 4IAZA 2FSOX 2UZEA 4AZSA 4RA4A 1PYXA 2JKKA 4GG7A 4LYNA 3I1AA 4TYIA 2XCKA 3U8WA 1LEWA 1FQ1B 4AZFA 3FAAA 2YDKA 4EWHA 4RLKA 1YI4A 1Q8TA 2GS2A 2J9MA 3AXWA 3QXOA 3BGQA 3LKMA 2JDVA 4JAJA 1F3MC 1U5QA 3LFEA 2VD5A 2HZ4A 3Q60A 4FR4A 2E9PA 3VWAA 1O6YA 5IQGA 4EEVA 4GW8A 5ITAA 2PMIA 1UU9A 1YWRA 5HG5A 4C4GA 2HZNA 2WXVA 4H3PA 4BDDA 4OGRA 3W2CA 3SG8A 1WAKA 4ZZMA 4RRVA 4Y46A 2R9SA 2W1IA 3EOCA 3MBLA 4G2FA 5HE1A 3TJDA 3BHUA 2R64A 4E4MA 3E88A 3PXQA 2SRCA 4O7LA 3GOPA 3I60A 4O0WA 3VHKA 2CCHA 4OTHA 3CTHA 1O6LA 4JIAA 3SDJA 1ATPE 1PXNA 4U8ZA 4AW0A 2J2IB 5T68A 2E9VA 1P14A 3LFNA 3QBNA 2QOHA 4BTFA 4FGRA 3OCBA 3VN9A 2PVFA 1GY3A 4CGAA 2BKZA 2PZPA 4PMTA 4RIYA 4Y5QA 2XJ1A 4O21A 3DCVA 1KE6A 3HP2A 1XH9A 4FMQA 3FQHA 5JH6A 2GS6A 3KF4A 4C62A 4X2JA 5CU0A 2Z60A 3HV6A 4KSQA 2PUNA 3QYWA 2ITTA 4AN2A 2UZDA 3JYAA 4F7NA 3UMXA 4BIBA 3LFCA 4BI0A 3KGAA 3HRCA 2WQMA 2QC6A 3BEAA 4D4SA 2CLQA 1PMUA 3ENHA 3AC8A 3NRMA 2VO6A 4USEA 5CVGA 3EKKA 1YXVA 1P5EA 2C3JA 5AAGA 5HKMA 2I0EA 3A7IA 3ERKA 4A06A 3F3TA 2O2UA 3I79A 2QU5A 5C01A 3UIXA 2G9XA 4WUAA 2PVJA 3BHVA 2W1HA 2UW6A 4YJRA 2OZOA 3NUYA 5FM2A 1ZMUA 2PL0A 3ZXZA 5M56A 5A4TA 4NZWB 3C0HA 2VTLA 3QYZA 3DLSA 5CAUA 4AT3A 5AP4A 4D28A 2IW9A 2WMWA 2W5BA 4O0TA 4X2FA 3TZMA 3MH1A 4NJDA 4BDBA 2OU7A 2Y8OA 4QMYA 3VUDA 4L45A 5CLPA 1LPUA 1ZRZA 4IQ6A 5BYZA 3TTJA 3O50A 4CFWA 3ZLXA 1FPUA 1MRVA 2VTJA 4DFNA 4LUEA 3MY0A 4TZRA 4FNXA 5I5ZA 4I41A 4ZTLA 5AV3A 2YJSA 3QA0A 3DJ7A 3LCSA 1PY5A 2R2PA 2A27A 2C0OA 5K0KA 1UV5A 4OT6A 2W5AA 3HV3A 2OH4A 3VS1A 4R5YA 4FG9A 2B52A 5CNOA 5L3AA 4IACA 3QCYA 3R7IA 3QAME 3BHHA 2BZKB 4ZY5A 4CMTA 4DH8A 5HZNA 2HCKA 3HECA 4OTFA 1YHVA 3Q4TA 2IWIA 4HZSA 3F5UA 4WKQA 4ANNA 1O9UA 4AE6A 4QQTA 1UWJA 3GC0A 5FGKA 3SW4A 2JKOA 2DYLA 2XK3A 2YM3A 3KRXA 5AR5A 3RAKA 3QZHA 5BUIA 2VZ6A 4M69A 2EXCX 3EYGA 2EVAA 3EL8A 5IMEA 1IRKA 1ZOGA 4N0SA 3V5PA 2YLFA 1JSUA 3EFJA 4B6LA 4AUAA 4Y8DA 2QLUA 2ZMDA 3H9RA 4CMUA 1SM2A 5FEEA 4AT4A 4NM3A 4JRNA 3W1FA 2HZ0A 4QD6A 1BKXA 3VS6A 5B0XA 3ORIA 4KWPA 5AR2A 3UPXA 3FJQE 4J1RA 3WZDA 5ETFA 4QMOA 1IR3A 1IASA 3OT3A 4BRXA 5HBEA 3PP1A 3EN6A 5BMMA 4EH4A 3R02A 4RC4A 1HOWA 4FX3A 1FVVA 2E2BA 1Q5KA 4YZ9A 3EJ1A 1G8AA 1OKWA 1NT2A 1KE9A 2JDSA 3R22A 4BCGA 3P4KA 3R71A 2PVRA 2EB2A 4QPMA 2Z7LA 4GS6A 3F82A 3DBFA 4H1MA 5E8SA 4Q9ZA 4PPCA 4F65A 4CD0A 2KTYA 3D7TB 4WNPA 4AS0A 2YM7A 4QYFA 1XBCA 2J0KA 3FMKA 4EOJA 3TIZA 2PE2A 4CQEA 3SW7A 1M2RA 2B9JA 1PXJA 3F3UA 5GZ8A 4B4LA 4FKWA 4JG8A 2ITQA 4TKSA 4HVSA 4TL0A 3O2MA 3B2WA 5GJDA 5IKWA 3ALNA 3DZQA 3QTZA 4FSUA 3TV6A 2XIXA 4DFZE 4RLLA 3R9RA 4KIQA 1H08A 2WGJA 4LFIA 3TZ8A 1OL5A 3PVGA 2WHBA 1VZOA 4KBAA 4PDSA 4GL9A 5DPVA 2X0GA 4GIHA 4V05A 3UTOA 4BZDA 4F64A 3NX8A 4OR5A 5FDPA 3A8WA 2VWVA 3GUBA 3ZLYA 4ZSLA 4C4IA 1AD5A 3FMMA 5IDPA 3ANQA 2DQ7X 2QKWB 4IX6A 1R0EA 3KK9A 4MNEB 2BILB 1ZY5A 2PZIA 3IDPA 5M55A 4GKHA 2QR7A 4ANBA 1M7NA 4FKUA 3R28A 2OZAB 1W98A 2R3MA 4TWPA 5FRIA 5JZNA 3EFLA 3JS2A 2RIOA 4FV3A 5HG8A 4I20A 4RIXB 4C3FA 4EHGA 1JSVA 2PVNA 4NM5A 4B8MA 4D4RA 2HW7A 2YWVA 1RE8A 3HUBA 2GFSA 2YABA 3PXZA 4C4EA 5JFSA 1Q8YA 5KMIA 4I5CA 3P1AA 4NIFB 5HOAA 2X7FA 4KUJA 4W4WA 3MS9A 4KBCA 2CSNA 5H2UA 3SOCA 2PE0A 3WZUA 4BGHA 4CLIA 2GNJA 3R63A 3E87A 3PP0A 4O7SA 2UZNA 2XM9A 4C38A 3F6XA 3MPMA 2BRMA 5IQAA 3RK5A 3DDPA 3PXKA 5HBJA 5AWMA 1F5QA 1V0OA 3DAEA 1BYGA 1CKIA 4GCJA 4D58A 4F70A 3FE3A 4UMUA 5BYYA 1VYZA 4IM2A 4Z9LA 3QUEA 3FMHA 4O7YA 4YHTA 4NCTA 5E8YA 4FV1A 1W84A 3DS6A 3R2BA 4G6LA 4UMQA 3D4QA 1MQ4A 4MD7E 3OCSA 3OS3A 4RQVA 3THBA 1W83A 3DAKA 4IZAA 2GCDA 2X7OA 3F2NA 1PXIA 4XRJA 3FY2A 3ZYAA 4XYFA 2F7ZE 5M51A 3R6XA 4V01A 3OHTA 1OKYA 2J51A 3G2FA 5DA3A 3SOAA 5IQFA 3G15A 3UIBA 1SNXA 3DLZA 1MQBA 5AX3A 3ZRLA 4BTKA 4RFMA 1BL7A 4YUQA 4BDAA 4WRSA 3C4ZA 3P0MA 2ITOA 5EYKA 3W55A 5CEKA 3E7OA 5HI2A 4KIKB 3KRRA 3OWPA 3BV3A 3A4PA 4UB7A 1KV2A 2RGPA 1RJBA 3LCKA 2X4ZA 4BCQA 1A06A 3F7ZA 4Y85A 2OIDA 4QMWA 5LCJA 5GIOE 4L3PA 2XVDA 5DR6A 4ZLZA 2C68A 3KK8A 4FIIA 3TWJA 2F9GA 5FEDA 1MUOA 2A1AB 4AG8A 4H39A 1TQMA 4APPA 3TIYA 5DBXA 3HAMA 2YAKA 1SVGA 2C47A 1PXLA 4YURA 3FXXA 3ZDUA 1M14A 5CT7A 4J8NA 4I23A 4AP7A 4D2VA 5K4JA 4Y72A 1OKVA 1R0PA 4EOSA 3RALA 4EQMA 1K9AA 5AMNA 5EDQA 2XNGA 2C6MA 2VRXA 4BCNA 2GTMA 5GIPE 2UZWE 4MD8E 3BEGA 4TRLA 1K2PA 2YLEA 5EFQA 3EH9A 5GINE 4QTDA 1RW8A 3I6WA 2I0VA 2WMUA 3PJ1A 3PFQA 4PMMA 3R83A 4JBQA 2CGVA 1DM2A 2J7TA 4G3EA 5AAFA 2BRBA 2UVXA 2ITWA 3QZFA 3I7BA 1URWA 2UW3A 3IS5A 2RSVA 3QA8A 4WO5A 2V55A 3ZCLA 4EYMA 2XIRA 3KXHA 3HP5A 4XX9A 2JEDA 3ZMMA 2R3GA 4DEDA 4IEBA 4M0ZA 4Z7GA 4A9RA 4DCAA 3FL5A 1WVYA 3L8PA 4QQJA 4E8AA 5J5TA 4PUZA 5CS6A 5ANDA 5EK7A 2QI8A 5HNBA 5M08A 1G3NA 3IW5A 2WEVA 3W33A 5I0BA 3LMIA 4FC0A 2W9FB 3S0OA 5HD4A 2ZDUA 4QYHA 5DYJA 1B39A 2VTQA 3F61A 3KMWA 2LAVA 3D9VA 3NS9A 3FMDA 1ZAOA 4FTIA 4LUDA 3ID6C 4F9AA 4I4FA 3OTVA 3GQLA 5H3QA 3Q6WA 3RINA 4PMSA 2C5OA 4LRJA 5DFPA 3O51A 1K3AA 3ELJA 3QTQA 2VX3A 1IG1A 4RWIA 3MYGA 3PJ3A 3QTSA 5FWKK 2QHMA 3D15A 2HIWA 4GFOA 5DVRA 3TNPC 3BYUA 2YCFA 4O1OA 1AQ1A 2A4LA 3FZOA 5KZIA 4E6CA 3TZ9A 2J90A 1XH5A 4MX9A 5FP6A 4EK8A 1FMKA 1S9IA 2FSTX 2OIBA 3FZTA 1OUYA 3VS3A 3MSSA 4FV2A 3SC1A 1YHWA 2YFXA 4KAOA 5DH3A 5FQDC 4RJ4A 4R78A 2QD9A 4BZOA 4IVAA 3OOMA 5JRQA 1CMKE 4EH7A 4R7IA 3FI4A 3LCOA 1U54A 3SHEA 4DFUA 4GSBA 4GJ2A 2Y6MA 1ZOEA 3AT2A 3R00A 2Z7SA 2ITZA 3AQVA 4F9YA 5DRBA 3BV2A 3PIZA 2X8EA 1OZ1A 4Q2AA 4ONAA 1PXOA 4RC2A 5JK3A 3BELA 3N9XA 4FUYA 5CSHA 2OF4A 4RZVA 3ZEWA 4EJNA 3AC2A 4GT5A 2WMSA 2QODA 3GC7A 2OICA 3RBWA 3UOJA 4FV5A 1UKHA 5FD2A 5H8GA 3RWPA 3EMGA 4A9YA 2VWYA 4FT7A 3PY3A 4AF3A 4QPAA 4FG7A 4O2ZA 4BI1A 4XOZA 2ZV7A 4GEOA 4EWQA 4HYSA 2WTIA 4YO6A 2VU3A 3C4WA 3EL7A 3W8QA 3IECA 4YBKA 1VJYA 2WEIA 4JJRA 4WNMA 5CALA 3KA0A 3COIA 4O96A 3CC6A 2C5XA 3FKOA 2H9VA 3OT8A 4FUXA 4LRKA 1WFCA 2JKMA 2BHHA 4J71A 5AV1A 5IU2A 2XKDA 4JX3A 4F1OA 3MPAA 4IZ7A 3ZO2A 3GXLA 3MVJA 4X0MA 4XMOA 4A9SA 4FNWA 3V51A 3Q2JA 4TYHB 4DT9A 4MEDA 4EZ5A 3CTJA 4E4NA 2VO0A 4FA2A 2ZV2A 4II5A 3EN4A 1JKSA 4GU9A 4K33A 5EKNA 2OGVA 4CG9A 4C59A 5L2WA 4FSMA 3DJ5A 3P7BA 3VW8A 2W99B 4F4PA 2GNFA 2QVSE 4HYUA 3MFUA 1YDTE 3ZDIA 5JGDA 4LGDA 5HEZA 3R7YA 2YN8A 2XIKA 5ANEA 3LFAA 3SAYA 3VS7A 2XNOA 1UVRA 3BYOA 4L68A 2GMXA 3L8VA 2BDJA 3D5XA 4EKLA 1V1KA 1V0BA 4ITJA 3DY7A 2IN6A 3EIDA 3QX2A 3SQQA 3AD6A 4AAAA 3HX4A 2Z02A 4AT5A 5CEPA 3VF9A 4PTGA 3NIEA 2XKFA 4D0XA 5CQUA 2W05A 2B9FA 3C5IA 3R7UA 3ACJA 3DBCA 5M4FA 3GBZA 3VUMA 1KWPA 5AR4A 3TM0A 3UYTA 1GJOA 1ZYSA 4XG3A 5DT0A 4MF0A 2WMVA 5J5SA 3QALE 4RFYA 1PXPA 2W1GA 2PPQA 2W1CA 4KABA 4FSTA 1UNLA 3U4UA 4J98A 3WYXA 1H24A 4MAOA 2FB8A 4GJ3A 3Q9WA 3QCQA 3C1XA 4BKZA 4ZS4A 3F3VA 2W0JA 4I92A 5CVHA 1YW2A 2C0TA 3QTRA 4QMUA 4XCUA 5BNJA 4XV3A 4H1JA 2WB8A 3GNIB 5AEPA 4TW9A 3RTPA 2I7QA 4FIJA 4J53A 5AP1A 5FM3A 1OUKA 1XH8A 5E8WA 5TE0A 4D0WA 5HX6A 4BYJA 5IA0A 3NSZA 3PE2A 4L46A 1J91A 3MVLA 4Y73A 3HA6A 1CKJA 3P5KA 5E91A 3TKHA 1OPKA 4DBXA 4C58A 3GU4A 2XS0A 3Q2MA 5KMOA 2ITYA 2X39A 3JR1A 4H36A 3RAHA 2WOTA 3C50A 3ITZA 3JXWA 4HVHA 3V6RA 5CU2A 2CDZA 1EH4A 2HELA 4UWBA 4ZMFA 1R78A 4JRVA 4S34A 3DZOA 4M97A 4BIDA 5BPYA 3E93A 3F5GA 4FI1A 1U59A 3HA8A 4XBRA 4ITIA 4XS2A 3TNIA 3LMGA 1BLXA 4G9RA 2OKRA 4WT6A 3TZ7A 1UU7A 3Q52A 3SV0A 4E6QA 4L7SA 3AD4A 2VNYA 3BBTB 2UZLA 4YO4A 2BRNA 5EHOA 4IHPA 5GJFA 1OL7A 3FZ1A 3GFEA 3NR9A 2OH0E 4WRGA 3R21A 2OXXA 2GNLA 4B7TA 5B2LA 3G33A 2Z7RA 3R30A 4MKCA 4E5WA 3R9HA 2RKUA 3MWUA 3LJ2A 4K1BA 4NFMA 5DR9A 3H0YA 3K54A 4KIPA 3ZFYA 4QP1A 2CNVA 2Q83A 3QFVA 3RJCA 5CF5A 3VUKA 2IZSA 3MTLA 4JR7A 1YVJA 4ID7A 1XJDA 4G34A 3RPRA 3DOGA 4X3JA 3HRBA 3ORZA 3N4TA 4AX8A 3PDTA 2C30A 3QXPA 3V5TA 4BY9E 1YI6A 1Y57A 4XG7A 3ZSHA 4HVDA 1H1RA 5IQCA 3QQJA 3DKFA 1HCLA 5KHWA 2J6MA 5D7AA 3PA3A 3E62A 5AR3A 4FGBA 4AGDA 2AC3A 2ZJWA 4YU2A 3L9NA 4IDVA 5LJJA 4E7WA 1IAHA 4S2ZA 4F9WA 2JC6A 5C8MA 2XYNA 3LJ1A 3WI6A 2BZIB 2VO3A 3EYHA 3KMMA 3II5A 3QHWA 4G1WA 3LFFA 3SXRA 4AW2A 4U80A 4HCTA 3KU2A 2QO7A 3Q4CA 5CI6A 5KNJA 5FXQA 5JFWA 3RHXA 4AXAA 4L01A 4O6EA 4RC3A 3BQRA 3T9TA 1WCCA 2YACA 2C3KA 3GI3A 2VV9A 1U4DA 4RFZA 4FE2A 3GU5A 3KXGA 5DN3A 3UZPA 1PMVA 2JIVA 4C4FA 1Z5MA 2PUUA 2CGWA 3DTCA 4HCUA 3TXOA 5IG1A 5GHVA 5IQIA 4RIWB 2V22A 4L52A 3OC1A 4J7BA 2PSQA 4M66A 4IJ9A 4EUTA 4PMPA 3QL8A 2Y7JA 2I40A 4O0YA 1XBBA 2FO0A 2VO7A 4EC8A 5KMJA 1AGWA 1JKKA 5AM7A 4FV4A 4C8BA 3U55A 4X2NA 5AP2A 5D9HA 2UZTA 4W4VA 4YZDA 1E1VA 4DEBA 3QKMA 4B8LA 4E20A 3FI2A 4MXAA 4JQEA 3FPQA 5HTBA 4EOPA 3VBVA 4IZ5A 5EKOA 2PTKA 4X3FC 3A2CA 1PXMA 2CHLA 3L8SA 4IJPA 4G31A 3JY9A 2CGUA 5IMXA 2YM6A 5ETIA 2PU8A 5CU4A 2ZVAA 2R3LA 4LOOA 3ZBXA 5IA4A 3I0QA 4YTHA 3LFSA 3VQHA 2C5NA 5M06A 2VNWA 2WMAA 3A7JA 3D94A 5B7VA 4Y83A 5EOBA 4C7TA 4DGOA 4CCUA 3NW6A 2HAKA 5AV0A 5L4QA 4ASZA 1VEBA 3Q9YA 1GIHA 1P4FA 2EB3A 3LPBA 4YZMA 5DWRA 4AGWA 1ND4A 3LMHA 2XM8A 2XKEA 1NW1A 5IZFA 4B0GA 1GNGA 4QMPA 4RJ5A 2R3JA 3AGMA 5EM8A 3OP5A 3M2WA 4TNBA 2CLXA 3FLZA 4XHKB 3UG2A 4I6HA 4YJSA 4ACMA 3SKCA 5HO7A 3LOKA 3S4QA 1MRYA 2PYWA 3ORKA 3QQHA 2O8YA 1KV1A 2WQBA 3HRFA 4ERKA 2GHLA 5EYCA 3UVRA 3EN9A 2F57A 4I6QA 2FVDA 3IW4A 4QP4A 5CEOA 2HOGA 2HZIA 3L9LA 3ZM4A 3CP9A 2C69A 4M84A 1NVRA 3AC4A 2E9NA 4QP6A 2W96B 3VUGA 4C02A 4U41A 4OAUC 4TPTA 3QZGA 2PWLA 2VTAA 2X9FA 3BRBA 2P0CA 4FEUA 3FPMA 4NYEA 4CQGA 4L53A 3ZLWA 3LXNA 4YC8A 4YC3A 4EUUA 2PZRA 4FVQA 3ACKA 2G2FA 3PPZA 1Q8ZA 2QOKA 4O0RA 3WIGA 3CQWA 3QKKA 4MH7A 4CRLA 4ZLYA 4FKGA 3DXPA 4MHAA 3FZPA 2BFYA 2J5EA 4HPTE 3EQPA 3BWFA 2QO9A 2P33A 1MRUA 2WMQA 4JVGA 3ANRA 4LI5A 4U3YA 4LV5A 4ZP5A 2YM4A 3BKBA 4D9UA 5JFXA 4ENYA 3VIDA 5K0XA 2QG5A 3DNEA 3CCNA 5EQYA 3EQDA 3S1HA 4QMVA 5LMAA 4FKPA 1NY3A 3EQHA 3ZUUA 5I9YA 2ONLA 4I6FA 4A7CA 4MBIA 4AOIA 5BVNA 5DT3A 4NW6A 3EFKA 1KOAA 4P90A 4QNAA 3OF0A 3FZSA 4MXXA 3F2RA 5BUJA 4NEUA 1H1PA 4MVFA 2B1PA 4JG6A 4M7IA 2V7OA 4CNHA 3OEZA 2PUPA 2F7EE 5HGIA 3LQ5A 4C61A 2R3RA 2CPKE 5JRSA 3QD4A 2XK7A 3QKLA 2BRHA 1WBVA 1E1XA 2X81A 3NAYA 3N51A 5FTGA 1REJA 2PULA 3FKLA 1PF8A 2EWAA 2UV2A 4FOCA 4NTSA 3HEGA 3O17A 4PWNA 1ERKA 4QP3A 1H28A 3UOLA 4LMNA 3W10A 1OIUA 2F4JA 5JGBA 2NRUA 4AA0A 2IPXA 2I1MA 4HYIA 4WA9A 3KFAA 4ZZNA 3ZU7A 3MA6A 1SVHA 1JVPP 3UMWA 2WQOA 4QOXA 1JAMA 3N4VA 4O0SA 4IB3A 4QP7A 4RG0A 3CLYA 4FZFB 4PPBA 5EHLA 2Z8CA 3FXZA 4Y95A 5JFVA 1GOLA 5A4LA 3TCPA 4WG4A 4YJOA 3T3VA 4BCIA 4JI9A 4QMMA 3RK9A 3SX9A 2W4KA 3U9CA 4GRBA 4G3CA 3QD0A 3QQGA 4F08A 2X9EA 3DDQA 2O65A 3ORMA 3RWQA 2J0IA 1OI9A 3FV8A 1S9JA 2R3HA 4G5JA 3SA0A 4FTQA 2BTRA 3ZZWA 4FIFA 5IQDA 3OOGA 4E5AX 4V04A 3DXQA 4F6WA 4FV7A 4R3PA 4BCFA 5CASA 2ZM1A 2YERA 1J3HA 2OXDA 2QOCA 4KBKA 4L43A 1NVSA 3P79A 3ORLA 5JZJA 2IW6A 3C4CA 4MTAA 4RA5A 4JBOA 3R8LA 2QKRA 4IVBA 4OTRA 4IX4A 1A9UA 3QRUA 4Q9SA 5J9ZA 4DF3A 4G3GA 4CKRA 1H0VA 1XO2B 2OFUA 4KKEA 5I4NA 1OM1A 5LCKA 4IZYA 4K77A 3KULB 5A4EA 4YNEA 3KVXA 4RSSA 1LUFA 2WTWA 3E64A 5J1WA 1JQHA 3IOPA 3WARA 2YIYA 3A62A 3CY2A 3EZVA 3FMEA 4PRJA 1LEZA 4XV9A 4IVDA 3RPOA 3OTUA 5E8TA 4BBFA 3H10A 3IW7A 5EG3A 4EK6A 2Y0AA 3G6HA 3OXZA 4F1MA 2ERKA 2XEYA 3VBYA 3V5JA 4BWXA 4CT1A 4C2WA 3BBWA 4R3CA 1M7QA 3V5QA 4D9TA 1TQIA 3EQIA 2B54A 3RI1A 5CSVA 4Z16A 3E8EA 2W5HA 2XH5A 3UP2A 5IF1A 3L8XA 3AG9A 4WUNA 2OLCA 5C27A 2BDWA 3KRLA 2WMRA 4PY1A 4XOYA 3OBGA 4UXLA 1J1BA 5CZIA 3FI3A 3IGOA 3VRYA 2XNEA 4R1YA 5LVPA 5E4HA 3I7CA 2AYPA 3MTFA 3R7VA 1TVOA 2QQ7A 4V0GB 5TF9A 2CKOA 5HE3A 5AM6A 3HUCA 5EM5A 2WMBA 4XLVA 5AAEA 3EB0A 1IA9A 3QCXA 4I3ZA 4EQCA 4U6RA 2QOLA 5JGAA 1KSWA 3LIJA 4E3CA 3R01A 5LVNA 2HWPA 4IAAA 4L6QA 4BB4A 4AZEA 4BDFA 2B7AA 3PJ8A 2BKKA 4DINA 1H07A 4C0TA 4JOAA 4IDTA 2R7IA 4IB5A 4LL0A 1ZZ2A 2GQGA 4W4YA 3U4WA 4CKJA 4XP0A 4IE9A 1ZYDA 5AP7A 2WMXA 3UC3A 5J9YA 4D2SA 3NUAA 2UUEA 5CF6A 4RMZA 2ZAZA 3VW6A 4U42A 2X2LA 1W82A 2R3OA 3D5UA 4QTBA 4FSQA 2XJ0A 4IIRA 4R1VA 1J7IA 5AA9A 2G2IA 4GU6A 3F2AA 4U44A 4BYIA 1OL2A 2GU8A 2ACXA 3ZONA 5KBRA 1YXUA 2X4FA 2UW5A 3I5ZA 2J0MB 4H3BA 3UBDA 3WF5A 1Q61A 4L42A 4FG8A 3KMUA 3PYYA 2R4BA 2F7XE 4TY1A 4EBVA 2VGOA 2HWOA 4C2VA 4ZJVA 3TUCA 4LV8A 4CLJA 2JDRA 1OPLA 3SLSA 3LJ0A 4YGAA 4OTWA 3D7TA 2R3FA 2B55A 1VR2A 2IVVA 2X7GA 4ZJJA 2BTSA 2GDOA 4X3FB 5HICA 3GU6A 3R1NA 4ZTMA 2YWPA 3C4FA 5KKRB 1Q4LA 2XBJA 3DAJA 2X8IA 4UZHA 4BCJA 4V0GA 3HMIA 3HMNA 3VJNA 2GQSA 4FKOA 4IXPA 4YLKA 4RJ3A 3ZOSA 4E4XA 5AUTA 5LOHA 2EUFB 3ODYX 2DUVA 4C37A 3KC3A 4TTHB 3ZLSA 3OWJA 2BDFA 2C6EA 3PLAE 5M4CA 4C34A 4PPAA 4YZBA 3VC4A 2VWBA 3P7CA 4HGSA 4MNEA 2QOBA 2YAAA 4FT9A 4TN6A 4CYJA 4E6AA 2C5YA 4P7EA 2JAMA 3BHTA 3GENA 3IW8A 1XBAA 5LMKC 3KXNA 5HU9A 1SNUA 4ITHA 1OL6A 3VBTA 2PVLA 4FKJA 3C4EA 5DIAA 4PL4A 4NU1A 2OZAA 1WZYA 4KIOA 4CTCA 2HK5A 1FBNA 4J95A 4IAKA 3OBJA 3EQRA 4RIXA 3UO6A 2JITA 1Q97A 3G5DA 4I5PA 4IFGA 2REIA 4EYJA 4ACDA 4YLJA 4L8MA 4BKJA 3KVWA 4X2GA 3E8NA 3BU5A 4AU8A 3KXZA 5F95A 4HVGA 5EM6A 3IO7A 4NIFA 1DI9A 3T9IA 3PRFA 4ZY6A 2WPAA 1JPAA 3ET7A 4HJOA 3HMMA 4L44A 3UVPA 5I9ZA 1Q41A 2XNNA 2XMYA 4YJTA 2I0YA 3RPYA 2XRUA 1Q8UA 3WIKA 1TKIA 4EHEA 1R1WA 4LG4A 4DN5A 5HHWA 1YOLA 2C6TA 2OJJA 2X8DA 2YIXA 3PVWA 5ETAA 3UYSA 2JAVA 3GQIA 4DGNA 3SRVB 4EH6A 3MVHA 4P4CA 2JFLA 3MDYA 4EZ7A 4C36A 5AR7A 5AUVA 4MQ2A 4HNIA 3C0GA 2QCSA 1ZYLA 3FDNA 3Q9XA 4DBNA 4O38A 2ZV8A 3VUIA 3W8LA 5JT2A 3NNVA 3WE4A 4UEUA 4IAFA 2LGCA 3UIUA 4HYHA 3DK7A 4RVKA 4ZTRA 5AUWA 4YTCA 5CANA 3GVUA 1YHSA 2BZHB 4U43A 3PVUA 4XLIA 3SGCA 4LL5A 5C1QB 5AX9A 2VTIA 3TJCA 2BVAA 3O0GA 2BUJA 3ZHPC 2ZB1A 4FKQA 4JT3A 5E90A 2GHGA 5I3OA 2OXYA 2WIHA 1YRPA 4KIKA 4JQ7A 4R8QA 4D1XA 4FF8A 3M42A 2YIQA 1YQJA 5T3QA 1UWHA 4GUBA 2RFNA 3NYOA 4C35A 3FLNC 2F49A 2H8HA 4RJ8A 3TKIA 4BCPA 4NKSA 5M57A 4EL9A 5JSMA 3ZO1A 4A4OA 4OBPA 1YKRA 5AUZA 3LLTA 3ODZX 5C9CA 2JKQA 2QU6A 3DQXA 3A4OX 3VULA 3B2TA 3GCSA 4PNIA 3UOHA 5BQ0A 3A7FA 3MV5A 3TV7A 3DFAA 5M53A 1W7HA 2HENA 3OWLA 4F99A 2ZYBA 5EYMA 4FZ7A 4F09A 4UMPA 2VAGA 2Q0NA 4BTMA 3QQKA 4FT3A 3DKCA 4JQ8A 4DGLC 5IUHA 5L8KA 3U6HA 2IVTA 3VVHA 5H8EA 3F5PA 2RFEA 3NVMB 3TT0A 2OI4X 5HCXA 4FL2A 4FV0A 3PG3A 3TTIA 3WBLA 4YSJA 3MB7A 3ZZEA 4QTCA 4PDYA 4YZNA 2CJMA 2G01A 4QT1A 4GV1A 2WTKB 4X7QA 3R7GA 1ZYCA 4NTTA 4DH1A 5DR2A 3LQ3A 3O71A 1FGKA 3NMUF 1U46A 4O7NA 4YJPA 5C03A 1XKKA 3K5VA 3ZS5A 2XK8A 1XH7A 4S33A 4DG3E 5KMMA 4FYOA 3BHYA 3NW7A 4J96A 4DFXE 3VBWA 4RX9A 3TEIA 3ATSA 3QTXA 4AFJA 4L00A 2V0DA 4ARKA 1JOWB 4B99A 2GQRA 3QWKA 2WTDA 1KOBA 3O96A 5ANKA 2GNGA 3LFBA 4LQMA 4PQNA 5ICPA 2WOUA 4U3ZA 3U9NA 4IANA 2UVYA 3O8PA 5TT7A 3RHKA 5L6PA 3G9NA 4OT5A 4EORA 4DEEA 4S30A 4TYJA 4UMRA 1OVEA 1R3CA 4ZSEA 5FEQA 4BDJA 3VQUA 3Q96A 4FV8A 3MIAA 4QMTA 4YJNA 4JX7A 5AP6A 4DC2A 5IQBA 5KMLA 4KD1A 3LW0A 2NO3A 3W2SA 2NPQA 3KCKA 3GT8A 3KRJA 5AIRA 3EN5A 4BWPA 3WZJA 5DNRA 1DI8A 3BGPA 3Q53A 4JS8A 4X21A 4DLJA 1H00A 3OD6X 2EU9A 5D11A 3BLRA 1H26A 4NSTA 3WE8A 4AA4A 3UO4A 4CYIA 2PZYA 4PF4A 1B6CB 2WTJA 4FKSA 5CU6A 3RNYA 2CNUA 4BL1A 4DTAA 3C4XA 5CF8A 1W0XC 2IZRA 3BE9A 4FNYA 4MYGA 2GHMA 4ENXA 5IUGA 4D55A 1APME 3UG1A 1GAGA 2OJGA 3ZUVA 5A4QA 3QC9A 4MXCA 4ANLA 2YA9A 4ALUA 2QOFA 5I9XA 2QOOA 3MH0A 4M0YA 4PDPA 3A7GA 4WNKA 3RZBA 1JKLA 3W16A 4IAIA 3W2OA 5K5NA 4FNZA 5EQPA 4CRSA 4E93A 4YR8A 3AC1A 5AADA 3QRIA 2HW6A 4I5HA 2O3PA 1UU8A 3BWJA 4GK4A 1OIYA 1KE5A 4IFCA 3FLWA 2ESMA 2QOIA 4W9XA 4DEIA 5HQ0A 4FSWA 4DT8A 3UNJA 3FYKX 3JUHA 1BI8A 2XNBA 2WFYA 4I0RA 2O64A 2ITVA 5AUUA 3I4BA 1UKIA 3RK7A 3OROA 3V3VA 5AR8A 2WMTA
chains in the Genus database with same CATH superfamily
3R7OA 3VAPA 2WU6A 3BYSA 3POOA 5HCZA 4CV9A 2OK1A 4NM7A 5K4IA 4UMTA 5EI2A 3EZRA 3HVCA 3NUPA 4OTGA 4FOBA 1UNHA 2Y9QA 3HMPA 4ZTNA 3UDTA 5M07A 5HTIA 2W1DA 3K3IA 3IGGA 4FKRA 4JNWA 4XG6A 2C1BA 3KREA 4MXYA 4ORKA 4IB1A 4O91A 5CAVA 5AJQA 3NEWA 4W9WA 1UU3A 4O7WA 1J1CA 3QHRA 4MBLA 4ALWA 5A14A 2WNTA 3OXTA 3PXRA 4WSQA 3VS5A 5HBHA 4C3RA 2X6EA 2Q0BA 2VGPA 5FLFA 4TYHA 3HYHA 2JD5A 2I0HA 2R0UA 2ZMCA 3DV3A 4TXCA 4QTEA 5I9VA 2X0QA 4FEWA 2XA4A 4ZJIA 3NCGA 4O86A 2CKEA 4MWIA 3O23A 2UZUE 3FQSA 2OG8A 4O81A 4HPUE 4KINA 1I09A 3UVQA 3ZRMA 5AP3A 3P5JC 1ZOHA 3V6SA 4DHFA 3QZIA 3OG7A 5HO8A 4QDEA 5HD7A 4TT7A 2XBAA 4ZK5A 3LCDA 5A6OA 3AC3A 1WBOA 3AOXA 2PE1A 2ZFYA 3F9NA 3H30A 4EK4A 4UY9A 5C4KA 3O7LB 4WG3A 4CFUA 2FA2A 3ORXA 3OW4A 4JIKA 4M15A 4NUSA 5CT0A 4GK2A 5HLPA 1YXXA 3GCVA 3RPSA 3BX5A 4RZWA 3FLSA 4IC7A 1Q24A 3PRIA 3RAIA 4D2WA 4LGGA 3HNGA 1U5RA 3P9JA 1WBPA 4AQCA 4YMJA 3GU7A 3MY1A 4TYEA 4J99A 3FLYA 3IKAA 4QP9A 4TWOA 3UO5A 4FK6A 4FKLA 3PLSA 3C9WA 4XUFA 4DH5A 4BR3A 3H9FA 2VWXA 4I4EA 5CXZA 3PSDA 2C0IA 4M3QA 4AZVA 2Z7QA 4YNOA 4BC6A 1UNGA 3QF9A 4FK3A 4M67A 3GGFA 3T8OA 3UQGA 5TO8A 1QPEA 3OWKA 4ZSAA 3HDNA 1P4OA 5HORA 3EN7A 3Q04A 3CPBA 3NNWA 3RKBA 1Q8WA 1ZZLA 2OBJA 2PMLX 4C4JA 5FTOA 3DKGA 4WG5A 4GUEA 4WD5A 1TZDA 2YITA 3D83A 3ORNA 5ANGA 5A3XA 3ZFXA 4FKTA 1PRYA 4FIHA 4EHZA 2IG7A 4CMOA 2UZOA 4P5ZA 3F66A 4KRDA 4PL5A 2VTSA 4DH7A 3FI8A 4O84A 3P86A 3QRKA 3T3UA 3F69A 3H4JA 3AC5A 4MD9E 4NW5A 3I6UA 2WZJA 3KB7A 4OTDA 2H96A 3R1QA 1BI7A 5J87A 1SZMA 5A46A 4D1ZA 5I9WA 3A8XA 2WELA 3PJCA 4F63A 3DU8A 3EFWA 4F7JA 5LARA 4BN1A 4NL0A 4FTJA 2CGXA 2PVHA 5D7VA 4FTOA 2E9OA 4BJJA 4TWCA 4CV8A 3VHEA 4YJUA 3CEKA 4FT0A 5HVJA 4WHZA 3Q4UA 3HKOA 4RT7A 5C8KA 3GFWA 5IA5A 5HVKA 3DB8A 2NYAA 2P2IA 3MFTA 4NCTC 4R3RA 4MXZA 5CSWA 1YI3A 4CFMA 3BCEA 3DA6A 2C5VA 5HO6A 5I9UA 3WZKA 4CCBA 2XNMA 4HGTA 1WVWA 4XV2A 3CKXA 4FVRA 2AC5A 4FEVA 4KA3A 5CX9A 3R8UA 4J8MA 2C6DA 4N70A 3NNXA 4NWMA 4OUCA 5F1ZA 3CKWA 5J9LA 5TOZA 3FL4A 5HX8A 3Q32A 2WO6A 4DITA 3CJGA 4YC6A 4WSYA 3CY3A 2OJFE 2F2CB 3CGOA 4PTEA 3H9OA 3MI9A 5F20A 4EI4A 5B2MA 4PL3A 4XV1A 4BCHA 2J5FA 3FQEA 3HV7A 2CKPA 4ASXA 3ZO3A 4MUQA 2GNHA 2XARA 3F3WA 2BMCA 3E63A 3O8TA 4GT4A 1LR4A 2ETKA 3GCPA 2X1NA 2FH9A 4HCVA 5E1SA 3ZFMA 4A9TA 4XH6A 3QUDA 4D5KA 4D2PA 3IONA 3B8QA 4EOKA 3QQFA 4O27B 5G6VA 3NFGB 3U6IA 4K11A 5KKRC 3PY1A 3A99A 4X2KA 4FTKA 1PJKA 3UQFA 5F9EA 3RNIA 1ZYJA 4YPSA 5CZHA 2H6DA 1OBGA 5KE0A 5FUTA 3VBXA 3BE2A 1FVTA 4GYGA 1X8BA 4EQUA 1R39A 4XEYA 5BX0A 2A0CX 3ZH8A 1Z57A 1ZY4A 4R7HA 4YHJA 3IDBA 4IX5A 5J1VA 4ZSJA 4XG4A 3LCTA 4L7FA 1H1WA 4RX7A 2W1FA 1P2AA 2J50A 2PY3A 2RFSA 3KL8A 3R2YA 4ZS0A 4KKHA 3UOKA 2UW9A 3VUHA 3R1SA 4W8EA 3W18A 2BZJA 3KCFA 4BHZA 5IEVA 1SMHA 2OF2A 2QLQA 3BIZA 4GFMA 4U5JA 1F0QA 2BHEA 2XK6A 3MY5A 5JQ5A 4RIYB 2XNPA 4ANOA 3QX4A 3SVVA 1BL6A 4HZRA 1JKTA 3BYVA 4EBWA 3P7AA 3R9NA 3PPKA 4FTNA 3NUXA 3O8UA 3EWHA 1OITA 2UW0A 3FHIA 1Y8YA 3E8DA 4ZMEA 3MVMA 4CZYB 4IMYA 2ITNA 4YSMA 4FT5A 3CS9A 4E26A 3D7ZA 3W0OA 2ZOQA 1HCKA 4O0UA 2C6OA 4JDIA 1RQQA 4RIWA 3E7VA 3QQLA 2HXQA 2X0OA 2XEZA 3QWJA 5AV4A 1NXKA 4XJ0A 1H27A 1UA2A 4CZUA 5AP5A 2W17A 3RPVA 4GVJA 4KSPA 3P08A 4RBLA 3IW6A 2XIZA 2YCQA 3QD3A 4YPDA 3PA4A 5E8VA 3HV5A 4G5PA 5D1JA 2VWUA 4YP8A 1YWNA 4QQ5A 4EONA 4C57A 2W7XA 5LMBA 3BLQA 3HZTA 4U40A 3O7LD 4EH9A 4DG2E 3GU8A 3WILA 1KE8A 2ZM3A 4FV9A 5EHYA 5L6WL 4OBQA 4APCA 3PA5A 4IADA 2XYUA 4LMUA 1OL1A 4O22A 4ZOGA 3G6GA 3S2PA 4AOTA 5EI6A 2YIRA 3W2RA 3ZC5A 4UN0C 3SXSA 4ZSGA 3C0IA 2UZBA 4WBOA 2XP2A 3U6JA 2NNWB 2JDTA 3FHRA 4U9AA 3VF8A 4O7TA 4GFGA 3DBEA 3KXMA 4GIIA 3PIYA 4M12A 3LLAA 3MH3A 5D41A 3FMLA 4BTJA 1BUHA 1H25A 2XF0A 5CTPA 1OIRA 4AZWA 4AGUA 3FMNA 3AKJA 3C13A 3Q9ZA 4B9DA 5BUEA 4AXCA 3A61A 3H3CA 4M69B 3F88A 2P3GX 4TYGA 4ASDA 4YZCA 5KBQA 1JBPE 2WTVA 2XCHA 4LOPA 3VNTA 4O7VA 4GVAA 4L9IA 2YHVA 4DGMA 3C7QA 3ZC6A 2YM8A 3UC4A 3FEGA 2CCIA 4O4FA 4ACHA 1OKZA 2YM5A 1OIQA 3COKA 1OGUA 4JDKA 3E3PA 3OMVA 4RGJA 5AV2A 1RDQE 1CSNA 4FSNA 4AACA 4ANSA 4XP2A 5FBNC 3RP9A 5HE2A 5HG9A 4F6SA 5J7HA 2XUUA 4RJ6A 3IQ7A 2W4JA 2F2UA 3HAVA 1L3RE 3NAXA 2ZDTA 2GS7A 2PVKA 3KY2A 4QO9A 2BAKA 2UW7A 4X6QC 4FIEA 4QTAA 4EZ3A 3HDMA 4LM5A 4HVIA 5CAOA 3K5UA 2PK9A 4QMNA 5KHXA 4JDJA 4M8TA 4O1PA 2O63A 2WTKC 3GC9A 4GYIA 2JBOA 3NUNA 1E9HA 2OW3A 3A60A 5DEWA 1OBDA 4W4XA 4FICA 3QUPA 2AUHA 3UZRA 3V8WA 3RGFA 4K8AA 3OFMA 5L6OA 4JDHA 4UBAA 1SVEA 3TUDA 4AW5A 2QO2A 3UPZA 4LRMA 5M09A 3G90X 4XG2A 2WAJA 4FTCA 4DYMA 2XZSA 5AIKA 1XWSA 2OSCA 3REPA 5C8NA 4F0FA 4CTBA 5ANIA 2R3PA 1Y6BA 4QP8A 1H8FA 4AFEA 2WKMA 3NCZA 4FL3A 3P23A 4BGQA 4O2PA 3VS2A 1PMNA 3ALOA 4BDIA 3OXIA 3DFCB 4BDKA 3VS0A 3TACA 4FODA 2VTRA 4LOQA 1ZMVA 5E9EA 4DTKA 3OY3A 2BIYA 4JXFA 5E8UA 4AZTA 3FSFA 3MFRA 3SG9A 5DI1A 2C6LA 1REKA 2WQEA 4NT4A 4G17A 5DGZA 4C33A 4C4HA 3D5WA 4MXOA 3A7HA 5EW8A 3PWDA 4OBOA 5CENA 4USDA 3I0OA 5JEBA 3ROYA 4I94A 4EK3A 3V04A 4D4VA 3ETAA 2G2HA 5L2SA 2FSMX 3BLHA 3WF7A 4CSVA 2KULA 3P78A 3UODA 4KNBA 3UNZA 2BROA 3UZTA 4NKAA 5BVWA 1GZKA 4DEGA 3L9PA 5DMZA 4IBMA 4BDHA 2R3QA 2GTNA 2W1ZA 2WU7A 4EKKA 2E9UA 4FYNA 3ZM9A 1V0PA 3LM5A 4QYYA 4RQKA 3RM6A 3W2PA 5I3RA 3PTGA 2IEWA 5F4NA 5HIDA 3V5LA 3MGYA 3PUPA 3CQUA 4JL9A 3TN8A 1IAJA 3LAUA 3MPTA 1I44A 2C3LA 4A4XA 1PKDA 5EQEA 4E6DA 4U97A 3ULZA 5HIEA 3PUFC 5CF4A 3TDVA 1G8KA 2XB7A 4G6NA 3WZEA 5LVOA 3D2IA 4AN9A 4AW1A 4ZXTA 5GZ9A 5CEIA 3ZO4A 4BCKA 5HNGA 3TKUA 2W4OA 3G9LX 3KULA 3PE1A 1JNKA 5LVLA 3GEQA 2BR1A 3ZBFA 2GPHA 3OVVA 2BIKB 2JIIA 4R7BA 3DK6A 3QCSA 3PSCA 5IUIA 5DHJA 3UGCA 1XH6A 3JY0A 3S95A 4DFLA 5DEYA 4F7SA 1NVQA 2C6IA 3WYYA 4QMQA 5K5XA 2ETMA 3BQCA 1GZ8A 3LFDA 2VTPA 4QYGA 3OCGA 3C5UA 5ACKA 3TDWA 3HGKA 2PMOX 5AUXA 4YJQA 3NDMA 3R8VA 3Q4ZA 2FUMA 4C3PA 1OB3A 5A9UA 4U45A 3MJ2A 3PY0A 4FRFA 4CEGA 1BX6A 4FTRA 3ROCA 4DEAA 4BVUA 3MB6A 3M11A 3BPRA 3FWQA 3BI6A 4FEQA 4BF2A 1WBTA 2PHKA 2VTHA 1BMKA 4O6LA 3BZ3A 4ZTSA 5KO1A 4J52A 3PZEA 1GZNA 3D14A 3IDCA 4JBPA 2YIWA 4K0YA 4ZTHA 5M4UA 3Q5ZA 2I6LA 4BDGA 3PJ2A 2XJ2A 4BBMA 1Y8GA 3S00A 1PXKA 1H01A 3G0FA 4EJ7A 5CWZA 3FSKA 3OCTA 4MWHA 2UW8A 1GZOA 3R7EA 3JPVA 4DH3A 1G8SA 5CAPA 3IK3A 4I24A 2X6DA 4KKGA 4U81A 2GNIA 1YOJA 2QOQA 4DFYA 5CNNA 5L8LA 1J7LA 2IZUA 2YEXA 3GCQA 3K3JA 5HE0A 4H05A 3W0SA 3MH2A 2YISA 4D5HA 4R6VA 3BGZA 4RWJA 4ACGA 1SYKA 5EDRA 2ZM4A 3NYNA 3R8ZA 2GFCA 2BPMA 4DFBA 4YJVA 2WD1A 5CI7A 4DLIA 4QMXA 4GKIA 4FTUA 1Q3DA 2VUWA 3JVRA 1XR1A 2VTTA 5EDPA 4G6OA 3ZRKA 5G1XA 1Q99A 4PDOA 1M52A 4F1TA 1GIIA 3CD3A 4KS8A 5LWMA 4FKVA 3R9DA 2VWIA 5E1EA 3R1YA 4FTAA 4NJ3A 3L1SA 4EH5A 5BVOA 4XP3A 3NUSA 1PMEA 4J97A 4HOKA 2YDIA 3GP0A 4Q5HA 5J95A 2DWBA 2A19B 2ITUA 2Y4IC 1JLUE 3NLBA 5JMSA 4AXFA 4DEHA 4K9YA 1YDRE 2RL5A 2FGIA 3D2KA 4F7LA 2BFXA 4X3FA 4FIGA 5FG8A 5H8BA 4F0IA 4GH2A 4N57A 1FOTA 3ENMA 4ANQA 4NFNA 3PSBA 2XRWA 3QRTA 2VX0A 3D5VA 5FXSA 2J4ZA 4A9UA 5EM7A 5LQFA 3DBQA 4S31A 4A07A 4O82A 5GZAA 5AUYA 3W32A 2IW8A 4KB8A 4UX9A 5EOLA 4FEXA 1MP8A 3F7WA 3LXPA 1QPDA 3NPCA 3BYMA 4FTTA 4XBUA 3EQBA 1PKGA 1ZMWA 3VO3A 5BMSA 2G15A 4YHFA 1YWVA 4KRCA 4BCMA 3Q5IA 2OIQA 4P2KA 3DXNA 3S3IA 3PXYA 4IWOA 4N4SA 5D12A 4DHZA 3OEFX 4QRCA 5IA2A 4H3QA 4XG9A 1YXTA 3KN5A 2X2MA 1U54B 1WBWA 3GC8A 1VYWA 3C51A 3L9MA 5M4IA 4EH8A 4YLLA 3OY1A 4QMZA 1OECA 2WIPA 1YXSA 5A4CA 4EOIA 5BVFA 3N4UA 2PUIA 4D2TA 3E8CA 3CTQA 5IQHA 1Y6AA 2O5KA 5HCYA 4FZAB 5GNKA 2BAQA 4QP2A 2J0LA 3KQ7A 4AGCA 4F78A 4BIEA 4I0TA 2EXMA 4M68A 5AA8A 2RF9A 4K2RA 2UZVA 2WTCA 4QMLA 3WOWA 2V62A 4UYAA 4AQKA 2JFMA 4DAWA 2NRYA 2YJRA 3LXKA 2X2KA 4OTQA 4OW8A 4UALA 1IA8A 1VLRA 5AFVA 4FZDB 3FC2A 3AMYA 2B4SB 2CN5A 2YZLA 2YZAA 3ORTA 5ANOA 5C26A 3CIKA 1Z9XA 3QC4A 4U0IA 4AWIA 3LVPA 4BICA 4CZTA 5F94A 1B38A 4UWCA 2OWBA 2QONA 5ETCA 5J8IA 3SRVA 4ZAUA 2XK4A 5FDXA 5CXHA 4IB0A 5E8XA 4EOLA 4ZY4A 2QHNA 1JSTA 3BU6A 4DDGA 4QPSA 4F9CA 3CPCA 5IISA 4IH8A 4IVCA 4E5BA 3LM0A 4ANMA 2PVMA 3MW1A 2PMNX 2RFDA 4PX6A 4M13A 4HGEA 4N6ZA 3TI1A 2BALA 4A4LA 4PNKA 2VWWA 2ONLC 2IZTA 1ZLTA 2R5TA 4F9BA 4CG8A 3FC1X 5CU3A 3F3ZA 4EOMA 4D2RA 2QR8A 2JBPA 3E92A 3NYVA 3HV4A 3RAWA 3MJ1A 4MBJA 5LWNA 3CJFA 4IWQA 2IJMA 2IO6A 5A54A 3UQCA 5IQEA 1J7UA 3VBQA 4RWKA 4RVLA 3GB2A 3LE6A 4IC8A 3K2LA 4OTIA 4F6UA 5JN2A 4YTIA 2B9HA 3ORPA 2IVSA 5IPJA 4FJVA 1H4LA 3COHA 3QU0A 3KIOC 1H0WA 2XKCA 4JBVA 4RVMA 4K18A 3NZ0A 2UW4A 2RG6A 4UV0A 4RIOA 4RPVA 1Q3WA 3CE3A 3W0QA 4CXAA 4L3LA 4USFA 3DK3A 5JQ8A 5A6NA 5DLSA 1O6KA 1GIJA 5JKGA 4M14A 2EXEA 2P4IA 5ANJA 3V01A 5HG7A 3V8TA 4QQCA 3RVGA 1FVRA 4GK3A 4CT2A 3FXWA 5CAQA 3ZTXA 2H34A 2VTMA 3GOKA 3SXFA 3NGAA 4FZ6A 2JDOA 4NH1A 2JLDA 5HVYA 3QTIA 1OPJA 2UVZA 2VTNA 2ZB0A 3PZHA 4O0XA 3CXWA 4FSYA 5E8ZA 3V8SA 4DE4A 2R0IA 4IM0A 4CFXA 3DB6A 4FV6A 5HNIX 5B2KA 4IW0A 4JR3A 4E1ZA 2ERZE 2HY0A 4CFFA 5CEMA 4BWKA 3E5AA 1QMZA 1XHAA 1YDSE 3FKNA 1FGIA 1QCFA 4HNFA 5BVEA 3RZFA 4WNOA 5DOSA 4X6RA 3QTUA 5CQWA 2W9ZB 4NM0A 3OW3A 4H58A 4U7ZA 5IA3A 4MK0A 2RG5A 3E3BX 5EH0A 3ZSIA 3CBLA 1FMOE 3DGKA 3PVBA 4IWDA 4OLIA 4Q5EA 2J0JA 4YBJA 4W8DA 1Q62A 4FVPA 4IWPA 2HXLA 4WBBB 5IDNA 2QG7A 1XQZA 2R7BA 2WQNA 3ZSGA 1WVXA 3FY0A 4RVTA 2FSLX 4BFMA 4PTCA 3MIYA 3TL8A 1QPCA 3O5AA 4AA5A 3QRJA 5DRDA 3DJ6A 1CDKA 1JWHA 1T46A 3PPJA 3POZA 4HW7A 3AMAA 4UZDA 5L2IA 2XK9A 5HESA 2YDJA 5CEQA 5HLNA 4IX3A 1FINA 3RMFA 5FBOA 4I1ZA 3KN6A 3FYJX 4F0GA 3H0ZA 3UE4A 4QEBA 4R5SA 2C6KA 3ZUTA 2V7AA 4GT3A 5J79A 4HGLA 4EOOA 2ITXA 4BCOA 2OJ9A 3AD5A 4Z7HA 3CD8A 2OJIA 3U87A 3M1SA 2HY81 3IPHA 3MFSA 2G1TA 2XIYA 1T45A 3R04A 3RCJA 1G5SA 4D4YA 3NVKI 4PV0A 4Y5HA 4IAYA 5KMNA 3W2QA 2Y6OA 5ACBC 4BZNA 4BI2A 3VUTA 5IA1A 3CGFA 4KS7A 5BYLA 3FMJA 1WMKA 4AOJA 2NP8A 5K3YA 3TUBA 2OO8X 4I0SA 4QNYA 4I93A 2CMWA 2JGZA 4YTFA 4BGGA 4UYNA 5LVMA 3LXLA 3NYXA 4JLCA 1DAWA 3CQEA 3Q3BA 4XNEA 5EW9A 3I5NA 2DS1A 3U51A 5HU3A 4L3JA 5IH4A 3B8RA 5IEXA 4FTMA 3I81A 3PXFA 4BHNA 4L67A 5CYIA 3R73A 2GSFA 1PW2A 2R3IA 5H9BA 1WBNA 3V5WA 1M2PA 3Q6UA 2HYYA 1NA7A 5EI8A 4E73A 5HTCA 5IEYA 3EQFA 4JG7A 2V5QA 5L8JA 3NWWA 5EW3A 4BKYA 3LQ8A 4OTPA 2B0QA 3DTWA 4QMSA 2Y4PA 2ITPA 1CTPE 2JIUA 2R3NA 3D0EA 3DQWA 3PG1A 4FBXA 4FL1A 2QNJA 5CSXA 3TNWA 3VRZA 3UIMA 2CNQA 3FBVA 4CVAA 3WF8A 3EKNA 2C3IB 5IH5A 4MCVA 3AT3A 4RWLA 5K9IA 2YCSA 1A48A 3NUUA 3EHAA 4Z3VA 3WF9A 3SD0A 3QTWA 2Z2WA 4LGHA 4PP7A 2Y4IB 3GCUA 1H1QA 1STCE 4DCEA 2CKQA 2PZ5A 5M44A 1PYEA 3FLQA 5J7BA 1IEPA 2R3KA 5D10A 5HIBA 3TNQB 3HL7A 2ZV9A 3JVSA 4E4LA 3LZBA 3MA3A 4IM3A 2QURA 4MNFA 5HLWA 4ZZOA 3VJOA 3UP7A 3WF6A 2BCJA 3ATTA 4G3DA 2PVYA 5CVFA 1ZXEA 3EQGA 2ETRA 4RX5A 4D1SA 5FXRA 3R8MA 3BL9A 2A2AA 1DAYA 4BBEA 1W8CA 4RJ7A 1CKPA 2BRGA 3QD2B 5LXMA 4I5MA 3UNKA 5BVKA 3RCDA 4O7ZA 4AE9A 3HLLA 5DG5A 4EH2A 2VTOA 3ZXTA 3KXXA 1TQPA 3BU3A 3KF7A 3MN3A 4I21A 4P5QA 5E92A 4DTBA 3R0TA 3R8PA 2W1EA 3MESA 4I22A 4G9CA 3DT1A 4BDEA 3AT4A 2W06A 3G51A 4RX8A 4GG5A 4CFNA 3ULIA 5AP0A 4ZLOA 4AN3A 2VWZA 5TR6A 5KCVA 5T6KA 3TNHA 3FZRA 2B53A 4I6BA 4ASEA 3EQCA 3QLGA 3RM7A 4Z55A 4G16A 4CFVA 5LMKA 3QLFA 4O7RA 4N6YA 4WIHA 5KZ0A 4WOVA 4DG0E 5BVDA 1XH4A 5IH6A 1YOMA 3OUNB 1L8TA 4TWNA 3NNUA 4MF1A 1KUTA 3F5XA 4CKIA 4MQ1A 1M17A 4EK5A 3VS4A 1M2QA 3NW5A 4ERWA 3COMA 1LP4A 1H1SA 1OMWA 1KE7A 4K6ZA 4QYEA 3OUKA 2B9IA 3DPKA 3R9OA 4EOQA 5CSPA 3LHJA 5E7RA 4NK9A 3OZ6A 5L2QA 3QQUA 1QPJA 3QGWA 4UWYA 3DKOA 3QGYA 5DE2A 5FTQA 3U54A 3LFQA 3UJGA 3KRWA 4FSRA 3KEXA 4TNDA 5KX8A 2C4GA 5C4LA 2CN8A 4O0VA 3PWYA 5GJGA 1Y91A 4G3FA 4XG8A 3DBDA 4OAVB 3TYKA 4S32A 5FP5A 4ZIMA 3TG1A 1DS5A 4EHVA 4ZEGA 2OFVA 5KUPA 2YCRA 4DA5A 3DNDA 4ACCA 3NIZA 2P2HA 2BAJA 3G0EA 1CM8A 5DT4A 4UXQA 4FSZA 3PIXA 4U79A 3IG7A 3ML1A 4FKIA 4EH3A 3TV4A 4EC9A 2C1AA 1WBSA 2O0UA 4DGGA 1PHKA 3HMOA 4FTLA 1URCA 2P55A 4JAIA 3ZEPA 3CR0A 4GMYA 3IOKA 5EYDA 2VX1A 3FUPA 5TKDA 3UDBA 4ALVA 3AGLA 3AMBA 2FYSA 4O83A 5KMKA 5L2TA 4R77A 2VN9A 1ZARA 4PP9A 4ZTQA 2IVUA 5CY3A 1QL6A 3KKVA 4XRLA 1ZWSA 3CSVA 4BDCA 4IAZA 2FSOX 2UZEA 4AZSA 4RA4A 1PYXA 2JKKA 4GG7A 4LYNA 3I1AA 4TYIA 2XCKA 3U8WA 1LEWA 1FQ1B 4AZFA 3FAAA 2YDKA 4EWHA 4RLKA 4JMQA 1YI4A 1Q8TA 2GS2A 2J9MA 3AXWA 3QXOA 3BGQA 3LKMA 2JDVA 4JAJA 1F3MC 1U5QA 3LFEA 2VD5A 2HZ4A 4O4DA 3Q60A 4FR4A 2E9PA 3VWAA 1O6YA 5IQGA 4EEVA 4GW8A 5ITAA 2PMIA 1UU9A 1YWRA 5HG5A 4C4GA 2HZNA 2WXVA 4H3PA 4BDDA 4OGRA 3W2CA 3SG8A 1WAKA 4ZZMA 4RRVA 4Y46A 2R9SA 2W1IA 3EOCA 3MBLA 4G2FA 5HE1A 3TJDA 2XAMA 1OGYA 3BHUA 2R64A 4E4MA 3E88A 3PXQA 2SRCA 4O7LA 3GOPA 3I60A 4O0WA 3VHKA 2CCHA 4OTHA 3CTHA 1O6LA 4JIAA 3SDJA 1ATPE 1PXNA 4U8ZA 4AW0A 2J2IB 5T68A 2E9VA 1P14A 3LFNA 3QBNA 2QOHA 4BTFA 4FGRA 3OCBA 3VN9A 2PVFA 1GY3A 4CGAA 2BKZA 2PZPA 4PMTA 4RIYA 4Y5QA 2XJ1A 4O21A 3DCVA 1KE6A 3HP2A 1XH9A 4FMQA 3FQHA 5JH6A 2GS6A 3KF4A 4C62A 4X2JA 5CU0A 2Z60A 3HV6A 4KSQA 2PUNA 3QYWA 2ITTA 4AN2A 2UZDA 3JYAA 4F7NA 3UMXA 4BIBA 3LFCA 4BI0A 3KGAA 3HRCA 2WQMA 2QC6A 3BEAA 4D4SA 2CLQA 1PMUA 3ENHA 3AC8A 3NRMA 2VO6A 4USEA 5CVGA 3EKKA 1YXVA 1P5EA 2C3JA 5AAGA 5HKMA 2I0EA 3A7IA 3ERKA 4A06A 3F3TA 2O2UA 3I79A 2QU5A 5C01A 3UIXA 2G9XA 4WUAA 2PVJA 3BHVA 2W1HA 2UW6A 4YJRA 2OZOA 3NUYA 5FM2A 1ZMUA 2PL0A 3ZXZA 5M56A 5A4TA 4NZWB 3C0HA 2VTLA 3QYZA 3DLSA 5CAUA 4AT3A 5AP4A 4D28A 2IW9A 2WMWA 2W5BA 4O0TA 4X2FA 3TZMA 3MH1A 4NJDA 4BDBA 2OU7A 2Y8OA 4QMYA 3VUDA 4L45A 5CLPA 1LPUA 1ZRZA 4IQ6A 5BYZA 3TTJA 3O50A 4CFWA 3ZLXA 1FPUA 1MRVA 2VTJA 4DFNA 4LUEA 3MY0A 4TZRA 4FNXA 5I5ZA 4I41A 4ZTLA 5AV3A 2YJSA 3QA0A 3DJ7A 3LCSA 1PY5A 2R2PA 2A27A 2C0OA 5K0KA 1UV5A 4OT6A 2W5AA 3HV3A 2OH4A 3VS1A 4R5YA 4FG9A 2B52A 5CNOA 5L3AA 4IACA 3QCYA 3R7IA 3QAME 3BHHA 2BZKB 4ZY5A 4CMTA 4DH8A 5HZNA 2HCKA 3HECA 4OTFA 1YHVA 3Q4TA 2IWIA 4HZSA 3F5UA 4WKQA 4ANNA 1O9UA 4AE6A 4QQTA 1UWJA 3GC0A 5FGKA 3SW4A 2JKOA 2DYLA 2XK3A 2YM3A 3KRXA 5AR5A 3RAKA 3QZHA 5BUIA 2VZ6A 4M69A 2EXCX 3EYGA 2EVAA 3EL8A 5IMEA 1IRKA 1ZOGA 4N0SA 3V5PA 2YLFA 1JSUA 3EFJA 4B6LA 4AUAA 4Y8DA 2QLUA 2ZMDA 3H9RA 4CMUA 1SM2A 5FEEA 4AT4A 4NM3A 4JRNA 3W1FA 2HZ0A 4QD6A 1BKXA 3VS6A 5B0XA 3ORIA 4KWPA 5AR2A 3UPXA 3FJQE 4J1RA 3WZDA 5ETFA 4AXDA 4QMOA 1IR3A 1IASA 3OT3A 4BRXA 5HBEA 3PP1A 3EN6A 5BMMA 4EH4A 3R02A 4RC4A 1HOWA 4FX3A 1FVVA 2E2BA 1Q5KA