4CMOA

Structure of the human anaplastic lymphoma kinase in complex with the inhibitor 2-((1r)-1-((3-amino-6-(2-methoxypyridin-3-yl)pyrazin-2-yl) oxy)ethyl)-4-fluoro-n-methylbenzamide
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
309
structure length
295
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 295
sequence length 309
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cmoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cmoA01
2C6LA 4O0XA 4YGAA 4EUUA 2JAMA 4MK0A 3LPBA 4F6WA 4TYIA 3RPVA 5KMNA 3K2LA 4K1BA 4YP8A 1NVQA 3F5PA 2BPMA 3SV0A 4IVBA 2VZ6A 4BGHA 5IQCA 3EN7A 2KULA 3S0OA 2C0TA 4YPSA 4UXQA 3T9TA 5AIRA 2XRWA 4KKGA 1ZXEA 3CCNA 3IGOA 2HIWA 1OGUA 4QP4A 5C03A 3LFCA 3O8TA 1UU3A 2XK4A 3SQQA 5HX6A 3IW4A 3M11A 3I7CA 4DGMA 1OIUA 4FNZA 2QHNA 2YDIA 5JZJA 5JSMA 3SLSA 4O7ZA 1KE8A 2W5BA 3OROA 3WE8A 2ZB1A 4GEOA 3AG9A 4ZTNA 3P78A 2WQNA 3Q2MA 3UYSA 2C5VA 3RINA 2AYPA 1G8AA 3RJCA 3BGZA 4QPAA 5BMMA 1KE5A 1GIIA 1KE7A 4P2KA 2XCHA 4W4YA 3KVWA 4ANBA 4CFXA 1IAJA 3UIXA 3BHUA 3OEZA 3QUPA 4G31A 2C4GA 4B0GA 4L42A 4Z7HA 4GK4A 4RIWB 1E1XA 4O0UA 4QD6A 5CSXA 2BFYA 3F61A 3IW5A 4C34A 3BLQA 1KOBA 1YOJA 4RPVA 4EJ7A 4S33A 3VS5A 1IA9A 4ASEA 3HYHA 2Y4IC 3MH3A 1M7NA 2IZRA 5DH3A 3HV5A 4WHZA 4DEHA 3GCQA 5HVJA 2HYYA 4O7RA 2C47A 3QZFA 4KIKB 2G15A 2Z7RA 5HLWA 3DBCA 3KXXA 4FTAA 4BCHA 3AGMA 2J9MA 3MB6A 4FX3A 4I3ZA 4BCFA 4ENXA 5IEXA 3NS9A 5AWMA 4G17A 2P4IA 3C4WA 5C8NA 4FV5A 4R3CA 2EUFB 5L2QA 4FIGA 4JAIA 3LQ3A 3DAJA 3QRKA 4G3CA 2JDRA 3EZVA 3HV4A 4IWQA 5AUWA 5ACBC 1FQ1B 4FICA 5L2TA 1ZLTA 3OWKA 4N6ZA 4WOVA 3UOKA 5JMSA 2WZJA 1QPCA 4FTUA 3NYVA 4ACCA 3RKBA 2RL5A 3VUHA 5CF8A 5A4EA 2ZVAA 3O7LB 4U80A 2O8YA 3VN9A 4RJ5A 4M69B 2ETKA 2GNGA 2YIQA 2Y8OA 3FL5A 4KD1A 5TO8A 4V01A 5LOHA 4YJTA 4K0YA 3TUBA 3Q60A 2PVRA 4PMTA 3WZEA 4MNEB 4I0SA 2BKKA 4H05A 3HAMA 5IMXA 4DCAA 2GHGA 2HWPA 4RBLA 3QUDA 2O64A 3EQDA 5GJGA 3ZXTA 2GNFA 4TYEA 2ZMCA 4FTNA 4NL0A 4FV7A 2VO0A 3DKCA 4Y46A 4ZIMA 4MXZA 4C4IA 2GDOA 5L8KA 1IRKA 4AT5A 4IVDA 4OTRA 3HZTA 3CY2A 1TQPA 1T46A 2WIHA 4FTQA 4X3FC 4YJPA 2PULA 3IONA 3W8QA 4RIYB 3VUKA 4RC3A 2V7OA 1URWA 5D11A 1QCFA 1NY3A 4NJ3A 2WD1A 2C1BA 4X2GA 3FI8A 3Q4UA 3K54A 1PKGA 4CCUA 3NGAA 3D2IA 3BEAA 5FEEA 5DR2A 3TL8A 4BCNA 4HVDA 2IG7A 3GC7A 4R1YA 4YTHA 1BL6A 4JBVA 5CEPA 4GJ3A 4BB4A 2WAJA 3E7VA 4CTBA 2XCKA 4C35A 3DOGA 4ANLA 5D1JA 5EKNA 3D5XA 3DFAA 1UWHA 1SVEA 2BZIB 3H4JA 4QNAA 5CI6A 2F7XE 4AAAA 4YZBA 2W1EA 3QUEA 2CGUA 2J51A 4EORA 4V0GB 3PLAE 5JK3A 4U43A 4EBWA 2ZV9A 2BRHA 5CEOA 3C4ZA 3Q9WA 2ITYA 4FTLA 4IX4A 4PDPA 4X3FB 3EQHA 4D2PA 3GI3A 4CKIA 3OCTA 4XX9A 3ORIA 4ASXA 4U45A 4C3RA 4QP6A 5KMOA 4CFNA 4FEUA 4Z9LA 4QP7A 5KBRA 4Z7GA 2J0LA 2WXVA 4BCKA 4HVHA 4DTAA 5EK7A 4C59A 3NWWA 5CQUA 2OK1A 4G2FA 3BZ3A 4UZDA 1HCLA 3WOWA 5J87A 3ZDUA 5IQAA 2JKQA 2PMIA 3U4WA 3UMWA 3LLTA 3W2RA 2IVSA 4JBQA 3CR0A 4RWIA 4XG3A 3KGAA 4GFOA 3GXLA 4YJQA 3UIMA 2JDTA 4DBNA 4DTKA 3VHEA 3IK3A 1G5SA 5CF6A 2BZJA 2WQBA 3V04A 4R8QA 3GB2A 3I60A 5LWMA 5BQ0A 5LVNA 2VN9A 2GU8A 5CAVA 4FVRA 3WF6A 4EQUA 3GOKA 2UW9A 3L9NA 4FV2A 1R0PA 1SYKA 4TRLA 4GIIA 4NZWB 4DBXA 3ZSHA 4CQEA 3OBGA 3MFRA 1M17A 2J5EA 3PXRA 3E7OA 1TVOA 4G3GA 4D1ZA 1Q61A 3G15A 2X4FA 3H0YA 4FEXA 2YIXA 2IN6A 4XV2A 4OUCA 3UVQA 3D14A 5CSVA 1BL7A 3TKHA 2ONLC 1I44A 1A06A 3F3ZA 3ZZEA 1JKLA 3UODA 4F0GA 5B0XA 1YW2A 2OH0E 2XEYA 3NAXA 3UPZA 2YHVA 3QU0A 2C68A 1GIJA 5HVYA 3G51A 3F3UA 3PYYA 3DKGA 2CGXA 3W2CA 4ZOGA 5DRDA 3C9WA 3R30A 5EHLA 3QYZA 5KMJA 1V0PA 1WFCA 4II5A 2JKOA 5C27A 5CEKA 4GRBA 5EQPA 1ZOGA 4IWOA 4C02A 3M42A 2OH4A 2J50A 4CMOA 3W2SA 4BBFA 2XK3A 3CC6A 3O2MA 2YLEA 4DGGA 4YHJA 3ZOSA 4LFIA 4IH8A 4BL1A 3ALNA 3WF8A 2B9FA 4FG7A 3OF0A 4RJ4A 4F7JA 4AGDA 3N4VA 5HTIA 3OUKA 3VS3A 3UVRA 5IDPA 1FMOE 4E5WA 1PMUA 3OCGA 4WA9A 2HXQA 3W2QA 3V6RA 2CLQA 3FZ1A 3LXKA 4I5CA 4PL3A 2BVAA 4FVQA 4USFA 4M0ZA 3E63A 1RE8A 1PF8A 2VRXA 3D4QA 3PXFA 3ZHPC 2QOIA 2ZV7A 3PTGA 3VBQA 3DNDA 3PY0A 2QLUA 4F70A 4YSMA 3V5TA 3ZLXA 4DFBA 2GTNA 3BYMA 2FA2A 3ACJA 3FXWA 3LFNA 4KA3A 1J7UA 5CVGA 2F57A 4UWBA 5BYZA 2J6MA 4X2KA 2ZM4A 3BELA 3DKOA 4A9UA 4E3CA 4KNBA 4PWNA 1REJA 4KS8A 2Y6OA 4DCEA 2OO8X 3R9OA 4D4VA 4FTJA 4EYMA 5AAGA 3ELJA 4UMQA 4JNWA 4M97A 2GCDA 3E87A 4GK3A 3TNQB 4YTIA 4WG5A 3R7IA 3ORZA 4TWPA 1PY5A 4IC8A 2PPQA 4MD8E 4OBOA 2WB8A 4OT6A 4UY9A 4BF2A 4IJPA 3QHRA 5HIEA 3R2YA 2WMQA 1YQJA 2W9ZB 3CGOA 5DT0A 3FKNA 3O96A 2GSFA 2EB2A 2WTKC 2UW3A 3FBVA 3L8SA 1FOTA 3KKVA 3V8TA 4JQ7A 4BZOA 5B2LA 3FZSA 4RVKA 3GU7A 5A54A 4FKVA 3QXPA 1VEBA 4YZMA 4O7YA 4FIEA 3DPKA 4IM0A 4AZWA 1KSWA 4NM3A 4XOZA 1H26A 5BVKA 3M1SA 3ALOA 4BIDA 4IHPA 5IZFA 2Z60A 4FV0A 4J1RA 5M09A 3NRMA 1OKZA 1ZARA 1CSNA 4ZTRA 1WBOA 1NA7A 5DT3A 3KC3A 3KU2A 4YZDA 3VQUA 5DIAA 4RGJA 2PYWA 5HORA 3LLAA 4PDOA 2Y6MA 2IW9A 4ZJVA 3U54A 2XK6A 4O83A 2B7AA 3QQLA 5CTPA 3VUIA 4FV9A 4U8ZA 2XVDA 3V8SA 2YIWA 3KQ7A 4IZ7A 2CHLA 2PHKA 4EYJA 2WTKB 3OUNB 4FBXA 4OTQA 3COIA 4RJ3A 3TIZA 2R64A 3FMMA 2ITUA 4DGNA 4F6UA 5JGBA 3BQRA 3U8WA 2ZAZA 5L4QA 2CN8A 2QU5A 3F7ZA 5HO6A 4Y72A 3UTOA 4W8DA 2QR7A 5IDNA 2OICA 3NNWA 3WZJA 3Q5IA 3NCZA 4F7LA 4BDDA 1GNGA 5ICPA 1UU7A 2JD5A 3R6XA 4FYNA 3LFQA 3RWPA 4RJ7A 1U5RA 4XV9A 1Q99A 2Z02A 4YO6A 2YWVA 4WNKA 2RIOA 3R7VA 4XH6A 3BU5A 5LMKC 1YXVA 4KB8A 5AV3A 3I1AA 4KRCA 4OTPA 4C38A 4IB0A 3LFBA 3EKNA 3C4XA 3LM5A 4QMOA 4CV8A 3NAYA 1GZ8A 3NYNA 3LCOA 2FO0A 3LE6A 4TTHB 4WKQA 3DA6A 3HL7A 5E8SA 3BV3A 5BYYA 1Y8GA 4RSSA 4Z55A 3R9HA 1PW2A 2X0GA 3IDCA 4FR4A 5D10A 3VIDA 2GS6A 4X3JA 5FWKK 2OSCA 3VW6A 1GZKA 2VWIA 1YWNA 3A8XA 3QTQA 4S31A 1YWVA 5LQFA 3C0IA 3R22A 3UOHA 1YRPA 2OIBA 3GCVA 1QPJA 2W4OA 4O0SA 5AJQA 4EHZA 3DFCB 3HDMA 5LVPA 3BYOA 3FC1X 2JDOA 5GJDA 5DMZA 1ATPE 3PWYA 1W82A 3TV4A 3QD4A 3TZ8A 1R3CA 4XV3A 4DN5A 1EH4A 1SNXA 3P4KA 5E91A 1BKXA 3TG1A 4A4LA 3OTUA 3OOMA 4FEVA 4L67A 1DI8A 4AS0A 3RPRA 4RQKA 2OW3A 4U3YA 3QQFA 5J1VA 4YBKA 1RW8A 4YC8A 2GS2A 4AT3A 2HENA 4EK8A 2QKRA 4XG2A 2F7ZE 4IE9A 4RLKA 4X6RA 4IDVA 4FODA 5KZIA 5C8KA 3FUPA 3JPVA 4EQCA 4U6RA 3E8EA 4QMZA 4YJNA 4BBMA 1P4FA 1J7LA 3H9FA 4JIKA 3FKLA 4A4OA 2Q0NA 4BKZA 1OKYA 3SRVB 4EK4A 1KV1A 4XP0A 5AP5A 5HU3A 1T45A 1H1WA 4TYJA 2ZM1A 1PXNA 4J8NA 4TYGA 3UG2A 4GKHA 4DGLC 2RSVA 2FB8A 2P2IA 1M2QA 3ANQA 3DZQA 4QTCA 4QYEA 3OBJA 2HW7A 2R3FA 2G2FA 4DINA 4JI9A 3GQIA 3V5QA 2A4LA 2UZDA 4AOIA 3RVGA 3NCGA 4BGGA 3VS7A 3MFSA 3R8PA 4EJNA 3BBWA 3F5GA 5J9YA 1QPDA 3RHXA 4IM3A 3VRYA 1OL5A 4M12A 3WARA 2F9GA 4YZNA 4EOJA 3A2CA 4QPMA 2CCIA 3C51A 4ZSEA 2OJJA 2A2AA 3PIYA 4S32A 4O84A 5CX9A 4MYGA 1TQIA 4JDKA 4AW1A 3MPTA 3NZ0A 5A4LA 5HBJA 3ANRA 2PMLX 3E8NA 3VW8A 1SVHA 4PTEA 2WEVA 2WMRA 3ZFXA 5CNOA 4J53A 2XUUA 2XMYA 4BHZA 4GVAA 2JEDA 5IQGA 4RZWA 3BPRA 4UWCA 3EIDA 3VS2A 5JGDA 1JBPE 2A0CX 3KRLA 4MX9A 3UOLA 4Y85A 4GUBA 4QQJA 2BRGA 2O5KA 4IAFA 3IW6A 2WTCA 4FIFA 2IZTA 1BLXA 5DHJA 5BUIA 2VTNA 4YZ9A 3ZCLA 3DK6A 4P4CA 2A1AB 2FVDA 2GQGA 4QYHA 4N70A 2R7BA 5DNRA 3ULZA 3VHKA 2YITA 4IBMA 3QQGA 2VTRA 1H08A 4YJVA 1Y8YA 2WU7A 2CN5A 4PDYA 3HNGA 2R5TA 4J98A 4F09A 3O23A 2UW4A 3PJ8A 3PP1A 1Q62A 5KMMA 2I0YA 3TKIA 3R1QA 1XKKA 4WSYA 5HLNA 4MBIA 4XEYA 2YZAA 3ORPA 4GFMA 3BHTA 3PA3A 5DOSA 5HG5A 4EK5A 4BDJA 3UQGA 4G9CA 2BFXA 4CFVA 2VWUA 3NUAA 3PRFA 5CQWA 4I22A 5F1ZA 3U87A 3ZC5A 3N51A 4FZ7A 4G3FA 4QP2A 2HZIA 4TNDA 4U81A 3DU8A 2I7QA 3BGPA 4MF1A 3VC4A 3PXZA 1U4DA 4R1VA 5IA1A 1YI6A 2C3JA 2VD5A 2XS0A 3MVHA 4LRKA 4M3QA 4RIXB 2R9SA 3I6WA 4X2FA 5BNJA 3R0TA 4JAJA 2XKCA 4DYMA 4EH4A 2B4SB 2G2HA 3CXWA 4EZ7A 1YHSA 2YCRA 3C1XA 1WBVA 1R1WA 3QQHA 4ID7A 5AUVA 2HK5A 4D5KA 5C01A 3OZ6A 1XBBA 3I5NA 5ANDA 3TUCA 4G3DA 5IQHA 4ACHA 1ZYCA 2C6EA 1H1QA 2UZBA 2YM4A 3KK8A 2JFMA 4IIRA 4PQNA 4ZLOA 3ZUVA 1OVEA 2X2KA 3DLZA 4F1TA 2GFCA 2Z2WA 4E20A 2LGCA 2QCSA 4YR8A 4QMXA 4F65A 3SG9A 4RX8A 4AFJA 3FI3A 3MH1A 4C3FA 4FA2A 4WG4A 5CXZA 1B38A 2QOLA 3AT3A 2JIIA 2VWWA 2XZSA 2W1ZA 3FMLA 3TT0A 3W55A 4HGLA 3UNJA 3ATSA 3AD4A 2BIKB 4CGAA 1W0XC 3H3CA 4FL2A 1I09A 1ZZ2A 2R3QA 2WMSA 2PVMA 3I6UA 5HNIX 4LQMA 4FSQA 3RM7A 4C58A 2UW5A 4D4RA 4NTSA 4ZTHA 1FGIA 4RJ6A 4WSQA 4TKSA 4Y95A 2NRYA 1H1SA 2X1NA 4EOLA 4L46A 4CFWA 3TDWA 1PMNA 4DH8A 2BALA 5JFVA 3DCVA 4CRLA 5ETCA 2V22A 4HYUA 3WYYA 4FZDB 3GFWA 5J95A 3QD3A 3CJGA 4RWJA 3OHTA 4IAAA 4HGTA 3S95A 3IPHA 4YSJA 4XUFA 4IW0A 4FIJA 4OLIA 2YIYA 1WBNA 4EL9A 3LFAA 2E9VA 3FMDA 2RG5A 2ZDTA 4M0YA 5EM7A 5EYCA 3EFLA 3CKWA 2PUNA 5E9EA 4NSTA 4USDA 4BWKA 4HYSA 4D4SA 2OJFE 5B7VA 5IQDA 3QTXA 4D4YA 4OTIA 4QP3A 4JJRA 3HV3A 1AD5A 5AP3A 2UZLA 4PL5A 4CV9A 4EZ5A 4CLIA 4NCTA 5GZAA 3PXKA 5J7BA 4FKQA 3DB6A 3F6XA 4USEA 4JR7A 2GPHA 4Y73A 5TF9A 3Q4TA 3FPQA 2E9UA 4RT7A 4P90A 5HOAA 4FV4A 3NEWA 4IX3A 5I9XA 3RM6A 2GNIA 4C0TA 3TEIA 3ZEPA 2GS7A 2X2LA 5DVRA 1NVRA 2QOHA 4GUEA 3QZGA 1O9UA 4AW5A 1YDSE 2XBJA 1UVRA 2YCFA 4GJ2A 4I21A 4M84A 4O6LA 1HOWA 2OXYA 5CYIA 2BCJA 4FUXA 3FMEA 5EYMA 1U46A 1RQQA 3L9PA 5DG5A 1IR3A 5L6WL 4FT9A 4L52A 3BHYA 2CKEA 1LP4A 3ZRLA 5J79A 4O27B 1OUKA 3R28A 3P9JA 5AR8A 3QF9A 2R3OA 2XRUA 2XKEA 3EMGA 3PPJA 3RZBA 2HW6A 1WCCA 2REIA 4PP7A 4I0TA 2PZIA 4IB5A 2WPAA 5CS6A 3V6SA 3VBTA 1KE6A 3NVMB 3UC4A 2GMXA 2BTSA 4F7NA 5C4LA 4MQ2A 2QD9A 4LG4A 4ORKA 5M55A 5HVKA 3PSCA 3FJQE 4EH8A 4YC3A 4K77A 4PV0A 4YHFA 4FVPA 3RHKA 1Z9XA 1YVJA 2DS1A 5J8IA 5AR7A 4UMUA 3EL7A 3ZLSA 4BGQA 1W7HA 2R0IA 3GVUA 4UMPA 5BUEA 1J1CA 3P7BA 5JFSA 4E5BA 3U4UA 2XJ1A 3MVMA 3NUUA 4RC4A 5ETAA 5HICA 4TPTA 5BVWA 3MFTA 3LW0A 1RJBA 2WHBA 4OTWA 3GU5A 3KFAA 1PYEA 4HGEA 4X2NA 3RZFA 3ZRMA 3ZSIA 3LFSA 1U54A 1SVGA 2PY3A 5AX9A 2PE2A 5CU6A 5T6KA 4IB1A 4AQCA 1P4OA 3RP9A 3BYSA 4BWXA 2VWZA 3F3WA 3FSKA 4ZSGA 5IUHA 3R7YA 3SX9A 3MTLA 2QURA 3QKKA 5HG9A 3VBYA 3NDMA 1ZOHA 4PDSA 2YCQA 3SDJA 5CEQA 3GCPA 4GYGA 1OIYA 3ZO4A 3E8CA 4DFLA 4KBCA 2R2PA 2QQ7A 3E3BX 4MKCA 1P2AA 3R9NA 4ANSA 4QMQA 4I5PA 4ANNA 3CBLA 4L01A 3LXLA 2E9OA 3R7EA 4RFMA 3EQIA 5E8XA 4O7LA 3NIEA 4O38A 1QMZA 3LXNA 3TWJA 3HUCA 2YM5A 4ZSAA 4WO5A 4BCQA 3Q6WA 3HLLA 2X8DA 1UNHA 4F0FA 1Q3DA 4X7QA 3PVGA 5E8YA 3DQXA 2CNQA 5DT4A 3FY2A 3U6HA 4HPUE 3KK9A 5B2MA 2X7GA 4K18A 2J0MB 3ROCA 1OI9A 1XH8A 3FZPA 3MV5A 3BKBA 3HV6A 4BTFA 3VUTA 2UVXA 2UW8A 2BMCA 3FV8A 1CKJA 2WKMA 2GQRA 3GQLA 3OMVA 3HKOA 1E9HA 3ENMA 3LVPA 3ORKA 3PZHA 4GT5A 4I5MA 4MD7E 3PLSA 4DT8A 1M2RA 5HCZA 3C4CA 2VNWA 5BYLA 3AT2A 3DAKA 4PMMA 5HG7A 3DJ5A 1OECA 3D5VA 2F4JA 3KB7A 3F5UA 3OP5A 3OY1A 3BWFA 3QX4A 2RFNA 3TZMA 4E4XA 3AC3A 2BR1A 5K5NA 2HY0A 2YIRA 3HMNA 3V51A 4EH7A 2CCHA 2VTHA 3TV6A 1UV5A 4R6VA 4G5PA 1CM8A 3AMYA 4F9YA 4B6LA 2VTOA 4ERWA 2V62A 5A4QA 2GQSA 2XNEA 5HBHA 5AEPA 3CE3A 2VX3A 2PSQA 4NIFB 3KY2A 3FI2A 3LOKA 1L3RE 3V01A 3DBEA 2VO7A 2OGVA 4B99A 3DK3A 1AQ1A 4MWHA 3TKUA 4CCBA 4YBJA 2X39A 3FQSA 4ITHA 5HEZA 5HE3A 1FBNA 3NW5A 1K2PA 1RDQE 3KULB 2PVNA 3QZHA 4C36A 2RFEA 3IG7A 2ZDUA 4BCJA 3UZTA 3WZDA 4BCGA 3Q5ZA 3JYAA 2JBPA 4FZ6A 3LMHA 5AUYA 3R1NA 3Q4CA 5FM3A 4J7BA 4H3BA 2I0EA 3K3IA 2C3LA 3JR1A 3QRTA 3EQFA 3HGKA 4EC8A 3QRUA 2ITOA 1GOLA 5FBOA 4NH1A 3VF8A 1YDTE 4ITJA 2UZOA 3AC8A 5DGZA 1YOMA 2IZSA 1UU8A 4FMQA 4FSUA 4TYHB 2QOBA 4LOPA 4G5JA 4E6AA 1WBWA 3H9OA 2VGOA 2UZEA 3KXHA 4HYIA 2PU8A 4BZNA 3SXRA 3VQHA 2F2UA 1ERKA 2GFSA 3LCSA 2XIYA 5DR9A 3NSZA 1JVPP 4MNFA 5G6VA 1IEPA 2CPKE 1DI9A 4GFGA 5DPVA 4FEWA 4GVJA 2C30A 3LQ5A 4KAOA 4C62A 5DA3A 3MW1A 1VZOA 4TT7A 2PVLA 2C0IA 4BIBA 4C61A 3EJ1A 4ERKA 2B9JA 5CF5A 4I6HA 3UJGA 2P3GX 5FDPA 3UPXA 1APME 3T3UA 2WTVA 4LOOA 4NT4A 4NU1A 4QYFA 5FDXA 4BBEA 4MXCA 3HECA 3ZDIA 4QP1A 4JVGA 4A9TA 3S2PA 3PIXA 3EN4A 1Y57A 4ZLYA 5FBNC 4AWIA 4RMZA 5I9UA 4EKLA 5HHWA 5IA4A 3UVPA 5C26A 2G1TA 4CRSA 5C1QB 2A27A 3VRZA 3AD5A 5FD2A 3WZKA 2XIKA 3D7TA 4E73A 3Q96A 4ZMEA 1MQBA 5EM6A 3RCDA 4C4JA 4DFZE 5FUTA 1JKTA 4C4GA 2VAGA 5FTGA 5EM5A 2HCKA 4BDHA 5HTCA 5DYJA 1DAYA 1OZ1A 1Q8YA 3HDNA 5JT2A 4OAUC 1M52A 2X2MA 2YM8A 4PY1A 5ANGA 4M67A 4JG6A 4FOCA 2YM7A 3TTJA 3LHJA 1KV2A 3R63A 3N9XA 2W7XA 5BMSA 4NM0A 3KL8A 4IAYA 3G90X 3UQCA 2YFXA 3C5UA 3ZMMA 2W96B 4QTBA 1G3NA 4JBPA 4QQCA 4FKWA 4FNYA 3RCJA 3U6IA 4JG7A 2Y4PA 2VWVA 3LJ1A 4JRNA 2YWPA 2RG6A 5CU3A 3NYXA 4G6LA 2RFDA 4U7ZA 2OF4A 1LEZA 5CEMA 3AQVA 5IUIA 3AT4A 3W8LA 3W18A 3QQKA 4LYNA 3TZ9A 3ZU7A 4GS6A 2PMOX 1Q97A 1GIHA 4ANMA 1LPUA 2ITWA 4D2TA 3U55A 3E93A 3MBLA 2AC5A 3V5PA 3JVSA 4A9RA 5HQ0A 4B4LA 2H6DA 3P5KA 4FKOA 3KCFA 5CT7A 5I9ZA 2G01A 4OBPA 4IX6A 2UZVA 4M68A 4Z16A 1CMKE 5BX0A 3ID6C 5EI8A 4FSZA 2JKKA 2V0DA 3MY1A 3RMFA 2I6LA 3VS0A 4L00A 1H00A 3ZO2A 5IQFA 4LGHA 4W4VA 5KX8A 4E26A 3ET7A 3MJ2A 3COMA 4ALVA 3C5IA 3O7LD 4MXAA 3UO4A 3PJ2A 4O91A 2X8IA 3CTQA 2BAJA 2E2BA 4DEDA 4AA0A 2H34A 5IQBA 3D2KA 3ENHA 4NWMA 1OPKA 2C6KA 2X6DA 4J95A 4RA4A 2R3LA 1HCKA 4BRXA 4ZLZA 5EM8A 3P0MA 3ATTA 3S4QA 4E4NA 4IDTA 3UZRA 5AP1A 2BAKA 4L68A 4FKTA 3TDVA 2QOFA 5FP6A 1XH7A 4E6DA 3R9RA 4O0TA 4BCIA 4WUNA 3RK5A 4H1JA 2YJSA 4PMSA 5A4CA 1JKKA 3KN6A 3UNKA 4OTDA 2CKPA 4XP3A 3THBA 2HWOA 1Q8ZA 4BTMA 3W33A 2EXEA 4O0YA 3FXXA 4F63A 5E1EA 2BUJA 2WELA 3R7OA 2UV2A 4N57A 4NM5A 2ITTA 5HX8A 3QTRA 2UZUE 4ZK5A 2R3GA 4C33A 3ROYA 1NVSA 5GZ8A 3DB8A 3U6JA 3REPA 3VULA 5G1XA 3SA0A 3CSVA 2Z7QA 3BQCA 3MPAA 4CZUA 4YLJA 4UYAA 3VUGA 4ZTMA 4PTGA 2Y9QA 4FG9A 3GGFA 1GZNA 4UMTA 4U79A 4YHTA 4ZEGA 5I3OA 5FEDA 1M7QA 3IOKA 3T9IA 2X81A 1F0QA 1JPAA 3F2NA 3QC9A 2OIQA 3R7UA 5FTOA 2UVYA 3AOXA 3ZEWA 3C50A 1V0BA 2KTYA 4L3PA 1W84A 3DT1A 3NUSA 4IZ5A 4O96A 5KCVA 1OKVA 2QO7A 1W98A 1S9IA 2F49A 2O3PA 4XMOA 5EH0A 4EOKA 1H1PA 4CTCA 2J4ZA 5IH6A 2VX1A 1Y91A 2GHLA 4R3PA 3WIKA 3ZZWA 5M4CA 3FDNA 5T3QA 3OC1A 2I40A 5ETIA 4A7CA 3MN3A 3KXGA 4RC2A 4B8MA 2R3NA 2DYLA 3FAAA 2BRMA 1GJOA 2EB3A 5AM7A 2XK9A 4IANA 4GW8A 3VJNA 1MRVA 3UG1A 4ACDA 3P79A 1ZMVA 4PF4A 5D41A 1YXXA 3UP2A 2NP8A 4QQTA 5BVOA 2OXDA 5A6NA 4D2WA 4AFEA 4RIOA 1NXKA 4GIHA 2FUMA 2WEIA 2YCSA 4M14A 5GHVA 5M57A 5CENA 5D12A 2OZAA 3QALE 2JFLA 3OT3A 4C4EA 4F9AA 1OL2A 2UVZA 3ZFMA 3FL4A 4EHVA 4ZY5A 3JY0A 4W8EA 5DEWA 1OL7A 4FC0A 3QZIA 3CKXA 4O1PA 4YLLA 4EWHA 2B1PA 4AZEA 4EH6A 2P2HA 2PZYA 3UP7A 3QTIA 3PA4A 4JOAA 3OW3A 3Q32A 2W5HA 3WI6A 3TXOA 3DDQA 1KOAA 4ALWA 3Q4ZA 2YAAA 4I92A 3SHEA 2VTQA 3LFEA 1LUFA 3CY3A 3RPYA 3D94A 4HCTA 4RVTA 4F9CA 2XNGA 5JFXA 3VBVA 5IQIA 2UW6A 5M06A 5AP4A 2OF2A 2I0VA 2WGJA 3GENA 4FE2A 4NK9A 4QTEA 3DLSA 4FKIA 3MSSA 4RG0A 4CFMA 4BDIA 3FXZA 3PG3A 5KMIA 3M2WA 4AOTA 2NRUA 3DDPA 4G1WA 4HCUA 1UKIA 4UN0C 3PY3A 4HNFA 4F9BA 3MY5A 4DFUA 2JC6A 1OUYA 4TY1A 5H9BA 4QYGA 3GOPA 3B8QA 3HMPA 4YJRA 1Y6BA 2XBAA 4AF3A 3PE2A 5CZHA 4EHEA 1LR4A 4FV6A 5DBXA 5HGIA 4ZS4A 3F7WA 5BPYA 3WF5A 4F7SA 2NNWB 3W16A 2R7IA 5LWNA 5TKDA 3L8VA 3TTIA 3ACKA 2XKDA 5HO7A 4O7NA 2IW6A 5EI6A 2G2IA 2Z7SA 3W10A 3F5XA 3W2OA 5L8JA 3GNIB 3DJ7A 4CSVA 1CKIA 5DRBA 2X4ZA 2XA4A 3JVRA 3JXWA 4YC6A 3Q3BA 5BVEA 2BRNA 3FMHA 3RALA 4D55A 3NW6A 5FG8A 3NW7A 3D15A 4WT6A 3MJ1A 4DF3A 2CSNA 3PRIA 4BTKA 2BILB 2VTPA 5LXMA 3B2TA 4LRMA 3PPKA 4MXYA 4XP2A 4I6BA 4E1ZA 4E4LA 5J5SA 3O8UA 4L7FA 4AACA 4WG3A 4JRVA 5DLSA 3HV7A 2XF0A 1PYXA 3FMJA 4IXPA 4AZTA 5AMNA 3E8DA 1JSUA 2QOKA 2FYSA 5E8ZA 3OOGA 5A3XA 3F66A 2V7AA 5FP5A 5TE0A 4FTCA 1WZYA 3DY7A 4KIPA 5GIOE 4Q5HA 3A4OX 5JGAA 4XHKB 4D9UA 2QG5A 4LL5A 4MBJA 3EZRA 1ZWSA 4IAIA 5L6OA 4I20A 3LCKA 3MS9A 5IPJA 4V04A 4GKIA 5C4KA 5EDRA 5EW9A 2R0UA 1MQ4A 2WTDA 4UB7A 5D7VA 4DC2A 5L8LA 3O51A 4AUAA 4F64A 3GU6A 5C9CA 1XH5A 4UV0A 2FH9A 3R1YA 3R02A 4U97A 4C4FA 1ZY4A 3OG7A 2VTAA 2FSTX 4JIAA 4CFUA 3DKFA 1WAKA 4DH3A 1XWSA 3BYUA 2ITPA 2C6DA 3QQUA 3R8VA 3EFKA 4DEAA 3FYKX 4RFZA 4RIWA 2W17A 3QLFA 3N4TA 3H9RA 3VF9A 2XP2A 5M44A 1VR2A 3HRCA 3PJCA 1BMKA 3G5DA 3VS1A 5KBQA 4MBLA 5JEBA 3MA6A 1O6KA 2B9HA 2ZOQA 3DV3A 3G6HA 3NUYA 3QXOA 4I6QA 3LCTA 4KIKA 4X2JA 4YJSA 3SAYA 5KHXA 4QNYA 3PZEA 1B6CB 4FKLA 3LJ0A 2HXLA 5K0KA 4L43A 5HU9A 2BAQA 2W1GA 2R3RA 4JT3A 5HIDA 3TACA 4RWKA 3E3PA 2B53A 1BI7A 1YXSA 2GNHA 4ARKA 4UMRA 5L2SA 2IVTA 5JQ5A 3EN5A 3FHRA 4K8AA 2CNUA 3BBTB 4FL1A 1BUHA 4QOXA 4XCUA 2QODA 3VBWA 2PL0A 5FEQA 4AGWA 1PRYA 5HG8A 4FSNA 2PE1A 1Y6AA 4C37A 3ORLA 4CD0A 3K5VA 4BDCA 4D0XA 3EH9A 3G33A 1A9UA 4FI1A 1PJKA 5E7RA 4GYIA 4IACA 4ZZNA 5FLFA 3OCSA 4DGOA 4AZFA 1ZMWA 1E1VA 3IOPA 1GAGA 5HD4A 4FK6A 2B9IA 3PP0A 4M69A 4N6YA 4CYIA 2YACA 5A14A 4BCOA 4FZAB 4FTRA 4IWDA 5LCJA 4JX3A 4CZYB 4E7WA 4MNEA 3BYVA 4QPSA 2BZKB 2WMBA 4NW5A 4AGUA 3DBDA 4YU2A 4ZAUA 2CKQA 3QCSA 1ZYDA 2C3KA 3BWJA 2RF9A 3QFVA 5FGKA 5FRIA 3ZTXA 4RZVA 5A4TA 5M51A 5ANIA 4N0SA 4R5YA 4C4HA 2WQEA 1OPJA 4EUTA 2WMUA 3BLRA 4EH3A 2PUIA 1VYZA 4UX9A 5J9ZA 2OG8A 2HAKA 5GNKA 4D0WA 5EDPA 3H0ZA 5J5TA 4L7SA 4J97A 2WTIA 4FNWA 3WF9A 1ND4A 3RAIA 1JSVA 4LMNA 3BHHA 4FKSA 4YURA 4O21A 4LGDA 4RIYA 3CS9A 3JUHA 4D9TA 4EOQA 5M07A 5HTBA 3NVKI 3RK7A 3K3JA 4ALUA 5IUGA 4QMLA 1H27A 5H2UA 2RKUA 4I5HA 4HGSA 3AC1A 3BU6A 3VUDA 2W4JA 3P23A 2CNVA 3IECA 3WIGA 3T3VA 4TL0A 2DWBA 5CU0A 4CLJA 4PPCA 4FIIA 1ZAOA 4XG7A 4KBKA 2WQOA 3QTWA 5CT0A 3UO5A 3Q04A 3IS5A 4XV1A 4KBAA 2YA9A 4FKRA 5HCYA 5KZ0A 3GUBA 3AD6A 3L9MA 3QLGA 3R71A 4CMTA 3ZH8A 4O81A 4IX5A 2W0JA 5E8WA 2ITXA 1XJDA 1DM2A 1JKSA 2FGIA 4KABA 3VUMA 3OFMA 4HCVA 4O7SA 4KUJA 3HMMA 3QRJA 4F1OA 2ITZA 4CZTA 1M2PA 5AR4A 2X6EA 3A7GA 3IKAA 4V0GA 5IEVA 4GMYA 3MWUA 4G9RA 4GU9A 5AP0A 1JNKA 4IZAA 2H9VA 3ORMA 4X3FA 4EOSA 4OR5A 3GCUA 4DH1A 3UQFA 4JBOA 2WIPA 2BKZA 5EFQA 1G8SA 3R73A 4FKJA 3QBNA 4TWCA 4LGGA 2BDFA 2VWXA 4XYFA 5E1SA 2WOUA 1Q5KA 3FC2A 5EYDA 4BI2A 1IAHA 3ZXZA 1WBSA 4DTBA 4QMPA 3SXFA 1JQHA 4G6OA 3LMIA 5HE2A 1BI8A 3MA3A 5AR5A 4M7IA 5AUUA 2VGPA 2BHHA 5EW8A 2PWLA 4HPTE 5LMAA 4R77A 5EG3A 5LMBA 5CZIA 4RVMA 2OZOA 4ZTLA 5KMKA 4EOPA 4JS8A 1OB3A 4LUEA 4AW0A 3FLZA 3G9NA 5E90A 3TM0A 3FI4A 3MYGA 4GCJA 2BIYA 4PPBA 4DT9A 4JDJA 3OW4A 4PP9A 4OBQA 5CANA 3KRJA 2VO6A 4CYJA 2ERZE 5J1WA 4R78A 4YLKA 4A9YA 1J1BA 4QMVA 4CG8A 4LI5A 3QL8A 3RTPA 2W5AA 4YJUA 1H0VA 4FKGA 4IB3A 3QWJA 1W83A 3KEXA 4EC9A 3F2AA 2C5YA 3KRRA 5E4HA 5HNGA 3MIAA 5LVLA 3QHWA 3E88A 3GC9A 2OFVA 4M13A 5HBEA 4WIHA 1YKRA 5L2WA 1DAWA 3F2RA 4I6FA 4CKRA 3OWLA 3ZONA 4EI4A 3IQ7A 4BZDA 4JG8A 3MFUA 4IZYA 3KCKA 4AOJA 4BR3A 4Y5HA 1IG1A 1K3AA 3FY0A 4BVUA 2QC6A 4UYNA 4RLLA 3Q9ZA 4XG4A 5CALA 4N4SA 3KRXA 3AGLA 2Y0AA 3A99A 5ETFA 1ZYLA 5HNBA 2B52A 2I0HA 2WMXA 3O17A 4FSMA 4AW2A 4DLIA 5JN2A 3PY1A 2YDKA 1U59A 5EHOA 4EH5A 2WMVA 2VTIA 3UBDA 3ZLYA 3ZUTA 4ASZA 4KWPA 4PUZA 4BDEA 4GK2A 2V55A 3QTUA 3HEGA 4LMUA 4FTIA 5T68A 3ODZX 3TNIA 1YI4A 4W4XA 5HE0A 4TWOA 2Q83A 2UUEA 4BFMA 3MVJA 4PRJA 4Z3VA 2ONLA 4UWYA 5AUTA 2JDVA 2PE0A 3GC0A 3D7ZA 3FZOA 2F7EE 2G9XA 3JS2A 5DFPA 1MRYA 1Z5MA 3NPCA 5CASA 4IQ6A 4ZTQA 2O0UA 4UEUA 4Q9ZA 4A4XA 3B8RA 4DH5A 4EK3A 3EN6A 5K4IA 3IDPA 4XBRA 4AP7A 4S34A 3FLQA 1NT2A 3H30A 4FIHA 2XNMA 2JAVA 2OXXA 3PVUA 2J0IA 3R8UA 4B8LA 3POZA 1WVWA 4BIEA 5JH6A 4GG7A 2WTWA 5CAQA 5IQEA 2QOOA 5AA8A 3COKA 4I24A 4BYJA 2BRBA 4KSPA 2PVKA 5F95A 3ORNA 2C6MA 5TR6A 2C3IB 3G2FA 5CNNA 5CU2A 3AMBA 5I4NA 3SGCA 5EQEA 4LL0A 2XB7A 3FYJX 3R01A 2HELA 2YISA 2QVSE 3SW7A 5LCKA 5CSPA 1J7IA 3PDTA 3OS3A 4EONA 4H39A 2BZHB 2W1HA 1WVYA 1OPLA 4DHFA 1SM2A 4DE4A 4R5SA 3NYOA 4HOKA 3II5A 1MRUA 4OTFA 1QL6A 4RX9A 4E4MA 3IW8A 4J96A 1JWHA 3TJCA 2BROA 3TZ7A 2JIVA 2DQ7X 4G16A 4OT5A 2H8HA 3QTSA 3S3IA 4A06A 4IVCA 5FTQA 1PXPA 3GC8A 3GP0A 5JFWA 5IH4A 4V05A 3AMAA 1IA8A 1A48A 4X0MA 4AGCA 2C69A 5E8UA 4ENYA 4DFYA 4D2SA 5HKMA 2JDSA 3I7BA 3KA0A 3V5LA 3NUNA 4RVLA 4D2VA 4ZZOA 4WUAA 1YXTA 3D83A 3RNYA 1H25A 4GG5A 3TUDA 2IWIA 3NIZA 1UNLA 2ETMA 3DJ6A 2VTLA 2VUWA 4RX7A 4XOYA 2PTKA 3W2PA 1Q8WA 3AC4A 4U42A 4XLIA 4BDFA 5AUXA 3U9CA 4XBUA 2XYNA 5GIPE 5BUJA 5A46A 1YHWA 2XIXA 5ANJA 4Q9SA 2RFSA 3FLWA 3A7JA 3Q52A 3I79A 2J5FA 4U5JA 1PKDA 4WNPA 2LAVA 3IDBA 4QQ5A 3FLSA 5GZ9A 4CEGA 5TOZA 4C2VA 4RQVA 2XK7A 5AM6A 4EHGA 4FL3A 1MUOA 4TW9A 2XM8A 5HCXA 2EU9A 4O2PA 4BI1A 3RPSA 2GHMA 3P1AA 3PXQA 3I0QA 3NUPA 4FT3A 5EHYA 4ZXTA 1YWRA 4C3PA 4IFGA 5LARA 1CKPA 4O7WA 4OTHA 1OIQA 4XS2A 3I0OA 4J8MA 5J7HA 4EKKA 5CSHA 3TI1A 3OVVA 3PJ3A 4DH7A 5AX3A 5FQDC 4BDBA 4KKHA 4PMPA 3HRBA 3R7GA 1PMVA 2W1DA 4ZMFA 1Q4LA 2Y4IB 4KS7A 4FF8A 2BTRA 4I23A 3ULIA 2EWAA 4U40A 4EK6A 2XNOA 3U51A 5EQYA 3WZUA 3KVXA 3L8PA 4EBVA 3A60A 5CAOA 3PA5A 4A07A 5IA2A 3QD2B 4ZP5A 2JGZA 4U0IA 5I0BA 2P33A 4GL9A 3EWHA 3LJ2A 4IADA 5F94A 3CD8A 4O82A 3TIYA 2HZ0A 3E92A 3DXNA 4AE6A 5AAEA 4WD5A 2QKWB 2QU6A 4MCVA 2P55A 4EQMA 2RGPA 4BKJA 3UC3A 2J90A 5E8TA 3ETAA 1ZOEA 1OBDA 4IC7A 2W1IA 3E64A 4L3LA 3P7AA 4CXAA 4DG0E 3RGFA 3MTFA 4IAKA 3BX5A 4ITIA 3PPZA 1ZYJA 2YN8A 1BYGA 1S9JA 3DAEA 4FKPA 3OD6X 4I94A 4QTAA 4QYYA 4AN9A 1H07A 3DBFA 5C8MA 2AC3A 2OFUA 3QD0A 1YI3A 3QA0A 2PZ5A 2V5QA 3I5ZA 3NNVA 3KF7A 3Q9YA 4NCTC 4PPAA 4E6CA 2X9EA 4DLJA 5HI2A 3EL8A 3PVBA 4IFCA 2XEZA 5D7AA 1DS5A 3FMNA 3UIUA 2QONA 3R1SA 4PNKA 5ITAA 4UXLA 4O0VA 4QMNA 3DZOA 4FZFB 3K5UA 4MXXA 1FPUA 4FV8A 4QP8A 3EYGA 5KNJA 2BDWA 4NKSA 5CI7A 5LMKA 2OBJA 4KIQA 3KRWA 1UA2A 1L8TA 5HESA 4BDGA 2UZNA 2HZNA 3DGKA 3POOA 5KUPA 3EHAA 3ERKA 5IMEA 5HO8A 4GSBA 2X9FA 3WBLA 2IZUA 2ETRA 4ZSLA 3PSDA 3CJFA 4NEUA 5HD7A 4UZHA 4K9YA 3HRFA 3UGCA 1H4LA 4ANQA 1UU9A 2ZM3A 3NR9A 3SRVA 2WMTA 1F3MC 3P86A 2SRCA 4FTOA 5M56A 1F5QA 4J99A 4FK3A 4MVFA 3ZM4A 4DAWA 4PNIA 4XRJA 5JRQA 4L53A 3DQWA 5K3YA 3TNWA 3GBZA 4BKYA 5M4FA 4QRCA 5BVDA 3KXZA 3IGGA 3QX2A 4AE9A 2YEXA 4O0WA 3R21A 4FG8A 4D1XA 2WNTA 3RPOA 5IF1A 2PVHA 2YDJA 1ZMUA 1K9AA 3CTHA 3GCSA 2FSLX 4I4EA 3HP2A 2PVFA 3V3VA 2Y7JA 3CPBA 4HJOA 2J0JA 3ODYX 5AP2A 3SW4A 4LV8A 3LCDA 4XRLA 4WNMA 4HYHA 4D58A 3ZM9A 5CVHA 5EOLA 3VAPA 1FVTA 1H0WA 3CQWA 5D9HA 3DNEA 4KRDA 2VNYA 5IH5A 3EFJA 2EXMA 2R4BA 5AV2A 2ESMA 4W4WA 1XR1A 2HY81 4R7BA 4RWLA 4RX5A 4I4FA 4H1MA 2JBOA 2PMNX 4MHAA 2R3IA 1FINA 3EKKA 3EYHA 4AZSA 2CGVA 3R9DA 1ZY5A 2ZV8A 3F69A 3NMUF 3OEFX 3LMGA 5CEIA 2IVUA 5CY3A 4BY9E 1W8CA 5KO1A 4O7TA 2B54A 4K6ZA 5FXRA 5M08A 3PJ1A 4FTKA 4KKEA 1U5QA 1LEWA 2QR8A 3LXPA 4XG9A 4NTTA 2WU6A 3EQBA 5AP7A 5HLPA 1URCA 3R2BA 2VO3A 2XNNA 3QKMA 4FYOA 1PXIA 3CIKA 4FTMA 4MAOA 3BGQA 4QMMA 4FV3A 3ZYAA 3UIBA 2XKFA 1YHVA 2XM9A 3HMIA 4MQ1A 1UWJA 2XH5A 3BEGA 4LM5A 4O0RA 2BDJA 1B39A 1Q41A 4Y83A 5KE0A 2ITNA 4DITA 5AADA 2Z8CA 3PWDA 4PTCA 4BCPA 3P7CA 5K9IA 2YZLA 3HAVA 1TQMA 4LUDA 4U44A 5JZNA 3FWQA 2O63A 3BCEA 4AA5A 2QNJA 5K0XA 3RI1A 1Q24A 2WMAA 4FT5A 4YPDA 4OAVB 5AFVA 3KMMA 1U54B 5HE1A 4FOBA 4RIXA 5CLPA 1P14A 3R83A 4DEEA 2UW7A 2VX0A 3UMXA 4O86A 4GT4A 4CT2A 3A7IA 1H8FA 2PUUA 3LM0A 3QCXA 3RWQA 4MD9E 4HVSA 4YUQA 5KHWA 4FGRA 3BIZA 5LVOA 2ZMDA 3EQPA 4CKJA 1FVVA 2VTJA 3KMUA 3UNZA 5I9WA 3F82A 2CKOA 3QTZA 4ACMA 3FZRA 2OIDA 3LQ8A 1PMEA 5ANEA 3R00A 3BE9A 2A19B 2UZTA 1OL6A 3JY9A 5EDQA 4JDIA 2GNLA 4QMYA 4X6QC 1H28A 4DA5A 3UOJA 5EOBA 3C7QA 4ZSJA 3T8OA 4AZVA 3TNHA 3DBQA 4AN2A 4IM2A 4I0RA 5M53A 2W99B 4M8TA 4RRVA 2R3KA 3OCBA 5F4NA 2VTSA 3QC4A 3C13A 4UBAA 1YOLA 5FXQA 4BYIA 3OXTA 4MH7A 2J2IB 3QAME 4TWNA 3COHA 5AV4A 3KXMA 3ITZA 2JKMA 4QP9A 1P5EA 1Q8TA 2B55A 3BRBA 3NNUA 2XK8A 3OXZA 4WBBB 3WILA 4QO9A 4BC6A 4FSWA 4PL4A 4L6QA 2ZJWA 4YMJA 4IMYA 2XIRA 3MB7A 4FV1A 3UZPA 3CGFA 3O0GA 4XG6A 2PUPA 4Y8DA 3QA8A 2OU7A 4RFYA 1SNUA 4O7VA 4U41A 1NW1A 4CMUA 4O22A 3EOCA 4KIOA 1GZOA 3VS6A 2R3HA 2YM3A 3PE1A 4K2RA 4L9IA 5JKGA 3KN5A 4JQEA 3VBXA 2PVJA 1R0EA 3D5UA 1OIRA 2DUVA 3Q6UA 4D28A 4C57A 3CLYA 4ZZMA 4OGRA 2P0CA 4NYEA 5TT7A 1YDRE 3TV7A 5J9LA 4ASDA 4MTAA 4LRJA 2Q0BA 1R39A 3CQEA 3P08A 4E93A 3E62A 3TNPC 4GU6A 4F99A 3CQUA 5KKRC 2GTMA 3FZTA 3LZBA 3PXYA 5LJJA 4NW6A 2JIUA 3CD3A 4NFNA 5EW3A 3LKMA 3OWPA 4NJDA 5CWZA 4ANOA 1XO2B 5DI1A 4AXAA 4K33A 4YZCA 2VTTA 1QPEA 4DEIA 1PHKA 3CPCA 3QKLA 3O50A 5E8VA 3F88A 1GY3A 3FQEA 2I1MA 1STCE 2OI4X 3WF7A 1FVRA 2CGWA 4APPA 3WE4A 4NUSA 2ITVA 3TN8A 3FE3A 5H8EA 3ZC6A 2XNBA 2EXCX 3TCPA 5ANOA 4W9XA 2E9NA 1OITA 3ZBFA 5DN3A 3CTJA 5LVMA 4BDAA 5I5ZA 3RNIA 2C6IA 4ZJJA 1SMHA 3HVCA 3VVHA 4DEBA 4S30A 5F9EA 2CDZA 2JITA 4OW8A 4R7IA 4DFXE 4ONAA 2YJRA 5AAFA 3UYTA 4O2ZA 4EOIA 2CLXA 3OXIA 4ZTSA 5KKRB 5M4IA 2UZWE 3BV2A 1PXMA 4APCA 4WNOA 3VS4A 2AUHA 3PG1A 4YTCA 4RJ8A 4CVAA 2ZV2A 3GU8A 1OBGA 3C4EA 2HZ4A 4JQ8A 1WVXA 3ZLWA 2WO6A 3L8XA 2ITQA 5AIKA 4BCMA 4HVGA 5JQ8A 3Q2JA 1XH9A 3C0HA 4FKUA 5IA5A 4HW7A 5L3AA 1XH4A 3QQJA 4WRGA 3RBWA 5K5XA 1PXJA 3ZUUA 5HIBA 2W9FB 2VWBA 3W32A 1WBPA 4R3RA 1FMKA 4YNEA 3SKCA 5F20A 4L44A 5I9VA 2ACXA 2J0KA 2XYUA 3BU3A 4GT3A 3D7TB 2X7FA 1VYWA 4O1OA 3WYXA 3F3VA 4TNBA 1SZMA 1OM1A 2QI8A 4JXFA 4XJ0A 1WMKA 3V5JA 1XQZA 2NPQA 3GFEA 1M14A 5L2IA 5GINE 2W06A 2IJMA 2YLFA 1PXOA 2BHEA 2B0QA 4F08A 3PUPA 3V8WA 4NKAA 2CJMA 4BHNA 4BICA 4YO4A 2F2CB 5AR3A 1PXKA 1ZZLA 4M15A 3FHIA 4W9WA 3DXPA 2VTMA 5BVNA 4FSYA 3DK7A 2NO3A 3E5AA 4BN1A 2IVVA 1JOWB 3N4UA 3ZFYA 3EQCA 5AR2A 2XJ2A 4CNHA 3V5WA 4AX8A 3AXWA 2WMWA 2WQMA 3MH2A 4H3QA 2OJIA 3DTCA 4E6QA 5JRSA 4I93A 4Y5QA 4IVAA 4FNXA 5DWRA 1V1KA 2PK9A 3OTVA 4G3EA 4P7EA 4PX6A 1MP8A 2OWBA 4O6EA 2FSOX 3S1HA 3PVWA 2PVYA 1JLUE 4XNEA 4AG8A 5IU2A 5IG1A 4P5QA 3FMKA 4Q5EA 4U9AA 1Q3WA 4KINA 1H01A 2O2UA 3MESA 1PXLA 3D0EA 4F0IA 4EWQA 1H24A 3GEQA 2GNJA 3O71A 4JR3A 4FUYA 4DEGA 1VJYA 1TKIA 2VU3A 4YJOA 4ZY4A 4C8BA 4QMSA 5KMLA 3QRIA 2HOGA 3A7HA 4FGBA 4E8AA 3OWJA 2IW8A 5EKOA 3RK9A 4B7TA 4GH2A 3SD0A 4F4PA 2ERKA 2EVAA 3NNXA 3KF4A 3OT8A 4L45A 4IEBA 4QTDA 3BHVA 5K4JA 3SOAA 5IEYA 4D1SA 3ORTA 1Z57A 3W1FA 3RAHA 1CDKA 1O6LA 4D2RA 1XBCA 5FXSA 3D9VA 1JAMA 2QO9A 1R78A 5ANKA 3ORXA 3R8MA 3A4PA 3KMWA 1OKWA 3AC5A 3F9NA 3LIJA 4FT7A 4NFMA 4JX7A 4BI0A 3VO3A 3TJDA 4EZ3A 3B2WA 3IW7A 2OJGA 1V0OA 4M66A 2XIZA 5CU4A 4IAZA 4NIFA 4YTFA 4QMUA 3SC1A 4L8MA 5FM2A 4ACGA 5E92A 3DXQA 2XJ0A 4I1ZA 4KSQA 1J3HA 4RA5A 3G9LX 3R8LA 2C5XA 5I3RA 3KULA 1KWPA 2C1AA 2ZYBA 3U9NA 3FQHA 4JLCA 1UKHA 5L6PA 3LFFA 3KREA 3VJOA 5HZNA 2R3MA 3CEKA 3MI9A 3ZO1A 2H96A 5GJFA 4CQGA 4L3JA 1REKA 5IISA 4WBOA 4XG8A 2W05A 4DFNA 1O6YA 4TXCA 5CSWA 5AV1A 2X7OA 5AV0A 4J71A 5B2KA 1XHAA 4TYHA 3I4BA 4U3ZA 4YNOA 2OLCA 1J91A 3HA6A 4LV5A 5A6OA 5ACKA 3UE4A 3C0GA 4X21A 4F1MA 4Q2AA 4EOMA 2FSMX 4R7HA 5CAPA 3F3TA 4CT1A 4AT4A 4XLVA 5DE2A 4AA4A 5DEYA 4DG2E 4S2ZA 3G0EA 1Q8UA 3QGYA 3VWAA 2C6TA 4F6SA 4ZJIA 4NM7A 2UW0A 2IO6A 4AN3A 3L1SA 3C4FA 3SOCA 3OY3A 3NX8A 4IJ9A 4C2WA 2IPXA 3BI6A 3QWKA 4FEQA 3EB0A 4OTGA 3RAWA 3MY0A 4C7TA 3ZRKA 3UDBA 2QHMA 3QCQA 1IASA 4FT0A 4ZS0A 4DG3E 4BWPA 3LAUA 4BTJA 2R3PA 1ZYSA 2OKRA 2XNPA 5CVFA 4H58A 2PZRA 2C5OA 2YAKA 4JL9A 2WTJA 1BX6A 2PZPA 4J52A 2CMWA 2VWYA 4P5ZA 3ZS5A 4FSRA 3I81A 2OZAB 2WOTA 3HX4A 2W1FA 4HZRA 3PFQA 5EYKA 3ZBXA 3L9LA 2JLDA 4EEVA 3DS6A 1CTPE 4GV1A 3ZO3A 2QG7A 3SG8A 1KE9A 3QYWA 4EH2A 3G6GA 5I9YA 4D5HA 5AA9A 1X8BA 3FPMA 3GU4A 3LFDA 3CP9A 3MDYA 5EI2A 3KXNA 3D5WA 4B9DA 3ZSGA 4K11A 4TZRA 2QOQA 5IKWA 5IA3A 3UO6A 2R3JA 4H36A 4QT1A 3A7FA 5H8GA 3MH0A 3MPMA 5AP6A 1KUTA 4HVIA 1OMWA 3HA8A 3H10A 3PIZA 5CF4A 4LOQA 3MGYA 3PSBA 4MWIA 4AU8A 2VV9A 4FTTA 4EOOA 5CAUA 4CFFA 4UALA 3QCYA 5A9UA 2X8EA 3EFWA 4ZY6A 3BLHA 3FSFA 1JSTA 4E5AX 5M4UA 3HUBA 3DTWA 3VNTA 4FSTA 3HMOA 5CXHA 4MF0A 1XH6A 3AC2A 3O8PA 3FLYA 3A62A 2W4KA 1OL1A 3NLBA 5BVFA 4A9SA 1FGKA 4JDHA 3R8ZA 3G0FA 1ZRZA 2QO2A 5AUZA 1YXUA 5DR6A 3Q9XA 1WBTA 4HZSA 4TN6A 3EN9A 4BDKA 2YERA 1AGWA 4G34A 1XBAA 3A61A 2QLQA 3FEGA 4MEDA 2YM6A 3MIYA 3R04A 3FKOA 1UNGA 2J7TA 2W1CA 5H3QA 3EQRA 3FLNC 2C5NA 5H8BA 4CG9A 3HP5A 3NUXA 3QGWA 2C6OA 3Q53A 4HNIA 3RAKA 5IA0A 3S00A 3EQGA 3MVLA 4WRSA 4F9WA 2OJ9A 4EH9A 4QMWA 4G6NA 4H3PA 2QOCA 4QMTA 2E9PA 2WFYA 3GT8A 3SXSA 4IWPA 3SVVA 2O65A 2YABA 4MXOA 1H1RA 2C0OA 3IO7A 3BE2A 2Z7LA 4I41A 2ZB0A 3A8WA
chains in the Genus database with same CATH superfamily
2C6LA 4O0XA 4YGAA 4EUUA 2JAMA 4MK0A 3LPBA 4F6WA 4TYIA 3RPVA 5KMNA 3K2LA 4K1BA 4YP8A 1NVQA 3F5PA 2BPMA 3SV0A 4IVBA 2VZ6A 4BGHA 5IQCA 3EN7A 2KULA 3S0OA 2C0TA 4YPSA 4UXQA 1OGYA 3T9TA 5AIRA 2XRWA 4KKGA 1ZXEA 3CCNA 3IGOA 2HIWA 1OGUA 4QP4A 5C03A 3LFCA 3O8TA 1UU3A 2XK4A 3SQQA 5HX6A 3IW4A 3M11A 3I7CA 4DGMA 1OIUA 4FNZA 2QHNA 2YDIA 5JZJA 5JSMA 3SLSA 4O7ZA 1KE8A 2W5BA 3OROA 3WE8A 2ZB1A 4GEOA 3AG9A 4ZTNA 3P78A 2WQNA 3Q2MA 3UYSA 2C5VA 3RINA 3P5JC 2AYPA 1G8AA 3UDSA 3RJCA 3BGZA 4QPAA 5BMMA 1KE5A 1GIIA 1KE7A 4P2KA 2XCHA 4W4YA 3KVWA 4ANBA 4CFXA 1IAJA 3UIXA 3BHUA 3OEZA 3QUPA 4G31A 2C4GA 4B0GA 4L42A 4Z7HA 4GK4A 4RIWB 1E1XA 4O0UA 4QD6A 5CSXA 2BFYA 3F61A 3IW5A 4C34A 3BLQA 1KOBA 1YOJA 4RPVA 4EJ7A 4S33A 3VS5A 1IA9A 4ASEA 3HYHA 2Y4IC 3MH3A 1M7NA 2IZRA 5DH3A 3HV5A 4WHZA 4DEHA 3GCQA 5HVJA 2HYYA 4O7RA 2C47A 3QZFA 4KIKB 2G15A 2Z7RA 5HLWA 3DBCA 3KXXA 4FTAA 4BCHA 3AGMA 2J9MA 3MB6A 4FX3A 4I3ZA 4BCFA 4ENXA 5IEXA 3NS9A 5AWMA 4G17A 2P4IA 3C4WA 5C8NA 4FV5A 4R3CA 2EUFB 5L2QA 4FIGA 4JAIA 3LQ3A 3DAJA 3QRKA 4G3CA 2JDRA 3EZVA 3HV4A 4IWQA 5AUWA 5ACBC 1FQ1B 4FICA 5L2TA 1ZLTA 3OWKA 4N6ZA 4WOVA 3UOKA 5JMSA 2WZJA 1QPCA 4FTUA 3NYVA 4ACCA 3RKBA 2RL5A 3VUHA 5CF8A 5A4EA 2ZVAA 3O7LB 4U80A 2O8YA 3VN9A 4RJ5A 4M69B 2ETKA 2GNGA 2YIQA 2Y8OA 2A98A 3FL5A 4KD1A 5TO8A 4V01A 5LOHA 4YJTA 4K0YA 3TUBA 3Q60A 2PVRA 4PMTA 3WZEA 4MNEB 4I0SA 2BKKA 4H05A 3HAMA 4DHJA 5IMXA 4DCAA 2GHGA 2HWPA 4RBLA 3QUDA 2O64A 3EQDA 5GJGA 3ZXTA 2GNFA 4TYEA 2ZMCA 4FTNA 4NL0A 4FV7A 2VO0A 3DKCA 4Y46A 4ZIMA 4MXZA 4C4IA 2GDOA 5L8KA 1IRKA 4AT5A 4IVDA 4OTRA 3HZTA 3CY2A 1TQPA 1T46A 2WIHA 4FTQA 4X3FC 4YJPA 2PULA 3IONA 3W8QA 4RIYB 3VUKA 4RC3A 2V7OA 1URWA 5D11A 1QCFA 1NY3A 4NJ3A 2WD1A 2C1BA 4X2GA 3FI8A 3Q4UA 3K54A 1PKGA 4CCUA 3NGAA 3D2IA 3BEAA 5FEEA 5DR2A 3TL8A 4BCNA 4HVDA 2IG7A 3GC7A 4R1YA 4YTHA 1BL6A 4JBVA 5CEPA 1XMMA 4GJ3A 4BB4A 2WAJA 3E7VA 4CTBA 2XCKA 4C35A 3DOGA 4ANLA 5D1JA 5EKNA 3D5XA 3DFAA 1UWHA 1SVEA 2BZIB 3H4JA 4QNAA 5CI6A 2F7XE 4AAAA 4YZBA 2W1EA 3QUEA 2CGUA 2J51A 4EORA 4V0GB 3PLAE 5JK3A 4U43A 4EBWA 2ZV9A 2BRHA 5CEOA 3C4ZA 3Q9WA 2ITYA 4FTLA 4IX4A 4PDPA 4X3FB 3EQHA 4D2PA 3GI3A 4CKIA 3OCTA 4XX9A 3ORIA 4ASXA 4U45A 4C3RA 4QP6A 5KMOA 4CFNA 4FEUA 4Z9LA 4QP7A 5KBRA 4Z7GA 2J0LA 2WXVA 4BCKA 4HVHA 4DTAA 5EK7A 4C59A 3NWWA 5CQUA 2OK1A 4G2FA 3BZ3A 4UZDA 1HCLA 3WOWA 5J87A 3ZDUA 5IQAA 2JKQA 2PMIA 3U4WA 3UMWA 3LLTA 3W2RA 2IVSA 4JBQA 3CR0A 4RWIA 4XG3A 3KGAA 4GFOA 3GXLA 4YJQA 3UIMA 2JDTA 4DBNA 4DTKA 3VHEA 3IK3A 1G5SA 5CF6A 2BZJA 2WQBA 3V04A 4R8QA 3GB2A 3I60A 5LWMA 5BQ0A 5LVNA 2VN9A 2GU8A 5CAVA 4FVRA 3WF6A 4EQUA 3GOKA 2UW9A 3L9NA 4FV2A 1R0PA 1SYKA 4TRLA 4GIIA 4NZWB 4DBXA 3ZSHA 4CQEA 4O4BB 3OBGA 3MFRA 1M17A 2J5EA 3PXRA 3E7OA 1TVOA 4G3GA 4D1ZA 1Q61A 2XAMA 3G15A 2X4FA 3H0YA 4FEXA 2YIXA 2IN6A 4XV2A 4OUCA 3UVQA 3D14A 5CSVA 1BL7A 3TKHA 2ONLC 1I44A 1A06A 3F3ZA 3ZZEA 1JKLA 3UODA 4F0GA 5B0XA 1YW2A 2OH0E 2XEYA 3NAXA 3UPZA 2YHVA 3QU0A 2C68A 1GIJA 5HVYA 3G51A 3F3UA 3PYYA 3DKGA 2CGXA 3W2CA 4ZOGA 5DRDA 3C9WA 3R30A 5EHLA 3QYZA 5KMJA 1V0PA 1WFCA 4II5A 2JKOA 5C27A 5CEKA 4GRBA 5EQPA 1ZOGA 4IWOA 4C02A 3M42A 2OH4A 2J50A 4CMOA 3W2SA 4BBFA 2XK3A 3CC6A 3O2MA 2YLEA 4DGGA 4YHJA 3ZOSA 4LFIA 4IH8A 4BL1A 3ALNA 3WF8A 2B9FA 4FG7A 3OF0A 4RJ4A 4F7JA 4AGDA 3N4VA 5HTIA 4AXFA 3OUKA 3VS3A 3UVRA 5IDPA 1FMOE 4E5WA 1PMUA 3OCGA 4WA9A 2HXQA 3W2QA 3V6RA 2CLQA 3FZ1A 3LXKA 4I5CA 4PL3A 2BVAA 3UDZA 4FVQA 4USFA 4M0ZA 3E63A 1RE8A 1PF8A 2VRXA 4O4EA 1XMLA 3D4QA 3PXFA 3VONA 3ZHPC 2QOIA 2ZV7A 3PTGA 3VBQA 3DNDA 3PY0A 2QLUA 4F70A 4YSMA 3V5TA 3ZLXA 4DFBA 2GTNA 3BYMA 2FA2A 3ACJA 3FXWA 3LFNA 4KA3A 1J7UA 5CVGA 2F57A 4UWBA 5BYZA 2J6MA 4X2KA 2ZM4A 3BELA 3DKOA 4A9UA 4E3CA 4KNBA 4PWNA 1REJA 4KS8A 2Y6OA 4DCEA 2OO8X 3R9OA 4D4VA 4FTJA 4EYMA 5AAGA 3ELJA 4UMQA 4JNWA 4M97A 2GCDA 3E87A 4GK3A 3TNQB 4YTIA 4WG5A 3R7IA 3ORZA 4TWPA 1PY5A 4IC8A 2PPQA 4MD8E 4OBOA 2WB8A 4OT6A 4UY9A 4BF2A 4IJPA 3QHRA 5HIEA 3R2YA 2WMQA 1YQJA 2W9ZB 3CGOA 5DT0A 3FKNA 3O96A 2GSFA 2EB2A 2WTKC 2UW3A 3FBVA 3L8SA 1FOTA 3KKVA 3V8TA 4JQ7A 4BZOA 5B2LA 3FZSA 4RVKA 3GU7A 5A54A 4AXEA 4FKVA 3QXPA 1VEBA 4YZMA 4O7YA 4FIEA 3DPKA 4IM0A 4AZWA 1KSWA 4NM3A 4XOZA 1H26A 5BVKA 3M1SA 3ALOA 4BIDA 4IHPA 5IZFA 2Z60A 4FV0A 4J1RA 5M09A 3NRMA 1OKZA 1ZARA 1CSNA 4ZTRA 1WBOA 1NA7A 5DT3A 3KC3A 3KU2A 4YZDA 3VQUA 5DIAA 4RGJA 2PYWA 5HORA 3LLAA 4PDOA 2Y6MA 2IW9A 4ZJVA 3U54A 2XK6A 4O83A 2B7AA 3QQLA 5CTPA 3VUIA 4FV9A 4U8ZA 2XVDA 3V8SA 2YIWA 3KQ7A 4IZ7A 2CHLA 2PHKA 4EYJA 2WTKB 3OUNB 4FBXA 4OTQA 3COIA 4RJ3A 3TIZA 2R64A 3FMMA 2ITUA 4DGNA 4F6UA 5JGBA 3BQRA 3U8WA 2ZAZA 5L4QA 2CN8A 2QU5A 3F7ZA 5HO6A 4Y72A 3UTOA 4W8DA 2QR7A 5IDNA 2OICA 3NNWA 3WZJA 3Q5IA 3NCZA 4F7LA 4BDDA 1GNGA 5ICPA 1UU7A 2JD5A 3R6XA 4FYNA 3LFQA 3RWPA 4RJ7A 1U5RA 4XV9A 1Q99A 2Z02A 4YO6A 2YWVA 4WNKA 2RIOA 3R7VA 4XH6A 3BU5A 5LMKC 1YXVA 4KB8A 5AV3A 3I1AA 4KRCA 4OTPA 4C38A 4IB0A 3LFBA 3EKNA 3C4XA 3LM5A 4QMOA 4CV8A 3NAYA 1GZ8A 3NYNA 3LCOA 2FO0A 3LE6A 4TTHB 4WKQA 3DA6A 3HL7A 5E8SA 3BV3A 5BYYA 1Y8GA 4RSSA 4Z55A 3R9HA 1PW2A 2X0GA 3IDCA 4FR4A 5D10A 3VIDA 2GS6A 4X3JA 5FWKK 2OSCA 3VW6A 1GZKA 2VWIA 1YWNA 3A8XA 3QTQA 4S31A 1YWVA 5LQFA 3C0IA 3R22A 3UOHA 1YRPA 3W0PA 2OIBA 3GCVA 1QPJA 2W4OA 4O0SA 5AJQA 4EHZA 3DFCB 3HDMA 5LVPA 3BYOA 3FC1X 2JDOA 5GJDA 5DMZA 1ATPE 3PWYA 1W82A 3TV4A 3QD4A 3TZ8A 1R3CA 4XV3A 4DN5A 1EH4A 1SNXA 3P4KA 5E91A 1BKXA 3TG1A 4A4LA 3OTUA 3OOMA 4FEVA 4L67A 1DI8A 4AS0A 3RPRA 4RQKA 2OW3A 4DHZA 4U3YA 3QQFA 5J1VA 4YBKA 1RW8A 4YC8A 2GS2A 4AT3A 2HENA 4EK8A 2QKRA 4XG2A 2F7ZE 4IE9A 4RLKA 4X6RA 4IDVA 4FODA 5KZIA 5C8KA 3FUPA 3JPVA 4EQCA 4U6RA 3E8EA 4QMZA 4YJNA 4BBMA 1P4FA 1J7LA 3H9FA 4JIKA 3FKLA 4A4OA 2Q0NA 4BKZA 1OKYA 3SRVB 4EK4A 1KV1A 4XP0A 5AP5A 5HU3A 1T45A 1H1WA 4TYJA 2ZM1A 1PXNA 4J8NA 4TYGA 3UG2A 4GKHA 4DGLC 2RSVA 2FB8A 2P2IA 1M2QA 3ANQA 3DZQA 4QTCA 4QYEA 3OBJA 2HW7A 2R3FA 2G2FA 4DINA 4JI9A 3GQIA 3V5QA 2A4LA 2UZDA 4AOIA 3RVGA 3NCGA 4BGGA 3VS7A 3MFSA 3R8PA 4EJNA 3BBWA 3F5GA 5J9YA 1QPDA 3RHXA 4IM3A 3VRYA 1OL5A 4M12A 3WARA 2F9GA 4YZNA 4EOJA 3A2CA 4QPMA 2CCIA 3C51A 4ZSEA 2OJJA 2A2AA 3PIYA 4S32A 4O84A 5CX9A 4MYGA 4QDEA 1TQIA 4JDKA 4AW1A 3MPTA 3NZ0A 5A4LA 5HBJA 3ANRA 2PMLX 3E8NA 3VW8A 1SVHA 4PTEA 2WEVA 2WMRA 3ZFXA 5CNOA 3PFYA 4J53A 2XUUA 2XMYA 4BHZA 4GVAA 2JEDA 5IQGA 4RZWA 3BPRA 4UWCA 3EIDA 3VS2A 5JGDA 1JBPE 2A0CX 3KRLA 4MX9A 3UOLA 4Y85A 4GUBA 4QQJA 2BRGA 2O5KA 4IAFA 3IW6A 2WTCA 4FIFA 4DDIA 2IZTA 1BLXA 5DHJA 5BUIA 2VTNA 4YZ9A 3ZCLA 3DK6A 4P4CA 2A1AB 2FVDA 2GQGA 4QYHA 4N70A 2R7BA 5DNRA 3ULZA 3VHKA 2YITA 4IBMA 3QQGA 2VTRA 1H08A 4YJVA 3BLAA 1Y8YA 2WU7A 2CN5A 4PDYA 3HNGA 2R5TA 4J98A 4F09A 3O23A 2UW4A 3PJ8A 3PP1A 1Q62A 5KMMA 2I0YA 3TKIA 3R1QA 1XKKA 4WSYA 5HLNA 4MBIA 4XEYA 2YZAA 3ORPA 4GFMA 3BHTA 3PA3A 5DOSA 5HG5A 4EK5A 4BDJA 3UQGA 4G9CA 2BFXA 4CFVA 2VWUA 3NUAA 3PRFA 5CQWA 4I22A 5F1ZA 3U87A 3ZC5A 3N51A 4FZ7A 4G3FA 4QP2A 2HZIA 4TNDA 4U81A 3DU8A 2I7QA 3BGPA 4MF1A 3VC4A 3PXZA 1U4DA 4R1VA 5IA1A 1YI6A 2C3JA 2VD5A 2XS0A 3MVHA 4LRKA 4M3QA 4RIXB 2R9SA 3I6WA 4X2FA 5BNJA 3R0TA 4JAJA 2XKCA 4DYMA 4EH4A 2B4SB 2G2HA 3CXWA 4EZ7A 1YHSA 2YCRA 3C1XA 1WBVA 1R1WA 3QQHA 4ID7A 5AUVA 2HK5A 4D5KA 5C01A 3OZ6A 1XBBA 3I5NA 5ANDA 3TUCA 4G3DA 5IQHA 4ACHA 1ZYCA 2C6EA 1H1QA 2UZBA 2YM4A 3KK8A 2JFMA 4IIRA 4PQNA 4ZLOA 3ZUVA 1OVEA 2X2KA 3DLZA 4F1TA 2GFCA 2Z2WA 4E20A 2LGCA 2QCSA 4YR8A 4QMXA 4F65A 3SG9A 4RX8A 4AFJA 3FI3A 3MH1A 4C3FA 4FA2A 4WG4A 5CXZA 1B38A 2QOLA 3AT3A 2JIIA 2VWWA 2XZSA 2W1ZA 3FMLA 3TT0A 3W55A 4HGLA 3UNJA 3ATSA 3AD4A 2BIKB 4CGAA 1W0XC 3H3CA 4FL2A 1I09A 1ZZ2A 2R3QA 2WMSA 2PVMA 3I6UA 5HNIX 4LQMA 4FSQA 3RM7A 4C58A 2UW5A 4D4RA 4NTSA 4ZTHA 3W0SA 1FGIA 4RJ6A 4WSQA 4TKSA 4Y95A 2NRYA 1H1SA 2X1NA 4EOLA 4L46A 4CFWA 3TDWA 1PMNA 4DH8A 2BALA 5JFVA 3DCVA 4CRLA 5ETCA 2V22A 4HYUA 3WYYA 4FZDB 3GFWA 5J95A 3QD3A 3CJGA 4RWJA 3OHTA 4IAAA 4HGTA 3S95A 3IPHA 4YSJA 4XUFA 4IW0A 4FIJA 4OLIA 2YIYA 1WBNA 4EL9A 3LFAA 2E9VA 3FMDA 2RG5A 2ZDTA 4M0YA 5EM7A 5EYCA 3EFLA 3CKWA 2PUNA 5E9EA 4NSTA 4USDA 4BWKA 4HYSA 4D4SA 2OJFE 5B7VA 5IQDA 3QTXA 4D4YA 4OTIA 4QP3A 4JJRA 3HV3A 1AD5A 5AP3A 2UZLA 4PL5A 4CV9A 4EZ5A 4CLIA 4NCTA 5GZAA 3PXKA 5J7BA 4FKQA 3DB6A 3F6XA 4USEA 4JR7A 2GPHA 4Y73A 5TF9A 3Q4TA 3FPQA 4JMQA 2E9UA 4RT7A 4P90A 5HOAA 4FV4A 3NEWA 4IX3A 5I9XA 3RM6A 4LDTA 2GNIA 4C0TA 3TEIA 3ZEPA 2GS7A 2X2LA 5DVRA 1NVRA 2QOHA 4GUEA 3QZGA 1O9UA 4AW5A 1YDSE 2XBJA 1UVRA 2YCFA 4GJ2A 4I21A 4M84A 4O6LA 1HOWA 2OXYA 5CYIA 2BCJA 4FUXA 3FMEA 5EYMA 1U46A 1RQQA 3L9PA 5DG5A 1IR3A 5L6WL 4FT9A 4L52A 3BHYA 2CKEA 1LP4A 3ZRLA 5J79A 4O27B 1OUKA 3R28A 3P9JA 5AR8A 3QF9A 2AEGA 2R3OA 2XRUA 2XKEA 3EMGA 3PPJA 3RZBA 2HW6A 1WCCA 2REIA 4PP7A 4I0TA 2PZIA 4IB5A 2WPAA 5CS6A 3V6SA 3VBTA 1KE6A 3NVMB 3UC4A 2GMXA 2BTSA 4F7NA 4AXDA 5C4LA 4QEBA 4MQ2A 2QD9A 4LG4A 4ORKA 5M55A 5HVKA 3PSCA 3FJQE 4EH8A 4YC3A 4K77A 4PV0A 4YHFA 4FVPA 3RHKA 1Z9XA 1YVJA 2DS1A 5J8IA 5AR7A 4UMUA 3EL7A 3ZLSA 4BGQA 1W7HA 2R0IA 3GVUA 4UMPA 5BUEA 1J1CA 4O4CA 3P7BA 5JFSA 4E5BA 3U4UA 2XJ1A 3MVMA 3NUUA 4RC4A 5ETAA 5HICA 4TPTA 5BVWA 3MFTA 3LW0A 1RJBA 2WHBA 4OTWA 3GU5A 3KFAA 1PYEA 4HGEA 4X2NA 3RZFA 3ZRMA 3ZSIA 3LFSA 1U54A 1SVGA 2PY3A 5AX9A 2PE2A 5CU6A 5T6KA 4IB1A 4AQCA 1P4OA 3RP9A 3BYSA 4BWXA 2VWZA 3F3WA 3FSKA 4ZSGA 5IUHA 3R7YA 3SX9A 3MTLA 2QURA 3QKKA 5HG9A 3VBYA 3NDMA 1ZOHA 4PDSA 2YCQA 3SDJA 5CEQA 3GCPA 4GYGA 1OIYA 3ZO4A 3E8CA 4DFLA 4KBCA 2R2PA 2QQ7A 3E3BX 4MKCA 1P2AA 3R9NA 4ANSA 4QMQA 4I5PA 4ANNA 3CBLA 4L01A 3LXLA 2E9OA 3R7EA 4RFMA 3EQIA 5E8XA 4O7LA 3NIEA 4O38A 1QMZA 3LXNA 3TWJA 3HUCA 2YM5A 4ZSAA 4WO5A 4BCQA 3Q6WA 3HLLA 2X8DA 1UNHA 4F0FA 1Q3DA 4X7QA 3PVGA 5E8YA 3DQXA 2CNQA 5DT4A 3FY2A 3U6HA 4HPUE 2XARA 3KK9A 5B2MA 2X7GA 4K18A 2J0MB 3ROCA 1OI9A 1XH8A 3FZPA 3MV5A 3BKBA 3HV6A 4BTFA 3VUTA 2UVXA 2UW8A 2BMCA 3FV8A 1CKJA 2WKMA 2GQRA 2XALA 3GQLA 3OMVA 3HKOA 1E9HA 3ENMA 3LVPA 3ORKA 3PZHA 4GT5A 4I5MA 4MD7E 3PLSA 4DT8A 1M2RA 5HCZA 3C4CA 2VNWA 5BYLA 3AT2A 3DAKA 4PMMA 5HG7A 3DJ5A 1OECA 3D5VA 3W0RA 2F4JA 3KB7A 3F5UA 3OP5A 3OY1A 3BWFA 3QX4A 2RFNA 3TZMA 4E4XA 3AC3A 2BR1A 5K5NA 2HY0A 4AQKA 2YIRA 3HMNA 3V51A 4EH7A 2CCHA 2VTHA 3TV6A 1UV5A 4R6VA 4G5PA 1CM8A 3AMYA 4F9YA 4B6LA 2VTOA 4ERWA 2V62A 5A4QA 2GQSA 2XNEA 5HBHA 5AEPA 3CE3A 2VX3A 2PSQA 4NIFB 4O4FA 3KY2A 3FI2A 3LOKA 1L3RE 3V01A 3DBEA 2VO7A 2OGVA 4B99A 3DK3A 1AQ1A 4MWHA 3TKUA 4CCBA 4YBJA 2X39A 3FQSA 4ITHA 5HEZA 5HE3A 1FBNA 3NW5A 1K2PA 1RDQE 3KULB 2PVNA 3QZHA 4C36A 2RFEA 3IG7A 2ZDUA 4BCJA 3UZTA 3WZDA 4BCGA 3Q5ZA 3JYAA 2JBPA 4FZ6A 3LMHA 5AUYA 3R1NA 3Q4CA 5FM3A 4J7BA 4H3BA 3NFGB 2I0EA 3K3IA 2C3LA 3JR1A 3QRTA 3EQFA 3HGKA 4EC8A 3QRUA 2ITOA 1GOLA 5FBOA 4NH1A 3VF8A 1YDTE 4ITJA 2UZOA 3AC8A 5DGZA 1YOMA 2IZSA 1UU8A 4FMQA 4FSUA 4TYHB 2QOBA 4LOPA 4G5JA 4E6AA 1WBWA 3H9OA 2VGOA 2UZEA 3KXHA 4HYIA 2PU8A 4BZNA 3SXRA 3VQHA 2F2UA 1ERKA 2GFSA 3LCSA 2XIYA 5DR9A 3NSZA 1JVPP 4MNFA 5G6VA 1IEPA 2CPKE 1DI9A 4GFGA 5DPVA 4FEWA 4GVJA 2C30A 3LQ5A 4KAOA 4C62A 5DA3A 3MW1A 1VZOA 4TT7A 2PVLA 2C0IA 4BIBA 4C61A 3EJ1A 4ERKA 2B9JA 5CF5A 4I6HA 3UJGA 2P3GX 5FDPA 3UPXA 1APME 3T3UA 2WTVA 4LOOA 4NT4A 4NU1A 4QYFA 5FDXA 4BBEA 4MXCA 3HECA 3ZDIA 4QP1A 4JVGA 4A9TA 3S2PA 3PIXA 3EN4A 1Y57A 4ZLYA 5FBNC 4AWIA 4RMZA 5I9UA 4EKLA 5HHWA 5IA4A 3UVPA 5C26A 2G1TA 4CRSA 5C1QB 2A27A 3VRZA 3AD5A 5FD2A 3WZKA 2XIKA 3D7TA 4E73A 3Q96A 4ZMEA 1MQBA 5EM6A 3RCDA 4C4JA 4DFZE 5FUTA 4F78A 1JKTA 4C4GA 2VAGA 5FTGA 5EM5A 2HCKA 4BDHA 5HTCA 5DYJA 1DAYA 1OZ1A 1Q8YA 3HDNA 5JT2A 4OAUC 1M52A 2X2MA 2YM8A 4PY1A 5ANGA 4M67A 4JG6A 4FOCA 2YM7A 3TTJA 3LHJA 1KV2A 3R63A 3N9XA 2W7XA 5BMSA 4NM0A 3KL8A 3AKKA 4FRFA 4IAYA 3G90X 3UQCA 2YFXA 3C5UA 3ZMMA 2W96B 4QTBA 1G3NA 4JBPA 4QQCA 4FKWA 4FNYA 3RCJA 3U6IA 3NFFB 4JG7A 2Y4PA 2VWVA 3LJ1A 4JRNA 2YWPA 2RG6A 5CU3A 3NYXA 4G6LA 2RFDA 4U7ZA 2OF4A 1LEZA 5CEMA 3PUFC 3AQVA 5IUIA 3AT4A 3W8LA 3W18A 3QQKA 4LYNA 3TZ9A 3ZU7A 4GS6A 2PMOX 1Q97A 1GIHA 4ANMA 1LPUA 2ITWA 4D2TA 3U55A 3E93A 3MBLA 2AC5A 3V5PA 3JVSA 4A9RA 5HQ0A 4B4LA 2H6DA 3P5KA 4FKOA 3KCFA 5CT7A 5I9ZA 2G01A 4OBPA 4IX6A 2UZVA 4M68A 4Z16A 1CMKE 5BX0A 3ID6C 5EI8A 4FSZA 2JKKA 2V0DA 3MY1A 3RMFA 2I6LA 3VS0A 4L00A 1H00A 3ZO2A 5IQFA 4LGHA 4W4VA 5KX8A 4E26A 3ET7A 3MJ2A 3COMA 4ALVA 3C5IA 3O7LD 4MXAA 3UO4A 3PJ2A 4O91A 2X8IA 3CTQA 2BAJA 2E2BA 4DEDA 4AA0A 3TYKA 2H34A 5IQBA 3D2KA 3ENHA 4NWMA 1OPKA 2C6KA 2X6DA 4J95A 4RA4A 2R3LA 1HCKA 4BRXA 4ZLZA 5EM8A 3P0MA 3ATTA 3S4QA 4E4NA 4IDTA 3UZRA 5AP1A 2BAKA 4L68A 4FKTA 3TDVA 2QOFA 5FP6A 1XH7A 4E6DA 3R9RA 4O0TA 4BJJA 4BCIA 4WUNA 3RK5A 4H1JA 2YJSA 4PMSA 5A4CA 1JKKA 3KN6A 3UNKA 4OTDA 2CKPA 4XP3A 3THBA 2HWOA 1Q8ZA 4BTMA 3W33A 2EXEA 2X0PA 4O0YA 3FXXA 4F63A 5E1EA 2BUJA 2WELA 3R7OA 2UV2A 4N57A 4NM5A 2ITTA 5HX8A 3QTRA 2UZUE 4ZK5A 2R3GA 4C33A 3ROYA 1NVSA 5GZ8A 3DB8A 3U6JA 3REPA 3VULA 5G1XA 3SA0A 3CSVA 2Z7QA 3BQCA 3MPAA 4CZUA 4YLJA 4UYAA 3VUGA 4ZTMA 4PTGA 2Y9QA 4FG9A 3GGFA 1GZNA 4UMTA 4U79A 4YHTA 4ZEGA 5I3OA 5FEDA 1M7QA 3IOKA 3T9IA 2X81A 1F0QA 1JPAA 3F2NA 3QC9A 2OIQA 3R7UA 5FTOA 2UVYA 3AOXA 3ZEWA 3C50A 1V0BA 2KTYA 1TFFA 4L3PA 1W84A 3DT1A 3NUSA 4IZ5A 4O96A 5KCVA 1OKVA 2QO7A 1W98A 1S9IA 2F49A 2O3PA 4XMOA 5EH0A 4EOKA 1H1PA 4CTCA 2J4ZA 5IH6A 2VX1A 1Y91A 2GHLA 4O4DA 4R3PA 3WIKA 3ZZWA 5M4CA 3FDNA 5T3QA 3OC1A 1W2FA 2I40A 5ETIA 4A7CA 3MN3A 2XANA 3KXGA 4RC2A 4B8MA 2R3NA 2DYLA 3FAAA 2BRMA 1GJOA 2EB3A 5AM7A 2XK9A 4IANA 4GW8A 3BL7A 3VJNA 1MRVA 3UG1A 3AKLA 4ACDA 3P79A 1ZMVA 4PF4A 5D41A 1ST4A 1YXXA 3UP2A 2NP8A 4QQTA 5BVOA 2OXDA 5A6NA 4D2WA 4AFEA 4RIOA 1NXKA 4GIHA 2FUMA 2WEIA 2YCSA 4M14A 5GHVA 5M57A 5CENA 5D12A 2OZAA 3QALE 2JFLA 3OT3A 4C4EA 4I6LA 4F9AA 1OL2A 2UVZA 3ZFMA 3FL4A 4EHVA 4ZY5A 3JY0A 4W8EA 5DEWA 1OL7A 4FC0A 3QZIA 3CKXA 4O1PA 4YLLA 4EWHA 2B1PA 4AZEA 4EH6A 2P2HA 2PZYA 3UP7A 3QTIA 3PA4A 4JOAA 3OW3A 3Q32A 2W5HA 3WI6A 3TXOA 3DDQA 1KOAA 4ALWA 3Q4ZA 2YAAA 4I92A 3SHEA 2VTQA 2X0OA 3LFEA 1LUFA 3CY3A 3RPYA 3D94A 4HCTA 4RVTA 4F9CA 2XNGA 5JFXA 3VBVA 5IQIA 2UW6A 5M06A 5AP4A 2OF2A 2I0VA