4CMOA

Structure of the human anaplastic lymphoma kinase in complex with the inhibitor 2-((1r)-1-((3-amino-6-(2-methoxypyridin-3-yl)pyrazin-2-yl) oxy)ethyl)-4-fluoro-n-methylbenzamide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
309
structure length
295
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 295
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cmoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cmoA01
5FBOA 4X2GA 3Q9YA 1FMKA 4Y95A 4P5QA 3PJ2A 2Z7RA 2OJFE 3PFQA 2XMYA 4KRDA 1YWVA 3POZA 4ZJIA 5DLSA 4EH6A 4BC6A 2I0EA 2F2UA 4I22A 3GCQA 3NIZA 2F7EE 1GIIA 3SXSA 4O22A 4S2ZA 1DM2A 5IZFA 3F2NA 3U8WA 5F1ZA 3RPRA 3U6JA 5J1VA 4OTDA 2WGJA 4N4SA 3I6UA 4DTBA 5CS6A 3N4UA 4KUJA 4YJUA 4IB0A 2C0TA 4C38A 3O8PA 5E1EA 2YACA 4RX8A 3VS4A 4KIKB 3R8UA 3CKXA 4GU6A 5AV0A 4N0SA 1JKLA 4TYEA 2W1CA 1PXPA 4O1PA 2YLFA 4O6EA 3DDQA 4RQVA 1OL2A 4EOJA 4O83A 4EJ7A 4FSTA 4IX5A 5CEOA 4TXCA 3C4XA 2XKEA 2Y4IC 3OEZA 5B7VA 3PZEA 4I3ZA 2C3JA 4NEUA 2WMUA 4YSJA 4N6YA 3TNHA 3CY3A 5AUXA 4E6QA 3WZKA 1LP4A 2VX0A 2X2LA 4ACHA 3HNGA 3EQBA 3TNPC 1OL6A 3DS6A 3ZLXA 4RJ7A 2XF0A 4FTTA 4ZJJA 3DNEA 4HYUA 3CPBA 1H1QA 3QZIA 3D5UA 4TZRA 4ZTHA 3BELA 5EDQA 4AGCA 3C1XA 3FUPA 1KOAA 3DK7A 4DGNA 4F70A 4RJ4A 4L3LA 4MD8E 5HVJA 1MQBA 4IM3A 3VF8A 5A4TA 4AGDA 4FV3A 2OU7A 4CV9A 4UWBA 4FI1A 4MH7A 3ZBXA 2R7BA 4BCQA 3F69A 4JG7A 5FM3A 2VTMA 3GOKA 2J0IA 3OZ6A 4F6SA 3SD0A 4MVFA 4I6HA 2QHNA 1JKTA 4JNWA 4TWCA 2HCKA 4EWHA 4FYNA 5EQYA 5IA0A 4BDCA 3L1SA 2BRMA 4S34A 4FV1A 3RALA 3PWDA 4AN2A 3IPHA 3VUDA 5F4NA 4JOAA 1VEBA 1M2PA 2R0UA 3Q4UA 5BMMA 3NUAA 1OI9A 4G34A 5AP7A 5J7HA 4MCVA 2PE0A 3EL8A 1RJBA 2ITNA 2V5QA 5CF6A 3HMMA 3P1AA 4RGJA 4BBFA 4RLLA 1H4LA 1H24A 2UW7A 4I0RA 4NL0A 5B0XA 3PG3A 5AWMA 4BCJA 3LCSA 2FSMX 4KRCA 2WMTA 3QA8A 4LRMA 5KMMA 4DE4A 4JI9A 4O38A 3V5LA 4F64A 5AEPA 2RKUA 4FIJA 3KREA 3RTPA 5IA3A 3OY3A 3RK9A 4RLKA 4KA3A 3SDJA 3FZ1A 3I79A 5J1WA 2OFVA 2G1TA 3R04A 3ORLA 4FV5A 4JR3A 5IQIA 3HZTA 4YZ9A 5LCKA 2R3FA 4FTMA 2IG7A 3NEWA 4QTAA 4OTIA 1LEWA 4C0TA 4KIOA 3O8UA 4GVJA 3PPKA 3RZBA 1Y6AA 1YI4A 2HXLA 4C58A 4E4XA 3E7OA 3CEKA 4DTAA 3ZSIA 5CVGA 3OCGA 5CALA 4AW0A 2V22A 4P90A 4M68A 4J96A 4AUAA 4AE6A 4O0RA 4RPVA 3QCYA 3EZRA 4X7QA 3DFAA 1PXJA 2PY3A 2BAJA 3QLFA 4XV9A 2Y9QA 3UZTA 2PVFA 5CY3A 5TO8A 3HAMA 5ACKA 4UBAA 2FH9A 2PVKA 4BFMA 5BQ0A 2ITWA 4QP7A 4BTJA 4DAWA 3DKGA 4V04A 1G5SA 2WMBA 3EN9A 4W4WA 4FVQA 3OOGA 4FIFA 3EFLA 2I6LA 4XCUA 1PY5A 1YXUA 2OGVA 1ATPE 3VULA 4O7VA 2VWUA 1XH4A 3FY0A 3QTUA 3VC4A 4E6AA 4FA2A 5FXRA 2F9GA 2Z7QA 2R64A 4IE9A 3E93A 4GT3A 2F49A 4DFLA 3BEGA 4O84A 2J0LA 4DLJA 4RQKA 3IDBA 5K3YA 4O0TA 1ZOEA 2QOIA 3P4KA 2C6TA 3VBVA 3WBLA 2WMAA 3SC1A 3NUUA 5HESA 4LMNA 4XOZA 4IZYA 5LMAA 4FNWA 1PYEA 2XK4A 5JH6A 4YZDA 3VNTA 3A8WA 4UYNA 4QMMA 4XH6A 4QP2A 2O0UA 4DLIA 4OR5A 1IASA 4QTDA 3R9NA 4O7TA 3AC3A 5HLWA 1IRKA 4ANBA 1Q3WA 3MI9A 4EC9A 2ZB0A 3EH9A 3Q4ZA 3QKMA 5T68A 4A4OA 4D2SA 3FZTA 4LL0A 5FEQA 4FTRA 4FKQA 4IBMA 1NXKA 5AV3A 4AF3A 4UYAA 2H34A 3FMDA 3DJ7A 2F2CB 1U46A 1U4DA 3CE3A 4ACMA 4KIKA 3LCKA 3NAYA 3ID6C 4EK6A 1UNHA 3GU5A 4RA4A 5K4IA 2GQSA 5HCXA 5M06A 2WIPA 5KKRB 3GQIA 3QX2A 5TE0A 5D41A 3ORPA 3MSSA 2GNGA 3SW7A 3MB6A 3TEIA 3PA5A 1OUKA 3N51A 3WYYA 4R3CA 4H3PA 4ALUA 3CJGA 2X7FA 1WBSA 4FKVA 5GHVA 5HCZA 4B0GA 4C35A 4CQGA 2KTYA 1XHAA 5FP6A 3ROYA 3W10A 2RL5A 1M52A 2C1AA 4FK3A 5FEDA 4ZSJA 3PVGA 4BYJA 3FQSA 2IWIA 4FODA 1JOWB 3OWJA 3CS9A 1VZOA 2DS1A 3NUXA 2PL0A 5AIRA 3I1AA 4ZK5A 4D2VA 2VNYA 4FTAA 1YVJA 4TYHA 5L2QA 2VU3A 3QYZA 3Q32A 3VS7A 3LFNA 2W96B 5DGZA 1WFCA 2Y8OA 5E8SA 2GCDA 4GUEA 5CAOA 2Z8CA 2XUUA 3VS6A 3PPZA 2B9FA 2X8EA 2CN5A 2UVZA 3IW4A 3OROA 5DYJA 3HV3A 1YHSA 1ZMUA 2HIWA 4I1ZA 4XG9A 4TL0A 2CKOA 4BY9E 3UVPA 4YZNA 1XJDA 4CFWA 4I4FA 2OJ9A 5EW8A 4HGTA 4BF2A 5L6OA 4P2KA 1OPLA 5IMEA 2QONA 2VX1A 4WRSA 2OJIA 5CSPA 1KE8A 3RWQA 2YITA 3TKHA 4FIHA 3TDWA 3OCBA 3VUMA 1OIYA 3F6XA 5AJQA 4A9TA 5M4UA 1H0WA 1F3MC 5KHXA 1VYWA 2W17A 4X3JA 2FSLX 4ZTQA 4NJDA 4V05A 4JBPA 4ZSGA 4AS0A 4YZCA 4CZYB 4QMUA 2JKMA 2R9SA 5CWZA 4USFA 4MD9E 2JBOA 5AR2A 4MAOA 4C3FA 1JNKA 5T6KA 5FEEA 4DBNA 4IEBA 3PA4A 4PQNA 2C6KA 1R78A 3K54A 4HZRA 4XG4A 4APCA 3GVUA 5ETCA 3MFRA 4Q5EA 1J91A 4Y83A 2A4LA 3BGZA 3LFCA 3G0EA 4FSMA 4L68A 4PRJA 5EG3A 1UU3A 3E8EA 5L3AA 3QGWA 3KXHA 4MNFA 4CG8A 3SQQA 4Q9SA 4PL3A 4S30A 2WTKB 3UIMA 3Q04A 1U54A 3ZC5A 2P2IA 3NCGA 4I6BA 3MY5A 5FQDC 4EQUA 3NMUF 4YC6A 2OW3A 3H9FA 5I9VA 3IW6A 4FKOA 4EH2A 2QOLA 3PSCA 1PMEA 2CLXA 1UV5A 3HL7A 4L43A 3OXIA 3R9DA 5A54A 3BYSA 5L2WA 4FE2A 1QPCA 4YP8A 1KV1A 4E7WA 5M09A 2G15A 5GZAA 3FHRA 1XO2B 4GK2A 4Z55A 4GSBA 3TV4A 3WF6A 5AFVA 3F3ZA 3AOXA 3WI6A 1OKYA 4FEQA 2XH5A 1XH8A 3H0YA 1AGWA 2JDOA 4WNKA 1MQ4A 3IDCA 4XBUA 4DBXA 4GCJA 5DMZA 4U9AA 5LVLA 3LOKA 4O7ZA 5FRIA 1P2AA 4AXAA 3OW3A 1FBNA 2W1GA 5HCYA 3PXZA 3WIGA 3KRLA 3R9HA 3R1SA 2CN8A 4CMOA 2XIYA 2ZJWA 3MTFA 3QHWA 2PE1A 3JUHA 3LM5A 4M14A 2P33A 1NA7A 5HX6A 2VTSA 3FZOA 2VWVA 4NZWB 3R71A 2XIRA 3M11A 2X6EA 4LOOA 4ZZNA 3PIYA 5EI8A 4G3FA 5HTBA 2XEZA 4ANNA 1UVRA 3EHAA 4M97A 2ZVAA 5LWNA 4ZSLA 1XH7A 3DQWA 2GFSA 4UB7A 4IJPA 1KV2A 4HGLA 2JAMA 5J87A 4DFNA 1LEZA 1PMNA 2WTJA 4FKWA 5K5NA 3MESA 3FXWA 3TJCA 2QNJA 1PYXA 4FSYA 3PXFA 5HZNA 3AC2A 2F7XE 5IUGA 4UX9A 3A62A 4W4YA 3MTLA 2GHLA 5J5SA 5E1SA 3AMBA 3QUDA 3ALNA 2C6MA 5TF9A 4FKTA 2OSCA 4GS6A 1PKDA 3ZO2A 1KE9A 3TV6A 2RFEA 3F5PA 4OTRA 1FGIA 1G8AA 4JQ8A 3BLHA 2O63A 3CJFA 4B9DA 4QP1A 4RBLA 2B1PA 4MNEB 3CQUA 3F7ZA 3G90X 3OUNB 2VTNA 2XNBA 5E92A 4ZZMA 3RCJA 3O7LB 2W4OA 3UBDA 2X1NA 4FGBA 3V5WA 4BGQA 3HV4A 3MPMA 5DRBA 4IW0A 5IQEA 1ZOGA 4QMSA 2YAAA 4Q2AA 3QKLA 2YDIA 4EOMA 2XRUA 1Y57A 5JFVA 4XV3A 2CGWA 2JIVA 3GEQA 4FOCA 3KU2A 2R3OA 4NWMA 4MF0A 2V7OA 2ZM3A 4R8QA 5GZ9A 3HLLA 4JJRA 3VBWA 2JDRA 3DXNA 3SHEA 3ZU7A 4XG2A 2A19B 2J90A 1PXKA 5TR6A 5L4QA 4OTWA 1M7QA 1IR3A 5KKRC 1LR4A 2B9JA 1ZY5A 3LFSA 2HXQA 3NX8A 4Q5HA 5D12A 3UIBA 2C5OA 3SGCA 2YM8A 3R7UA 3ZLSA 4BKZA 3N9XA 4QYFA 3GC8A 4CTCA 3PE2A 3FKLA 3VJOA 3F3TA 4XEYA 3EIDA 3HMOA 4CKRA 3S0OA 5CAQA 3IECA 1TVOA 2BROA 1JAMA 2QI8A 2WO6A 1B6CB 4AA5A 3C7QA 3OVVA 3VUTA 4GFOA 4M7IA 2UV2A 4FKIA 4QMXA 5L2IA 5IUIA 1W7HA 4WNPA 2WIHA 2FSTX 4JIKA 3CXWA 4DINA 4BBMA 4EK5A 1PHKA 5AP3A 4DEBA 5HE3A 3ROCA 4F65A 2UZUE 4MBIA 4XOYA 1QPJA 4BVUA 5B2KA 2C5NA 2PZIA 4O0YA 3RBWA 4M69A 5CF8A 5ITAA 3E87A 3UODA 3KXNA 4AQCA 1Q41A 1U5RA 3BE9A 5B2MA 1HCLA 1CKIA 2XBAA 2BAQA 2RFDA 4L7SA 5DI1A 3W2PA 5KHWA 2VRXA 5ANEA 1CM8A 2WTCA 4K8AA 2GS6A 3W1FA 4DEIA 4QP8A 2J0JA 2W1FA 4E4LA 4GG7A 5LOHA 2QOKA 3ZRKA 2W06A 3UNZA 4N57A 2IW9A 3EQDA 5EYCA 3AMAA 1BX6A 2W0JA 3P79A 3PPJA 3D0EA 2R3KA 3R01A 1PJKA 4FG9A 4G3GA 2V7AA 1J1BA 2E9UA 3T3VA 1OKZA 2UZBA 2J7TA 1OM1A 4MKCA 4U44A 4C4EA 2IVVA 4IMYA 2PUNA 4MX9A 3FMKA 2ZAZA 2VTLA 4G6NA 5JT2A 3KXGA 3BV3A 5AAFA 3OD6X 1Q3DA 3IQ7A 4H1JA 4H05A 3R9RA 3VS5A 3TL8A 2XNNA 2AC3A 2R3LA 2XKFA 3ODZX 2WTKC 4YJRA 4Z9LA 3ZFMA 5JGDA 3V8SA 5H8EA 3UZRA 2XIXA 1B38A 3ZO3A 4XP0A 4WIHA 4ZMEA 2VWWA 4G6LA 3FBVA 4DFZE 4EJNA 1WVWA 2YA9A 1IG1A 1XQZA 3BX5A 3FC1X 3GCUA 3I7BA 4E5AX 3LXNA 2HZ0A 4RFZA 4YSMA 3BLRA 3R30A 3R02A 1VYZA 4AZTA 3V6RA 5G1XA 2J50A 4GK3A 2WD1A 4G5PA 5BVOA 1P4OA 2ITOA 4JVGA 3G15A 1FGKA 2C69A 2BRGA 4F99A 5IDNA 3RM7A 4XLIA 4OTHA 5FXQA 4PF4A 1QL6A 2JC6A 3EQGA 2Y4IB 3ENMA 3O96A 4MYGA 5IH5A 4MBLA 4O86A 4IX6A 3COHA 4YURA 4AA4A 4FMQA 4C62A 1ZMVA 1JWHA 3DA6A 5J9YA 3SRVA 3N4TA 4FKSA 4U43A 4FEUA 5KCVA 2JFLA 4F0IA 4MWHA 3LJ0A 1DS5A 4C59A 2UZWE 3ULIA 5KMNA 1YXVA 4C34A 3W8LA 2BILB 4NT4A 5J79A 1U5QA 2F7ZE 2IZSA 3KULA 4YC3A 3LCTA 4PDYA 4ITIA 4BGHA 2P4IA 2WAJA 2ACXA 5A6NA 5IISA 3SVVA 3NNUA 4CMTA 4LRKA 4GG5A 4X0MA 4ZSEA 3MDYA 3DXQA 4EYJA 3ZH8A 3FEGA 4MNEA 3NCZA 2PU8A 4CFVA 5KMLA 4CNHA 4WG3A 4Z7HA 4CCUA 3BYVA 1A9UA 4QMOA 3KMUA 4PDOA 3P23A 5JRSA 4D58A 3L8VA 4OTFA 5JQ5A 2WMSA 3D2KA 3FZRA 3QC4A 3QA0A 3QCXA 4ANLA 5KMJA 4ZIMA 5EFQA 3I6WA 2WHBA 1DAWA 2OKRA 2JKKA 4M3QA 2GQRA 3FMMA 5CVFA 4KBKA 2PMNX 3DFCB 3TKIA 1PXNA 3PIZA 3DTCA 2OZOA 3UIUA 2BFXA 2W4KA 3HMIA 4FT9A 2EB2A 3GGFA 4I4EA 3OWPA 3QZFA 5J8IA 4CZTA 1WVYA 3N4VA 4XP3A 3RPSA 1OB3A 4F09A 5M55A 1F5QA 4M84A 3S4QA 2EWAA 1Q8WA 4E6CA 1IAHA 3Q2MA 2UW4A 3R8PA 3K3IA 5A4EA 4RWLA 3C0HA 2X39A 3OXTA 1JSVA 4HYSA 4YJQA 3TIZA 5BVDA 4I0SA 4XP2A 5AV2A 4YJVA 4EOIA 2C6IA 4AWIA 3DTWA 3LFFA 5ACBC 3ZHPC 3ET7A 4DH3A 5LVNA 3V01A 2Y6OA 3RPOA 5IUHA 3ZC6A 5FLFA 3EN6A 1B39A 3RHXA 4YU2A 5IQGA 2E9PA 1URCA 4EKKA 5J9ZA 4EOLA 1PRYA 3D83A 2VTRA 3WF9A 3QUPA 4F7LA 5DR2A 3R7OA 4H3QA 1Q4LA 2XIKA 4FSWA 1MP8A 1OVEA 4D4VA 1YXSA 4GJ3A 2W4JA 4QPSA 4MTAA 4L46A 3FLYA 3A2CA 4ACDA 2KULA 5CYIA 1Q5KA 3QRUA 1K2PA 4BTKA 4BN1A 3AGLA 5KZIA 2PZYA 3DAKA 2J9MA 2WU7A 4DC2A 3W8QA 2QC6A 2XJ2A 4EWQA 5EQPA 2O2UA 4DYMA 3KXMA 1REKA 3GC9A 4I24A 4R78A 2F57A 2PVMA 3UMXA 3HRCA 4KBAA 5TOZA 3VS3A 4PNKA 3EWHA 4FL2A 4YTHA 2W1HA 2OXDA 3QQJA 4RMZA 4HVDA 3R00A 3EQRA 4WG4A 3BGQA 4IIRA 4JAIA 3QTIA 1YXXA 4IZ5A 4LYNA 5EDRA 4D1ZA 4C61A 5HTIA 2WTDA 2QO9A 2VN9A 1WBOA 3POOA 4AACA 1SNUA 2WMRA 4JDKA 3FY2A 5DA3A 5GZ8A 3O51A 2W05A 3DT1A 2JGZA 3I5ZA 1APME 3UG2A 3P9JA 3VHEA 2C4GA 3O2MA 4H39A 4AAAA 5EDPA 4UMUA 4J98A 3TN8A 5FM2A 2CSNA 5AADA 3ENHA 4G3CA 4XMOA 1OMWA 1KSWA 3QL8A 4ZLZA 4GYIA 5FTQA 5HICA 4L7FA 2ZV7A 5AP4A 1W83A 5CNOA 1CDKA 4DFXE 3OEFX 3JXWA 3RI1A 4D55A 1YI6A 3REPA 4ASXA 1VR2A 4CLJA 2YDJA 3I81A 3NPCA 4PTGA 2VWYA 3LJ1A 3QHRA 2W5AA 5JFSA 3KB7A 3OBGA 3V5JA 3UP2A 3FMJA 4I92A 3K5VA 2W99B 4NM5A 1PW2A 3U4UA 4DITA 4E3CA 4O6LA 3GCPA 4G9RA 3VAPA 3E8CA 3ZO4A 4HVIA 2I0YA 4RIOA 4GKHA 2XK9A 4QTBA 4BI1A 1KE7A 1JKKA 2BAKA 2YDKA 3Q5IA 3F5GA 3PJCA 1FVRA 4H36A 3VF9A 2BDJA 1HCKA 1ZZ2A 2R3QA 3MVLA 3OBJA 4D1XA 3PG1A 3LXLA 3W33A 1R3CA 3THBA 4ZSAA 2OJGA 1GAGA 2WELA 4FG7A 3FHIA 4KAOA 4JT3A 4I5HA 3ACJA 4BCHA 4C4GA 1Q99A 2WTIA 3DQXA 3COIA 3ULZA 3ZSHA 2NRYA 3FE3A 1V0BA 3HP5A 4HCUA 2YIYA 4CGAA 2NP8A 5JFWA 1Q8TA 2JBPA 3Q4CA 5C03A 4GEOA 4TYHB 5CSHA 3V8WA 5HNIX 3IOPA 2OIQA 2R0IA 4UY9A 4QTCA 4BBEA 3CKWA 3H30A 3KVWA 4A9YA 5J7BA 3QQFA 3LMHA 5DRDA 3W2OA 5H3QA 4S33A 4EOSA 3EB0A 2BHEA 3NSZA 4AFEA 5A4CA 4C2WA 5H8GA 4A9UA 4EORA 4LV8A 3BEAA 4DEHA 4CSVA 3MYGA 3UQFA 1ZAOA 5AX9A 4BCPA 4TT7A 4U5JA 4YTCA 3E64A 3EYGA 2QKRA 3D14A 2IN6A 3LFAA 4IANA 4LM5A 3F3UA 1AQ1A 2Z2WA 2P3GX 3SOAA 5LXMA 5E8YA 3LFBA 2QOHA 3UPXA 5FGKA 5HD7A 1WMKA 3DAJA 1YOMA 3NYXA 3S3IA 2G9XA 4L53A 4AFJA 4E8AA 4HNIA 4LUDA 1PXOA 1TQMA 3TTIA 5KZ0A 5HX8A 3TM0A 5KMOA 1FVVA 1ZXEA 3L8XA 4QMTA 3NS9A 2WTVA 4DG3E 2XEYA 4FEVA 4JIAA 5D10A 4PL5A 3GFEA 3KCFA 5ANGA 5IA1A 1ZARA 2X0GA 2ITYA 3QRJA 4C37A 1U54B 4BCNA 2PUUA 3FLQA 5D11A 4XV1A 2YCRA 3SKCA 5K0XA 4FTKA 1XKKA 4OBPA 1KOBA 4IAZA 4Y85A 4YBKA 2VX3A 5HKMA 4LI5A 2ZM1A 3F82A 2UVXA 2UW3A 3DLSA 4KKHA 1BI8A 2JD5A 2OI4X 2QR7A 5BYZA 4X2JA 5EHLA 5CNNA 1JVPP 2YM6A 3F3VA 3HMPA 4GL9A 4HPTE 2OXXA 4JLCA 3O50A 4OT5A 4NTTA 4X6QC 4KSPA 4RFYA 4HVGA 2BRBA 5CU4A 5HVKA 3C5IA 2YM3A 3AC4A 2Q0NA 3VW6A 2Z7LA 3VHKA 4C33A 2XM8A 4GVAA 3TWJA 3OUKA 2WMXA 5AUWA 3SV0A 4C4FA 3ZCLA 3UPZA 2R3GA 5HO8A 2DWBA 4ANQA 4O0VA 2VNWA 4RX5A 1TKIA 3P7CA 4QMPA 3PXYA 4I5PA 4U79A 5KBQA 5AA9A 1NW1A 2R3MA 4YUQA 4DFBA 3GT8A 3VUKA 4QD6A 1G8SA 4FUXA 5CU2A 4QP9A 1V0OA 2XK6A 3HKOA 4G9CA 2CKQA 5HEZA 5GNKA 3COKA 4A9RA 1GZNA 3FPMA 2NNWB 4YGAA 3WYXA 3MJ2A 3KK9A 2YCFA 4IQ6A 4EC8A 3DKCA 4CKJA 4F0FA 3OWLA 3QWJA 5E8WA 4AZWA 3MN3A 2IO6A 3R7VA 5K5XA 3LAUA 2GNFA 2PMOX 4PMMA 3C0IA 3DK6A 3FMNA 4CRLA 4XHKB 5BNJA 3H9OA 4AOJA 3MY0A 3ORTA 3UE4A 3M42A 2RGPA 1WBNA 1H26A 2O8YA 3RP9A 2YHVA 2RIOA 5CEIA 3AQVA 4DEEA 2B9HA 3QXOA 5HBHA 1AD5A 1J7IA 5TKDA 3VUGA 4J8MA 3U6HA 4HZSA 5M56A 3W16A 4CEGA 3FLNC 3PRFA 3AC8A 2PK9A 4DN5A 4F7SA 2BZHB 4NM0A 3RPVA 3CQEA 5DG5A 2QOOA 4GT5A 3UOHA 1QPDA 5IA4A 4WBBB 2VTAA 2YIRA 4A9SA 4AZSA 3VWAA 3NGAA 5DVRA 4O0SA 4PPBA 3GU6A 2ETKA 4M67A 2ITVA 3MWUA 4YHJA 3UQCA 3V3VA 3ELJA 4BYIA 3DB6A 4FYOA 4EK8A 1JBPE 2X6DA 2DUVA 4PNIA 5AM7A 3O17A 2OXYA 5AAEA 3WZJA 3E63A 3G5DA 1P14A 4NTSA 4G2FA 2XK7A 4QMLA 4BI2A 3CSVA 4W9WA 5EM7A 4WT6A 3W2RA 4QQTA 5HHWA 1OL1A 2WPAA 3OCTA 4JDJA 2F4JA 3QAME 3DBFA 2IZTA 4NU1A 5AV1A 4U40A 3DKFA 2JDSA 1FPUA 3VIDA 4D2WA 3SG8A 3MVMA 3PLAE 1YOJA 2GHMA 5FWKK 2QKWB 3ORNA 3ATTA 1H25A 2IVUA 1Y6BA 3CGFA 3PJ1A 3U55A 2ZV2A 4QMVA 2G2IA 3GXLA 3HUBA 3FSFA 1OECA 4IFGA 5JGAA 2QODA 4HVSA 3MA6A 5HD4A 1IA9A 3KMWA 4ITHA 2Y0AA 3GC0A 3F9NA 3TJDA 2EUFB 4BIDA 2YIWA 1H27A 2OH4A 4E5BA 3ORIA 4IB5A 4A4XA 2VWBA 4YHTA 4M69B 5DT3A 4YNEA 2YM4A 4XS2A 4LGGA 3UIXA 3W32A 3MJ1A 4MF1A 3RMFA 4DTKA 3IW5A 1QCFA 2YN8A 3OF0A 2YISA 5HBEA 1O6LA 2QO7A 1UU7A 5K0KA 4EK3A 4EK4A 1DI8A 4E93A 2PTKA 5DPVA 5KUPA 3VS1A 4UWCA 4XNEA 1OL5A 3F66A 5EI2A 4BZOA 3KF4A 3PXRA 4TYGA 2EVAA 5HE0A 3TCPA 3NW7A 3P78A 3GI3A 4FBXA 4ACGA 5D7AA 2J0KA 4FTLA 4JRVA 5AR8A 3WZDA 2W1EA 1F0QA 3OW4A 4AT5A 3DU8A 4EHGA 4EOOA 3NDMA 2YJSA 3Q5ZA 2XKCA 4D1SA 4B8LA 4NKAA 4YZMA 4FSNA 4OGRA 1R39A 4CG9A 2QR8A 1XH5A 4DGGA 3T3UA 1WAKA 3G6GA 5DH3A 2C47A 4FKGA 2B53A 3BV2A 3FYJX 4X2KA 3RNYA 2CNUA 3UO5A 3HA8A 4LGDA 5L8LA 4I6FA 1PXIA 3KGAA 4G3EA 3GCVA 2UW5A 4EONA 1W84A 4AE9A 1YXTA 2JIIA 4EQCA 2JIUA 1R0PA 3P86A 2CHLA 2V55A 3AC1A 4RC2A 2E9OA 2RG5A 3OCSA 2WQOA 3U9CA 3VUIA 5I9UA 4BDDA 2R3HA 2YFXA 4GU9A 5FG8A 2P55A 4I0TA 2GMXA 1Q62A 2PVLA 4LG4A 2B7AA 4FR4A 4Z7GA 2B4SB 2C5XA 3ZM4A 4O0UA 4DFUA 4CFFA 4CLIA 3MFSA 3SLSA 4NCTA 5JFXA 4BGGA 4AZEA 2NPQA 4L9IA 4Q9ZA 4HGEA 3F5UA 4OT6A 2IPXA 5HE1A 4EH4A 1YWNA 3TZ9A 1Z9XA 4BWKA 4IHPA 4L67A 4J8NA 5FDXA 3QRIA 4K1BA 3V5QA 1JQHA 3ZBFA 4PMPA 5L2TA 3I0QA 4OLIA 4BHNA 2CKEA 3SX9A 1K3AA 1M14A 5IEYA 4O0XA 4G17A 3AT3A 5CQWA 3PYYA 4NCTC 3KXZA 1W0XC 2W5BA 2E9NA 1UKHA 3DBEA 3DJ6A 3DZQA 3CGOA 3D9VA 3NR9A 4KD1A 2ITTA 4H1MA 3ACKA 3MV5A 4OBQA 4L3PA 3SRVB 4BIBA 4ZY4A 1H8FA 4O1OA 2JKOA 2QVSE 3MH3A 2VD5A 3DKOA 4FVPA 2XYNA 1FOTA 3KL8A 4JQEA 4WNMA 1IEPA 4XYFA 3PLSA 3TXOA 4BDAA 5B2LA 5IQAA 2BKZA 3V6SA 3NNWA 4WNOA 5BYYA 2JDVA 5E7RA 3H3CA 5EH0A 2UZVA 2C6OA 3KULB 4PL4A 4X2FA 1UNLA 4QMZA 3QTRA 4TTHB 2QD9A 3GENA 4E26A 2X2MA 4IXPA 3FLSA 4N6ZA 4FK6A 5CSWA 5AIKA 2ZDTA 3A7HA 5ANIA 1O9UA 4TPTA 4FV4A 2W9ZB 4AGWA 1V0PA 5I9YA 3KVXA 3HYHA 3FZSA 1MRVA 3QKKA 4J53A 2BIKB 1SM2A 2GTNA 3IKAA 3QGYA 3FPQA 3ZRMA 3ZRLA 3JR1A 4R7HA 4RIXA 3UOLA 3F61A 2ZMDA 1E1VA 4F7JA 4D5HA 3DOGA 3OTUA 2GNLA 1BLXA 4HYHA 2QURA 4E1ZA 5BVFA 3TNIA 2GS7A 5IH4A 3QWKA 2B9IA 4X3FA 1H08A 4QP6A 5CT0A 3PRIA 4ZTRA 5KO1A 4K6ZA 2PVYA 1RQQA 3BRBA 4RJ8A 4EH5A 4ENXA 3EL7A 2GNHA 3G2FA 3PY1A 4O2PA 5DEYA 4JR7A 5CLPA 3ZEWA 5DT4A 3NAXA 5JN2A 3EOCA 5C1QB 5LVPA 5FUTA 3MVJA 3FDNA 3MW1A 5CTPA 4B8MA 3C50A 3FI4A 3HV7A 4U8ZA 1Q8YA 1H1SA 2I40A 3Q2JA 4G16A 3EKKA 3O8TA 2JLDA 2R3JA 4X3FC 3R21A 5EOLA 4EKLA 3ZUUA 4JG8A 3F2RA 4BDJA 4JAJA 3OT8A 3ETAA 4BDHA 5GINE 5EM8A 4K9YA 4V0GB 5EI6A 5G6VA 2G2FA 5HG8A 5TT7A 3PP0A 3LXPA 4ZAUA 5DN3A 4U42A 3LQ8A 4NIFB 5M57A 4IB3A 4DGLC 2WNTA 1ZOHA 4IAIA 3VBYA 3FL5A 3FZPA 3R73A 4JXFA 3SOCA 3BZ3A 2BFYA 3ORZA 3TDVA 2RF9A 5HVYA 2ITXA 4F7NA 1NT2A 4AX8A 1KE5A 4IWOA 4I20A 4R7IA 2VTPA 4C4HA 2J2IB 4ZLYA 5CANA 3R7EA 3P7BA 4GKIA 2YAKA 4BZNA 4F4PA 3QC9A 1UKIA 3E3BX 3ZXTA 2JKQA 3NVMB 5I9ZA 5D9HA 3AT4A 5AP0A 4FL1A 4RX7A 2QU5A 3LHJA 2CMWA 4ID7A 5EHYA 4FNXA 4BCIA 3R7IA 5C01A 3IW7A 3CC6A 4FOBA 4IH8A 2BZIB 4PDPA 3KRXA 4OTGA 1ZY4A 5HI2A 3EN4A 2WEIA 4RRVA 5LCJA 3BHHA 3BYMA 3GNIB 3I0OA 1M7NA 4J52A 2CKPA 1OBGA 1YKRA 2ETRA 4NKSA 5C27A 3VQHA 1KUTA 4RJ6A 5HIEA 4BDEA 4ENYA 5I0BA 4DEAA 2O5KA 3JY0A 2OJJA 3DY7A 4NW5A 5LVMA 3MPTA 4FIEA 3OP5A 2UUEA 4R5SA 5CT7A 1W8CA 4AW5A 2VO0A 3FKOA 4OTPA 4XBRA 4CT1A 5JRQA 4FZFB 3F5XA 4FKLA 3DAEA 5M07A 4NM3A 4UXQA 1YRPA 3WE8A 3BCEA 3QD0A 2HZ4A 1YW2A 1QPEA 2UW6A 1GZOA 3Q4TA 4IFCA 3QZGA 4MD7E 1P4FA 4HCVA 5AUYA 4F6WA 2A2AA 4K11A 5BX0A 5JKGA 3JVSA 3A99A 2QLUA 3TI1A 4K0YA 5D7VA 4U97A 3O23A 4IC8A 4V01A 4IM2A 3H0ZA 4AZFA 1OPJA 3LFEA 4BB4A 4Y5HA 2V62A 1STCE 3SXRA 2XK8A 1LUFA 1L3RE 5ETIA 3RK5A 3WIKA 3U51A 3T8OA 3FMEA 5DE2A 3ZSGA 2I7QA 1XR1A 4RIYA 1SVEA 2VWIA 3SAYA 4K33A 1GY3A 3R22A 2C3IB 4W9XA 2XZSA 3D4QA 1OKVA 4FNYA 4IDVA 2C6LA 3V51A 4EQMA 1SVHA 4DGOA 4JX7A 3VRZA 5HU9A 5BVKA 2WMWA 4MXZA 5A9UA 2YCQA 3W2SA 4DG0E 5A4QA 2HW6A 3QQKA 5AP1A 2YZAA 5IA5A 4RVLA 1ZWSA 2O65A 4IADA 1MRYA 3AC5A 2EXMA 3L9MA 5CEQA 2BUJA 3AT2A 3PXKA 4M66A 4YTIA 3PY0A 3C13A 4DA5A 3LPBA 4IVAA 2GU8A 5CSXA 4YHFA 3JPVA 2BTSA 2XS0A 3QUEA 4HJOA 3TNWA 1U59A 3HDMA 3TZMA 4ASZA 4AU8A 4F9WA 1ZYJA 2IVSA 4L42A 3DNDA 2E2BA 5AAGA 1OZ1A 5FDPA 3LIJA 4UZHA 1KE6A 4KABA 4OAVB 3SG9A 2ESMA 4AP7A 3MFUA 3QRTA 5ANKA 3HRBA 4I6QA 4DEGA 5LARA 5BPYA 4F9CA 4C8BA 4EZ5A 4C4IA 5H2UA 3GC7A 3MIYA 4IVCA 3QQHA 5DIAA 3U54A 2QOQA 2A1AB 3ITZA 2WQEA 3FSKA 1GIHA 5AUVA 1Q8UA 2IW6A 4NFNA 4CD0A 2G2HA 2YERA 4RIWA 2WU6A 4CFMA 1O6KA 3BE2A 2PUPA 1H1PA 2B52A 3LMGA 4RWKA 3HV5A 4YJTA 4DEDA 2ITZA 4E4NA 4WA9A 5C9CA 4DCEA 1UWJA 4CV8A 4FEWA 4Z3VA 3H4JA 4R1YA 3NNVA 4FF8A 4ONAA 4YR8A 3FJQE 1J3HA 2SRCA 2GSFA 2I0VA 4B7TA 4QP3A 1Q97A 4QOXA 3RHKA 3E3PA 1JKSA 4IC7A 3TT0A 3AD4A 3UC4A 4A07A 3OY1A 3G6HA 2QO2A 2XJ1A 4TYJA 1Z57A 5HQ0A 3R63A 2VTIA 3OFMA 4KINA 3P5KA 1K9AA 2PE2A 3QD2B 4IX3A 4RT7A 4FV6A 2B54A 2UZNA 4OBOA 3UNJA 2GNIA 4BCFA 2QCSA 3QD4A 4JBOA 3VBQA 2PUIA 3TV7A 5E4HA 1NY3A 5CZIA 1PMUA 3FQHA 2BKKA 4W8EA 3FYKX 3IOKA 3R2YA 2OZAB 4V0GA 4X2NA 3MS9A 4YLJA 5CU3A 5BVWA 3S2PA 3KN5A 3V5PA 5IQCA 4IJ9A 4CYIA 4JG6A 4NIFA 2R3IA 4BWXA 3TIYA 4QP4A 3RPYA 1Y91A 4C57A 3SXFA 5AM6A 5EYDA 2ERKA 3KK8A 4ZZOA 5CAVA 5HG5A 4FTJA 2C0OA 4PV0A 1Y8GA 4O7YA 2HW7A 3CIKA 4J99A 4IAYA 4FIGA 3B8RA 2GS2A 4PY1A 1M2RA 1E9HA 2OLCA 4C3PA 3KRRA 4D2PA 4AT4A 3BBTB 4YJOA 4U3ZA 3W18A 3DZOA 5KBRA 5EQEA 3MY1A 1Q24A 3Q6UA 1R0EA 4ZTLA 2WZJA 4Y8DA 5EM5A 3HMNA 4S32A 4FVRA 4U7ZA 3DV3A 1H1RA 4WOVA 3HVCA 3LM0A 2BALA 2X9EA 3RZFA 3BHYA 4IVBA 2W9FB 3AD6A 3TUCA 3WZEA 1XBCA 4RZVA 1X8BA 2HOGA 3UP7A 2J51A 2YIXA 3KA0A 4CYJA 2RSVA 2J6MA 3CQWA 2WB8A 2GNJA 3AD5A 3KCKA 4M8TA 1MRUA 4MQ2A 5DEWA 4EUUA 1NVSA 1TQIA 5LMBA 1YHWA 1S9JA 4YJSA 3SW4A 3A7JA 3RM6A 4BL1A 4ZTNA 4QQCA 3UVRA 3RAHA 3IO7A 3Q53A 4K77A 4KBCA 4KS8A 2PZ5A 4A06A 4AN9A 3E62A 4J7BA 2RFSA 4CVAA 3KKVA 4XRJA 5EHOA 4M0YA 1OPKA 3EN7A 1OBDA 3FI8A 1BMKA 2RFNA 3HGKA 4IAAA 3VRYA 2FB8A 1GZ8A 2H96A 4WG5A 1UNGA 4BICA 1Q8ZA 4EH3A 4QTEA 1XWSA 3ZLWA 2ITPA 2X4ZA 4RC3A 1ERKA 3QF9A 1ZYSA 5M44A 3PP1A 5E8VA 5FTGA 2BDFA 3AG9A 5BVNA 2RG6A 4UMPA 2C0IA 5E90A 2BTRA 1PKGA 2W1IA 3KRJA 4FC0A 3C5UA 5E8ZA 5ETAA 4E6DA 2O3PA 4FKPA 3DPKA 3HDNA 4FKUA 3FMLA 4YNOA 1GZKA 2OH0E 3BBWA 4L44A 4AN3A 3R28A 3UG1A 3W2CA 3BU5A 5DFPA 4O91A 4MWIA 3ERKA 2HWOA 3GFWA 4FT3A 4S31A 5A4LA 1J7LA 3RAWA 3CBLA 4TYIA 3Q9ZA 3QD3A 5LWMA 2VO6A 1H28A 2C30A 3QXPA 3JYAA 2HY81 3S00A 5CI7A 3ALOA 3NRMA 2R3PA 4IDTA 2QG7A 2WXVA 4OTQA 2CGUA 4C3RA 2BMCA 4HPUE 3QX4A 4L6QA 2CLQA 4ZS4A 4RWJA 3ZUTA 4CFXA 2EU9A 3FLWA 2W1DA 5IKWA 2X8IA 3DBDA 4L00A 4AGUA 1A48A 2R3NA 3BLQA 5HOAA 2GFCA 4BKYA 4BWPA 1WVXA 2YLEA 3KMMA 3MBLA 5K9IA 4AW2A 5L6WL 2J5FA 3BHVA 1M17A 4C02A 2FSOX 4O7SA 3AXWA 4QNYA 5EKOA 3WF8A 3OTVA 1GJOA 4EOPA 4IWPA 4K18A 4YO6A 4LGHA 4YJNA 2LAVA 1LPUA 3C4WA 4RVTA 4BIEA 1H0VA 2YABA 2FO0A 2XNEA 3PTGA 4RG0A 2C1BA 2FUMA 3QALE 4YO4A 5IEVA 3MGYA 3UNKA 1L8TA 2JDTA 3VW8A 3OXZA 3U4WA 4WHZA 4TWNA 1J1CA 2PPQA 4PX6A 4CKIA 5BUIA 2BDWA 2ONLA 3NW6A 3G51A 4UZDA 4XG3A 1A06A 1O6YA 4IACA 4QMQA 2H6DA 2ZDUA 4BDBA 5HO7A 2WMVA 5L6PA 3ZDIA 4D0XA 4I94A 5BVEA 5HIBA 1NVRA 4RFMA 3RVGA 4ZJVA 3TACA 2QOFA 3NYVA 5JSMA 2UZOA 3MPAA 3R8ZA 4XJ0A 4WKQA 3BU6A 2Y6MA 3PJ3A 4K2RA 4BCMA 4HVHA 3EYHA 3FAAA 3RINA 4BCOA 2O64A 2J0MB 4PMTA 2X9FA 3OMVA 2OZAA 2YWVA 4FSRA 2XK3A 3VBTA 2CNVA 3CTQA 3Q3BA 2CGVA 2ONLC 2W7XA 4R6VA 3F88A 5F9EA 2X2KA 4R5YA 5CEMA 5HORA 3EQFA 4ZTSA 4G31A 1J7UA 4WUAA 3II5A 5BUJA 4WD5A 3A7GA 3DB8A 2IVTA 3LLAA 3E7VA 4GMYA 4KKGA 3H10A 2UVYA 5HG9A 4EHZA 4WRGA 4YLKA 3UOKA 4M0ZA 4YMJA 2HY0A 3MH2A 4CFUA 2WEVA 4EBWA 4N70A 4P7EA 2XNGA 2YWPA 3G33A 3R0TA 5ICPA 2ZMCA 5JQ8A 3EQHA 1UA2A 1OGUA 1PMVA 2PHKA 2X8DA 4O0WA 3QTXA 4FTNA 4P5ZA 4F63A 4XG6A 1OL7A 4RVMA 4TWPA 3D94A 5CSVA 4APPA 3LFQA 4II5A 4F6UA 5HBJA 4B4LA 4UALA 3KRWA 2FVDA 3A7IA 4IAFA 4MXCA 4DH1A 5AR7A 4RX9A 1W98A 3FQEA 3NLBA 1XH6A 3D5VA 3OS3A 4GJ2A 3ZONA 4YBJA 3D5WA 3CP9A 3HEGA 4W4VA 2WTWA 4DT8A 5ANOA 2XA4A 1H1WA 1QMZA 4B99A 3FC2A 3FMHA 2JAVA 3EFKA 2VO3A 4IM0A 4CXAA 3TTJA 1TQPA 2QHMA 5CASA 5M53A 4UMRA 5IQBA 2FA2A 3RAIA 3T9IA 3ZZWA 2UZLA 4FEXA 1BL6A 1OIUA 3BIZA 3QRKA 5A3XA 3Q52A 4USEA 3ZFYA 1DAYA 4DGMA 4BDKA 4NFMA 1IAJA 3PUPA 2PMLX 1Z5MA 2P2HA 4EH8A 4J97A 4U81A 3VQUA 2H9VA 4HOKA 4ZS0A 4UN0C 2ERZE 3F2AA 4GYGA 3WE4A 5JZJA 3IGOA 2YM7A 3ORMA 4OUCA 2VGOA 4AZVA 4TNBA 2GDOA 3P7AA 4D4SA 2CNQA 4ACCA 4AW1A 3DXPA 5DOSA 5CENA 4EH7A 2ZYBA 4FL3A 5GJDA 1CTPE 4BDIA 1PXLA 2V0DA 4QYYA 3C4CA 4LUEA 4RSSA 4G1WA 4QYHA 5DWRA 4ERWA 2B55A 5DNRA 3WILA 4O7RA 3IS5A 3QQUA 3QBNA 4ANSA 3QU0A 4ERKA 1YDRE 5GIPE 3F7WA 2C5VA 2REIA 5AP6A 3BKBA 3BI6A 3IONA 2IZRA 2VWZA 4KB8A 4EHEA 3F3WA 4EZ3A 3RGFA 3UMWA 4YPSA 1URWA 3L9LA 4AA0A 2YZLA 5BUEA 4FX3A 3M1SA 4A7CA 2XJ0A 3PVUA 4LOQA 1BUHA 1JPAA 3OG7A 2VTTA 3NWWA 4FTCA 5E8XA 2CGXA 4RIXB 5HE2A 1DI9A 5CEKA 3P08A 1MUOA 4ZP5A 4EUTA 2YEXA 2WQBA 4JDHA 5HU3A 3W2QA 3R1NA 2WKMA 4UEUA 2BRHA 3TZ7A 3ZFXA 5IPJA 5JGBA 4X3FB 1I44A 3IG7A 4UXLA 4QO9A 4FIIA 4D2RA 5EK7A 3PJ8A 4D4RA 1EH4A 2ITQA 1V1KA 4KIQA 5JK3A 4PWNA 2VTJA 3ORXA 3NUPA 4EOQA 5CI6A 4TW9A 5FTOA 5L8JA 4XLVA 1ND4A 1BI7A 5M4FA 2OIDA 2PZRA 4FT7A 4RA5A 3HRFA 4LV5A 2VTQA 5C8KA 2YIQA 5CF5A 3U9NA 4OAUC 4F0GA 5LQFA 3QZHA 5EM6A 5E9EA 3UGCA 3FWQA 2YM5A 5AA8A 1SNXA 4GUBA 3WZUA 4DH8A 3RJCA 3AMYA 5F94A 4WBOA 3T9TA 4MBJA 3CTHA 3LQ5A 1GIJA 1YQJA 4E73A 1WBVA 3A61A 3ZXZA 3DBCA 4F9AA 2QLQA 4QPAA 3TKUA 3WARA 3LW0A 2P0CA 2VTHA 3BYOA 4IWDA 5E91A 4O96A 2ZOQA 4R77A 5E8TA 4XRLA 2C6DA 2HZNA 3KN6A 2OIBA 4B6LA 3KEXA 2CCHA 3EFWA 2OF4A 4RJ5A 2QOBA 3B2TA 3C9WA 3MB7A 3TG1A 5C4KA 4YJPA 5KNJA 2AYPA 2Q0BA 3ZO1A 3HECA 2WOTA 2GTMA 5J5TA 5C26A 4EL9A 2PVNA 1ZYDA 5I3OA 5JEBA 4C7TA 2ZV9A 1OIQA 3I5NA 4FSUA 5AP5A 2R5TA 3HUCA 4GFMA 5K4JA 3DBQA 2ZV8A 4GH2A 2XNPA 3CY2A 4MK0A 1SMHA 4L45A 4H3BA 4F9BA 4GIHA 2R2PA 3BQCA 3R1QA 2ZM4A 4BI0A 2W5HA 3C4EA 5C8NA 3E8NA 3GQLA 3K3JA 2BZKB 4LRJA 3R8LA 3E88A 3U6IA 4ARKA 2Z02A 3PSDA 3NNXA 2OWBA 4QMWA 2HELA 1BYGA 3NIEA 4PTCA 1SVGA 1YHVA 3C4FA 1ZRZA 3UVQA 4MQ1A 5CF4A 4FGRA 4DG2E 4JDIA 5FP5A 3GU4A 5CXZA 4G6OA 4GRBA 2HK5A 3ZTXA 4NW6A 4QPMA 4KKEA 2VAGA 5IU2A 2XBJA 3R8VA 5AMNA 3NZ0A 2X7OA 4IX4A 4PP7A 4EOKA 4ASEA 2CJMA 3DGKA 4ALVA 4KSQA 1Y8YA 3FXZA 4ALWA 4RIYB 4QQ5A 3PIXA 4E5WA 2Y4PA 3NUSA 4JQ7A 4LL5A 4LMUA 4Y46A 1WBWA 4QNAA 4R3RA 4Z16A 2NO3A 2VO7A 4MXAA 3EMGA 4PP9A 2Z60A 2BR1A 4M12A 5F95A 5I4NA 1ZYCA 2XKDA 1S9IA 5HLNA 3A8XA 4I23A 1JSUA 3WF7A 5ANJA 3QLGA 2BZJA 5KMIA 3IW8A 2YJRA 5CEPA 4JS8A 3A60A 1VJYA 3NUNA 1KWPA 1SZMA 4L01A 1FMOE 3VJNA 3ZZEA 3LQ3A 3EQIA 3Q9XA 2Q83A 2BHHA 5HTCA 4FTOA 3D15A 3MVHA 4ANMA 4AT3A 3K5UA 3PY3A 4W4XA 4W8DA 4X21A 2X7GA 4O21A 4F9YA 3NYOA 3RWPA 2H8HA 4FZ7A 3ZUVA 5EW9A 5AV4A 5CZHA 4LFIA 4FICA 5GIOE 2OG8A 3PWYA 3GBZA 3VS2A 3RAKA 5LMKA 5DHJA 3ANRA 3R7YA 3KY2A 3I7CA 4ZXTA 1OITA 3PVWA 1WBPA 5DR6A 4RIWB 5AUUA 3CD3A 3Q60A 5JZNA 4O27B 4O7LA 4XX9A 3UO4A 4NYEA 3UTOA 2JEDA 2R7IA 1WZYA 2HZIA 3A4PA 5HO6A 2VTOA 5EYMA 3KFAA 3LCOA 3R7GA 3D5XA 3CPCA 3DCVA 3HP2A 4FZ6A 3V04A 3E8DA 4MXOA 3ZOSA 2VWXA 4QT1A 1UWHA 4CFNA 3ZM9A 4Y73A 2DYLA 4J95A 5LMKC 4O82A 2CPKE 1BL7A 2OBJA 2VV9A 5H8BA 4JBQA 4ZLOA 5IG1A 2DQ7X 1CMKE 4JRNA 4FG8A 4J71A 5ETFA 3KXXA 1ZYLA 4EHVA 3FI3A 4U45A 2BPMA 2IZUA 2UZTA 3LFDA 4FV9A 4A4LA 4D0WA 3RCDA 2R4BA 4DF3A 5GJFA 3A7FA 3B2WA 3UO6A 4I5CA 3TUDA 4CQEA 2XVDA 3I60A 4WUNA 4XG7A 5H9BA 1FQ1B 4IAKA 4U6RA 4ZEGA 5M4IA 4KS7A 5M51A 3UYTA 5L2SA 4U3YA 1M2QA 5C8MA 3R6XA 3ANQA 4FV0A 4NJ3A 1IA8A 4FSQA 4IVDA 5DR9A 3VBXA 1RW8A 2G01A 2GQGA 5IF1A 4NUSA 3BWJA 3MH1A 4FV8A 3U87A 5KX8A 5EYKA 3ZDUA 2UW0A 3ODYX 4O7WA 5IQFA 3DDPA 3IK3A 5IQDA 3S1HA 2PVJA 3LLTA 4Y5QA 3Q6WA 4WO5A 4EBVA 5CQUA 4ITJA 4QYEA 3HX4A 3FL4A 4U0IA 4FTIA 3MIAA 3FLZA 4MHAA 4TNDA 1YWRA 2NRUA 2X4FA 2EXEA 5ANDA 2ETMA 3BYUA 5CX9A 5IH6A 4RWIA 2HENA 4O7NA 4F08A 4CT2A 4TWOA 1T46A 3G9LX 2LGCA 2PZPA 3QFVA 1P5EA 1YI3A 4QMYA 3R8MA 4RVKA 5LJJA 4BRXA 5A14A 5I9WA 2R3RA 1I09A 3UC3A 3MA3A 4XV2A 1BKXA 5F20A 4F1OA 4EEVA 2Y7JA 3QQGA 3G0FA 2UW9A 4EYMA 3SA0A 2XNOA 1H00A 2OFUA 4FNZA 5FXSA 3EJ1A 5A6OA 4G5JA 4UMTA 4ORKA 3L8SA 5D1JA 3RKBA 4DH5A 5BYLA 2XCKA 1RDQE 2WFYA 3L8PA 3A4OX 2JITA 1OIRA 2IJMA 4HNFA 4C2VA 4CRSA 1E1XA 4TN6A 2A0CX 4YC8A 3D7ZA 3S95A 3O7LD 4R7BA 4DCAA 3CLYA 4ZY6A 4ASDA 5JMSA 3EN5A 3VVHA 1XBBA 3L9NA 3QCQA 3BU3A 4MXYA 5A46A 3LMIA 4FTQA 1PXMA 2HAKA 4NSTA 4D2TA 4D4YA 4QMNA 4Y72A 3DK3A 4MXXA 4IZAA 4BDFA 3KC3A 4G3DA 3VO3A 4AG8A 5IEXA 1Q61A 4BCGA 4QQJA 4HYIA 3PSBA 2PVHA 3TNQB 2XM9A 3JY9A 3LE6A 2C68A 4JX3A 2PULA 3QQLA 2AUHA 3BHUA 5T3QA 3UYSA 3D7TB 3NW5A 5AR5A 1ZLTA 3R83A 3QYWA 3GCSA 3O0GA 4IZ7A 4JL9A 3ATSA 1XBAA 3K2LA 4FT5A 3NVKI 3DLZA 4LOPA 1JLUE 3MFTA 1OKWA 4PMSA 2C3LA 4GT4A 4M15A 2XP2A 4PPCA 5IMXA 4R1VA 3EQCA 4NH1A 3JS2A 3C51A 3LZBA 4FTUA 4FV7A 4U80A 2XRWA 3DJ5A 5EOBA 4P4CA 3PA3A 3O71A 1W82A 4DH7A 2VZ6A 5M4CA 2WOUA 2E9VA 2I0HA 3EKNA 2FGIA 4TY1A 3BQRA 3R2BA 4E20A 3TZ8A 3VS0A 4I41A 3WF5A 1YOLA 2Z7SA 3ZLYA 2A27A 2GPHA 5BMSA 4FV2A 3EQPA 4C4JA 4GV1A 2VGPA 4RJ3A 3QTZA 5J95A 3QTSA 1JSTA 3EZVA 3V8TA 4RZWA 2YCSA 3NUYA 4FZDB 5AR3A 2VUWA 3PZHA 4UWYA 3CR0A 4FSZA 3GP0A 1WBTA 2PVRA 3WOWA 3KF7A 4YTFA 2PMIA 5M08A 2QQ7A 4ZOGA 4I21A 3OWKA 2AC5A 3E5AA 3PVBA 3GOPA 4LQMA 5DBXA 4DHFA 5IQHA 1GOLA 5I5ZA 4XUFA 4MEDA 4BTFA 4F1MA 4GFGA 3CD8A 5IDPA 3E92A 2XCHA 2OF2A 4CZUA 3VN9A 3UDBA 4D9TA 4EZ7A 4J1RA 4USDA 3FI2A 4X6RA 2C6EA 2I1MA 1H07A 5AX3A 5HG7A 4AOTA 3PXQA 4O81A 4H58A 4ANOA 5KE0A 2XNMA 4PPAA 3CTJA 1CKJA 3LKMA 3PE1A 4BZDA 3FXXA 4BTMA 3UJGA 1UU9A 4U41A 2XIZA 5DT0A 3UOJA 4JBVA 3B8QA 2ZB1A 4OW8A 4PUZA 3RNIA 2EB3A 3H9RA 3C4ZA 3IDPA 3R1YA 2XB7A 3BHTA 5AUTA 3Q96A 5CXHA 2PYWA 4M13A 4ZTMA 4UMQA 3P0MA 2ITUA 3L9PA 3W55A 4CTBA 4UV0A 3ORKA 3QCSA 2XYUA 4RC4A 4DT9A 2BIYA 2B0QA 3PDTA 5IA2A 3BGPA 2BCJA 3LVPA 4EH9A 5KMKA 3COMA 3QTWA 4D28A 2GHGA 4FT0A 2QU6A 2BVAA 2EXCX 3M2WA 3RK7A 3ZS5A 1ZZLA 3FKNA 5EKNA 2UZDA 3AGMA 1CSNA 4NM7A 1REJA 3V5TA 2FYSA 3GU8A 4IWQA 5HIDA 4DFYA 3D2IA 4ZY5A 3EFJA 4QRCA 1HOWA 4GW8A 4NK9A 4C36A 1R1WA 4WSYA 4YZBA 2IW8A 4BDGA 4AOIA 3LJ2A 4L52A 1YDTE 5HNBA 3FV8A 5CU6A 3ZMMA 4EI4A 3LXKA 5CAPA 3OHTA 5HLPA 4HW7A 5EW3A 5AR4A 1ZMWA 3Q9WA 1FINA 2HYYA 2X81A 4KNBA 2C5YA 5CVHA 3BPRA 1CKPA 2JFMA 3BWFA 3GB2A 4FKJA 2UZEA 4YLLA 5C4LA 4KWPA 2WQMA 2PSQA 3C0GA 2BRNA 4R3PA 3UQGA 4I5MA 3OOMA 3LCDA 3NYNA 4L3JA 4L8MA 3ZEPA 3I4BA 4YPDA 5CAUA 5AP2A 2WMQA 3GU7A 1NVQA 3OC1A 2WQNA 3QTQA 1WCCA 3HV6A 3UZPA 3ZYAA 1T45A 3HAVA 4I93A 4F1TA 3KQ7A 2W1ZA 3MH0A 4CMUA 2QG5A 4QYGA 4HCTA 2J4ZA 4CCBA 4D9UA 4KIPA 1YDSE 5I9XA 4TRLA 3TUBA 1UU8A 4E4MA 4HGSA 2HWPA 4IB1A 4GK4A 4GIIA 4XG8A 2OICA 4PDSA 5FBNC 5L8KA 1FVTA 5CU0A 4FZAB 3G9NA 3IGGA 3OT3A 5AUZA 4BCKA 2CDZA 4D5KA 1G3NA 1PF8A 5HNGA 2UW8A 3D7TA 4FUYA 5HGIA 1GNGA 4ZMFA 4BR3A 4BHZA 2C3KA 1XH9A 5J9LA 2CCIA 1RE8A 2OK1A 1SYKA 4O2ZA 1H01A 2OO8X 4PTEA 1OUYA 5E8UA 5FD2A 5GJGA 4BKJA 3HA6A 5LVOA 3VUHA 2QOCA 5I3RA 4WSQA 3GUBA 4FKRA 3CCNA 3JVRA 4TKSA 3R9OA 2J5EA 2PWLA
chains in the Genus database with same CATH superfamily
5FBOA 4X2GA 3Q9YA 1FMKA 4Y95A 4P5QA 3PJ2A 2Z7RA 2OJFE 3PFQA 2XMYA 4KRDA 1YWVA 3POZA 4ZJIA 5DLSA 4EH6A 4BC6A 2I0EA 2F2UA 4I22A 3GCQA 2AEGA 3NIZA 2F7EE 1GIIA 3SXSA 4O22A 4S2ZA 1DM2A 5IZFA 3F2NA 3U8WA 5F1ZA 3RPRA 3U6JA 5J1VA 4OTDA 2WGJA 4N4SA 3I6UA 4DTBA 5CS6A 3N4UA 4KUJA 4YJUA 4IB0A 2C0TA 4C38A 3O8PA 5E1EA 2YACA 4RX8A 3VS4A 4KIKB 3R8UA 3CKXA 4GU6A 5AV0A 4N0SA 1JKLA 4TYEA 2W1CA 1PXPA 4O1PA 2YLFA 4O6EA 3DDQA 4RQVA 1OL2A 4EOJA 4O83A 4EJ7A 4FSTA 4IX5A 1ST0A 5CEOA 4TXCA 3C4XA 2XKEA 2Y4IC 3OEZA 5B7VA 3PZEA 4I3ZA 2C3JA 4NEUA 2WMUA 4YSJA 4N6YA 3TNHA 3CY3A 5AUXA 4E6QA 3WZKA 1LP4A 2VX0A 2X2LA 4ACHA 3HNGA 3EQBA 3TNPC 1OL6A 3DS6A 3ZLXA 4RJ7A 2XF0A 4FTTA 4ZJJA 3DNEA 4HYUA 3CPBA 1H1QA 3QZIA 3D5UA 4TZRA 4ZTHA 3BELA 5EDQA 4AGCA 3C1XA 3FUPA 1KOAA 3DK7A 4DGNA 4F70A 4RJ4A 4L3LA 4MD8E 5HVJA 1MQBA 4IM3A 3VF8A 5A4TA 4AGDA 4FV3A 2OU7A 4CV9A 4UWBA 4FI1A 4MH7A 3ZBXA 2R7BA 4BCQA 3F69A 4JG7A 5FM3A 2VTMA 3GOKA 2J0IA 3OZ6A 4F6SA 3SD0A 4MVFA 4I6HA 2QHNA 1JKTA 4JNWA 4TWCA 2HCKA 2IF8A 4EWHA 4FYNA 5EQYA 5IA0A 4BDCA 3L1SA 2BRMA 4S34A 4FV1A 3RALA 3PWDA 4AN2A 1G8JA 3IPHA 3VUDA 5F4NA 4JOAA 1VEBA 1M2PA 2R0UA 3Q4UA 5BMMA 3NUAA 1OI9A 4G34A 5AP7A 5J7HA 4MCVA 2PE0A 3EL8A 1RJBA 2ITNA 2V5QA 5CF6A 3HMMA 3P1AA 4RGJA 4BBFA 4RLLA 1H4LA 1H24A 2UW7A 4I0RA 4NL0A 5B0XA 3PG3A 5AWMA 4BCJA 3LCSA 2FSMX 4KRCA 2WMTA 3QA8A 4LRMA 5KMMA 4DE4A 4JI9A 4O38A 3V5LA 4F64A 5AEPA 2RKUA 4FIJA 3KREA 3RTPA 5IA3A 3OY3A 3RK9A 4RLKA 4KA3A 3SDJA 3FZ1A 3I79A 5J1WA 2OFVA 2G1TA 3R04A 3ORLA 4FV5A 4JR3A 5IQIA 3HZTA 4YZ9A 5LCKA 2R3FA 4FTMA 2IG7A 3NEWA 4QTAA 4OTIA 1LEWA 4C0TA 4KIOA 3O8UA 4GVJA 3PPKA 3RZBA 1Y6AA 1YI4A 2HXLA 4C58A 4E4XA 3E7OA 3CEKA 4DTAA 3ZSIA 5CVGA 3OCGA 5CALA 4AW0A 2V22A 4P90A 4M68A 4J96A 4AUAA 4AE6A 4O0RA 4RPVA 3QCYA 1W2FA 3EZRA 4X7QA 3DFAA 3AKLA 1PXJA 2PY3A 2BAJA 3QLFA 4XV9A 2Y9QA 3UZTA 2PVFA 5CY3A 5TO8A 3HAMA 5ACKA 4UBAA 2FH9A 2PVKA 4BFMA 5BQ0A 2ITWA 4QP7A 4BTJA 4DAWA 3DKGA 4V04A 1G5SA 2WMBA 3EN9A 4W4WA 4FVQA 3OOGA 4FIFA 3EFLA 2I6LA 4XCUA 1PY5A 1YXUA 2OGVA 1ATPE 3VULA 4O7VA 2VWUA 1XH4A 3FY0A 3QTUA 3VC4A 4E6AA 4FA2A 5FXRA 2F9GA 2Z7QA 2R64A 4IE9A 3E93A 4GT3A 2F49A 4DFLA 3BEGA 4O84A 2J0LA 4DLJA 4RQKA 3IDBA 5K3YA 4O0TA 1ZOEA 2QOIA 3P4KA 2C6TA 3VBVA 4QDEA 3WBLA 2WMAA 3SC1A 3NUUA 5HESA 4LMNA 4XOZA 4IZYA 5LMAA 4FNWA 1PYEA 2XK4A 5JH6A 1G8KA 3TYKA 4YZDA 3VNTA 3BLAA 3A8WA 4UYNA 4QMMA 4XH6A 4QP2A 2O0UA 4DLIA 4OR5A 1IASA 4QTDA 3R9NA 4O7TA 3AC3A 5HLWA 1IRKA 4ANBA 1Q3WA 3MI9A 4EC9A 2ZB0A 3EH9A 3Q4ZA 3QKMA 5T68A 4A4OA 4D2SA 3FZTA 4LL0A 5FEQA 4FTRA 4FKQA 4IBMA 1NXKA 5AV3A 4AF3A 4UYAA 2H34A 3FMDA 3DJ7A 2F2CB 1U46A 1U4DA 3CE3A 4ACMA 4KIKA 3LCKA 3NAYA 3ID6C 4EK6A 1UNHA 3GU5A 4RA4A 5K4IA 2GQSA 5HCXA 5M06A 2WIPA 5KKRB 3GQIA 3QX2A 5TE0A 5D41A 3ORPA 3MSSA 2GNGA 3SW7A 3MB6A 3TEIA 3PA5A 1OUKA 3N51A 3WYYA 4R3CA 4H3PA 4ALUA 3CJGA 2X7FA 1WBSA 4FKVA 5GHVA 5HCZA 4B0GA 4C35A 4CQGA 2KTYA 1XHAA 5FP6A 3ROYA 3W10A 2RL5A 2X0QA 1M52A 2C1AA 4FK3A 5FEDA 4ZSJA 3PVGA 4BYJA 3FQSA 2IWIA 4FODA 1JOWB 3OWJA 3CS9A 1VZOA 2DS1A 3NUXA 2PL0A 5AIRA 3I1AA 4ZK5A 4D2VA 2VNYA 4FTAA 1YVJA 4TYHA 5L2QA 2VU3A 3QYZA 3Q32A 3VS7A 3LFNA 2W96B 5DGZA 1WFCA 2Y8OA 5E8SA 2GCDA 4GUEA 5CAOA 2Z8CA 2XUUA 3VS6A 3PPZA 2B9FA 2X8EA 2CN5A 2UVZA 3IW4A 3OROA 5DYJA 3HV3A 1YHSA 1ZMUA 2HIWA 4I1ZA 4XG9A 4TL0A 2CKOA 4BY9E 3UVPA 4YZNA 1XJDA 4CFWA 4I4FA 2OJ9A 5EW8A 4HGTA 4BF2A 5L6OA 4P2KA 1OPLA 5IMEA 2QONA 2VX1A 4WRSA 2OJIA 5CSPA 1KE8A 3RWQA 2YITA 3TKHA 4FIHA 3TDWA 3OCBA 3VUMA 1OIYA 3F6XA 5AJQA 4A9TA 5M4UA 1H0WA 1F3MC 5KHXA 1VYWA 2W17A 4X3JA 2FSLX 4ZTQA 4NJDA 4V05A 4JBPA 4ZSGA 4AS0A 4YZCA 4CZYB 4QMUA 2JKMA 2R9SA 5CWZA 4USFA 4MD9E 2JBOA 5AR2A 4MAOA 4C3FA 1JNKA 5T6KA 5FEEA 4DBNA 4IEBA 3PA4A 4PQNA 2C6KA 1R78A 3K54A 4HZRA 4XG4A 4APCA 3GVUA 5ETCA 3MFRA 4Q5EA 1J91A 4Y83A 2A4LA 3BGZA 3LFCA 3G0EA 4FSMA 4L68A 4PRJA 5EG3A 1UU3A 3E8EA 5L3AA 3QGWA 3KXHA 4MNFA 4CG8A 3SQQA 4Q9SA 4PL3A 4S30A 2WTKB 3UIMA 3Q04A 1U54A 3ZC5A 2P2IA 3NCGA 4I6BA 3MY5A 5FQDC 4EQUA 3NMUF 4YC6A 2OW3A 3H9FA 5I9VA 4FJVA 3IW6A 4FKOA 4EH2A 2QOLA 3PSCA 1PMEA 2CLXA 1UV5A 3HL7A 4L43A 3OXIA 3R9DA 5A54A 3BYSA 5L2WA 4FE2A 1QPCA 4YP8A 1KV1A 4E7WA 5M09A 2G15A 5GZAA 3FHRA 1XO2B 4GK2A 4Z55A 4GSBA 3TV4A 3WF6A 5AFVA 3F3ZA 3AOXA 3WI6A 1OKYA 4FEQA 2XH5A 1XH8A 3H0YA 1AGWA 2JDOA 4WNKA 1MQ4A 3IDCA 4XBUA 4DBXA 4GCJA 5DMZA 4U9AA 5LVLA 3LOKA 4O7ZA 5FRIA 1P2AA 4AXAA 3OW3A 1FBNA 2W1GA 5HCYA 3PXZA 3WIGA 3KRLA 3R9HA 3R1SA 2CN8A 4CMOA 2XIYA 2ZJWA 3MTFA 3QHWA 2PE1A 3JUHA 3LM5A 4M14A 2P33A 1NA7A 5HX6A 2VTSA 3FZOA 2VWVA 4NZWB 3R71A 2XIRA 3M11A 2X6EA 4LOOA 4ZZNA 3PIYA 5EI8A 4G3FA 5HTBA 2XEZA 4ANNA 1XMMA 1UVRA 3EHAA 4M97A 2NYAA 2ZVAA 5LWNA 4ZSLA 1XH7A 3DQWA 2GFSA 4UB7A 4IJPA 1KV2A 4HGLA 2JAMA 5J87A 4DFNA 1LEZA 1PMNA 2WTJA 4FKWA 5K5NA 3MESA 3FXWA 3TJCA 2QNJA 1PYXA 4FSYA 3PXFA 5HZNA 3AC2A 2F7XE 5IUGA 4UX9A 3A62A 4W4YA 3MTLA 2GHLA 5J5SA 5E1SA 3AMBA 3QUDA 3ALNA 2C6MA 5TF9A 4FKTA 2OSCA 4GS6A 1PKDA 3ZO2A 1KE9A 3TV6A 2RFEA 3F5PA 4OTRA 1FGIA 1G8AA 4JQ8A 3BLHA 2O63A 3CJFA 4B9DA 4QP1A 4RBLA 2B1PA 4MNEB 3CQUA 3F7ZA 3G90X 3OUNB 2VTNA 2XNBA 5E92A 4ZZMA 3RCJA 3O7LB 2W4OA 3UBDA 2X1NA 4FGBA 3V5WA 4BGQA 3HV4A 3MPMA 5DRBA 4IW0A 5IQEA 1ZOGA 4QMSA 2YAAA 4Q2AA 3QKLA 2YDIA 4EOMA 2XRUA 1Y57A 5JFVA 4XV3A 2CGWA 2JIVA 3GEQA 4FOCA 3KU2A 2R3OA 4NWMA 4MF0A 2V7OA 2ZM3A 4R8QA 5GZ9A 3HLLA 4JJRA 3VBWA 2JDRA 3DXNA 3SHEA 3ZU7A 4XG2A 2A19B 2J90A 1PXKA 5TR6A 2AQXA 5L4QA 4OTWA 1M7QA 1IR3A 5KKRC 1LR4A 2B9JA 1ZY5A 3LFSA 2HXQA 3NX8A 4Q5HA 5D12A 3UIBA 2C5OA 3SGCA 2YM8A 3R7UA 3ZLSA 4BKZA 3N9XA 4QYFA 3GC8A 4CTCA 3PE2A 3FKLA 3VJOA 3F3TA 4XEYA 3EIDA 3AKJA 3HMOA 4CKRA 3S0OA 5CAQA 3IECA 1TVOA 2BROA 1JAMA 2QI8A 2WO6A 1B6CB 4AA5A 3C7QA 3OVVA 3VUTA 4GFOA 4M7IA 2UV2A 4FKIA 4QMXA 5L2IA 5IUIA 1W7HA 4WNPA 2WIHA 2FSTX 4JIKA 3CXWA 4DINA 4BBMA 4EK5A 1PHKA 5AP3A 4DEBA 5HE3A 3ROCA 4F65A 2UZUE 4MBIA 4XOYA 1QPJA 4BVUA 5B2KA 2C5NA 2PZIA 4O0YA 3RBWA 4M69A 5CF8A 5ITAA 3E87A 3UODA 3KXNA 4AQCA 1Q41A 1U5RA 3BE9A 5B2MA 1HCLA 1CKIA 2XBAA 2BAQA 2RFDA 4L7SA 5DI1A 3W2PA 5KHWA 2VRXA 5ANEA 1CM8A 2WTCA 4K8AA 3BL7A 2GS6A 3W1FA 4DEIA 4QP8A 4JMQA 2J0JA 2W1FA 4E4LA 4GG7A 5LOHA 2QOKA 3ZRKA 2W06A 3UNZA 4N57A 2IW9A 3EQDA 5EYCA 3AMAA 1BX6A 2W0JA 3P79A 3PPJA 3D0EA 2R3KA 3R01A 1PJKA 4FG9A 4G3GA 2V7AA 1J1BA 2E9UA 3T3VA 1OKZA 2UZBA 2J7TA 1OM1A 4MKCA 4U44A 4C4EA 2IVVA 4IMYA 2PUNA 4MX9A 3FMKA 2ZAZA 2VTLA 4G6NA 5JT2A 3KXGA 3BV3A 5AAFA 3OD6X 1Q3DA 3IQ7A 4H1JA 4H05A 3R9RA 3VS5A 3TL8A 2XNNA 2AC3A 2R3LA 2XKFA 3ODZX 2WTKC 4YJRA 4Z9LA 3ZFMA 5JGDA 3V8SA 5H8EA 2ZFYA 3UZRA 3ML1A 2XIXA 1B38A 3ZO3A 4XP0A 4WIHA 4ZMEA 2VWWA 4G6LA 3FBVA 4DFZE 4EJNA 1WVWA 2YA9A 1IG1A 1XQZA 3BX5A 3FC1X 3GCUA 3I7BA 4E5AX 3LXNA 2HZ0A 4RFZA 4YSMA 3BLRA 3R30A 3R02A 1VYZA 4AZTA 3V6RA 5G1XA 2J50A 4GK3A 2WD1A 1W2DA 4G5PA 5BVOA 1P4OA 2ITOA 4JVGA 3G15A 1FGKA 2C69A 2BRGA 4F99A 5IDNA 3RM7A 4XLIA 4OTHA 5FXQA 4PF4A 1QL6A 2JC6A 3EQGA 2Y4IB 3ENMA 3O96A 4MYGA 5IH5A 4MBLA 4O86A 4IX6A 3COHA 4YURA 4AA4A 4FMQA 4C62A 1ZMVA 1JWHA 3DA6A 5J9YA 3SRVA 3N4TA 4FKSA 4U43A 4FEUA 5KCVA 2JFLA 4F0IA 4MWHA 3LJ0A 1DS5A 4C59A 2UZWE 3ULIA 5KMNA 1YXVA 4C34A 3W8LA 2BILB 4NT4A 5J79A 1U5QA 2F7ZE 2IZSA 3KULA 4YC3A 3LCTA 4PDYA 4ITIA 4BGHA 2P4IA 2WAJA 2ACXA 5A6NA 5IISA 3SVVA 3NNUA 4CMTA 4LRKA 4GG5A 4X0MA 4ZSEA 3MDYA 3DXQA 4EYJA 3ZH8A 3FEGA 4MNEA 3NCZA 2PU8A 4CFVA 5KMLA 4CNHA 4WG3A 4Z7HA 4CCUA 3BYVA 1A9UA 4QMOA 3KMUA 4PDOA 3P23A 5JRSA 4O4DA 4D58A 3L8VA 4OTFA 5JQ5A 2WMSA 3D2KA 3FZRA 3QC4A 3QA0A 3QCXA 4ANLA 5KMJA 4ZIMA 5EFQA 3I6WA 2WHBA 1DAWA 2OKRA 2JKKA 4M3QA 2GQRA 3FMMA 5CVFA 4KBKA 2PMNX 3DFCB 3TKIA 1PXNA 3PIZA 3DTCA 2OZOA 3UIUA 2BFXA 2W4KA 3HMIA 4FT9A 2EB2A 3GGFA 4I4EA 3OWPA 3QZFA 5J8IA 4CZTA 1WVYA 3N4VA 4XP3A 3RPSA 1OB3A 4F09A 5M55A 1F5QA 4M84A 4O4EA 3S4QA 2EWAA 1Q8WA 4E6CA 1IAHA 3Q2MA 2UW4A 3R8PA 3K3IA 5A4EA 4RWLA 3C0HA 2X39A 3OXTA 1JSVA 4HYSA 4YJQA 3TIZA 5BVDA 4I0SA 4XP2A 5AV2A 4YJVA 4EOIA 2C6IA 4AWIA 3DTWA 3LFFA 5ACBC 3ZHPC 3ET7A 4DH3A 5LVNA 3V01A 2Y6OA 3RPOA 5IUHA 3ZC6A 5FLFA 3EN6A 1B39A 3RHXA 4YU2A 5IQGA 2E9PA 1URCA 4EKKA 5J9ZA 4EOLA 1PRYA 3D83A 2VTRA 3WF9A 3QUPA 4F7LA 5DR2A 3R7OA 4H3QA 1Q4LA 2XIKA 4FSWA 1MP8A 1OVEA 4D4VA 1YXSA 4GJ3A 2W4JA 4QPSA 4MTAA 4L46A 3FLYA 3A2CA 4ACDA 2KULA 5CYIA 1Q5KA 3QRUA 1K2PA 4BTKA 4BN1A 3AGLA 5KZIA 2PZYA 3DAKA 2J9MA 2WU7A 4DC2A 3W8QA 2QC6A 2XJ2A 4EWQA 5EQPA 3TMOA 2O2UA 4DYMA 3KXMA 1REKA 3GC9A 4I24A 4R78A 2F57A 2PVMA 3UMXA 3HRCA 4KBAA 5TOZA 3VS3A 4PNKA 3EWHA 4FL2A 4YTHA 2W1HA 2OXDA 3QQJA 4RMZA 4HVDA 3R00A 3EQRA 4WG4A 3BGQA 4IIRA 4JAIA 3QTIA 1YXXA 4IZ5A 4LYNA 5EDRA 4D1ZA 4C61A 5HTIA 2WTDA 2QO9A 2VN9A 1WBOA 3POOA 4AACA 1SNUA 2WMRA 4JDKA 3FY2A 5DA3A 5GZ8A 3O51A 2W05A 3DT1A 2JGZA 3I5ZA 1APME 3UG2A 3P9JA 3VHEA 2C4GA 3O2MA 4H39A 4AAAA 5EDPA 4UMUA 4J98A 3TN8A 5FM2A 2CSNA 5AADA 3ENHA 4G3CA 4XMOA 1OMWA 1KSWA 3QL8A 4ZLZA 4GYIA 5FTQA 5HICA 4L7FA 2ZV7A 5AP4A 1W83A 5CNOA 1CDKA 4DFXE 3OEFX 3JXWA 3RI1A 4D55A 1YI6A 3REPA 4ASXA 1VR2A 4CLJA 2YDJA 3I81A 3NPCA 4PTGA 2VWYA 3LJ1A 3QHRA 2W5AA 5JFSA 3KB7A 3OBGA 3V5JA 3UP2A 3FMJA 4I92A 3K5VA 2W99B 4NM5A 1PW2A 3U4UA 4DITA 4E3CA 4O6LA 3GCPA 4G9RA 3VAPA 3E8CA 3ZO4A 4HVIA 2I0YA 4RIOA 4GKHA 2XK9A 4QTBA 4BI1A 1KE7A 1JKKA 2BAKA 2YDKA 3Q5IA 1XMLA 3F5GA 3PJCA 1FVRA 4H36A 3VF9A 2BDJA 1HCKA 1ZZ2A 2R3QA 3MVLA 3OBJA 4D1XA 3PG1A 3LXLA 3W33A 1R3CA 3THBA 4ZSAA 2OJGA 1GAGA 2WELA 4FG7A 3FHIA 4KAOA 4JT3A 4I5HA 3ACJA 4BCHA 4C4GA 1Q99A 2WTIA 3DQXA 3COIA 3ULZA 3ZSHA 2NRYA 3FE3A 1V0BA 3HP5A 4HCUA 2YIYA 4QDVA 4CGAA 2NP8A 5JFWA 1Q8TA 2JBPA 3Q4CA 5C03A 4GEOA 4TYHB 5CSHA 3V8WA 5HNIX 3IOPA 2OIQA 2R0IA 4UY9A 4QTCA 4BBEA 3CKWA 3H30A 3KVWA 4A9YA 5J7BA 3QQFA 3LMHA 5DRDA 3W2OA 5H3QA 4S33A 4EOSA 3EB0A 2BHEA 3NSZA 4AFEA 5A4CA 4C2WA 5H8GA 4A9UA 4EORA 4LV8A 3BEAA 4DEHA 4CSVA 3MYGA 3UQFA 1ZAOA 5AX9A 4BCPA 4TT7A 4U5JA 4YTCA 3E64A 3EYGA 2QKRA 3D14A 2IN6A 3LFAA 4IANA 4LM5A 3F3UA 1AQ1A 2Z2WA 2P3GX 3SOAA 4O4FA 5LXMA 5E8YA 3LFBA 2QOHA 3UPXA 5FGKA 5HD7A 1WMKA 3DAJA 1YOMA 3NYXA 3S3IA 2G9XA 4L53A 4AFJA 4E8AA 4HNIA 4LUDA 1PXOA 1TQMA 3TTIA 5KZ0A 5HX8A 3TM0A 5KMOA 5BV3A 1FVVA 1ZXEA 3L8XA 4QMTA 3NS9A 2WTVA 4DG3E 2XEYA 4FEVA 4JIAA 5D10A 4PL5A 3GFEA 3KCFA 5ANGA 5IA1A 1ZARA 2X0GA 2ITYA 3QRJA 4C37A 1U54B 4BCNA 2PUUA 3FLQA 5D11A 4XV1A 2YCRA 3SKCA 5K0XA 4FTKA 1XKKA 4OBPA 1KOBA 4IAZA 4Y85A 4YBKA 2VX3A 5HKMA 4LI5A 4DHIB 2ZM1A 3F82A 2UVXA 2UW3A 3DLSA 4KKHA 1BI8A 2JD5A 2OI4X 2QR7A 5BYZA 4X2JA 5EHLA 5CNNA 1JVPP 2YM6A 3F3VA 3HMPA 4GL9A 4HPTE 2OXXA 4JLCA 3O50A 4OT5A 4NTTA 4X6QC 4KSPA 4RFYA 4HVGA 3P5JC 2BRBA 5CU4A 5HVKA 3C5IA 2YM3A 3AC4A 2Q0NA 3VW6A 2Z7LA 3VHKA 4C33A 2XM8A 4GVAA 3TWJA 3OUKA 2WMXA 5AUWA 3SV0A 4C4FA 3ZCLA 3UPZA 2R3GA 5HO8A 2DWBA 4ANQA 4O0VA 2VNWA 4RX5A 1TKIA 3P7CA 4QMPA 3PXYA 4I5PA 4U79A 5KBQA 5AA9A 1NW1A 2R3MA 4YUQA 4DFBA 3GT8A 3VUKA 4QD6A 1G8SA 4FUXA 5CU2A 4QP9A 1V0OA 2XK6A 3HKOA 4G9CA 2CKQA 5HEZA 5GNKA 3COKA 4A9RA 1GZNA 3FPMA 2NNWB 4YGAA 3WYXA 3MJ2A 3KK9A 2YCFA 4IQ6A 4EC8A 3DKCA 4CKJA 4F0FA 3OWLA 3QWJA 5E8WA 4AZWA 3MN3A 2IO6A 3R7VA 5K5XA 3LAUA 2GNFA 2PMOX 4PMMA 3C0IA 3DK6A 3FMNA 4CRLA 4XHKB 5BNJA 3H9OA 4F78A 4AOJA 3MY0A 3ORTA 3UE4A 3M42A 2RGPA 1WBNA 1H26A 2O8YA 3RP9A 2YHVA 2RIOA 5CEIA 3AQVA 4DEEA 2B9HA 3QXOA 5HBHA 1AD5A 1J7IA 5TKDA 3VUGA 4J8MA 3U6HA 4HZSA 5M56A 3W16A 4CEGA 3FLNC 3PRFA 3AC8A 2PK9A 4DN5A 4F7SA 2BZHB 4NM0A 3RPVA 3CQEA 5DG5A 2QOOA 4GT5A 3UOHA 1QPDA 5IA4A 4WBBB 2VTAA 3NFGB 2YIRA 4A9SA 4AZSA 3VWAA 3NGAA 5DVRA 4O0SA 4PPBA 3GU6A 2ETKA 4M67A 2ITVA 3MWUA 4YHJA 3UQCA 3V3VA 3ELJA 4BYIA 3DB6A 4FYOA 4EK8A 1JBPE 2X6DA 2DUVA 4PNIA 5AM7A 3O17A 2OXYA 5AAEA 3WZJA 3E63A 3G5DA 1P14A 4NTSA 4G2FA 2XK7A 4QMLA 4BI2A 3CSVA 4W9WA 5EM7A 4WT6A 3W2RA 4QQTA 5HHWA 1OL1A 2WPAA 3OCTA 4JDJA 2F4JA 3QAME 3DBFA 2IZTA 4NU1A 5AV1A 4U40A 3DKFA 2JDSA 1FPUA 3VIDA 4D2WA 3SG8A 3MVMA 3PLAE 1YOJA 2GHMA 5FWKK 2QKWB 3ORNA 3ATTA 1H25A 4AXDA 2IVUA 1Y6BA 3CGFA 3PJ1A 3U55A 2ZV2A 4QMVA 2G2IA 3GXLA 3HUBA 3FSFA 1OECA 4IFGA 5JGAA 2QODA 4HVSA 3MA6A 5HD4A 1IA9A 3KMWA 4ITHA 2Y0AA 3GC0A 3F9NA 3TJDA 2EUFB 4BIDA 2YIWA 1H27A 2OH4A 4E5BA 3ORIA 4IB5A 4A4XA 2VWBA 4YHTA 4M69B 5DT3A 4YNEA 2YM4A 4XS2A 4LGGA 3UIXA 3W32A 3MJ1A 4MF1A 3RMFA 4DTKA 3IW5A 1QCFA 2YN8A 3OF0A 2YISA 5HBEA 1O6LA 2QO7A 1UU7A 5K0KA 4EK3A 4EK4A 1DI8A 4E93A 2PTKA 5DPVA 5KUPA 3VS1A 4UWCA 4XNEA 1OL5A 3F66A 5EI2A 4BZOA 3KF4A 3PXRA 4TYGA 2EVAA 5HE0A 3TCPA 3NW7A 3P78A 3GI3A 4FBXA 4ACGA 5D7AA 2J0KA 4FTLA 4JRVA 5AR8A 3WZDA 2W1EA 1F0QA 3OW4A 4AT5A 3DU8A 4EHGA 4EOOA 3NDMA 2YJSA 3Q5ZA 2XKCA 4D1SA 4B8LA 4NKAA 4YZMA 4FSNA 4OGRA 1R39A 3PFYA 4CG9A 2QR8A 1XH5A 4DGGA 3T3UA 1WAKA 3G6GA 5DH3A 2C47A 4FKGA 2B53A 3BV2A 3FYJX 4X2KA 3RNYA 2CNUA 3UO5A 3HA8A 4LGDA 5L8LA 4I6FA 1PXIA 3KGAA 4G3EA 3GCVA 2UW5A 4EONA 1W84A 4AE9A 1YXTA 2JIIA 4EQCA 2JIUA 1R0PA 3P86A 2CHLA 2V55A 3AC1A 4RC2A 2E9OA 2RG5A 3OCSA 2WQOA 3U9CA 3VUIA 5I9UA 4BDDA 2R3HA 2YFXA 4GU9A 5FG8A 2P55A 4I0TA 2GMXA 1Q62A 2PVLA 4LG4A 2B7AA 4FR4A 4Z7GA 2B4SB 2C5XA 3ZM4A 4O0UA 4DFUA 4CFFA 4CLIA 3MFSA 3SLSA 4NCTA 5JFXA 4BGGA 4AZEA 2NPQA 4L9IA 4Q9ZA 4HGEA 3F5UA 4OT6A 2IPXA 5HE1A 4EH4A 1YWNA 3TZ9A 1Z9XA 4BWKA 4IHPA 4L67A 4J8NA 5FDXA 3QRIA 4K1BA 3V5QA 1JQHA 3ZBFA 4PMPA 5L2TA 3I0QA 4OLIA 1TFFA 4BHNA 2CKEA 3SX9A 1K3AA 1M14A 5IEYA 4O0XA 4G17A 3AT3A 5CQWA 3PYYA 4NCTC 3KXZA 1W0XC 1TZDA 2W5BA 2E9NA 1UKHA 3DBEA 3DJ6A 3DZQA 3CGOA 3D9VA 3NR9A 4KD1A 2ITTA 4H1MA 3ACKA 3MV5A 4OBQA 4L3PA 3SRVB 4BIBA 4ZY4A 1H8FA 4O1OA 2JKOA 2QVSE 3MH3A 2VD5A 3DKOA 4FVPA 2XYNA 1FOTA 3KL8A 4JQEA 4WNMA 1IEPA 4XYFA 3PLSA 3TXOA 4BDAA 5B2LA 5IQAA 2BKZA 3V6SA 3NNWA 4WNOA 5BYYA 2JDVA 5E7RA 3H3CA 5EH0A 2UZVA 2C6OA 3KULB 4PL4A 4X2FA 1UNLA 4QMZA 3QTRA 4TTHB 2QD9A 3GENA 4E26A 2X2MA 4IXPA 3FLSA 4N6ZA 4FK6A 5CSWA 5AIKA 4QEBA 2ZDTA 3A7HA 5ANIA 1O9UA 4TPTA 4FV4A 2W9ZB 4AGWA 1V0PA 5I9YA 3KVXA 3HYHA 3FZSA 1MRVA 3QKKA 4J53A 2BIKB 1SM2A 2GTNA 3IKAA 3QGYA 3FPQA