3OXIA

Design and synthesis of disubstituted thiophene and thiazole based inhibitors of jnk for the treatment of neurodegenerative diseases
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
355
structure length
322
Chain Sequence
NQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVREHTIEEWKELIYKEVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 10
publication title Design and synthesis of disubstituted thiophene and thiazole based inhibitors of JNK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 322
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oxiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oxiA01
5BYZA 3FL5A 1M14A 3PXKA 2BUJA 4YGAA 3I5NA 4FEVA 2BIYA 5BVKA 1KE5A 2X8EA 3I7BA 2J9MA 4XG2A 4KSQA 5IF1A 3K3JA 3FLYA 3QFVA 4M84A 3UODA 3E8CA 3EQCA 3VN9A 2C6KA 3MSSA 3F7WA 4LGHA 3D7ZA 4O84A 3Q4CA 4O6LA 3JYAA 5HE1A 4FR4A 4HYIA 3Q5IA 5E8WA 4YJNA 2IO6A 2UW3A 2C1BA 3BEGA 4MXZA 4DG2E 4BCKA 4QQTA 3ZSGA 2VD5A 1LEWA 4C4IA 1OL6A 2VWWA 1OIUA 4FTAA 4FV4A 4I0SA 4WNOA 2RSVA 2WQBA 1IA8A 3QHRA 4BCFA 3DXQA 5BVFA 1W0XC 3NAYA 2E2BA 4ZTRA 4DEGA 3DLZA 2W0JA 4EONA 3HDNA 3V5TA 5BPYA 4NZWB 5TE0A 3WILA 2B0QA 2V7AA 4O0UA 1JSVA 4L9IA 4BZNA 2VX0A 4GFMA 2QD9A 1K2PA 5HO7A 4XP3A 3C5IA 2R7BA 4YHJA 3QRKA 4IFGA 5JMSA 4S31A 1NVRA 4TTHB 2HXQA 4RGJA 4P5ZA 1PXOA 4I93A 3G90X 4MQ2A 2ETRA 5HIEA 4E3CA 2W96B 5DG5A 2XA4A 4JR3A 4EOQA 2R4BA 3H0ZA 3GOKA 4R6VA 3HYHA 4ZY4A 2VV9A 4C0TA 4K2RA 1Q8WA 3CPBA 5KMNA 4MCVA 4F7SA 3EQDA 1OGUA 2OI4X 1MP8A 1CM8A 2W05A 4L00A 4NM3A 4BFMA 4D9TA 3MN3A 5IA5A 4WSYA 3MVJA 3PPJA 4HVGA 1XO2B 4NM0A 4XV2A 5EQPA 5HCXA 4MF1A 2J0JA 4LOOA 4ERWA 3UZPA 2UW6A 3BHYA 1VYZA 2PWLA 4MNEA 3P7CA 2JFMA 4WUNA 2CHLA 1OL7A 4EOOA 2CPKE 2R3PA 2IZSA 2RF9A 3C7QA 3PXZA 2ZM4A 2VWZA 3WE4A 3LFNA 4KBKA 4AZVA 3F3UA 3MFTA 1CKJA 3HMNA 4E6AA 4Y5QA 2H96A 3ODYX 4PNKA 2JIUA 3PPKA 3R6XA 3UQFA 5DMZA 3KCKA 5H3QA 3ATSA 3LMHA 2WQNA 3DNDA 5EKOA 2R3GA 3QQFA 4CKIA 5JKGA 3ATTA 1JKKA 4G3EA 5EOLA 4I6BA 1LPUA 4KUJA 4BBEA 3FXXA 5LWNA 2PU8A 3CTHA 2C68A 3D7TA 3FLWA 3FQSA 2YA9A 4FZAB 4NCTC 3RZFA 5HORA 1Q8TA 3QD0A 2PL0A 3QTXA 5JRQA 4IVCA 2ZB0A 3R9DA 5GJDA 1L8TA 2J50A 3TNIA 3B2WA 4GCJA 4CKRA 4B9DA 3OY3A 2VGOA 5I9YA 1QL6A 1R1WA 2A0CX 2CLQA 2GNLA 3NNVA 3IGGA 5DR9A 3F3WA 5GJGA 1STCE 4WIHA 4HVDA 4E5WA 3AG9A 4IMYA 3UQCA 3UBDA 4ZMFA 2NPQA 3CEKA 5LCJA 4TL0A 1U54B 3GENA 5DYJA 1FVTA 2I0EA 4YNOA 3HAMA 2G2FA 3SV0A 3QGWA 2C3IB 4FV2A 2ZV9A 4DC2A 1PY5A 4ZZMA 3O8UA 2WGJA 4CFFA 1WBVA 2PHKA 3O96A 4FIIA 4HJOA 2E9UA 4I20A 4WT6A 3KVXA 3F2RA 4JG7A 3QTIA 4F7NA 5DOSA 3IW8A 4N0SA 1IAJA 3PPZA 5F1ZA 3CJGA 4JQ7A 3KF4A 5CENA 3T9IA 4BDFA 4MYGA 1APME 1H0VA 1YOJA 3I0OA 1ZXEA 2YDIA 4QMOA 5EYCA 3ZXTA 2C5YA 1OL2A 4GUEA 3MH0A 4L52A 3GFEA 4G9RA 3HGKA 4YC8A 2CKOA 2JKMA 4O0YA 3PZHA 5AIKA 1NW1A 5FXSA 4BYJA 2HW6A 1JSTA 5KO1A 2V5QA 3QKKA 1IA9A 5AFVA 5I9WA 3H10A 4OTWA 1H1SA 2OJ9A 4DH3A 3BEAA 4B99A 5EYMA 3IKAA 2OK1A 5C8KA 4FT9A 1IR3A 2RFDA 5D10A 5AR4A 3QRJA 5IQIA 3PJ1A 4RIYB 4A9RA 3FPMA 2QOCA 3E8DA 5M53A 2GTNA 4PNIA 5C4LA 3LCDA 4ITJA 2P55A 4M66A 2OIQA 3FKOA 1CMKE 4CZUA 5I0BA 4JI9A 4YURA 3KQ7A 3VVHA 2UW4A 3P7BA 3E3BX 5J87A 5CXZA 3IK3A 4F08A 4O81A 3ULIA 4CFNA 5KX8A 5E9EA 4A4OA 4QMMA 4YJPA 2E9NA 2WMVA 3C51A 3Q6UA 3EL7A 3OVVA 2CKQA 4N4SA 5E92A 3L9PA 5AX9A 2VTQA 5KE0A 4YMJA 5BYYA 1BMKA 1PKGA 3R9NA 3RKBA 3SOCA 4F9WA 1JWHA 1XJDA 3R8ZA 5ETAA 2B4SB 4JG6A 3FLNC 3QHWA 4RSSA 2IG7A 2QR7A 2ITTA 3RM7A 4ACDA 4QQJA 4K9YA 2ZDUA 3RJCA 3D5WA 4OAUC 5M09A 3G2FA 1Q24A 4FBXA 1R78A 2ONLA 2XKDA 4ZTSA 3DB6A 4DFXE 4R5YA 3WZKA 3UZRA 3WF9A 3FLSA 4TN6A 3EKKA 3R7GA 3CQEA 2YM7A 4MBJA 5CLPA 1KUTA 1WVYA 3P7AA 3RZBA 1OZ1A 4XP2A 2W1CA 3LMGA 4G3CA 1H08A 2WTKB 5IDNA 1Q5KA 4JQ8A 4YTFA 1NA7A 3BGPA 5LQFA 3K5VA 2WTDA 3NUYA 3LFCA 2XS0A 4JT3A 2WMUA 3ZFMA 2QNJA 2YZLA 5K0KA 1R0EA 3AGMA 3NGAA 2YM3A 2JAVA 3FL4A 5J7HA 1XH8A 4PX6A 4L3LA 4YUQA 2VX1A 2J0KA 2W1GA 4BVUA 3LFEA 5IA2A 4M0ZA 3F3VA 4J71A 1GAGA 3DKCA 4EQUA 4FKQA 4IDVA 4TNDA 4ALWA 2QLUA 4JBOA 4R8QA 3GP0A 4IE9A 2UZBA 3DBQA 4GYGA 3PLAE 2XH5A 3CLYA 3FI3A 2C6LA 5EI8A 4BI0A 5FDXA 2SRCA 4GYIA 4FEWA 1PKDA 4D1ZA 3TUBA 2G2HA 4YJVA 3DZOA 4O0WA 3ENHA 5AP0A 3LCOA 5FM2A 3G33A 3UZTA 3LJ2A 3R8MA 4A9TA 4EOJA 3BE2A 5LOHA 4I22A 5T68A 3H9RA 3R01A 4L45A 3EQFA 3ACJA 5AP5A 1JSUA 2X9FA 4GK4A 4R5SA 3LFSA 3R7EA 4QTEA 3HA8A 4YNEA 1P4FA 1YXTA 2OJGA 2E9PA 4Z7GA 2I40A 3KULA 3UIUA 3O50A 4FKJA 4QRCA 4RX8A 5I9XA 1Y57A 3TACA 1OITA 4IC8A 4TYHB 2WMTA 1FGIA 2PMNX 4H3BA 4JBPA 1TQMA 4NIFB 3SW7A 4JJRA 5HLPA 1OVEA 1KOBA 1U5QA 2F4JA 4M3QA 3NVMB 3BHHA 4AG8A 5L3AA 1FOTA 2FSOX 3SDJA 4IM3A 3BRBA 2J0LA 4PP9A 4QMYA 1ZYDA 3GU8A 5LJJA 3FPQA 4EOLA 3GU4A 4B8MA 3C0HA 5E8VA 2PUPA 4FK3A 4OBPA 2O8YA 4RC3A 5M4CA 5AV2A 1BX6A 4D2WA 4L67A 2YDJA 3PIXA 4X3FB 1K3AA 4U0IA 3BU6A 3JY9A 3C4ZA 3PXYA 1NVSA 5IQAA 3OG7A 4DEHA 4GL9A 3O8TA 3LLAA 3TEIA 4MXOA 2Y4IB 2Q0NA 4KKGA 3RALA 3RAHA 1H07A 4B6LA 4EEVA 4E4MA 4FTQA 4S34A 3TV4A 3PZEA 1UKHA 4HYUA 2VWIA 4JAIA 3MV5A 4XOZA 4I41A 4XP0A 4FSMA 4FVRA 4JXFA 4ZY5A 4FSTA 2GQGA 3R73A 3ZCLA 1YI4A 4J97A 5EK7A 3KN6A 4OBQA 3ROYA 5IDPA 3UQGA 2X8IA 3QKLA 3WIGA 1SYKA 3QA0A 3PY1A 1AD5A 3BPRA 4ZSGA 2PVRA 3BLHA 2PVKA 3Q4ZA 4D2RA 2PUIA 2YDKA 3SG8A 2V7OA 4EUUA 5HBHA 3GBZA 3H9OA 4YZCA 5CZIA 3RINA 4EHZA 3H30A 3DOGA 3O2MA 3UOLA 4HVIA 5A4EA 5CAQA 2R3RA 4IJ9A 5BVDA 3RNYA 5E90A 5IUIA 3QQKA 4LL0A 5D12A 4C2VA 2QQ7A 5FXRA 2OXXA 2OH4A 3PJ3A 4D4VA 4FF8A 4W4VA 2X0GA 2C6TA 5E8YA 4FT7A 4OTQA 4UXLA 3WF8A 3I7CA 3PRIA 3GNIB 3NX8A 4KKEA 2IW9A 5F20A 4QMNA 3COKA 4OTFA 2JD5A 2OXYA 4FI1A 2CKEA 4EYMA 2CKPA 3ZC5A 4BICA 3SX9A 4DFZE 2ITVA 4DFYA 5HQ0A 3S00A 2IWIA 4BI2A 5EKNA 1MRUA 2YITA 4AN3A 3ENMA 4YLLA 4Q5EA 4KS8A 3ZUTA 4O96A 5LMKC 4UYAA 2WTKC 2CCHA 3NUPA 4FSRA 4UV0A 5HHWA 4E4NA 2A2AA 3DAKA 1VYWA 3KEXA 4TXCA 1F3MC 2BRBA 5T3QA 2UW5A 5E1SA 4F7LA 1Z9XA 3E64A 4JLCA 4K8AA 1MUOA 4X2KA 3FMHA 4CYIA 2C6OA 3BI6A 3DU8A 4C62A 1U4DA 2VO6A 4YO4A 2B55A 2ACXA 2XBAA 5ACKA 1DI9A 1BI8A 1YDTE 2YLEA 4FKOA 4NT4A 5CEKA 1JKLA 3DAJA 4XRJA 1REJA 3S4QA 4DBNA 1PMNA 1Y6AA 5D7AA 2QI8A 2YERA 4OUCA 2OIDA 4GJ2A 4RIXA 4AN2A 2Y6OA 5TT7A 4AA5A 3GOPA 4AW2A 4FNWA 3A7IA 2Y4PA 4HW7A 2QG7A 5JGBA 4ZTQA 4GT4A 3ZOSA 4F0GA 5BX0A 4X2GA 1A48A 4QTDA 3I81A 5HNGA 4ZY6A 3C5UA 4PPAA 2CGWA 3TJCA 1H0WA 4DTAA 1OPKA 2UVZA 4GG5A 4X6RA 5J5SA 2ZDTA 4R3CA 3QRIA 3R02A 4FSUA 1DI8A 2GS2A 2JLDA 3LCKA 5AR5A 3BKBA 5HG9A 4I23A 4U41A 4EOPA 4ZZNA 4IC7A 1UKIA 3F2AA 3DV3A 4CV8A 4EHGA 4EH2A 1MRVA 5AR7A 3DKOA 3BCEA 3R9RA 4RJ5A 4BTMA 3IS5A 3CBLA 3D14A 4I5PA 4XBUA 4ANSA 2WTJA 3CE3A 2J0MB 4HOKA 4WNMA 3DFAA 2PPQA 3C13A 2WMQA 4FVPA 1TQPA 3EZVA 4CKJA 3E63A 3HUBA 4I6FA 4Q9ZA 5HG7A 3OCTA 4XX9A 4DITA 3FAAA 5G1XA 4C4JA 4XH6A 5A6NA 5A4TA 2IN6A 2UZWE 4O2ZA 4FKUA 2NRUA 5CASA 5FXQA 5F95A 3QQUA 5M4IA 3QC9A 2R3MA 3C50A 1ZOGA 4CVAA 4NU1A 1KSWA 1M2QA 4X3FC 1Q3DA 2QU5A 4EK8A 3QKMA 3S2PA 4BWXA 3I0QA 3N9XA 4BCIA 3MY0A 3ORZA 4PTGA 4V05A 3V5PA 2BR1A 3P78A 2Y4IC 1JVPP 4IX4A 4U44A 3Q60A 3MPAA 4C61A 3COMA 4G6NA 3PA4A 4ENYA 5CAUA 5HICA 4YLKA 3VHEA 4J98A 4IB0A 4D5HA 1LP4A 3GCVA 3GUBA 3MPMA 4U79A 5DFPA 1ATPE 3QTRA 4QTAA 2HWPA 2HENA 5CI7A 4DYMA 5I3RA 4X0MA 5M07A 4QMQA 1UV5A 1PXLA 1YWRA 3W33A 1OKVA 5CAPA 1FVRA 3LFDA 4FL3A 2Z7RA 5IQBA 5DE2A 2YCSA 5CWZA 3ET7A 2X4ZA 5E8ZA 4C37A 5HD4A 1YOMA 3FE3A 2W1FA 3F69A 3GC7A 3ZM4A 4QYYA 2C6EA 1H27A 4ASZA 3A7HA 1ZYSA 4A9SA 4YZMA 3SXRA 4QMPA 3FXZA 1SZMA 4FL1A 3MA3A 4IM2A 5GZ9A 3LJ1A 1XQZA 4KIPA 3ZLWA 2HELA 4RFMA 4IWPA 2X7FA 2P33A 3VWAA 4IW0A 3OXIA 3U6JA 2EB3A 4U45A 1I09A 4LL5A 3TJDA 2W06A 5IQHA 3O8PA 4GMYA 3R9OA 1RW8A 2VWXA 3U9NA 4LUDA 2QU6A 3JXWA 3RAIA 4NK9A 4S32A 5AR2A 1OBDA 4FEXA 3L9NA 3EFLA 2X81A 3MBLA 2XZSA 4QYFA 5DHJA 2PZPA 2GU8A 2XK7A 2JITA 2OU7A 3DY7A 3VC4A 4YR8A 4FNYA 4OTRA 3P0MA 4ZSEA 3DK3A 3GXLA 3UMWA 5LVOA 3UOJA 4GUBA 1P2AA 5A9UA 3K2LA 3U54A 4RZVA 4IB3A 2XMYA 2BHEA 2RKUA 2JDOA 4JBQA 3UDBA 2XIXA 3ORMA 5LXMA 4PMSA 4QPAA 2PVFA 5AAEA 3R00A 2W9FB 2VTLA 3OZ6A 3FMJA 2X4FA 4C35A 5KMOA 4RJ6A 1H28A 3PXFA 2ZVAA 3PXQA 3OMVA 1FMKA 4ANMA 2H8HA 3UC4A 4PDYA 1JQHA 5L2WA 1IASA 2IW8A 4DEAA 4ZJJA 5I9VA 3V8TA 4LOQA 3UVRA 4TYGA 4JAJA 4V04A 3ZMMA 4CEGA 3OCBA 4IWQA 4YHFA 5BVWA 4QYGA 5CF8A 2V62A 1SMHA 4FTJA 4UZHA 2CN8A 5EHOA 4BDCA 4PTCA 3UMXA 2F7EE 1WBNA 4EL9A 1Z57A 2AUHA 4MWIA 4EOKA 2HYYA 2X6EA 3AD6A 3QX2A 3VS4A 3VW8A 4GG7A 3MJ2A 5L8JA 2QC6A 5JK3A 3QRTA 2R3FA 3KXXA 4DGOA 2UVXA 4U9AA 4OTPA 3HMIA 3F5PA 4AOJA 5CF5A 4U3ZA 5DWRA 4N57A 4NKAA 2B52A 4KINA 4JRNA 2C47A 4V01A 5CU6A 5CXHA 2Q0BA 1JOWB 4U7ZA 2RGPA 4IANA 2PZRA 3IW6A 4MXXA 3SHEA 2XNBA 4AQCA 4J8MA 3E5AA 4ZLZA 4BR3A 3WZDA 4JX3A 4RIOA 5EYDA 3FLZA 4YTCA 1B6CB 2XJ2A 5JGAA 2WOUA 2I0HA 5FTOA 4EK5A 2EXEA 3MFUA 2H9VA 3OOMA 4DEDA 3CIKA 3KMMA 3WZJA 4JRVA 4R7IA 5ANOA 2X2LA 3KK9A 3EN9A 3I5ZA 4QMLA 4JX7A 1ZMUA 4KIQA 5E8XA 4UMPA 4BCHA 4PP7A 1W84A 4UMUA 4M7IA 4FTCA 4XV1A 5FBOA 1NY3A 3AC1A 4I3ZA 2ZYBA 3TDWA 1H26A 3FY2A 1IEPA 1OKZA 3MYGA 4F09A 4FTIA 3JVSA 3VS3A 1XH7A 4GT5A 3A7FA 2PTKA 4WBBB 3DQXA 5J7BA 2Y7JA 2X7OA 3MVMA 2C5VA 3NLBA 3QZGA 3GCPA 4JL9A 5CT7A 3A99A 4RX9A 2OJJA 3ZO1A 5DT3A 5TF9A 4O1PA 3OEFX 5M56A 4K11A 5EDPA 4MVFA 3SVVA 1P14A 3ORLA 3OWJA 1H25A 1YXUA 3A62A 3F2NA 2I0YA 5L2IA 3NW7A 3LCTA 5KHXA 2QOLA 2CJMA 1J3HA 3TG1A 4CZYB 3FWQA 2BAKA 3R30A 4JDIA 3UOKA 3QYWA 2UVYA 4PMMA 2ETMA 4XUFA 1UNHA 1CKPA 2ZM3A 3V01A 4F9BA 5CVHA 5ANDA 2VNWA 4ZSJA 5M57A 3W8QA 2QHNA 3DTCA 2CN5A 2VNYA 3A2CA 2RFSA 3AD5A 3HMMA 4PMPA 4IDTA 4XRLA 4EBVA 3EJ1A 4G2FA 3NDMA 1E9HA 2WMWA 2CGVA 4G1WA 3RPYA 3O71A 4DH5A 2J6MA 4ZIMA 3LMIA 3P9JA 3IECA 4G34A 4GK2A 3DT1A 1PXIA 3EQPA 4OGRA 4EWQA 4N6YA 2ETKA 2XK8A 2A4LA 4A9YA 3ITZA 4MD8E 4WA9A 4XCUA 4YJTA 5HIDA 4FG7A 5CX9A 4DH7A 3U4WA 1U59A 4E26A 4IAYA 2YAKA 4PTEA 4G3GA 3ZBXA 5LWMA 4ORKA 5FTGA 4QTCA 5KHWA 3ROCA 4P4CA 4NH1A 3CP9A 3ZLXA 4AZEA 4IX5A 4NW5A 4RX5A 3QUEA 3W2PA 3WI6A 2QCSA 1TVOA 1OL1A 5IEYA 4E6DA 3IQ7A 2HCKA 2HXLA 3OOGA 3U4UA 4FMQA 3G9NA 2O3PA 2PVHA 4FTKA 4O7TA 2HZ4A 3EIDA 3MW1A 4IVAA 3P5KA 2UZDA 4FX3A 2WQEA 3MTLA 3DDQA 4IAIA 5EOBA 4LQMA 2CNVA 5C4KA 4GVJA 4BI1A 1Q62A 1H4LA 3CTQA 3BBTB 1M17A 1W83A 3NCGA 4NW6A 1T46A 4K18A 3RPOA 2VX3A 4AT4A 3NNWA 3R1YA 2UZLA 2JC6A 3D2KA 3MDYA 3O51A 4JNWA 4LRJA 3VUGA 4E6CA 4F7JA 2OXDA 3LXNA 3WF6A 3D15A 1XH9A 5DEWA 5J1WA 3PXRA 4ZSAA 2BDWA 4FV5A 3QUDA 1FGKA 3NUSA 5AP6A 5CANA 4FV9A 4C33A 3KKVA 2EVAA 3FLQA 3Q52A 4XS2A 5AUXA 5HE3A 3W2SA 5FQDC 3HV4A 5AM6A 4WG4A 3DQWA 3VJOA 4JIAA 4LMUA 2GNGA 1W98A 4GEOA 4ZTHA 3R7VA 5IH4A 1KWPA 2PE0A 2PMIA 3NCZA 4BIEA 1J7IA 1REKA 3QBNA 3FZRA 4MQ1A 2BALA 1I44A 3AT3A 3QALE 4ITIA 4OR5A 3PY3A 3ULZA 3JPVA 2BZHB 3LM0A 5AMNA 4ZLOA 4YJQA 3EFKA 4IACA 2DUVA 4G16A 4L68A 4CD0A 3FQEA 5JQ8A 1YW2A 3REPA 3L9LA 5CSWA 3OFMA 4TYJA 4MF0A 2B7AA 5HU9A 3GVUA 3OBGA 4W4XA 2O5KA 3WYYA 4HYHA 1WBTA 2GCDA 4ARKA 3ZLSA 4UXQA 1A06A 3TL8A 2C5XA 5J9ZA 1SM2A 2BZKB 2ZM1A 3R8LA 3H3CA 3QU0A 1K9AA 2JIIA 4L42A 4PPCA 4AGUA 2FSMX 4AZFA 4QMTA 2C4GA 5IA0A 3KULB 5IZFA 4R3PA 4ZS4A 4FIGA 4AW5A 3R21A 2OZOA 2ZMDA 4FG8A 4PL5A 2V55A 2OIBA 4N6ZA 4AZSA 1SVEA 4FZFB 4GV1A 1ZRZA 2ITNA 2H34A 2OW3A 3R71A 3R63A 5EM7A 5AWMA 1J1CA 2WFYA 3THBA 3TNWA 2JIVA 4UZDA 5BVEA 3TWJA 2QODA 5BYLA 3KXHA 2XEZA 3MTFA 3SRVA 4ANBA 4B8LA 3FQHA 2HY81 3KA0A 4UX9A 3DTWA 5AA8A 2J90A 2JDSA 3VUIA 1ZMVA 4J7BA 3SGCA 3OBJA 3DKGA 3EZRA 2C30A 2JKOA 2HZNA 5EM6A 2YM6A 3DJ6A 1ERKA 3C4FA 3ORNA 1DS5A 3NWWA 3TT0A 3MY5A 1V1KA 2PZYA 2WQMA 4NSTA 3I4BA 4FZ7A 4BWPA 5HG8A 4F65A 4NL0A 2AYPA 4IIRA 4HZSA 3A4PA 1B38A 5HEZA 4DG0E 3E7OA 2DWBA 5LVNA 4J52A 4ZTLA 4YP8A 3FMMA 5IQDA 1WBOA 4IWDA 4FC0A 3BHTA 4M15A 4XG7A 4YJRA 5EYKA 2X7GA 4FVQA 3N4VA 4XBRA 3ZZWA 5J95A 3OP5A 4QT1A 2QURA 3QQGA 4O7SA 5HTIA 3EB0A 3P1AA 4I5MA 4AX8A 1JBPE 3ZUUA 3CD3A 4IVBA 3DNEA 5FEQA 4ZMEA 4GK3A 2VTOA 2W9ZB 3EFWA 3HMOA 5HO6A 2VGPA 3MFRA 3VUKA 3VBVA 2YIQA 1VZOA 1OIRA 4BTFA 3KN5A 2OF2A 1YWVA 1PHKA 3VS5A 3LZBA 4DLIA 2JAMA 4F6UA 4XG8A 1SVGA 4EH9A 1ND4A 2XYNA 5HG5A 2YACA 1XH5A 1BLXA 2GNFA 1RDQE 4O0SA 2V0DA 1WCCA 4FTOA 3KU2A 3ZM9A 3OS3A 5BNJA 3QCYA 4NM7A 4QQ5A 3EQIA 2CGXA 3HECA 4W4WA 1QPCA 2R3LA 4JQEA 3L8PA 3TTIA 4H36A 5M44A 5HVYA 3RPRA 1FVVA 3ELJA 2BCJA 3O17A 2UW0A 2O65A 4FOCA 2ONLC 5ANKA 3RK5A 3ZBFA 4F1MA 2GQRA 4DN5A 3EQBA 5HX8A 4CT2A 4BZDA 2QOIA 5BUEA 5CTPA 3KRRA 1YHVA 1O6KA 4D1SA 2WELA 5C1QB 1BUHA 3DBFA 3GC8A 4OTDA 1U5RA 3FJQE 4X2JA 4TPTA 4ANOA 4J1RA 2BKKA 3W1FA 5AV0A 1FBNA 3QCQA 2R64A 5DRBA 3OT8A 4HGLA 2QKRA 3WF7A 4Z7HA 1PXJA 3LFFA 4BN1A 4FUYA 3RHKA 5C8NA 3VBQA 5BQ0A 3NYNA 5L2SA 2QHMA 4L53A 5JZNA 4AU8A 5K5XA 3C1XA 3Q3BA 4WRSA 3AOXA 3Q04A 4TKSA 1BYGA 4U3YA 3T3UA 4QP2A 4BTJA 3FI8A 3ORXA 4AOTA 2R3OA 2PMLX 4DT8A 4PDSA 4FL2A 3HP2A 3VBXA 3F88A 5IQCA 3VO3A 1PYXA 2JFLA 5CF6A 5F94A 4LOPA 3LIJA 5JFVA 2FYSA 4L01A 4EKLA 2WU6A 3OF0A 3W32A 1PXPA 2WNTA 4FSZA 3NR9A 4MEDA 2R9SA 4I6QA 4LV8A 3TKIA 4EZ7A 4LGGA 4O7RA 1OB3A 4GU9A 4EYJA 3M1SA 4FKLA 3S3IA 3DFCB 5FLFA 4ALUA 4BCPA 3DJ7A 4DLJA 3WZEA 4ZZOA 2UZTA 3OTUA 4EOSA 2IVUA 2XNNA 4AW1A 2GMXA 2GNJA 2PK9A 3JS2A 2JDRA 3DK7A 3PTGA 3R28A 5GHVA 4CLJA 2QOQA 2WAJA 3R7UA 3N51A 3RK9A 4CFXA 3SA0A 5D41A 1G8SA 3PY0A 2Z7SA 3M42A 3NUXA 4NJ3A 4FK6A 5LMAA 3BYOA 1OIQA 2JBOA 4YC6A 2E9OA 2WZJA 3QD4A 5HOAA 2DS1A 4AGWA 4BDIA 3DZQA 2PUNA 4KRCA 5IQGA 2CCIA 4F9AA 2F7ZE 4GRBA 3RP9A 5I3OA 1P5EA 4I0RA 4NFMA 3JUHA 3ORKA 2QO9A 5LMBA 3R1QA 4FGBA 3DBCA 3QD2B 1Q8UA 5L6PA 2VZ6A 3POOA 4FKSA 4I94A 5AP4A 4GKHA 5CSHA 3II5A 4MX9A 4RWKA 4DGGA 4U40A 4I5CA 3W55A 3NYVA 4BTKA 2YM5A 4GH2A 4A9UA 2W4KA 4LFIA 2XIYA 1IAHA 4LV5A 1E1VA 4YPDA 2VTTA 3QCXA 1GZKA 5CAVA 1UVRA 4QMSA 5I9ZA 4IEBA 4RVMA 4LRKA 3PSBA 4GU6A 4USEA 1HCLA 4D4YA 3HV5A 4UMTA 3S95A 1PMEA 4FT3A 3LQ8A 5J1VA 3HUCA 5EI6A 3HAVA 3DKFA 3NUAA 2BHHA 3BLRA 2I6LA 3R7YA 4AWIA 3RWPA 4B7TA 3DXNA 4FKWA 4G6OA 2ESMA 4IAAA 4XV9A 1URWA 2F9GA 3C0IA 5FTQA 4C3PA 4D4RA 4D2SA 3NAXA 4RJ3A 5CSPA 3BQCA 4OTGA 2GDOA 3MA6A 4FNXA 3CPCA 2RIOA 2VTMA 4WD5A 4YZDA 1OIYA 5JRSA 3M11A 4BDAA 5CALA 3A7GA 5TR6A 4ANLA 3GU6A 5EM8A 4QP3A 5JH6A 2GFSA 2I1MA 3BYSA 4O0XA 3SAYA 3UIXA 3NZ0A 4IZAA 2LGCA 3A8XA 2W1EA 5K0XA 1ZZLA 4JR7A 1UNLA 5EH0A 3HMPA 3UGCA 4H1JA 4R7HA 5H9BA 4QMWA 4A06A 4FKGA 4LUEA 2QOHA 3VS6A 4O2PA 5AAGA 4B4LA 4H05A 4EH4A 4EZ3A 1ZOEA 2WHBA 4YSJA 2P0CA 4BKZA 5JQ5A 3LFBA 1JLUE 3BIZA 3O23A 2OWBA 4QTBA 3KFAA 2XKFA 4RA4A 3W16A 5J5TA 1UU8A 3BZ3A 4L7SA 5C8MA 4APPA 4OW8A 2BRNA 1H1WA 3VF9A 4W8EA 2IW6A 4M8TA 2OH0E 5DEYA 4ERKA 3PSDA 4Q5HA 1TKIA 1Y6BA 2HOGA 5H8EA 4BZOA 2YEXA 3Q4TA 4OT6A 1TQIA 5CT0A 1LUFA 2WMRA 1UNGA 2JBPA 4H1MA 1Q99A 2VUWA 5HCYA 4FKPA 3OW3A 3ORTA 4TWCA 4UEUA 1H24A 2OJFE 3L8SA 4G6LA 2VWUA 3R8UA 3VNTA 4C3RA 3CS9A 5HCZA 1Q8ZA 1QMZA 4ZXTA 5B2LA 3BYMA 3E8EA 2ERKA 5A6OA 5HVKA 5G6VA 3IPHA 3VS2A 3QTUA 4U6RA 4WSQA 3C4EA 3U6HA 3R8PA 3F7ZA 2YFXA 3K5UA 4KIKB 3GT8A 3PLSA 3QZFA 4X21A 3HA6A 5DIAA 4C34A 5I4NA 3LM5A 3FZ1A 3PP1A 3ORIA 4FTLA 4TWNA 2O63A 4Y73A 4R78A 4AXAA 3FEGA 4I1ZA 4ONAA 4JOAA 5GIPE 4FGRA 3ALNA 3FHRA 4WO5A 4ACCA 5KCVA 3QAME 5CSVA 3VJNA 4AN9A 3ZFXA 1EH4A 3DGKA 2CMWA 3P23A 1PMUA 4TRLA 2OF4A 4WBOA 4ZEGA 1H1QA 2YN8A 3MB6A 3EKNA 5AUYA 4AZTA 5HTBA 5HD7A 3MY1A 2DQ7X 3FDNA 4C02A 3FMLA 4O27B 4ASDA 4BCJA 2ZMCA 4U43A 2REIA 3GEQA 1WZYA 3DBEA 3OC1A 4FIEA 2X9EA 2PY3A 5HNBA 4ZAUA 2R3NA 3FZPA 2WKMA 3PIZA 2WMXA 2WTVA 3Q5ZA 3TZ7A 2CLXA 3MJ1A 5CVGA 3B2TA 5IQEA 3VUMA 5CEIA 3RTPA 3MS9A 4F6SA 3BELA 4G5PA 4MBLA 4BDHA 3L8VA 4FTRA 1H00A 4O7VA 5IU2A 4OTHA 3EN6A 4FYNA 3P86A 3PRFA 3V5LA 4QOXA 3TV6A 3CQWA 4IH8A 5HIBA 3OROA 4PV0A 3VULA 2J5EA 2JDTA 2XM9A 3UIBA 4BB4A 2OLCA 4ITHA 2FGIA 2BMCA 2Z8CA 3L1SA 5C03A 2OZAA 4RG0A 3NW5A 3G0EA 4RVKA 1PYEA 4TZRA 4TYHA 3TZMA 4ALVA 5L2TA 5KZIA 5J79A 2VWYA 3NUUA 4FEQA 4FT0A 2F57A 4NIFA 4Y95A 3WIKA 4EH7A 3H9FA 5LVLA 2WTWA 3SLSA 4XG9A 4O38A 4O7YA 2WQOA 3VBWA 3KRLA 3RAWA 3GI3A 2W1ZA 1UU9A 1MQ4A 4IJPA 4CRLA 3I6UA 1JKSA 2IPXA 2FB8A 4EC9A 1F0QA 3VS0A 4FV8A 4RLLA 3HLLA 4UALA 3EYHA 3QYZA 4IQ6A 3V5JA 3GQIA 2ITWA 5KBQA 5LVPA 4RWIA 3LE6A 3LXLA 3FKLA 4TW9A 4DHFA 4X3FA 2XNOA 4CCUA 3UPZA 4AW0A 4EUTA 1MRYA 1BKXA 4RQVA 3UOHA 3ZDIA 4L6QA 5AEPA 3S0OA 1UU3A 5TOZA 2GTMA 3F9NA 3H0YA 5HNIX 5M51A 3PWYA 3Q53A 4TWOA 3UJGA 4AGDA 2J0IA 4XG3A 2PVJA 4YZNA 5H8GA 1GZNA 4KBAA 1YHWA 5EHLA 1YQJA 3DA6A 3O7LD 3WZUA 4BKYA 4Q9SA 3EMGA 3LHJA 4C2WA 3B8QA 4C4GA 3VF8A 4PQNA 1M52A 3ALOA 2VTIA 4QMXA 2UUEA 3HP5A 4KB8A 4EJ7A 4I0TA 4FUXA 5KMKA 4XV3A 4C4HA 4UYNA 4G5JA 4I4EA 4CFMA 2RFEA 4YHTA 3NUNA 4RBLA 1R0PA 4CFWA 1QPDA 3WF5A 2LAVA 1U46A 3RM6A 4EORA 4XHKB 2ITXA 4KBCA 3Q32A 4L7FA 5D11A 4A4LA 4CTBA 3A61A 3TUCA 5L8LA 3I60A 1KE9A 3UNZA 1ZY4A 4YJUA 2VN9A 2W99B 4D2VA 2RG6A 5D9HA 4Q2AA 4IB1A 3CGOA 3Q4UA 4RJ4A 3UYTA 2Z7QA 4HGEA 5AP2A 3GQLA 4HPUE 2YAAA 4G9CA 4WG5A 2C5NA 4WRGA 2BDJA 4TY1A 4KWPA 2VAGA 3ODZX 3RMFA 2B9HA 2OBJA 2I7QA 3AMAA 3D94A 3TNQB 2GSFA 3PE2A 5FEDA 5H2UA 4HGSA 4ID7A 1YXSA 3R7IA 3HL7A 3LQ5A 3JY0A 2F2CB 2XRUA 3MVLA 2YWVA 2PMOX 5IISA 2WIPA 4O0TA 5IA4A 5CEOA 4O7LA 5GZ8A 3PYYA 4H58A 4AT3A 2W7XA 5FBNC 4D55A 4RJ7A 4CQEA 2WTIA 1J91A 2XP2A 4ZTNA 4CFUA 5A4LA 4O7WA 4MNEB 3NVKI 4RVTA 3QRUA 3H4JA 5DN3A 3IW4A 1PXMA 2ZOQA 2UV2A 4DTKA 4F9CA 1YI6A 2YZAA 5AUVA 3PUPA 4ZLYA 4DINA 2EB2A 3ETAA 3OW4A 4FT5A 2GS7A 3BLQA 3E93A 3F6XA 4LRMA 3OTVA 4IWOA 5AR3A 3ZRLA 2NRYA 3DJ5A 3Q9WA 3QXPA 3NYXA 4FKRA 2QOKA 4H39A 4M97A 4D4SA 1CDKA 3U55A 3OWLA 3L8XA 1DM2A 3D7TB 2OICA 4C59A 2QOBA 1PXNA 2OG8A 2AC5A 2VTPA 2IZRA 1OUYA 4HPTE 3PWDA 4CYJA 5KMIA 5I5ZA 3KREA 2W1IA 5EG3A 2R3JA 3OY1A 5DNRA 3ZYAA 4BDBA 5ICPA 1F5QA 4NEUA 3EQRA 3K3IA 3RHXA 4EOIA 4DFUA 3QC4A 4BHZA 4BDJA 3F3ZA 3R1NA 2YCFA 3BGZA 3FUPA 1ZZ2A 4LG4A 2BAJA 4XG4A 1VJYA 3DK6A 1XKKA 2XM8A 4FV6A 2QLQA 5EHYA 3TIZA 3W18A 4EH8A 4FSNA 5A54A 4QD6A 1M7NA 4KA3A 1WVXA 4XMOA 4DGNA 2PUUA 5ANJA 1PJKA 1Q97A 2XKEA 3F66A 5AAFA 4L43A 3C4WA 2BPMA 2OGVA 4ACHA 2CGUA 4O7NA 3PDTA 3COIA 4X7QA 2WMAA 5A4CA 5DPVA 5ANGA 3OD6X 3E87A 4W8DA 4G3FA 3BV2A 4QNAA 3UC3A 3GU7A 5IMXA 2EXCX 1KE8A 4FG9A 3G51A 3BGQA 2VWBA 3QL8A 5AM7A 3QGYA 2B9IA 4R77A 3FMDA 3SRVB 1YDRE 4J95A 4QMUA 4RIWA 4G17A 3PVWA 5CU4A 4UWCA 5AV3A 1WBPA 2IVTA 2ZB1A 5IQFA 4Y83A 3IDCA 3ZRMA 1JNKA 3AXWA 3GC0A 3HZTA 5AUZA 3ACKA 4PDOA 4ZK5A 3ZEWA 4EC8A 5FP5A 4C57A 5KZ0A 5K9IA 2FSTX 1ZAOA 4PWNA 4GSBA 4TYIA 2YJSA 4H3PA 2E9VA 5F4NA 5AUWA 1E1XA 3EN4A 3R9HA 3RNIA 5IA1A 2ZV8A 4HNIA 2XVDA 3PJ8A 1L3RE 1SVHA 1XBBA 1YWNA 4XG6A 2NNWB 2XK3A 1OL5A 3IO7A 3NW6A 4FYOA 5DR2A 3UNJA 5AADA 3KXNA 4ZJIA 5IG1A 3ZO2A 4BGGA 3MH2A 3V6RA 4AA0A 2BDFA 4QPMA 1PW2A 4FSQA 3SD0A 2WMBA 3Q2MA 4RWLA 5CYIA 2OJIA 5B2KA 4YO6A 4EQCA 2XYUA 3LFQA 1WBSA 1WVWA 2C6DA 2WD1A 2WB8A 5K5NA 2XBJA 5ETIA 5M4FA 4K1BA 3CXWA 4FKTA 5AX3A 5M06A 3BWJA 3G9LX 3C0GA 4JIKA 1UWJA 4DEEA 2G9XA 4PPBA 4HVSA 3F82A 1WFCA 4KD1A 3NRMA 3ZHPC 4ANQA 2PULA 3FV8A 3OEZA 3KCFA 3V51A 4CFVA 2PE2A 5T6KA 2BILB 4BCNA 2C6MA 3GB2A 4BGQA 3V6SA 5LVMA 4R1YA 2XF0A 5B2MA 2C3JA 4P90A 4D1XA 5KKRB 1FQ1B 5ETCA 1H1PA 3OXTA 4FV3A 4ASXA 4YU2A 1FINA 1RQQA 3ZDUA 2UW7A 4O7ZA 1KV1A 5FWKK 1OPJA 4FV1A 3VRZA 3EQHA 5CZHA 4ACGA 4UY9A 3NMUF 3QWKA 1JKTA 3PG3A 2HY0A 2BAQA 2F2UA 2IVVA 5C9CA 4YBKA 5HX6A 5JFXA 3N4TA 4QMZA 5IH5A 2WXVA 3MH3A 3MWUA 3OCSA 3TDVA 4EK6A 3C4CA 2PSQA 4UN0C 1ZYLA 3VUHA 2Y0AA 5BVOA 4QPSA 3FHIA 2GQSA 2BFXA 4PUZA 5BMMA 3AGLA 3IGOA 2QO2A 4KIOA 4PMTA 4WNPA 4DE4A 1V0BA 3PA5A 3QX4A 4IBMA 1M2RA 4BDGA 3NNXA 3PFQA 3KRXA 4BDEA 5GINE 3IW7A 3MIAA 1YOLA 5E8SA 4F6WA 5JT2A 1G5SA 4PY1A 5I9UA 4XYFA 4AGCA 1UWHA 5EFQA 2XIRA 3TIYA 4XNEA 1YRPA 1SNUA 4V0GA 5FRIA 3JR1A 5DT0A 3BQRA 2G2IA 2C6IA 3CJFA 3KRJA 3MVHA 2QKWB 1R39A 3D5XA 5DT4A 3PVGA 3TXOA 4J8NA 2Z60A 5JGDA 3PJ2A 3F5GA 3AC2A 2PZ5A 3SQQA 4F63A 3OUKA 3UO6A 4DEIA 2YABA 3ZZEA 3FY0A 2BRGA 2YCRA 4USDA 3RGFA 4MXAA 2W4OA 3HNGA 3K54A 2XIZA 5TKDA 5CU0A 4DT9A 2FH9A 5A4QA 5EQEA 2DYLA 1Q3WA 5E8UA 4BL1A 3UO5A 4J99A 3UYSA 4EKKA 4EH3A 3VIDA 4YJSA 4BGHA 4AS0A 3AT4A 4GIIA 3WYXA 5KBRA 4M69A 2XK4A 3ID6C 2W4JA 5GZAA 4Y8DA 1BL6A 2BZJA 3QTZA 4I92A 3BYUA 4I24A 4NCTA 4RQKA 4QP8A 4ASEA 3EFJA 4QNYA 2PZIA 3FSKA 3ANRA 3BBWA 4U97A 4C4EA 4RC4A 3I1AA 4AAAA 2XNEA 4O21A 5CNNA 3O0GA 1Z5MA 3WBLA 4P2KA 3QQJA 4GVAA 2UZEA 4EBWA 4CZTA 3RCDA 4WNKA 3I6WA 3WOWA 3T9TA 3LW0A 4JVGA 1ZWSA 4L46A 2G01A 4K6ZA 4NTSA 4YBJA 4D0XA 2XK6A 4O6EA 1O6LA 4DH8A 5CEPA 5IUHA 3CD8A 5BUIA 1UU7A 2VRXA 4AF3A 4FICA 2PVLA 3BHUA 3BYVA 3FI2A 3HEGA 4U5JA 4II5A 2R3IA 3GCQA 2VTHA 4A4XA 4WHZA 5C01A 4CMOA 4YTIA 4AACA 2XB7A 2X2KA 4MD9E 4CGAA 2IZUA 3E7VA 5FUTA 2OSCA 4F99A 2J51A 1KE6A 2W5AA 3FZOA 2R3KA 2VO3A 2VO7A 3HRFA 3QF9A 3CCNA 3R2YA 3L9MA 2PVYA 2WMSA 4KKHA 5DR6A 2R0IA 2C3KA 3LPBA 4FTUA 4HVHA 2WEIA 2XRWA 2A19B 5HE2A 3V8SA 4U80A 5JN2A 4Y72A 4EK4A 3TUDA 2YIWA 1XWSA 5EW3A 5CAOA 5DVRA 1DAYA 3UNKA 1LEZA 1UA2A 4Z55A 4IB5A 3NSZA 3W2RA 4CTCA 4FZDB 1WMKA 4BHNA 2HW7A 4D2TA 4E5BA 4E4LA 3IONA 2W17A 1Q4LA 2F49A 1W82A 4KAOA 3A4OX 3RVGA 5AUUA 4YSMA 3TI1A 4FTMA 4CT1A 3SG9A 1ZYJA 4X3JA 1NXKA 3W10A 5HLNA 3IOKA 5B7VA 4X6QC 3DDPA 4QP6A 4C7TA 3LCSA 4IVDA 2EXMA 4TT7A 4D9UA 4EJNA 3MB7A 5KKRC 5BUJA 1QCFA 3RBWA 3LVPA 4FZ6A 3JVRA 1V0PA 4HCVA 4CNHA 1HOWA 1GY3A 2V22A 2C69A 2R0UA 3DCVA 3FMKA 2G1TA 5FD2A 2NP8A 4YLJA 5E91A 4L8MA 5IH6A 4GIHA 1Q41A 4LMNA 4JS8A 4I21A 3AMBA 4DGLC 5J9YA 2IJMA 4ZSLA 4FOBA 3ZO3A 3EN7A 4GFOA 3UP2A 1WBWA 2ITYA 4MAOA 1BL7A 1DAWA 3PA3A 2UZOA 2UW8A 3QZIA 4L3PA 3SC1A 4JBVA 4BF2A 3A60A 2KTYA 2CNQA 3CQUA 3QQLA 4Z3VA 4HCUA 1SNXA 3TKHA 3UVQA 5CF4A 4MWHA 2YIYA 4DGMA 4E93A 3OWKA 4EOMA 4UMRA 5DI1A 3CSVA 4NFNA 4NUSA 3POZA 3D5VA 4CG9A 2BRMA 3CY3A 4R3RA 5IEVA 3EN5A 2GHGA 5E4HA 3EOCA 2Y6MA 4CSVA 2X6DA 4A07A 3T3VA 2CSNA 1YVJA 3F3TA 3PP0A 4HYSA 2GFCA 2F7XE 3EQGA 3PVBA 3LKMA 3PG1A 1ZMWA 3G15A 3MH1A 3AT2A 4DFNA 4IAKA 3IOPA 1R3CA 4P5QA 1G3NA 4FSWA 4RIXB 3DXPA 5J8IA 4RWJA 2PVNA 3HRCA 4FKIA 4RFYA 4DA5A 3V8WA 1V0OA 3BU3A 3F5UA 4TNBA 4K77A 4RT7A 2UW9A 4EQMA 3KF7A 4HGTA 4E7WA 1GJOA 2C1AA 2WOTA 4NWMA 5CNOA 5IMEA 5JFWA 3CKXA 4CG8A 4GFGA 4USFA 2UZNA 2W5HA 2CNUA 4DBXA 2C3LA 3NS9A 3AC5A 2B9JA 4YPSA 1CKIA 2YIXA 3G5DA 2WU7A 2ZV7A 1YDSE 4QP1A 2HWOA 2VU3A 4MXCA 1KV2A 2WIHA 3TZ8A 2UZVA 2YISA 3TZ9A 3Q2JA 3AC4A 4MTAA 1IRKA 2QVSE 3IG7A 4UWBA 5F9EA 5L4QA 4Z9LA 5HLWA 2BKZA 3VBTA 3R22A 1PMVA 3OWPA 3QQHA 3QWJA 4RZWA 4CMUA 3RI1A 3R83A 4IZYA 3KXGA 3CKWA 3PE1A 5EDQA 5CQWA 5TO8A 3VBYA 4ZTMA 2WO6A 4QP9A 5HBEA 4I6HA 4U81A 4O82A 4KRDA 2P4IA 4PF4A 3E3PA 1AQ1A 1URCA 2XNPA 2GNHA 4FV0A 4MXYA 3KMWA 2YWPA 3PIYA 5CEQA 3FZTA 3DB8A 4OLIA 4CCBA 3CY2A 4O1OA 4UBAA 4AZWA 4NJDA 4DG3E 5AJQA 1U54A 2HAKA 2OZAB 4FIFA 4PRJA 4D28A 2VTSA 3BU5A 5AP1A 4PL4A 3DS6A 1S9JA 4QP4A 2YLFA 4JDHA 1XR1A 3KL8A 3ZTXA 3MIYA 3VQHA 3COHA 3PJCA 5ANEA 2XUUA 2BTRA 3FI4A 2BROA 1PXKA 2GHMA 5HZNA 4K0YA 4AA4A 5CVFA 4W9WA 4C4FA 1VEBA 3Q6WA 5ACBC 4W9XA 3MFSA 3ZXZA 2O2UA 3ERKA 4ZJVA 2YIRA 2BRHA 4OT5A 1S9IA 4YZ9A 4H3QA 5FM3A 3W2CA 1OBGA 3EHAA 4CLIA 3ZSIA 5HESA 2HIWA 5E1EA 3LFAA 1XH4A 4CRSA 5ITAA 5E8TA 3Q96A 1GIHA 4DAWA 1Y8YA 3FYKX 5HVJA 3RPSA 2UZUE 3P4KA 5L2QA 5AP7A 1OKYA 3OCGA 3A8WA 1Y91A 4U42A 1GZOA 2BIKB 2P2IA 1VR2A 3TTJA 3SW4A 4E4XA 4DH1A 3U87A 3HKOA 4O86A 3UE4A 1H1RA 4KSPA 3D9VA 3PVUA 4GJ3A 4JG8A 1M2PA 2EU9A 2H6DA 5AR8A 2BVAA 5DRDA 3TV7A 3WE8A 5FP6A 1XH6A 2VTRA 5B0XA 3FYJX 4XJ0A 4QO9A 5DLSA 3UO4A 1ZY5A 3U6IA 4YTHA 3BHVA 2Z2WA 3FZSA 4F70A 5BMSA 3IDBA 3EWHA 4BCQA 3FC2A 4G3DA 1PF8A 1Q8YA 4N70A 3MI9A 4WKQA 3QXOA 4IM0A 4RIYA 5L6OA 2ITOA 4MK0A 1J7UA 4A7CA 2R2PA 3OT3A 5DA3A 2VO0A 3NPCA 5FGKA 4J96A 4E8AA 4G31A 1OECA 4NYEA 4NM5A 4JDKA 4I5HA 2ITQA 3BWFA 4AFJA 4XEYA 2I0VA 4KNBA 3R8VA 3QUPA 4FNZA 4FSYA 3E88A 2XNGA 3G6GA 4Y85A 4ENXA 4MD7E 2BTSA 4E73A 2C0TA 2B53A 4RA5A 4BYIA 5M08A 4IX6A 2GS6A 4J53A 3VS7A 2JKKA 3CR0A 4RX7A 4XOYA 3Q9YA 4KABA 1YI3A 4EWHA 4EH5A 5JEBA 4MHAA 3VW6A 4ACMA 2XEYA 3CGFA 4BCOA 5L8KA 3KB7A 2C5OA 5KMJA 2HZ0A 4NKSA 4F64A 2OFVA 3Q9XA 4PDPA 5ETFA 5JFSA 4M14A 1GIIA 4YC3A 3CTJA 4GS6A 3MPTA 3SOAA 4AUAA 4BY9E 3ZO4A 4NTTA 4BIDA 1LR4A 3R2BA 2QO7A 4OBOA 4BRXA 1OMWA 5JZJA 3F5XA 3HV3A 4XLIA 4JDJA 3ZONA 4GKIA 5LMKA 2BFYA 2A1AB 4IFCA 3KXZA 2YM8A 2PYWA 2ITZA 1KE7A 3LXPA 4QMVA 5DGZA 2EWAA 4RFZA 4D5KA 1AGWA 3E92A 4DFBA 3QD3A 3GGFA 2QR8A 2R3QA 1JAMA 2W5BA 4GT3A 4FEUA 5D7VA 3D4QA 2IZTA 3AD4A 3NYOA 2FUMA 5LARA 3VRYA 1J7LA 4MBIA 4DCAA 2FSLX 3AC3A 1KOAA 3P79A 1P4OA 2KULA 4QP7A 3VAPA 2XJ0A 2YJRA 4LI5A 5DBXA 4C3FA 4AOIA 4EHVA 4MNFA 4C38A 5AA9A 4M68A 3UP7A 4R7BA 2G15A 3G6HA 1XHAA 4XLVA 5CEMA 4QQCA 4F1TA 4DF3A 3RPVA 1GZ8A 3NEWA 3ZEPA 3CC6A 2X39A 3RCJA 4CMTA 1CTPE 3I79A 3G0FA 3BE9A 2W1HA 3DBDA 3W2QA 2QOFA 3QZHA 3Q9ZA 3ZLYA 3BX5A 4B0GA 3S1HA 4RPVA 5AIRA 5LCKA 4RVLA 4AP7A 3BV3A 4IADA 2ZV2A 5EW8A 4BWKA 2XJ1A 4MH7A 4W4YA 4F4PA 4MKCA 2Y8OA 4D2PA 1T45A 3MESA 3AMYA 1OKWA 2OKRA 3EYGA 5IA3A 2O0UA 3SKCA 4X2NA 2VWVA 3UG1A 4EH6A 1A9UA 2ITUA 3GFWA 4R1VA 4S30A 3IW5A 3U8WA 2R5TA 5D1JA 2CDZA 3UTOA 1QPJA 2X2MA 4RIWB 2GHLA 3NIZA 2XCHA 1GIJA 5IEXA 3FMNA 3WARA 1FPUA 3QCSA 2R7IA 5ANIA 5HI2A 2BZIB 5HU3A 3LJ0A 1IG1A 5J9LA 1YHSA 2J7TA 3D2IA 4EI4A 1NT2A 4BDKA 3E62A 2JEDA 3OUNB 3D0EA 3KMUA 4AT5A 2JKQA 3AC8A 3GC9A 3M2WA 1FMOE 4FTNA 3V04A 4D58A 3ZFYA 3UIMA 3D83A 3V5WA 3ZU7A 5AV4A 5HKMA 4OAVB 4TYEA 4BIBA 3KK8A 5CY3A 4BC6A 5AUTA 2FO0A 2OO8X 1OPLA 3UG2A 4HNFA 2ERZE 3T8OA 2XKCA 3NIEA 4HZRA 5HE0A 3TM0A 3KVWA 4CQGA 5CQUA 4GW8A 4IAFA 1WAKA 3B8RA 4FKVA 4M67A 4E1ZA 5K4IA 5KNJA 1H8FA 3NNUA 3C9WA 3DLSA 2JDVA 3KRWA 4FODA 4P7EA 3GCUA 3FC1X 3SXSA 3E8NA 3MGYA 4IXPA 1J1BA 4L44A 3VQUA 1QPEA 1ZOHA 1Y8GA 3OXZA 4LYNA 4Y5HA 3FXWA 3RAKA 3QA8A 1GOLA 4BDDA 1NVQA 3ZC6A 3EH9A 1H01A 1RJBA 2W1DA 1XBCA 1JPAA 4M0YA 3UVPA 2P2HA 2WTCA 3QTSA 2X8DA 2XCKA 3F61A 1O9UA 5CU2A 1B39A 3QLFA 3A7JA 5H8BA 2RG5A 4AFEA 3V5QA 4E5AX 3IDPA 3D5UA 3R04A 4D0WA 3HX4A 2AC3A 4BBMA 5EDRA 5A46A 1BI7A 2P3GX 2X1NA 3LLTA 4PL3A 4EK3A 2HK5A 1CSNA 2J5FA 2PVMA 1XBAA 3LAUA 1W7HA 2XK9A 4QYEA 4EZ5A 3FKNA 3AQVA 3LXKA 2ZAZA 3QTWA 4UMQA 4LM5A 2Z02A 2WEVA 3LQ3A 3N4UA 4BCMA 2IVSA 1MQBA 4S2ZA 4F0FA 1PRYA 2QOOA 2YCQA 2YM4A 3FMEA 5EI2A 5KMMA 4ANNA 2O64A 1YXXA 5KMLA 1OI9A 4CV9A 3KY2A 2VTAA 4IX3A 5HGIA 3HDMA 4EHEA 3TCPA 3UPXA 1X8BA 3GU5A 4WG3A 4QYHA 1OM1A 3W2OA 2J2IB 4IHPA 2Q83A 5FDPA 2ITPA 4CXAA 4O83A 4DCEA 3OHTA 5M4UA 3HV7A 3R7OA 2XIKA 2Y9QA 4I4FA 2VTNA 4LGDA 4OTIA 4BBFA 5AV1A 2WPAA 3ORPA 5CU3A 2C0OA 4YZBA 1YXVA 2VTJA 4WUAA 4ZOGA 4V0GB 2Z7LA 4FE2A 2PE1A 5IPJA 2QG5A 3SXFA 4APCA 2R3HA 3KGAA 4AE9A 4KIKA 5GJFA 4FIHA 3TNPC 3TN8A 4DFLA 5HBJA 3QLGA 4ZP5A 2B9FA 3HVCA 5CSXA 2C0IA 1Q61A 3VS1A 1YKRA 2QONA 4RC2A 3ZRKA 4FV7A 1ZYCA 4KS7A 4UB7A 4M13A 5L6WL 2RFNA 1M7QA 2FVDA 3R1SA 4HCTA 4O0VA 5EW9A 4F0IA 3U9CA 4RMZA 3LOKA 2FA2A 2GPHA 1G8AA 5KUPA 5HTCA 4IZ5A 5IUGA 5CI6A 1OUKA 5CS6A 3ANQA 4WOVA 4M69B 3ZS5A 5C27A 5BVNA 5GNKA 4ZS0A 3VUTA 4FA2A 5K4JA 1W8CA 1RE8A 4AE6A 2OFUA 3EL8A 4C36A 2ZJWA 2J4ZA 5GIOE 5A3XA 2GNIA 4YJOA 5C26A 3RWQA 2B1PA 3VUDA 3U51A 2NO3A 3R0TA 4E6QA 4K33A 3ZSHA 3KC3A 5A14A 4RJ8A 3FSFA 3QTQA 4O22A 5FEEA 3P08A 2RL5A 4M12A 4C58A 4BKJA 4FTTA 4RRVA 4O91A 3W8LA 5HO8A 5EQYA 5K3YA 5FG8A 3VHKA 3TKUA 4UWYA 5EM5A 5IKWA 4DEBA 5DH3A 1O6YA 4S33A 3HV6A 3RK7A 3PSCA 3DPKA 4TWPA 2A27A 3ZUVA 3KXMA 5M55A 4E20A 4BCGA 3DAEA 4F1OA 4Z16A 4U8ZA 4DTBA 2B54A 5AP3A 3FBVA 4Y46A 2JGZA 1ZARA 3GCSA 2HZIA 4L3JA 5JSMA 3ZH8A 3HRBA 4F9YA 3O7LB 3C4XA 4FIJA 4X2FA 3V3VA 3TNHA 4O0RA 4C8BA 4IZ7A 4IAZA 1HCKA 1ZLTA 2XNMA 5E7RA 1GNGA 2EUFB 4RLKA 2YHVA
chains in the Genus database with same CATH superfamily
5BYZA 3FL5A 1M14A 3PXKA 2BUJA 4YGAA 3I5NA 4FEVA 2BIYA 5BVKA 1KE5A 2X8EA 3I7BA 2J9MA 4XG2A 4KSQA 5IF1A 3K3JA 3FLYA 3QFVA 4M84A 3UODA 3E8CA 3EQCA 3VN9A 2C6KA 3MSSA 3F7WA 4LGHA 3D7ZA 4O84A 3Q4CA 4O6LA 3JYAA 5HE1A 4FR4A 4HYIA 3Q5IA 5E8WA 4YJNA 2IO6A 2UW3A 2C1BA 3BEGA 4MXZA 4DG2E 4BCKA 3W0MA 4QQTA 3ZSGA 2VD5A 1LEWA 4C4IA 1OL6A 4F78A 2VWWA 1OIUA 4FTAA 4FV4A 4I0SA 4WNOA 2RSVA 2WQBA 1IA8A 3QHRA 4BCFA 3DXQA 5BVFA 1W0XC 3NAYA 2E2BA 4ZTRA 4DEGA 3DLZA 2W0JA 4EONA 3HDNA 3V5TA 5BPYA 4NZWB 5TE0A 3WILA 2B0QA 2V7AA 4O0UA 1JSVA 4L9IA 4BZNA 2VX0A 4GFMA 2QD9A 1K2PA 5HO7A 4XP3A 3C5IA 2R7BA 4YHJA 3QRKA 4IFGA 5JMSA 4S31A 1NVRA 4TTHB 2HXQA 4RGJA 4P5ZA 1PXOA 4I93A 3G90X 4MQ2A 2ETRA 5HIEA 4E3CA 2W96B 5DG5A 2XA4A 4JR3A 4EOQA 2R4BA 3H0ZA 3GOKA 4R6VA 3HYHA 4ZY4A 2VV9A 4C0TA 4K2RA 1Q8WA 3CPBA 5KMNA 4MCVA 4F7SA 3EQDA 1OGUA 2OI4X 1MP8A 1CM8A 2W05A 4L00A 4NM3A 4BFMA 4D9TA 3MN3A 5IA5A 4WSYA 3MVJA 3PPJA 4HVGA 1XO2B 4NM0A 4XV2A 5EQPA 5HCXA 4MF1A 2J0JA 4LOOA 4ERWA 3UZPA 2UW6A 3BHYA 1VYZA 2PWLA 4MNEA 2NYAA 3P7CA 2JFMA 4WUNA 2CHLA 1OL7A 4EOOA 2CPKE 2R3PA 2IZSA 2RF9A 3C7QA 3PXZA 2ZM4A 2VWZA 3WE4A 3LFNA 4KBKA 4AZVA 3F3UA 3MFTA 1CKJA 3HMNA 4E6AA 4Y5QA 2H96A 3ODYX 4PNKA 2JIUA 3PPKA 3R6XA 3UQFA 5DMZA 3KCKA 5H3QA 3ATSA 3LMHA 2WQNA 3DNDA 5EKOA 2R3GA 3QQFA 4CKIA 5JKGA 3ATTA 1JKKA 4G3EA 5EOLA 4I6BA 1LPUA 4KUJA 4BBEA 3FXXA 5LWNA 2PU8A 3CTHA 4O4DA 2C68A 3D7TA 3FLWA 3FQSA 2YA9A 4FZAB 4NCTC 3RZFA 5HORA 1Q8TA 3QD0A 2PL0A 3QTXA 5JRQA 4IVCA 2ZB0A 3R9DA 5GJDA 1L8TA 2J50A 3TNIA 3B2WA 4GCJA 4CKRA 4B9DA 4AXEA 3OY3A 2VGOA 5I9YA 1QL6A 1R1WA 2A0CX 2CLQA 2GNLA 3NNVA 3IGGA 5DR9A 3F3WA 5GJGA 1STCE 4WIHA 4HVDA 4E5WA 3AG9A 4IMYA 3UQCA 4QDVA 3UBDA 4ZMFA 2NPQA 3CEKA 4O4EA 5LCJA 4TL0A 1U54B 3GENA 5DYJA 1FVTA 2I0EA 4YNOA 3HAMA 2G2FA 3SV0A 3QGWA 2C3IB 4FV2A 2ZV9A 4DC2A 1PY5A 4ZZMA 3O8UA 2WGJA 4CFFA 1WBVA 2PHKA 3O96A 4FIIA 4HJOA 2E9UA 4I20A 4WT6A 3KVXA 3F2RA 4JG7A 3QTIA 4F7NA 5DOSA 3IW8A 4N0SA 1IAJA 3PPZA 5F1ZA 3CJGA 4JQ7A 3KF4A 5CENA 3T9IA 4BDFA 4MYGA 1APME 1H0VA 1YOJA 3I0OA 1ZXEA 2YDIA 4QMOA 5EYCA 3ZXTA 2C5YA 1OL2A 4GUEA 3MH0A 4L52A 3GFEA 4G9RA 3HGKA 4YC8A 2CKOA 2JKMA 4O0YA 3PZHA 5AIKA 1NW1A 5FXSA 4BYJA 2HW6A 1JSTA 5KO1A 2V5QA 3QKKA 1IA9A 5AFVA 5I9WA 3H10A 4OTWA 1H1SA 2OJ9A 4DH3A 3BEAA 4B99A 5EYMA 3IKAA 2OK1A 5C8KA 4FT9A 1IR3A 2RFDA 5D10A 3BL9A 5AR4A 3QRJA 5IQIA 4QDEA 3PJ1A 4RIYB 4A9RA 3FPMA 2QOCA 3E8DA 5M53A 2GTNA 3BLAA 4PNIA 5C4LA 3LCDA 4ITJA 2P55A 4M66A 2OIQA 3FKOA 1CMKE 4CZUA 5I0BA 4JI9A 4YURA 4DDIA 3KQ7A 3VVHA 1W2DA 2UW4A 3P7BA 3E3BX 5J87A 5CXZA 3IK3A 4F08A 4O81A 3ULIA 4CFNA 5KX8A 5E9EA 4A4OA 4QMMA 4YJPA 2E9NA 2X0OA 2WMVA 3C51A 3Q6UA 3EL7A 3OVVA 2CKQA 4N4SA 5E92A 3L9PA 5AX9A 2VTQA 5KE0A 4YMJA 5BYYA 1BMKA 1PKGA 3R9NA 3RKBA 3SOCA 4F9WA 1JWHA 1XJDA 3R8ZA 5ETAA 2B4SB 4JG6A 3FLNC 3QHWA 4RSSA 2IG7A 2QR7A 2ITTA 3RM7A 4ACDA 4QQJA 4K9YA 2ZDUA 3RJCA 3D5WA 4OAUC 5M09A 3G2FA 1Q24A 4FBXA 1R78A 2ONLA 2XKDA 4ZTSA 3DB6A 4DFXE 4R5YA 3WZKA 3UZRA 3WF9A 3FLSA 4TN6A 3EKKA 3R7GA 3CQEA 2YM7A 4MBJA 5CLPA 1KUTA 1WVYA 3P7AA 3RZBA 1OZ1A 4XP2A 2W1CA 3LMGA 4G3CA 1H08A 2WTKB 5IDNA 1Q5KA 4JQ8A 4YTFA 1NA7A 3BGPA 5LQFA 3K5VA 2WTDA 3NUYA 3LFCA 2XS0A 4JT3A 2WMUA 3ZFMA 2QNJA 2YZLA 3TYKA 5K0KA 1R0EA 3AGMA 3NGAA 2YM3A 2JAVA 3FL4A 5J7HA 1XH8A 4PX6A 4L3LA 4YUQA 2VX1A 2J0KA 2W1GA 4BVUA 3LFEA 5IA2A 4M0ZA 3F3VA 4J71A 1GAGA 3DKCA 4EQUA 4FKQA 4IDVA 4TNDA 4ALWA 2QLUA 4DHIB 4JBOA 4R8QA 3GP0A 4IE9A 2UZBA 3DBQA 4GYGA 4JMQA 3PLAE 2XH5A 3CLYA 3FI3A 2C6LA 5EI8A 4BI0A 5FDXA 2SRCA 4GYIA 4FEWA 1PKDA 4D1ZA 3TUBA 2G2HA 4YJVA 3DZOA 4O0WA 3ENHA 5AP0A 3LCOA 5FM2A 3G33A 3UZTA 3LJ2A 3R8MA 4A9TA 4EOJA 3BE2A 5LOHA 4I22A 5T68A 3H9RA 3R01A 4L45A 3EQFA 3ACJA 5AP5A 1JSUA 2X9FA 4GK4A 4R5SA 3LFSA 3R7EA 4AQKA 4QTEA 3HA8A 4YNEA 1P4FA 1YXTA 2OJGA 2E9PA 4Z7GA 2I40A 3KULA 3UIUA 3O50A 4FKJA 4QRCA 4RX8A 5I9XA 1Y57A 3TACA 1OITA 4IC8A 4TYHB 2WMTA 1FGIA 2PMNX 4H3BA 4JBPA 1TQMA 4NIFB 3SW7A 4JJRA 4O4BB 5HLPA 1OVEA 1KOBA 1U5QA 2F4JA 4M3QA 3NVMB 3BHHA 4AG8A 5L3AA 1FOTA 2FSOX 3SDJA 4IM3A 4QEBA 3BRBA 2J0LA 4PP9A 4QMYA 1ZYDA 3GU8A 5LJJA 3FPQA 4EOLA 3GU4A 4B8MA 3C0HA 5E8VA 2PUPA 4FK3A 4OBPA 2O8YA 4RC3A 5M4CA 5AV2A 1BX6A 4D2WA 4L67A 4LDTA 2YDJA 3PIXA 4X3FB 1K3AA 3W0OA 4U0IA 3BU6A 3JY9A 3C4ZA 3PXYA 1NVSA 5IQAA 3OG7A 4DEHA 4GL9A 3O8TA 3LLAA 3TEIA 4MXOA 2Y4IB 2Q0NA 4KKGA 3RALA 3RAHA 1H07A 4B6LA 4EEVA 4E4MA 4FTQA 4S34A 3TV4A 3PZEA 4BJJB 1UKHA 4HYUA 2VWIA 4JAIA 3MV5A 4XOZA 4I41A 4XP0A 4FSMA 4FVRA 4JXFA 4ZY5A 4FSTA 2GQGA 3R73A 3ZCLA 1YI4A 4J97A 5EK7A 3KN6A 4OBQA 3ROYA 5IDPA 3UQGA 2X8IA 3QKLA 3WIGA 1SYKA 3QA0A 3PY1A 1AD5A 3BPRA 4ZSGA 2PVRA 3BLHA 2PVKA 3Q4ZA 4D2RA 2PUIA 2YDKA 3SG8A 2V7OA 4EUUA 5HBHA 3GBZA 3H9OA 4YZCA 5CZIA 3RINA 4EHZA 3H30A 3DOGA 3O2MA 3UOLA 4HVIA 5A4EA 5CAQA 2R3RA 4IJ9A 5BVDA 3RNYA 5E90A 5IUIA 3QQKA 4LL0A 5D12A 4C2VA 2QQ7A 5FXRA 2OXXA 2OH4A 3PJ3A 4D4VA 4FF8A 4W4VA 2X0GA 2C6TA 5E8YA 4FT7A 4OTQA 4UXLA 3WF8A 3I7CA 3PRIA 3GNIB 3NX8A 4KKEA 2IW9A 5F20A 4QMNA 3COKA 4OTFA 2JD5A 2OXYA 4FI1A 2CKEA 4EYMA 2CKPA 3ZC5A 4BICA 3SX9A 4DFZE 2ITVA 4DFYA 5HQ0A 3S00A 2IWIA 4BI2A 5EKNA 1MRUA 2YITA 4AN3A 3ENMA 4YLLA 4Q5EA 4KS8A 3ZUTA 4O96A 5LMKC 4UYAA 2WTKC 2CCHA 3NUPA 4FSRA 4UV0A 5HHWA 4E4NA 2A2AA 3DAKA 1VYWA 3KEXA 4TXCA 1F3MC 2BRBA 5T3QA 2UW5A 5E1SA 4F7LA 1ST0A 1Z9XA 3E64A 4JLCA 4K8AA 1MUOA 4X2KA 3FMHA 4CYIA 2C6OA 3BI6A 3DU8A 4C62A 1U4DA 2VO6A 4YO4A 2B55A 2ACXA 2XBAA 5ACKA 1DI9A 1BI8A 1YDTE 2YLEA 4FKOA 4NT4A 5CEKA 1JKLA 3DAJA 4XRJA 1REJA 3S4QA 4DBNA 1PMNA 1Y6AA 5D7AA 2QI8A 2YERA 4OUCA 2OIDA 4GJ2A 4RIXA 4AN2A 2Y6OA 5TT7A 4AA5A 3GOPA 4AW2A 4FNWA 3A7IA 2Y4PA 4HW7A 2QG7A 5JGBA 4ZTQA 4GT4A 3ZOSA 4F0GA 5BX0A 4X2GA 1A48A 4QTDA 3I81A 5HNGA 4ZY6A 3C5UA 4PPAA 2CGWA 3TJCA 1H0WA 4DTAA 1OPKA 2UVZA 4GG5A 4X6RA 5J5SA 2ZDTA 4R3CA 3QRIA 3R02A 4FSUA 1DI8A 2GS2A 2JLDA 3LCKA 5AR5A 3BKBA 5HG9A 4I23A 4U41A 4EOPA 4ZZNA 4IC7A 1UKIA 3F2AA 3DV3A 4CV8A 4EHGA 4EH2A 1MRVA 5AR7A 3DKOA 3BCEA 3R9RA 4RJ5A 4BTMA 3IS5A 3CBLA 3D14A 4I5PA 4XBUA 4ANSA 2IF8A 2WTJA 3CE3A 2J0MB 4HOKA 4WNMA 3DFAA 2PPQA 3C13A 2WMQA 4FVPA 1TQPA 3EZVA 4CKJA 3E63A 3HUBA 4I6FA 4Q9ZA 5HG7A 3OCTA 4XX9A 4DITA 3FAAA 5G1XA 4C4JA 4XH6A 5A6NA 5A4TA 2IN6A 2UZWE 4O2ZA 4FKUA 2NRUA 5CASA 5FXQA 5F95A 3QQUA 5M4IA 3QC9A 2R3MA 3TMOA 3C50A 1ZOGA 4CVAA 3BL7A 4NU1A 1KSWA 1M2QA 1W2CA 4X3FC 1Q3DA 2QU5A 4EK8A 3QKMA 3S2PA 4BWXA 3I0QA 3N9XA 4BCIA 3MY0A 3ORZA 4PTGA 4V05A 3V5PA 2BR1A 3P78A 2Y4IC 1JVPP 4IX4A 4U44A 3Q60A 3MPAA 4C61A 3COMA 4G6NA 3PA4A 4ENYA 5CAUA 5HICA 4YLKA 3VHEA 4J98A 4IB0A 4D5HA 1LP4A 3GCVA 3GUBA 3MPMA 4U79A 5DFPA 1ATPE 3QTRA 4QTAA 2HWPA 2HENA 5CI7A 4DYMA 5I3RA 4X0MA 5M07A 4QMQA 1UV5A 1PXLA 1YWRA 3W33A 1OKVA 5CAPA 1FVRA 3LFDA 4FL3A 2Z7RA 5IQBA 5DE2A 2YCSA 5CWZA 3ET7A 2X4ZA 5E8ZA 4C37A 5HD4A 1YOMA 3FE3A 2W1FA 3F69A 3GC7A 3ZM4A 4QYYA 2C6EA 1H27A 4ASZA 3A7HA 2XALA 1ZYSA 4A9SA 4YZMA 3SXRA 4QMPA 3FXZA 1SZMA 4FL1A 3MA3A 4IM2A 5GZ9A 3LJ1A 1XQZA 4KIPA 3ZLWA 2HELA 4RFMA 4IWPA 2X7FA 2P33A 3VWAA 4IW0A 3OXIA 3U6JA 5M06A 2EB3A 4U45A 1I09A 4LL5A 3TJDA 2W06A 5IQHA 3O8PA 3W0SA 4GMYA 3R9OA 1RW8A 2VWXA 3U9NA 4LUDA 2QU6A 3JXWA 3RAIA 4NK9A 4S32A 5AR2A 1OBDA 4FEXA 3L9NA 3EFLA 2X81A 3MBLA 2XZSA 4QYFA 5DHJA 2PZPA 2GU8A 2XK7A 2JITA 2OU7A 3DY7A 3VC4A 4YR8A 4FNYA 4OTRA 3P0MA 4ZSEA 3DK3A 3GXLA 3UMWA 5LVOA 3UOJA 4GUBA 1P2AA 5A9UA 3K2LA 3U54A 4RZVA 4IB3A 2XMYA 2BHEA 2RKUA 2JDOA 4JBQA 3UDBA 2XIXA 3ORMA 5LXMA 4PMSA 4QPAA 2PVFA 5AAEA 3R00A 2W9FB 2VTLA 3OZ6A 3FMJA 2X4FA 4C35A 5KMOA 4RJ6A 1H28A 3PXFA 2ZVAA 3PXQA 3PFYA 3OMVA 1FMKA 4ANMA 2H8HA 3UC4A 4PDYA 1JQHA 5L2WA 1IASA 2IW8A 4DEAA 4ZJJA 5I9VA 3V8TA 4LOQA 3UVRA 4TYGA 4JAJA 4V04A 3ZMMA 4CEGA 3OCBA 4IWQA 4YHFA 5BVWA 4QYGA 5CF8A 2V62A 1SMHA 4FTJA 3PUFC 4UZHA 2CN8A 5EHOA 4BDCA 4PTCA 3UMXA 2F7EE 1WBNA 4EL9A 1Z57A 2AUHA 4MWIA 4EOKA 2HYYA 2X6EA 3AD6A 3QX2A 3VS4A 3VW8A 4GG7A 3MJ2A 5L8JA 2QC6A 5JK3A 3QRTA 2R3FA 3KXXA 4DGOA 2UVXA 4U9AA 4OTPA 3HMIA 3F5PA 4AOJA 5CF5A 4U3ZA 5DWRA 4N57A 4NKAA 2B52A 4KINA 4JRNA 2C47A 4V01A 5CU6A 5CXHA 2Q0BA 1JOWB 4U7ZA 2RGPA 4IANA 2PZRA 3IW6A 4MXXA 3SHEA 2XNBA 4AQCA 4J8MA 3E5AA 4ZLZA 4BR3A 3WZDA 4JX3A 4RIOA 5EYDA 3FLZA 4YTCA 1B6CB 2XJ2A 5JGAA 2WOUA 2I0HA 5FTOA 4EK5A 2EXEA 3MFUA 2H9VA 3OOMA 4DEDA 3AKJA 3W0QA 3CIKA 3KMMA 3WZJA 4JRVA 4R7IA 5ANOA 2X2LA 3KK9A 3EN9A 3I5ZA 4QMLA 4JX7A 1ZMUA 4KIQA 5E8XA 4UMPA 4BCHA 4PP7A 1W84A 4UMUA 4M7IA 4FTCA 4XV1A 5FBOA 1NY3A 3AC1A 4I3ZA 2ZYBA 3TDWA 1H26A 3FY2A 1IEPA 1OKZA 3MYGA 4F09A 4FTIA 3JVSA 3VS3A 1XH7A 4GT5A 3A7FA 2PTKA 4WBBB 3DQXA 5J7BA 2Y7JA 2X7OA 3MVMA 2C5VA 3NLBA 3QZGA 3GCPA 4JL9A 5CT7A 3A99A 4RX9A 2OJJA 3ZO1A 5DT3A 5TF9A 4O1PA 3OEFX 5M56A 4K11A 5EDPA 4MVFA 3SVVA 1P14A 3ORLA 3OWJA 1H25A 1YXUA 3A62A 3F2NA 2I0YA 5L2IA 3NW7A 3LCTA 5KHXA 2QOLA 2CJMA 1J3HA 3TG1A 4CZYB 3FWQA 2BAKA 3R30A 4JDIA 3UOKA 3QYWA 2UVYA 4PMMA 2ETMA 4XUFA 1UNHA 1CKPA 2ZM3A 3V01A 4F9BA 5CVHA 5ANDA 2VNWA 4ZSJA 5M57A 3W8QA 2QHNA 3DTCA 3W0RA 2CN5A 2VNYA 3A2CA 2RFSA 3AD5A 3HMMA 4PMPA 4IDTA 4XRLA 4EBVA 3EJ1A 4G2FA 3NDMA 1E9HA 2WMWA 2CGVA 4G1WA 3RPYA 3O71A 4DH5A 1VLRA 2J6MA 4ZIMA 3LMIA 3P9JA 3IECA 4G34A 4GK2A 3DT1A 1PXIA 3EQPA 4OGRA 4EWQA 1ST4A 4N6YA 2ETKA 2XK8A 2A4LA 4A9YA 3ITZA 4MD8E 4WA9A 4XCUA 4YJTA 5HIDA 4FG7A 5CX9A 4DH7A 3U4WA 1U59A 4E26A 4IAYA 2YAKA 4PTEA 4G3GA 3ZBXA 5LWMA 4ORKA 5FTGA 4QTCA 5KHWA 3ROCA 4P4CA 4NH1A 3CP9A 3ZLXA 4AZEA 4IX5A 4NW5A 4RX5A 3QUEA 3W2PA 3WI6A 2QCSA 1TVOA 1OL1A 5IEYA 4E6DA 3IQ7A 3W0NA 2HCKA 2HXLA 3OOGA 3U4UA 4FMQA 3G9NA 2O3PA 2PVHA 4FTKA 4O7TA 2HZ4A 3EIDA 3MW1A 4IVAA 3P5KA 2UZDA 4FX3A 2WQEA 3MTLA 3DDQA 4IAIA 5EOBA 4LQMA 2CNVA 5C4KA 2XARA 4GVJA 4BI1A 1Q62A 1H4LA 3CTQA 3BBTB 1M17A 1W83A 3NCGA 4NW6A 1T46A 4K18A 3RPOA 2VX3A 4AT4A 3NNWA 3R1YA 2UZLA 2JC6A 3D2KA 3MDYA 3O51A 4JNWA 4LRJA 3VUGA 4E6CA 4F7JA 2OXDA 3LXNA 3WF6A 3D15A 1XH9A 5DEWA 5J1WA 3PXRA 4ZSAA 2BDWA 4FV5A 3QUDA 1FGKA 3NUSA 5AP6A 5CANA 4FV9A 4C33A 3KKVA 2EVAA 3FLQA 3Q52A 4XS2A 5AUXA 5HE3A 3W2SA 5FQDC 3HV4A 5AM6A 4WG4A 3DQWA 3VJOA 4JIAA 4LMUA 2GNGA 1W98A 4GEOA 4ZTHA 3R7VA 5IH4A 1KWPA 2PE0A 2PMIA 3NCZA 4BIEA 1J7IA 1REKA 3QBNA 3FZRA 4MQ1A 2BALA 1I44A 3AT3A 3QALE 4ITIA 4OR5A 3PY3A 3W0PA 3ULZA 3JPVA 2BZHB 3LM0A 5AMNA 4ZLOA 4YJQA 3EFKA 4IACA 2DUVA 4G16A 4L68A 4CD0A 3FQEA 5JQ8A 1YW2A 3REPA 3L9LA 5CSWA 3OFMA 4TYJA 4MF0A 2B7AA 5HU9A 3GVUA 3OBGA 4W4XA 2O5KA 3WYYA 4HYHA 1WBTA 2GCDA 4ARKA 3ZLSA 4UXQA 1A06A 3TL8A 2C5XA 5J9ZA 1SM2A 2BZKB 2ZM1A 3R8LA 3H3CA 3QU0A 1K9AA 2JIIA 4L42A 4PPCA 4AGUA 2FSMX 4AZFA 4QMTA 2C4GA 5IA0A 3KULB 5IZFA 4R3PA 4ZS4A 4FIGA 4AW5A 3R21A 2OZOA 2ZMDA 4FG8A 4PL5A 2V55A 2OIBA 4N6ZA 4AZSA 1SVEA 4FZFB 4GV1A 1ZRZA 2ITNA 2H34A 2OW3A 3R71A 3R63A 5EM7A 5AWMA 1J1CA 2WFYA 3THBA 3TNWA 2JIVA 4UZDA 5BVEA 3TWJA 2QODA 5BYLA 3KXHA 2XEZA 3MTFA 3SRVA 4ANBA 4B8LA 3FQHA 2HY81 3KA0A 4UX9A 3DTWA 5AA8A 2J90A 2JDSA 3VUIA 1ZMVA 4J7BA 3SGCA 3OBJA 3DKGA 3EZRA 2C30A 2JKOA 2HZNA 5EM6A 2YM6A 3DJ6A 1ERKA 3C4FA 3ORNA 1DS5A 3NWWA 3TT0A 3MY5A 1V1KA 2PZYA 2WQMA 4NSTA 3I4BA 4FZ7A 4BWPA 5HG8A 4F65A 4NL0A 2AYPA 4IIRA 4HZSA 3A4PA 1B38A 5HEZA 4DG0E 3E7OA 2DWBA 5LVNA 2XAOA 4J52A 4ZTLA 4YP8A 3FMMA 5IQDA 1WBOA 4IWDA 4FC0A 3BHTA 4M15A 4XG7A 4YJRA 5EYKA 2X7GA 4FVQA 3N4VA 4XBRA 3ZZWA 3UDSA 5J95A 3OP5A 4QT1A 2QURA 3QQGA 4O7SA 5HTIA 3EB0A 3P1AA 4I5MA 4AX8A 1JBPE 3ZUUA 3CD3A 4IVBA 3DNEA 5FEQA 4ZMEA 4GK3A 2VTOA 2W9ZB 3EFWA 3HMOA 5HO6A 2VGPA 3MFRA 3VUKA 3VBVA 2YIQA 1VZOA 1OIRA 4BTFA 3KN5A 2OF2A 1YWVA 1PHKA 4FJVA 3VS5A 3LZBA 4DLIA 2JAMA 4F6UA 4XG8A 1SVGA 4EH9A 1ND4A 2XYNA 5HG5A 2YACA 1XH5A 1BLXA 2GNFA 1RDQE 4O0SA 1XMMA 2V0DA 1WCCA 4FTOA 3KU2A 3ZM9A 3OS3A 5BNJA 3QCYA 4NM7A 4QQ5A 3EQIA 2CGXA 3HECA 4W4WA 1QPCA 2R3LA 4JQEA 3L8PA 3TTIA 4H36A 2X0QA 5M44A 5HVYA 3RPRA 1FVVA 3ELJA 2BCJA 3O17A 2UW0A 2O65A 4FOCA 2ONLC 5ANKA 3RK5A 3ZBFA 4F1MA 2GQRA 4DN5A 3EQBA 5HX8A 4CT2A 4BZDA 2QOIA 5BUEA 5CTPA 3KRRA 1YHVA 1O6KA 4D1SA 2WELA 5C1QB 1BUHA 3DBFA 3GC8A 4OTDA 1U5RA 3FJQE 4X2JA 4TPTA 4ANOA 4J1RA 2BKKA 3W1FA 5AV0A 1FBNA 3QCQA 2R64A 5DRBA 3OT8A 4HGLA 2QKRA 3WF7A 4Z7HA 1PXJA 3LFFA 4BN1A 4FUYA 3RHKA 5C8NA 3VBQA 3O5AA 5BQ0A 3NYNA 5L2SA 2QHMA 4L53A 5JZNA 4AU8A 5K5XA 3C1XA 3Q3BA 4WRSA 3AOXA 3Q04A 4TKSA 1BYGA 4U3YA 3T3UA 4QP2A 4BTJA 3FI8A 3ORXA 4AOTA 2R3OA 2PMLX 4DT8A 4PDSA 4FL2A 3HP2A 3VBXA 3F88A 5IQCA 3VO3A 1PYXA 2JFLA 5CF6A 5F94A 4LOPA 3LIJA 5JFVA 2FYSA 4L01A 4EKLA 2WU6A 3OF0A 3W32A 1PXPA 2WNTA 4FSZA 3NR9A 4MEDA 2R9SA 4I6QA 4LV8A 3TKIA 4EZ7A 4LGGA 4O7RA 1OB3A 4GU9A 4EYJA 3M1SA 4FKLA 3S3IA 3DFCB 5FLFA 4ALUA 4BCPA 3DJ7A 4DLJA 3WZEA 4ZZOA 2UZTA 3OTUA 4EOSA 2IVUA 2XNNA 4AW1A 2GMXA 2GNJA 2PK9A 3JS2A 2JDRA 3DK7A 3PTGA 3R28A 5GHVA 4CLJA 2QOQA 2WAJA 3R7UA 3N51A 3RK9A 4CFXA 3SA0A 5D41A 1G8SA 1XMLA 3PY0A 2Z7SA 3M42A 3NUXA 4NJ3A 4FK6A 5LMAA 3BYOA 1OIQA 2JBOA 4YC6A 2E9OA 2WZJA 3QD4A 5HOAA 2DS1A 4AGWA 4BDIA 3DZQA 2PUNA 4KRCA 5IQGA 2CCIA 4F9AA 2F7ZE 4GRBA 3RP9A 5I3OA 1P5EA 4I0RA 4NFMA 3JUHA 3ORKA 2QO9A 5LMBA 3R1QA 4FGBA 3DBCA 3QD2B 1Q8UA 5L6PA 2VZ6A 3POOA 4FKSA 4I94A 5AP4A 4GKHA 5CSHA 3II5A 4MX9A 4RWKA 4DGGA 4U40A 4I5CA 3W55A 3NYVA 4BTKA 2YM5A 4GH2A 4A9UA 2W4KA 4LFIA 2XIYA 1IAHA 4LV5A 1E1VA 4YPDA 2VTTA 3QCXA 1GZKA 5CAVA 1UVRA 4QMSA 5I9ZA 4IEBA 4RVMA 4LRKA 3PSBA 4GU6A 4USEA 1HCLA 4D4YA 3HV5A 4UMTA 3S95A 1PMEA 4FT3A 3LQ8A 5J1VA 3HUCA 5EI6A 3HAVA 3DKFA 3NUAA 2BHHA 3BLRA 2I6LA 3R7YA 4AWIA 3RWPA 4B7TA 3DXNA 4FKWA 4G6OA 2ESMA 4IAAA 4XV9A 1URWA 2F9GA 3C0IA 5FTQA 4C3PA 4D4RA 4D2SA 3NAXA 4RJ3A 5CSPA 3BQCA 4OTGA 2GDOA 3MA6A 4FNXA 3CPCA 2AEGA 2RIOA 2VTMA 4WD5A 4YZDA 1OIYA 5JRSA 3M11A 4BDAA 5CALA 3A7GA 5TR6A 4ANLA 3GU6A 5EM8A 4QP3A 5JH6A 2GFSA 2I1MA 3BYSA 4O0XA 3SAYA 3UIXA 3NZ0A 4IZAA 2LGCA 3A8XA 2W1EA 5K0XA 1ZZLA 4JR7A 1UNLA 5EH0A 3HMPA 3UGCA 4H1JA 4R7HA 5H9BA 4QMWA 4A06A 4FKGA 4LUEA 2QOHA 3VS6A 4O2PA 5AAGA