5J95A

Map4k4 in complex with inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
296
structure length
284
Chain Sequence
DLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title MAP4K4 in complex with inhibitor
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 284
sequence length 296
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j95A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5j95A01
3U6JA 4I92A 4M15A 2CCHA 2PYWA 3HV4A 2W4OA 2CCIA 2RSVA 3ROYA 5DYJA 1GJOA 3HMOA 3TZ8A 5BNJA 1ATPE 2GTMA 1MRVA 3D7ZA 3NAXA 2C6EA 4QMLA 5ANKA 5HG7A 3TNWA 4EL9A 2YJRA 5CX9A 3P4KA 4QP9A 1U59A 4LRJA 4CKJA 3PJ3A 4USFA 3BV2A 3BRBA 4FR4A 4U5JA 5KZIA 2JLDA 3EQDA 3QRTA 2HELA 3RNYA 5L4QA 5DE2A 3TJCA 3HMNA 3O0GA 2VWUA 5CAOA 4YPDA 3BQRA 3UGCA 3BWFA 5C26A 3R01A 1PHKA 4HZRA 4I4EA 4P5QA 4WIHA 2VTSA 5IPJA 4AGWA 4YTCA 4MHAA 5IA4A 3QKMA 1ERKA 1DI9A 3RCJA 4FNWA 3I0OA 5HICA 4EOOA 4RBLA 3QZGA 4GFOA 4F9YA 4NM3A 3A2CA 3MVJA 4DG2E 5JGAA 2OK1A 3C4ZA 4BCQA 4PMSA 3DTWA 4QMMA 5CU2A 5IKWA 4O27B 4D28A 3EQBA 3B8RA 1WMKA 4WSYA 4F08A 5LWMA 1E1VA 4C3FA 3DFCB 2X6DA 2C0OA 4HVIA 3KL8A 5A4LA 4LOOA 3D14A 3WI6A 2OXXA 2ZMCA 3NZ0A 4XG4A 2IVSA 2HK5A 4J8NA 1DS5A 5HOAA 4UXQA 4RIWA 4BCFA 3U9CA 1M52A 1R3CA 2QD9A 4ZS4A 3PXYA 4HOKA 4RFYA 4JQEA 3CY2A 4BGHA 3HUBA 5I5ZA 3NWWA 4ACCA 5CAUA 4BDCA 4XP2A 4L68A 4M13A 4NIFB 4V0GB 5HX8A 1ZYJA 5HE1A 2QOKA 1OL5A 2XNOA 3ACJA 3OXIA 3PXRA 3LQ8A 2XJ2A 2YERA 4QP4A 2YDKA 3OCSA 1Y8YA 3LM5A 3Q4CA 5J79A 5TT7A 4QPMA 5H3QA 3BPRA 4DITA 4PUZA 3EL8A 5LMAA 4BDAA 5EI8A 4S31A 3DGKA 4PDOA 5IEYA 4JDIA 4EUUA 1BLXA 3VUKA 3KXNA 4V04A 2QO9A 2V62A 2Z60A 2JIVA 4CFVA 3UQGA 4FNZA 2XVDA 4FTKA 3F3ZA 3FKLA 3KXMA 2YCQA 3TZMA 4Z3VA 3QTRA 3U8WA 3UVPA 4ANQA 2YIWA 4MVFA 2W9ZB 5AUYA 4XBUA 3LW0A 5EQEA 4RG0A 3SOAA 3G9LX 3VQUA 3PDTA 3ZUVA 3FMNA 3EQCA 2GNGA 4FVRA 3MY0A 3IOPA 5JQ8A 4HGEA 2Z7LA 3E8EA 4EZ7A 3RK5A 1OL6A 2V7AA 2GCDA 5AUVA 3GCPA 3HP2A 2R7BA 3JYAA 4ITHA 3G33A 4LL0A 4EWQA 5HE3A 2YM3A 4O1PA 1IAJA 3PVGA 1P14A 5AJQA 3R1YA 2Z8CA 1MQ4A 1KWPA 1IA8A 5HE0A 4RX7A 5CSHA 2QR7A 4U45A 3T9IA 5M4IA 3PSBA 4NM5A 3HYHA 2I0YA 4DFBA 4QO9A 4G6OA 4CMUA 3R7YA 2PVNA 3QAME 3DBFA 3FI4A 2JKOA 1PF8A 1PYEA 3DB8A 1VYWA 4C8BA 4M97A 5LVMA 4U3YA 4B7TA 5JEBA 3R04A 3RMFA 5HGIA 3O8PA 2Y4PA 3LFNA 2BDJA 4ERWA 3F3UA 4MKCA 3GU7A 3NS9A 5J87A 5KKRC 4C4GA 5B2KA 2BALA 3QX2A 3FZRA 5HIDA 2VRXA 1S9IA 3C4CA 4FKGA 4JT3A 4FTIA 4LYNA 4BCIA 3MY1A 1XH4A 2CMWA 3D9VA 4FIIA 5CXZA 2J2IB 4MD7E 5EOBA 4C36A 4DGMA 3PRFA 4MCVA 4EWHA 4QMQA 3G6HA 2W1DA 3CJFA 4B4LA 2C5XA 4HVGA 2GS7A 4QMXA 1NVRA 4FEQA 4C0TA 5FXSA 2J51A 4HCUA 5FEQA 4JX3A 3QUEA 4OTWA 4RVMA 5CS6A 2W1EA 2WO6A 3O96A 5KBRA 2H6DA 4A9YA 4IADA 2W0JA 2FSTX 4BCJA 2A2AA 4PPAA 4RIXB 2BIYA 2J7TA 4Q9ZA 3QQFA 3ZCLA 2HOGA 3JR1A 1H27A 3UIUA 3F88A 1FGIA 3KB7A 3TIZA 2VO3A 4J1RA 1JKSA 3QQJA 4KAOA 4IH8A 3GT8A 3VAPA 3V6SA 3S1HA 2QOHA 2RIOA 3IONA 5FBOA 5I3OA 3H0ZA 3UE4A 3UZPA 2BVAA 3NLBA 4RJ4A 3W8LA 4IEBA 5ANIA 5C8MA 3ELJA 3GQLA 3DBQA 4GFMA 5J8IA 4CFXA 5LVPA 3IW6A 4GVAA 2PL0A 4MAOA 2WMQA 3ANRA 3ET7A 2WMXA 4W9WA 3AMAA 3QTUA 4RX9A 4AW5A 4BKJA 2CJMA 4J98A 4LL5A 2OXYA 5I9YA 4O7SA 3LFAA 4FG8A 4I1ZA 3E3PA 2BZKB 4Y5QA 2J0JA 4ZSAA 2OGVA 3FZSA 4XYFA 5F9EA 3PVWA 1SNUA 4CV9A 4R77A 2EB2A 2R3PA 3D7TA 3PJ2A 1OB3A 3WYXA 3D5VA 1TQMA 5AP6A 4ZTHA 2E9NA 3CQEA 4AW1A 2RG5A 4UX9A 3KEXA 1YHWA 5EOLA 4AZSA 2OJGA 2WHBA 4NKAA 2C3LA 5D12A 4AW2A 4EH5A 5E1SA 2WAJA 4DH1A 2QO2A 3GCSA 3PLAE 2VWWA 4MD9E 2C68A 3R8VA 3AQVA 2GHMA 2JD5A 3MV5A 5B2LA 5KO1A 1KE7A 3PTGA 4TWPA 4FA2A 3VRYA 2VO6A 2QI8A 3BHTA 4MNFA 5F4NA 3REPA 3DLSA 3Q60A 4AN3A 4ORKA 3G9NA 3NUXA 1K2PA 2XK8A 5EI2A 1U54B 2JDRA 4CKIA 4O7TA 4Y8DA 4OT6A 5IQDA 4O7YA 4AFEA 4QRCA 4YLJA 5FLFA 4FTLA 4KKEA 4PPBA 2BRMA 4KS8A 4M69B 3LFEA 4CTCA 4FEUA 2X4FA 4BZNA 3ZSHA 2QOBA 1H26A 4BCMA 2YIQA 4R78A 1E1XA 2UW8A 4ALWA 3VS1A 2AC3A 3FMDA 3S4QA 3HP5A 4GVJA 4CGAA 3CTQA 4LRKA 2GMXA 3H9FA 4L3PA 5FEEA 4C4FA 3DJ5A 5ETAA 1BUHA 3MVLA 4IFGA 4ZSEA 2OKRA 2OZOA 4GUBA 4ZZNA 1H0VA 4FOBA 4OTDA 4IB3A 4KKHA 5AEPA 2NNWB 3GCUA 1OIYA 4A9SA 1WVYA 2H8HA 4C4IA 4E6CA 3MI9A 3GU4A 2XIXA 4U6RA 4GCJA 4EBVA 2XJ1A 4FV7A 2W4KA 3UBDA 3F2RA 3RPOA 1PKDA 4EK6A 1URWA 1XH9A 4IB0A 3WZEA 3QXOA 3R1NA 4FZ7A 4O38A 1IR3A 1Z57A 2ITNA 1YW2A 2B52A 3TEIA 3CR0A 4XBRA 4CFNA 1Q61A 2W1FA 4E1ZA 3LKMA 2JKQA 4F9CA 2YA9A 2W17A 4E4MA 2CLQA 2C6LA 4F99A 2X39A 3BHYA 3QD3A 2W5BA 3ORLA 2E9PA 3FMJA 1KUTA 4QPSA 5D11A 3EFWA 1Q99A 3PY0A 3UG1A 5L2SA 2YM7A 3R9HA 4RVLA 2R7IA 4R8QA 4AAAA 1WBSA 1WVWA 4K77A 3W10A 4YSMA 1JKKA 3A8XA 3QQKA 3QRKA 4I5CA 4R7BA 5BVFA 4DG3E 4QYFA 3E5AA 5L6WL 4AGUA 5A14A 5C03A 4L45A 4EC9A 5JFVA 1Q62A 4E73A 4W9XA 2C1AA 3VN9A 4S33A 2ETMA 5JFSA 3UO5A 4IAYA 1U46A 4UALA 4MNEA 4I4FA 1H1PA 4RIYB 4YHFA 3ROCA 3VS0A 3VS7A 1OITA 2XUUA 4WG4A 4YUQA 3TDVA 2IG7A 3ZH8A 4X3FB 2PZ5A 3FDNA 3QLFA 4AA0A 2C47A 3UOLA 1M2RA 4G5PA 3S2PA 1JLUE 4BCOA 4FTNA 1P2AA 3W16A 2UZWE 3BWJA 3GC9A 2BFXA 4JAIA 4CT2A 4H05A 3E8NA 1H8FA 2OJ9A 4FTUA 3UQFA 1B38A 3P78A 2JDSA 3PJ1A 4LUEA 4NYEA 4KS7A 2ETRA 3BZ3A 4AX8A 4Q9SA 1OIRA 4CMTA 5L2WA 2VTRA 4ZTNA 4A9TA 5K5XA 4QMTA 3FUPA 2B9JA 4IVAA 5CZIA 3Q53A 3UODA 4O2ZA 4FSMA 4C7TA 3QKLA 1H24A 1W7HA 2OLCA 3TJDA 2UW6A 4YO6A 4A06A 1UU7A 4PNKA 2W1IA 2W96B 2XKDA 4J8MA 4OTIA 3H9RA 3LXNA 4EOSA 2H34A 5IEVA 4EYMA 2YZLA 3PZEA 1J3HA 2RFNA 5I9UA 2W1ZA 3E88A 4EK5A 5FP5A 3VW8A 4D9UA 3LFFA 3PUPA 1P4OA 4C4JA 4FTTA 2XK3A 4LGGA 4AE6A 4AT4A 3ZRLA 4AW0A 2YCRA 4QMUA 4YC3A 2BZIB 3AOXA 4AZVA 4FKSA 1G8SA 4BTKA 2R5TA 3II5A 4ERKA 5IH4A 4FV4A 3F5PA 3HEGA 3KULB 4FKOA 2ZDTA 3UP2A 2UW5A 4ZTLA 2GQRA 3R1SA 3N4VA 3PPJA 2OZAB 4MEDA 4M67A 4EH7A 4DINA 4I21A 1OZ1A 3ALNA 3C4EA 4RZWA 1DM2A 3A4OX 1OUYA 5HIBA 4NCTA 2XRUA 4E93A 5IQAA 3MESA 3DJ7A 3FC1X 2PVJA 2GHGA 2IZSA 3AC1A 4RQVA 3UMXA 3V01A 4OBOA 4FKJA 3EL7A 5DR9A 3PPKA 3VJNA 3IDCA 3NIEA 4N6YA 4E4NA 5HNBA 4EONA 4GUEA 4ZLYA 2CNQA 3KU2A 2B4SB 4TRLA 3EYGA 1FVTA 4BKZA 4FV5A 4O84A 5IQEA 4PDPA 3RAIA 1OBGA 3SAYA 3OBGA 4KUJA 3V5TA 4I5PA 3MW1A 5HLNA 4IE9A 4F7JA 3DAEA 4IZ7A 5M55A 3JY9A 2FSOX 3H3CA 2PE0A 5HZNA 2PE2A 4DH7A 3A99A 2OF2A 2XJ0A 5E8YA 4IX6A 3LCDA 3DT1A 4LFIA 3PFQA 1PXLA 4X6RA 3TNQB 2WTKB 3K5UA 5AP3A 3M42A 4C2VA 4JG8A 2G15A 4EUTA 5E4HA 4B99A 4BGGA 5D10A 4Y85A 4R3CA 3EFLA 1YKRA 3AXWA 1LP4A 4Z55A 3C0HA 4GFGA 4E4LA 5L2TA 3SLSA 4RA4A 4M3QA 3A7GA 4NJDA 5ETCA 1M7NA 1O6YA 3QLGA 5LJJA 2FA2A 4FOCA 1IEPA 5TE0A 4TYGA 3FXZA 4GIIA 2YAKA 4O91A 3QCSA 5BUEA 3DLZA 4YTFA 5IF1A 3HRCA 4YJNA 4J52A 4ZMEA 4D0XA 5AUUA 4BDHA 3DXNA 4JIKA 4J7BA 3G15A 4ITIA 3HRFA 3GBZA 3EJ1A 3DQWA 3FKNA 5CXHA 4DF3A 3LMGA 4FIJA 1OPLA 4FT3A 3DDPA 4C2WA 5A54A 4ANSA 3R6XA 2QQ7A 4QMZA 5FXRA 3MN3A 1YI4A 5CU6A 2WELA 3P7CA 5FTQA 5FG8A 3RI1A 4ASDA 2BFYA 2O2UA 4JQ7A 2PWLA 1GY3A 1FVVA 2EXEA 2WQBA 4BDKA 4WNPA 4ITJA 2Y7JA 1GZOA 3NAYA 3OY3A 2Y8OA 2NRYA 2WXVA 5IH5A 2C4GA 5BVOA 4IVCA 3UG2A 5D41A 3BBTB 1PXPA 2QOQA 4EOQA 5IQBA 1OPKA 3GGFA 3R9OA 3SD0A 2FYSA 4BR3A 2QOIA 3FZOA 4N4SA 3DU8A 2OFVA 3UQCA 2Y6OA 2R64A 2XM9A 3OCTA 4GT5A 4X3FC 5TF9A 5LARA 1CM8A 3OWPA 1HCKA 1YI3A 4CYIA 1CKPA 3EZVA 3BHHA 4G9RA 3DV3A 3R9NA 4DH5A 4F6UA 5BMSA 1ZRZA 3MPMA 4JX7A 5CEMA 3KCFA 3MBLA 2PVYA 2EUFB 2YIRA 3AGLA 4YPSA 2G9XA 2VTMA 2CGVA 4O96A 3MFUA 3A62A 3MPAA 4WHZA 1G8AA 1PMVA 4D1SA 3FLQA 2VTNA 3MWUA 5EHLA 3TL8A 2BR1A 2EU9A 4FK3A 2DYLA 3ORNA 4FSNA 5D9HA 1XH8A 3FHRA 2F49A 4RX5A 3NW6A 4DFLA 3SRVB 3OWLA 1UNHA 3VUGA 2ITWA 2WQNA 5DT3A 2PUUA 3CLYA 3OXZA 1CMKE 3VC4A 1LEWA 4IX5A 3Q2JA 5HQ0A 4ZY5A 3SW7A 2PVFA 4L67A 3G6GA 5DRBA 3UVQA 4MBJA 4BDBA 2Z2WA 1CKIA 4AG8A 4NEUA 5EKNA 4XX9A 3ZS5A 5CEQA 2VD5A 5KUPA 2OO8X 2X6EA 3EQFA 4P2KA 2YABA 4L00A 3KY2A 3CJGA 3GENA 5I9XA 3IK3A 4ACMA 3G0EA 4RLKA 5M08A 3OUKA 4YJTA 2IW6A 2XA4A 1Y6BA 1KV1A 2X2LA 4X21A 1F0QA 3QQLA 5E9EA 3JXWA 4ZJJA 2P33A 2C0IA 4BI0A 3WIKA 2W05A 3CGOA 4MXXA 5C8KA 1EH4A 1PW2A 2CKPA 1YQJA 3E87A 3KF7A 4EQMA 4QP1A 2E9VA 3NPCA 4FGBA 2CKQA 1LR4A 2CSNA 3BELA 4EJ7A 4MTAA 2XYNA 2GHLA 3UMWA 3R22A 4DEIA 3LMIA 3CD3A 3C7QA 3GNIB 3RNIA 3UPXA 5IEXA 4I22A 4IAFA 3SVVA 5GINE 4CKRA 3R63A 3ORKA 4G3CA 2NPQA 3Q6WA 1H1RA 2QOLA 3FSFA 4D2PA 1ZMVA 3PA5A 4KIKA 4DTKA 2ITTA 3Q4UA 5TKDA 3A7FA 3PVBA 1A06A 2X4ZA 2WMAA 4TNDA 1GOLA 3BYSA 3NSZA 3PPZA 4Q5EA 4BZOA 2O64A 3Q4ZA 3N51A 4ZOGA 3QBNA 4E7WA 5JFWA 2DUVA 4PL4A 1J7UA 1DAYA 3ORMA 2GNFA 4MYGA 4ZEGA 4C37A 2E9UA 2W99B 4DE4A 5JGBA 4KINA 4FIFA 4NUSA 1REKA 3MTLA 4FNYA 3VBVA 3DK7A 5D7VA 3V5JA 5CY3A 4DG0E 3HNGA 2ZV9A 4CLIA 4F6WA 4DEAA 3KK8A 5EG3A 5AWMA 3W2SA 4OTRA 2WTKC 5EM5A 1YI6A 3ANQA 3UVRA 1BYGA 2A1AB 4GSBA 3ZZWA 3TM0A 2HYYA 4AZEA 4AFJA 4AGCA 4BF2A 1MP8A 3UIMA 5H2UA 5HG9A 4MWHA 2Z7QA 1YXXA 2PZIA 2DWBA 2QG5A 2RFEA 2CHLA 5L8KA 4F6SA 2G2IA 4FKVA 3R71A 4O0XA 5FUTA 2VZ6A 2HY0A 3DB6A 3EOCA 3QXPA 4UB7A 1GAGA 2A19B 2R0UA 3BU5A 4PMTA 5ITAA 1PRYA 4KIOA 4U44A 3F82A 4LV8A 3FEGA 2PY3A 5KZ0A 3ENHA 5DG5A 3C4XA 3RPVA 5TO8A 4UY9A 4EH6A 3ZM9A 4EYJA 4KD1A 2UW3A 5K0XA 3TT0A 3UIXA 5AP2A 2R3JA 3EKNA 1WBVA 3I7BA 3R7GA 4IX3A 4X0MA 3RHKA 5HU9A 1YVJA 5FM3A 3RM7A 2WQMA 2B1PA 1UKHA 4YZNA 1Q24A 4PNIA 4PL5A 3FL5A 1MRUA 3CQUA 1QCFA 5CQUA 4D4RA 1GZNA 3SV0A 5CALA 1OKYA 3DS6A 3L9NA 3PE2A 4GMYA 4L01A 3C13A 4FTRA 4ONAA 1T46A 4QTDA 5FTOA 2CDZA 3PA3A 4FV0A 4JI9A 4M0YA 1OVEA 3DJ6A 4XP0A 4C35A 3BYUA 1JVPP 2O0UA 4FKUA 5EYKA 5HG5A 4C34A 3U6IA 2X0GA 3TTIA 5CSWA 5FTGA 2O63A 3BU3A 1WAKA 4UYAA 4BFMA 4I23A 4CD0A 3RAHA 3M2WA 4RJ8A 4BDFA 3EWHA 4CRLA 3KCKA 3I7CA 5CQWA 1A9UA 2JGZA 4EBWA 4D4SA 4K18A 1WBWA 4U81A 3WF9A 5CWZA 3CS9A 5AR3A 5CU4A 3OROA 5H8BA 1U4DA 5T6KA 4O82A 5LMBA 3FPMA 4DEEA 4FICA 4R7IA 2XP2A 2O8YA 3OWKA 4PTCA 2NRUA 3P1AA 2WB8A 2W9FB 2PULA 3U4UA 4QYHA 3GU6A 5KHWA 3MJ1A 4G6NA 5M09A 4R6VA 2X7GA 5HNGA 4AACA 5K9IA 4JQ8A 2QO7A 4N70A 4BYJA 5B0XA 4DYMA 4M12A 3UDBA 1PXNA 4FL3A 3V5LA 2FGIA 3AGMA 1YRPA 3BIZA 2BAKA 4PPCA 4RT7A 4FNXA 2WQEA 3TV6A 2XNGA 5H8EA 2HZIA 3PSCA 4O6LA 1PYXA 3LFQA 5AADA 1OGUA 5AV4A 1YWVA 2BRHA 2IJMA 4YC6A 3TZ9A 2JBPA 5BX0A 4N6ZA 3HGKA 3VBYA 5AA9A 2C69A 1MQBA 5DT0A 3E62A 4YHJA 2HIWA 3SC1A 3V8SA 3VS3A 3VBXA 3ZEPA 2ZM1A 2I0EA 3AD6A 3NX8A 4KBAA 4DGNA 2BPMA 4O7RA 4N0SA 3FMEA 5IA1A 2IWIA 4IANA 1OUKA 4OR5A 2QLQA 3AC2A 4YJRA 2EWAA 4D2RA 3D4QA 3R0TA 4XG8A 2FUMA 2XKFA 4XG6A 2C5YA 5AUTA 4L42A 1OECA 3FY0A 4EHVA 4JS8A 5HESA 3V04A 5DGZA 4BWKA 3QZIA 1H28A 2C30A 1Y6AA 4L7SA 5CT7A 4ANBA 3Q4TA 2UZTA 4X3JA 4XLIA 3MGYA 4ASXA 4IZAA 3RCDA 4C3PA 5LVOA 4H3PA 1S9JA 3B8QA 5C01A 2WMVA 3LVPA 2J4ZA 1AGWA 1VYZA 4NSTA 3ODZX 3R2YA 4EOIA 2WMUA 1YDSE 4AOIA 4DGGA 4AP7A 3TIYA 2VGOA 3PRIA 1UNLA 2UZBA 2YM5A 3U54A 4FK6A 3R8PA 1RJBA 2QCSA 3PZHA 4CFFA 4EORA 5J9YA 4A4LA 3WZKA 4BTJA 1UNGA 3EIDA 2ERZE 4EI4A 4IBMA 3COKA 4R7HA 5JZNA 2IO6A 3F5GA 3KXXA 1ZMUA 2Y6MA 3L8PA 2F7ZE 5HD7A 2BDFA 2W5HA 3EN6A 5L6OA 4RJ6A 4M0ZA 2WMWA 4L6QA 4G2FA 4TXCA 4NIFA 4V0GA 4KRDA 2FSMX 4ZLZA 1OL7A 5HU3A 4XEYA 2GNLA 3LXPA 3NGAA 2YIYA 5CLPA 3NYXA 2G01A 3DCVA 2A27A 3IW5A 4YJPA 3OW3A 1WVXA 4BHNA 2A0CX 4M68A 2YLEA 2YWVA 4CSVA 5AUZA 5HBJA 1UA2A 3IDPA 3LXLA 2UW9A 2UVZA 5BPYA 3FHIA 4MXZA 1CKJA 3ERKA 3P0MA 3QA8A 4FX3A 4L7FA 3F7ZA 1W84A 3C5UA 4QQJA 4WT6A 4CFUA 5B7VA 4FL2A 2X1NA 3E7VA 4D5KA 1BI8A 1XKKA 3BHVA 4E6DA 5J7HA 2HW7A 2RF9A 5IUGA 3N4UA 3I79A 4QMYA 1APME 3CSVA 5AX9A 3DY7A 4E5BA 4CFMA 4WG3A 2QLUA 4RGJA 4QQCA 3FI8A 1H00A 3IW4A 4U0IA 3OY1A 5AR8A 4I0TA 1CDKA 4U41A 4DN5A 3EFJA 2J5EA 4PRJA 2YN8A 5E8WA 3UO4A 4E3CA 2F2CB 2ITXA 2WTDA 5LMKC 2JC6A 3KRLA 3W2OA 3GUBA 1WBTA 4RFMA 3D7TB 3CPCA 4EZ3A 2J90A 4NK9A 2R3FA 3I1AA 4U7ZA 3QU0A 4PTEA 4QP8A 3V5WA 3HMMA 4C4EA 5I3RA 5LXMA 3HUCA 3F69A 1STCE 1V1KA 4E5AX 3BHUA 3OVVA 4WKQA 3F7WA 3ZFXA 5ANDA 3KQ7A 3AG9A 4G9CA 1PMEA 4RJ3A 5K3YA 5E92A 5CAPA 4RSSA 4DH8A 4BRXA 3Q9ZA 4RC2A 3RAKA 3TV7A 2W1GA 4ZY6A 4CXAA 3IS5A 4XJ0A 4FZAB 3ZUTA 4EOMA 5GZAA 4WUAA 1JOWB 3KA0A 1PXIA 3HECA 4BIEA 4BWXA 2UV2A 3BQCA 4YGAA 5CEIA 2IW8A 3ZDUA 5AAEA 4FSWA 5JN2A 2BUJA 3QX4A 3NYOA 4FG9A 4YJOA 1YXSA 1SM2A 4IFCA 5E8TA 3RZFA 1UKIA 3AC8A 5IQHA 3BE2A 5CNOA 5DHJA 3R1QA 5AV3A 4HGLA 2W4JA 4TYHA 1JPAA 4QMOA 3TNPC 3ZLSA 3BYMA 4QMPA 4E8AA 5EM6A 4BL1A 2BTSA 1JKTA 4NFMA 4XRLA 3RTPA 2PVKA 2VNYA 5CVFA 1XBAA 2I0VA 3LCSA 2PUPA 5EDPA 3L9MA 3AC5A 5E91A 3ZDIA 3QTIA 4ZZOA 2IN6A 3QHWA 2BAQA 3FYKX 4JR3A 1R78A 3WILA 2BTRA 2GPHA 3K3JA 3PY3A 2R9SA 4PP9A 2H9VA 2QKWB 1ZY4A 4XOZA 4CNHA 5HO6A 3ZONA 4EOLA 1H07A 1WBPA 5FRIA 5BYZA 2ONLA 1FBNA 4O2PA 4QMVA 3VS4A 2YISA 3D94A 2OW3A 3AMBA 2UZNA 3FL4A 2JIIA 4HGTA 3ULIA 2IVUA 3NUUA 3CE3A 3JVSA 3ORPA 2WEVA 2IW9A 3RK9A 5L3AA 2RG6A 3A7HA 3LFDA 4O7ZA 3BU6A 4IAIA 5JQ5A 4OTQA 5GZ9A 4WUNA 5JFXA 3GXLA 1OKWA 3ZO2A 4B8LA 2O3PA 2C6KA 1YDRE 3OCGA 4K33A 3KRJA 3KRXA 2XMYA 2ETKA 1PXOA 3D5XA 2PVMA 4K11A 4NWMA 1OM1A 3ODYX 3OHTA 4M7IA 3OS3A 4S32A 4XHKB 5EQYA 4Z9LA 2HWPA 4CFWA 2BRNA 3GEQA 3LCKA 2VTOA 4KIQA 5E8VA 5A6NA 5KMJA 1OKVA 4JJRA 2HZNA 3PP1A 4FI1A 3FLZA 3PXKA 3V5QA 3ZO1A 3OT3A 5KMKA 2R3KA 5EH0A 5AP0A 3L8XA 3E93A 2JIUA 3MVHA 3BEGA 3R83A 4CCBA 5FQDC 3NUSA 4MNEB 4LG4A 2P0CA 4PF4A 2VWYA 4IVBA 5FD2A 3SKCA 4D2VA 5ACBC 3VIDA 4YMJA 4ZMFA 2YEXA 3CTJA 3TUBA 4WOVA 3F3WA 3BGZA 1ZYCA 5GJGA 4DC2A 2YHVA 4CZYB 5BUIA 4PY1A 4FSTA 4WO5A 3DAKA 2BHHA 1BX6A 3HMIA 2VTQA 2ITPA 3FI2A 4Y83A 2B55A 3WF5A 1U54A 3LLTA 1XBBA 4JL9A 3VUTA 4YU2A 4XV3A 3IW7A 1ZWSA 4EK4A 3OFMA 4LGHA 1FGKA 3FQHA 2B54A 3O23A 3ZFMA 1RDQE 4YLKA 5CSXA 4FT5A 4IAAA 4KSPA 4WBBB 5HKMA 1UV5A 3VHEA 3GP0A 3W33A 3EYHA 4WA9A 3E92A 2CN8A 3BCEA 2QOOA 3O50A 1Q4LA 2GDOA 3S3IA 4BYIA 2C5OA 3KVWA 3F5UA 3UYSA 2WU7A 3W2QA 3DFAA 2R3IA 5GIOE 3EMGA 4ZAUA 3KC3A 4GW8A 2PVHA 3RM6A 3MFTA 5KMOA 4MX9A 4I0RA 2Q0BA 4RX8A 3ZU7A 2V55A 4H3BA 1ZOEA 2VWBA 4U9AA 1ZYDA 3S95A 4GT3A 4MWIA 4IZ5A 2QHMA 1KE5A 3B2WA 4KA3A 3EHAA 3W32A 3FXWA 4DH3A 4OGRA 4USEA 3WF7A 1W83A 4JDJA 4RVKA 4BBMA 2UUEA 4JIAA 3MH0A 3A7IA 3UO6A 4IM3A 3I6WA 3QYZA 1KE6A 4RVTA 1R1WA 4F7LA 5LVNA 4II5A 3UIBA 1NY3A 3BX5A 4PMMA 4BDDA 4ZXTA 4AN2A 3U51A 2C5NA 4FTQA 3OCBA 1R39A 1IG1A 3UPZA 4EOPA 4FEXA 1UWHA 1ZOHA 4F65A 5I9ZA 2G2HA 1UVRA 2O5KA 2C6DA 2VO0A 4MQ2A 4QP3A 4QD6A 4YNEA 2O65A 4LV5A 3QTXA 4FF8A 4BCPA 4XRJA 3TKHA 4TWNA 4XP3A 3QC9A 2VTJA 5EHOA 3GCQA 5GJDA 3TWJA 4C62A 4YZMA 1Q3DA 5E7RA 5LVLA 3FLWA 1XR1A 3OF0A 4YZBA 5EYMA 3PIZA 2CLXA 3FAAA 3ZSIA 5LOHA 4NH1A 4RIYA 4WSQA 4BICA 3DBCA 2PSQA 3QL8A 4U80A 4QTAA 4ZZMA 3BGPA 4TYJA 4QMSA 2FO0A 4X3FA 3SX9A 2F4JA 3E3BX 4RA5A 5AM7A 4NJ3A 5GHVA 3QUDA 4BCGA 3MH1A 4EEVA 5BYYA 4AE9A 4MH7A 4XOYA 3EKKA 5HORA 4G34A 2R3HA 3ATSA 2R3LA 4BHZA 2SRCA 4Y95A 3V51A 5HIEA 5JSMA 4XG3A 1F3MC 2PMOX 1BL7A 4U42A 3RALA 3F3TA 3WF6A 2UZDA 4A9RA 2IZRA 4YZ9A 4RC4A 5CF5A 5HVYA 3C5IA 4AS0A 2WTJA 3EQPA 2PMNX 2ZB1A 2XIKA 5AIRA 4O83A 1WBOA 3LOKA 2B9IA 4RJ5A 3RPYA 4UEUA 4B6LA 2E9OA 4FTCA 3ZTXA 5CNNA 3R7OA 3HDMA 5M44A 3CIKA 2BDWA 2YITA 2VWXA 3BGQA 3VJOA 5HCXA 4EJNA 3RPSA 3PYYA 1NA7A 2YCFA 3AD5A 3HZTA 3OUNB 4LMUA 3UJGA 3I4BA 4O0YA 4C38A 2R3MA 4I6HA 2GQSA 1Y91A 2XS0A 2CNVA 4N57A 1PMNA 5EW3A 1XJDA 3HKOA 4BDEA 4O7NA 3RPRA 3IGGA 3UOJA 4BY9E 4KRCA 4NTSA 4RWKA 3TCPA 3LPBA 5DEYA 3FLYA 4E20A 4C33A 3CC6A 4G31A 4TY1A 4YZDA 3DQXA 5IA2A 3ZFYA 3IOKA 3BLRA 2OIDA 3KREA 2XRWA 3EFKA 5DFPA 4J97A 2KULA 2ZM4A 4CT1A 5I0BA 3D0EA 2F7XE 1KSWA 2F9GA 3WF8A 5HVKA 4C57A 4CVAA 3TUDA 1F5QA 4MBLA 4O21A 2PTKA 4Z7GA 4EQUA 3I5NA 4WRGA 5FBNC 4UMUA 3I6UA 4U8ZA 4YTHA 3SW4A 3LJ2A 1AD5A 2YAAA 4FVQA 2Z02A 5E8SA 5G6VA 4ZSGA 4AF3A 5GIPE 5HNIX 3UZTA 4RIOA 3LAUA 3C0IA 3VQHA 2XBJA 4LUDA 1OKZA 4P5ZA 3LQ3A 4I41A 2GSFA 4ANNA 4KWPA 2RL5A 4IM2A 3D83A 2JFLA 1RW8A 3C4FA 3ZBXA 2PPQA 4H39A 4O0WA 4U40A 3QHRA 3ZEWA 3OMVA 1URCA 3F6XA 3LZBA 4FYNA 5HE2A 4GV1A 3PG3A 2CGXA 4IX4A 4O0TA 3VNTA 5HCZA 3ZRKA 2BZHB 1TQIA 4ANMA 3O7LD 5AV0A 3DXPA 3FI3A 4HVSA 1J91A 5J1WA 4IB5A 2Y9QA 4NZWB 3Q6UA 4HCVA 4HYSA 4TKSA 5DH3A 3ZLWA 2CKOA 3BBWA 4NW6A 5I4NA 3UNZA 4GJ3A 4FSYA 2YM8A 4ZSLA 2WMSA 3COIA 3NNWA 4BVUA 3NVKI 5EW9A 5GZ8A 2G2FA 4IAKA 1P4FA 5AM6A 3KRRA 4IXPA 2BAJA 2IVTA 3NUNA 2VGPA 2WNTA 4JG7A 3WBLA 4J96A 2QU5A 4YLLA 3RGFA 1FINA 1M17A 3H0YA 4R3RA 4UMTA 4OTHA 2ZM3A 3UNJA 4DGLC 3F9NA 4NKSA 4RMZA 4FC0A 4ALUA 5BMMA 4DGOA 4X2GA 4YTIA 4D55A 2BRGA 1M7QA 2X7OA 2B9HA 2GU8A 4HYHA 3M11A 1PMUA 1L8TA 5IMEA 4YO4A 3FLSA 1W0XC 3ZC5A 2OU7A 5KE0A 4BI2A 3PJ8A 5M07A 4RWIA 4DLIA 3DNDA 4I0SA 2F57A 4EOJA 1ZYLA 5CF4A 3MFSA 1Q41A 3C0GA 5LQFA 1H1SA 4S2ZA 3PE1A 4UZHA 3ZZEA 3EQHA 3SXRA 3DDQA 1ZAOA 2ERKA 4F0GA 3QF9A 2J5FA 5F95A 4Q5HA 2G1TA 2UZVA 4Y73A 5C27A 4GEOA 4YBJA 3NDMA 2Y4IB 2JKMA 4MXOA 5BVDA 2WKMA 4LM5A 4TZRA 2IVVA 4FKIA 5CSVA 4DFYA 2BZJA 2ITUA 3R02A 2C6OA 4HVDA 5FDPA 4YURA 4KKGA 2ITYA 3PVUA 3GFEA 4EH8A 3GVUA 3PJCA 4JDHA 2FVDA 4UXLA 5FEDA 2C0TA 2WTWA 2XK9A 3NNVA 4IJ9A 3CY3A 4L8MA 3TACA 4IWDA 2J6MA 5EKOA 3U55A 4KIKB 2C6MA 3CPBA 4FUXA 3ALOA 3ZO3A 5IQCA 4JBPA 4JAJA 3IKAA 2JFMA 3QTWA 1NVSA 2OH4A 3NYVA 5KBQA 1Z5MA 4IHPA 3R8LA 3DPKA 4I3ZA 4XLVA 4ZJIA 4HNFA 3NNXA 3TZ7A 4D4VA 4QMNA 3GFWA 4WBOA 3G2FA 2Q0NA 3ZSGA 4F7NA 1JBPE 5I9VA 3VUIA 3PA4A 4FV9A 1Q8ZA 4EKLA 1XBCA 4BTFA 3QZHA 3FYJX 5E8UA 4TN6A 3V8TA 4HNIA 2YDJA 4FSZA 2NO3A 3MH3A 4OBQA 3DBDA 1B6CB 3MA6A 3SOCA 5HLWA 4OAVB 2XNBA 1DI8A 2V5QA 3ZM4A 4X6QC 5F94A 3GB2A 3RJCA 4YJQA 4CZUA 4AOTA 3U4WA 2QVSE 3GC7A 2CGWA 3A7JA 3F2NA 4G6LA 5CEOA 5DNRA 1M2QA 2XF0A 5EM7A 1X8BA 4L3JA 2WIPA 3HVCA 4MXAA 3WZUA 3EN9A 4FV1A 5FP6A 3W2PA 4A07A 5DWRA 4L53A 4C3RA 2PE1A 4F63A 1SYKA 1VJYA 3F5XA 5CZHA 4L44A 3T3UA 2W06A 4M14A 3UOHA 4IW0A 4F9WA 1KOBA 5HTIA 3MTFA 4L43A 5EDRA 3R30A 2YJSA 4FKLA 5AP1A 4X7QA 3EN5A 3Q9YA 5DBXA 5E8XA 3VRZA 3SA0A 3EQIA 4O22A 1MUOA 4HPUE 2HZ0A 4R5YA 3KFAA 4LGDA 2VAGA 2UW7A 5FGKA 3SXSA 1IAHA 2FSLX 4I6QA 4BIDA 4RZVA 5A6OA 2WEIA 2B53A 4JBQA 2FB8A 2R3OA 3CCNA 3CQWA 4IZYA 5EHYA 2EXCX 4F70A 4XH6A 2X81A 3SG9A 2XK4A 4PDSA 4UWBA 5LWNA 5C8NA 4WNKA 4DBNA 4HPTE 5AAGA 5CI6A 4GKHA 3Q32A 3RVGA 5KMNA 3S0OA 1JSVA 1U5RA 2ZJWA 4W8EA 2PUNA 3NYNA 2JAVA 5JRSA 2EVAA 3K54A 3N9XA 3M1SA 3HMPA 1H1WA 2GTNA 4IWOA 3WOWA 4CEGA 1PY5A 4P90A 4UWYA 1PXMA 1CTPE 3HV5A 4G3DA 3VBTA 4BN1A 4TPTA 1OL1A 4QOXA 1IA9A 3C1XA 3PY1A 3QQGA 1XH5A 3MIAA 2HXQA 4FZ6A 3VBWA 5ANJA 2F7EE 2F2UA 4BDIA 3FQEA 4IWPA 5HVJA 5K4IA 3OTVA 3OBJA 4BC6A 4ZY4A 1JAMA 4PDYA 2C3JA 2PU8A 4BDGA 4RIWB 2JBOA 1ZYSA 4UZDA 5KMLA 3TNHA 2WMRA 4A4XA 1YXUA 4KIPA 4AZWA 4GRBA 2YLFA 5IMXA 3AC4A 3EH9A 5M56A 4BB4A 2XBAA 2X9EA 5J1VA 2R0IA 4ZTRA 5DI1A 4APPA 4NTTA 4FGRA 5FDXA 4QYEA 5HG8A 5HD4A 4I94A 5CYIA 4K0YA 3N4TA 1W82A 4H1JA 5HX6A 2XH5A 2V7OA 5F1ZA 4DCEA 4D5HA 1DAWA 4ZTMA 3F61A 5AA8A 2BROA 5HHWA 3PP0A 5J7BA 3R7VA 4CYJA 5LMKA 3DKGA 1JWHA 4JXFA 2OJFE 3PWDA 1FMOE 3VO3A 4ARKA 1K3AA 1ZY5A 1WBNA 3R8UA 2OF4A 1HCLA 5L2QA 3ULZA 2EB3A 3D2KA 3MPTA 1YDTE 3ZUUA 2BHEA 2PVRA 4IC7A 3WE4A 1Q5KA 3NCZA 2HXLA 5M51A 4FEVA 1Q8UA 4CCUA 4UMPA 2J50A 4EHZA 2C5VA 4FTAA 2BCJA 3RBWA 5IDNA 5KHXA 5IQGA 1O6KA 1JSUA 3CD8A 5L8JA 4AUAA 4HYIA 3IG7A 4JRNA 1O9UA 5ETIA 4GH2A 4V01A 3VF8A 3AT3A 3KN6A 2QOCA 2Y4IC 3JUHA 3F2AA 5JKGA 3KXHA 5CVHA 5IA5A 4HGSA 5EI6A 3ORXA 4L46A 5J95A 4HCTA 2GQGA 3FKOA 2UZOA 1IASA 2WZJA 3RHXA 4AA5A 5I9WA 4F7SA 4F9AA 5BUJA 3IO7A 4YBKA 4YZCA 1ZXEA 5M57A 5JH6A 3GI3A 4UBAA 3PXFA 2GFSA 1P5EA 4GL9A 5KNJA 4D0WA 1K9AA 3NUAA 4IACA 4AZTA 5L6PA 1G5SA 5T68A 2CPKE 3ENMA 4PTGA 4DT8A 3G0FA 2WTVA 2QKRA 1WZYA 3FC2A 3PSDA 4LRMA 3UNKA 1OL2A 4I5HA 4NM0A 5M4CA 2I0HA 4FIHA 4BZDA 3GU8A 1NT2A 1J1CA 1H4LA 4XNEA 4IVDA 4K6ZA 5HLPA 4C02A 4F1TA 4RWJA 4W4WA 3K3IA 3VWAA 3Q3BA 4RC3A 3D5UA 2A4LA 3R8ZA 2XNPA 3SXFA 4XS2A 2OSCA 3L8SA 1A48A 1NVQA 3KXZA 4G3EA 2I7QA 4HVHA 4C58A 5KMMA 4QTBA 2X2KA 4V05A 2QR8A 3QYWA 1T45A 4AOJA 3H4JA 1GIHA 3VVHA 4EZ5A 3VULA 4OAUC 5C4KA 3POZA 4F4PA 5DT4A 5CAVA 2P2IA 3NCGA 3C51A 3HA6A 4XV9A 5A4EA 1RQQA 1WFCA 2XNMA 3JVRA 4R1YA 2QU6A 1XO2B 4ZLOA 3RWQA 4MQ1A 4ANLA 1MRYA 4BBFA 5T3QA 5CAQA 3VF9A 4DTAA 3ACKA 5AX3A 5DN3A 3LCOA 5AR5A 5IA3A 2RGPA 5JZJA 4FE2A 4QYGA 2IZUA 3P9JA 4YNOA 4G3FA 5FXQA 4F0IA 4TL0A 5CI7A 2XNEA 4L52A 5DPVA 3L9PA 3ZHPC 1RE8A 3BEAA 3CGFA 4WNMA 3JPVA 4RFZA 3L1SA 3NVMB 3P7AA 1OPJA 4FV8A 2WTCA 3LHJA 2JDOA 4FV3A 4GT4A 3FBVA 4PL3A 4W4VA 3R9RA 2OIQA 3SG8A 3DA6A 4UMRA 3T8OA 4DFUA 3ZLYA 4O0UA 3KVXA 4QQTA 4OW8A 2OH0E 3ZXTA 5IISA 3IPHA 2XNNA 2VWZA 3WYYA 5M4UA 4JDKA 3H30A 2ITQA 2ZYBA 3DZOA 3HLLA 3OWJA 2UZEA 4I6BA 4QQ5A 5ANGA 3ETAA 4B9DA 4EC8A 3ZLXA 4CZTA 4CG9A 3BLQA 3JY0A 4DCAA 4FTOA 4KB8A 3ITZA 1J7IA 4YJVA 3V5PA 3SGCA 3IGOA 4J95A 3QQUA 4ZK5A 1YOMA 5KX8A 4TYHB 5IA0A 1SZMA 5EQPA 1JSTA 4UV0A 3VUDA 5JK3A 5D1JA 5EK7A 2J0KA 3R73A 4EH2A 5A3XA 3NR9A 1VZOA 2NP8A 4D4YA 3QC4A 3Q9WA 5GJFA 1J1BA 1Q97A 2B0QA 5IQIA 2CN5A 3AT4A 3DOGA 4HW7A 2ITOA 4AZFA 4G1WA 3FWQA 4GK3A 2CKEA 3ZO4A 2VNWA 3BYOA 2GNHA 3Q04A 1ZMWA 4FT0A 4EHEA 2IPXA 1L3RE 3MSSA 1NXKA 3HX4A 4FTJA 1FMKA 1FQ1B 3I60A 4APCA 3BLHA 3TG1A 5AR2A 1KE9A 4G16A 4ID7A 3HRBA 4DFNA 3TV4A 5HO8A 5M06A 2AUHA 2JEDA 4MF0A 2LGCA 2XIZA 3RP9A 4EOKA 2BRBA 3CXWA 3CBLA 5ACKA 5AIKA 4DTBA 1H1QA 4IDTA 4KBCA 4LMNA 3RWPA 1YOJA 2PHKA 5BVKA 2WGJA 3OXTA 4JG6A 3ORTA 3D15A 4D2TA 4RIXA 4ASEA 2IZTA 4O7VA 1JKLA 2YM4A 2CNUA 3SQQA 3UC3A 2YIXA 1GNGA 2X7FA 4HYUA 5B2MA 3CKXA 3HAMA 5AV2A 3VBQA 2XM8A 3MYGA 4BCNA 1BL6A 4FG7A 5GNKA 1UU3A 3CKWA 3DXQA 5CANA 1OMWA 2VTTA 4FT7A 4MD8E 3T3VA 5IH6A 3EN7A 3FQSA 3ZC6A 3Q9XA 2YM6A 4EH4A 1W8CA 2ZV7A 2VX1A 2VUWA 2WQOA 4S30A 3MY5A 5BVNA 3PWYA 4RRVA 3QKKA 4JVGA 3NUPA 3ORIA 1JQHA 3E7OA 4DFZE 1Z9XA 4JBVA 1YWRA 1SVGA 1TVOA 4I6FA 2P2HA 4QTCA 3P08A 3HV6A 3PIYA 3NW5A 4JLCA 4GK2A 3FSKA 3HV7A 3NEWA 4XG9A 5DVRA 3UYTA 4D2SA 5CEPA 2VV9A 2WMBA 2BIKB 2JAMA 3GQIA 3LIJA 4FTMA 5EFQA 2XEZA 3BYVA 4EQCA 5ICPA 3BKBA 5IUIA 4J53A 3UOKA 3QTSA 3U6HA 3A60A 4ZIMA 5C1QB 5AUXA 3ATTA 4LI5A 4AN9A 1Q3WA 4FV6A 1Q8WA 4Y72A 5DOSA 4PMPA 5TOZA 3UTOA 3QRJA 5LCKA 4F9BA 1ZARA 2J9MA 2PMIA 2RFDA 1GIJA 3R9DA 4C59A 3QRIA 5IG1A 4AT5A 4DA5A 1FOTA 3ZMMA 1AQ1A 1TKIA 4I20A 3LFBA 4GG7A 5JGDA 2PZYA 1LEZA 4QYYA 2HZ4A 1H08A 3C50A 2QC6A 5M4FA 3QRUA 3S00A 3DTCA 4MXCA 2QONA 2WOTA 3D2IA 2XB7A 1YOLA 3V8WA 1PXJA 5G1XA 4A4OA 3NIZA 3TKUA 3P86A 4XMOA 2I1MA 4YJUA 3KKVA 4DAWA 3PXQA 3O17A 3WIGA 2C3KA 3O8TA 3WE8A 4M69A 2AYPA 4RQKA 4K2RA 3FY2A 3GOPA 2ESMA 3P5KA 2WTIA 3ZOSA 4E26A 3LJ1A 4FZDB 1ZZ2A 3LFSA 1VEBA 2Y0AA 4CV8A 5HO7A 3LXKA 4BIBA 3DKFA 5J9ZA 4FBXA 1CSNA 5CSPA 3MB6A 1V0OA 5BQ0A 2QURA 2V22A 4FUYA 3KGAA 4A7CA 2HAKA 5A4CA 1OBDA 4TT7A 1UU9A 3SHEA 5M53A 3P7BA 2E2BA 4UMQA 3FZTA 3B2TA 2UW0A 3W2CA 4BGQA 3LLAA 4QP6A 4FSQA 2W1CA 3MA3A 4K9YA 2ITVA 5A46A 2QODA 2XK6A 3ZXZA 4PP7A 3TDWA 4W8DA 2Z7RA 4M84A 3AT2A 4YHTA 1PKGA 1BKXA 2EXMA 4ENYA 4FKQA 3L9LA 5DIAA 5AP7A 3KMWA 1H25A 4NFNA 3TUCA 2R3NA 2WPAA 3RKBA 4K1BA 3WZDA 2FH9A 3MS9A 4TTHB 1LUFA 3WZJA 5CASA 2HW6A 2VWIA 2C6TA 3MIYA 4G17A 5A4QA 3O7LB 1I44A 1XWSA 3RZBA 2WU6A 4BBEA 3HAVA 5AFVA 2JDTA 3PLSA 4IAZA 3Q52A 3UC4A 4DEDA 4DEHA 2Q83A 3GC0A 3HL7A 4GG5A 4YP8A 4GKIA 3I0QA 3QALE 4EHGA 3OEZA 4ZS0A 4U97A 2WFYA 5ETFA 4JNWA 4IM0A 4K8AA 2HWOA 5CTPA 5E90A 4ZTQA 5K0KA 4O6EA 5L8LA 2XIRA 1I09A 3R2BA 2XCKA 5DEWA 4OTPA 1QMZA 4FV2A 3VS2A 2R3QA 2VWVA 2YFXA 1SVEA 3FZPA 1VR2A 2RFSA 5AP4A 3KMMA 4TNBA 2X8EA 3Q2MA 4WG5A 2R3GA 4I24A 2OI4X 3QWKA 3VUHA 3W18A 3E8DA 3OP5A 4E6QA 3H9OA 5EM8A 3NRMA 4Q2AA 4F09A 5IUHA 5CF8A 5A4TA 4X2FA 1R0PA 4XV1A 4FZFB 5BYLA 3NUYA 1PXKA 2J0LA 3NNUA 4D2WA 1KV2A 2QHNA 2ZVAA 2V0DA 2OIBA 3O51A 3ORZA 4D1XA 3QTQA 2YCSA 5K5NA 3EZRA 4FIEA 3GU5A 2VTPA 3CTHA 2DS1A 4D1ZA 5C4LA 5AV1A 4WRSA 3V6RA 3OTUA 5J5TA 3F3VA 5AR4A 2ONLC 4ZP5A 2I6LA 2JKKA 4FL1A 2GNIA 3VW6A 4MBIA 1YHSA 2RKUA 2WMTA 1IRKA 4B0GA 4DEBA 2C3IB 1QPCA 4PX6A 3OEFX 1SMHA 3RINA 4YR8A 1UU8A 4OUCA 3UZRA 3KRWA 1H01A 4O0RA 3QGYA 2H96A 1M14A 4F1OA 3E64A 3I5ZA 3LMHA 2UZLA 3R00A 1E9HA 1Q8YA 1LPUA 1TQPA 2VTIA 3A8WA 3Q96A 4I5MA 3V3VA 2AC5A 4I93A 3RK7A 3ZYAA 3GCVA 5AAFA 4QPAA 3TI1A 3QD4A 4DFXE 4GK4A 4PQNA 3HA8A 3VS5A 2YZAA 3QCQA 2R2PA 3F66A 4X2KA 3QGWA 3IECA 1GZ8A 3OG7A 4IC8A 1V0BA 3KULA 4DT9A 3DKCA 2UVYA 3QTZA 2J0MB 1M2PA 4OTFA 2OZAA 4TYEA 4QTEA 3CEKA 5DR2A 1OIUA 3E63A 5J9LA 4FODA 2PK9A 4QT1A 3OC1A 4G5JA 2VU3A 3R8MA 3T9TA 2OWBA 5CENA 4H36A 4RPVA 3FPQA 4L3LA 3VUMA 3FV8A 4X2NA 4GJ2A 1PJKA 4DHFA 1KE8A 2QNJA 2ACXA 1YWNA 4FIGA 4R3PA 2B7AA 5TR6A 3W55A 2ZV8A 2ITZA 4NU1A 4XV2A 4BCKA 4KNBA 3WARA 4U79A 4NT4A 4O0SA 5E1EA 1GIIA 2OG8A 2ZAZA 3C9WA 4TYIA 5BVEA 4FSUA 5LCJA 4R5SA 3AD4A 4GU9A 3OOGA 4F64A 2OXDA 4CG8A 4O0VA 4QNYA 4B8MA 1Q8TA 4AA4A 2ZMDA 3THBA 4KBKA 3FMHA 2KTYA 4ACHA 3ID6C 2XYUA 4FKWA 3OT8A 3QD2B 3KMUA 3KN5A 5AP5A 4BTMA 4EK3A 3O2MA 1FVRA 4IJPA 1SNXA 3FLNC 3R21A 4H58A 4TWCA 4CQEA 1U5QA 5H8GA 4FMQA 4CRSA 2I40A 4O81A 4NL0A 4QMWA 4E6AA 1XH6A 2QOFA 1ZLTA 4M66A 3TTJA 2PVLA 1HOWA 2BKZA 2VX0A 2GFCA 3FMKA 5JT2A 2ZOQA 2YACA 3ZBFA 5J5SA 4OBPA 2XZSA 4JR7A 5HI2A 1REJA 3QCYA 4Z7HA 3A61A 2ZB0A 2P4IA 4CTBA 4FEWA 4D9TA 3L8VA 1OIQA 1V0PA 3FMLA 2C1BA 3UP7A 4RWLA 3AMYA 4ZTSA 5AMNA 4KSQA 4RLLA 4O86A 3MJ2A 3MH2A 3GC8A 4CQGA 5EYDA 2OJJA 4D58A 3QCXA 2DQ7X 5BVWA 2GS6A 4FKRA 4MK0A 2X8DA 3HDNA 4IWQA 2B9FA 1GZKA 3G5DA 4FYOA 2HCKA 4QP2A 4A9UA 4E5WA 3G51A 2XEYA 2W5AA 3LM0A 3P23A 2QG7A 4JRVA 1JNKA 3DAJA 4FVPA 2XKCA 3NW7A 3KXGA 4JOAA 1R0EA 4PWNA 3TN8A 2VX3A 3IW8A 3H10A 3MDYA 3QUPA 4OT5A 3FE3A 4TW9A 3VS6A 2XIYA 4IIRA 5CU0A 2XKEA 4FSRA 5JMSA 4YSJA 4W4XA 4FKTA 5DLSA 5KMIA 4P7EA 4USDA 4J99A 3NMUF 3P79A 2C6IA 4XUFA 5DRDA 1O6LA 4QP7A 2VTLA 4JBOA 5L2IA 1NW1A 4C61A 3TXOA 4AU8A 3TNIA 1XHAA 4OLIA 4NCTC 1QPDA 3EQRA 2UVXA 3FMMA 5EW8A 4ALVA 4O7WA 3QFVA 4MXYA 5H9BA 2OFUA 2WOUA 3DK6A 4ANOA 4G3GA 3U87A 2UZUE 4AXAA 4L9IA 3Q5ZA 5E8ZA 4IQ6A 5A9UA 4WD5A 2R4BA 4ENXA 2X8IA 4FKPA 4W4YA 4BI1A 3O71A 2Z7SA 2UW4A 1XQZA 4GIHA 1UWJA 5EDQA 1SVHA 3IDBA 4ASZA 5IQFA 3A4PA 4LQMA 4DBXA 4LOQA 3JS2A 3ZRMA 2OJIA 3R7EA 4GS6A 4J71A 4NM7A 4F1MA 2VO7A 4MF1A 4PV0A 4TWOA 3W2RA 3SDJA 1YXTA 4HZSA 3LCTA 4R1VA 4XG7A 4H3QA 2XK7A 1G3NA 2OICA 3OD6X 2R3RA 5CVGA 4Y5HA 1BI7A 2BMCA 4P4CA 2VTAA 4GYGA 4IMYA 4BCHA 2PUIA 3U9NA 4HJOA 4FT9A 4Y46A 3RAWA 4H1MA 5HTCA 3DNEA 5K4JA 5DA3A 3QA0A 5HBEA 1FPUA 3IQ7A 4GU6A 4UYNA 3GOKA 5F20A 3VHKA 5DMZA 5ANEA 3MB7A 4AGDA 3QQHA 4O1OA 4EKKA 3FZ1A 5KCVA 1H0WA 2VTHA 3COHA 3LFCA 3DBEA 1ZZLA 3BV3A 3QZFA 5EYCA 3SRVA 2VN9A 2HY81 3PG1A 2W7XA 4YJSA 4UN0C 1ND4A 3TKIA 3KK9A 3R28A 4IDVA 3W8QA 4CLJA 5HTBA 4EH3A 3K2LA 4EK8A 3AC3A 3PXZA 5DR6A 3BI6A 1ZOGA 3MVMA 1KOAA 1YXVA 2X2MA 3EQGA 1QL6A 4AQCA 3QWJA 2X9FA 4DEGA 3D5WA 3DKOA 2JITA 1YHVA 3MFRA 3EB0A 4BDJA 5ANOA 4ACDA 4DLJA 5HEZA 2PMLX 5CU3A 2BILB 3Q5IA 1Y8GA 1XH7A 5C9CA 3KF4A 5JRQA 3POOA 2YWPA 4KABA 5FM2A 3DZQA 3O8UA 1QPJA 4UWCA 4C4HA 5IDPA 3G90X 4GYIA 3FJQE 4OTGA 5IZFA 4O7LA 3LJ0A 4IB1A 4ACGA 5CEKA 3EN4A 2REIA 4NW5A 4X2JA 4E4XA 2HENA 4CMOA 3C4WA 4U3ZA 4EH9A 3HV3A 2GS2A 4Z16A 5KKRB 3FXXA 3LE6A 2BKKA 3LQ5A 1WCCA 3R7IA 2W1HA 3R7UA 4XG2A 2GNJA 4BKYA 4U43A 5D7AA 2LAVA 2WD1A 2WIHA 5IU2A 3OOMA 2J0IA 2CGUA 3DK3A 4YC8A 4LOPA 5CT0A 3QD0A 4ZJVA 1Y57A 2XCHA 5AR7A 4BWPA 1QPEA 2OBJA 2ZDUA 4QNAA 3E8CA 4AT3A 1B39A 3OZ6A 4S34A 4F0FA 5HCYA 3W1FA 1J7LA 3CP9A 3PIXA 4RJ7A 4WNOA 5AUWA 1BMKA 5HBHA 2P55A 3K5VA 3OW4A 2P3GX 5CF6A 2PZRA 1OI9A 1W98A 4ZSJA 3COMA 3BE9A 4XCUA 2YDIA 2ZV2A 4M8TA 2PZPA 5FWKK 4AWIA 2JDVA 3I81A
chains in the Genus database with same CATH superfamily
2NYAA 3U6JA 4I92A 4M15A 2CCHA 2PYWA 3HV4A 2W4OA 2CCIA 2RSVA 3ROYA 5DYJA 1GJOA 3HMOA 3TZ8A 5BNJA 1ATPE 2GTMA 1MRVA 3D7ZA 3NAXA 2C6EA 4QMLA 5ANKA 5HG7A 3TNWA 4EL9A 2YJRA 5CX9A 3P4KA 4QP9A 1U59A 4LRJA 4CKJA 3PJ3A 4USFA 3BV2A 3BRBA 4FR4A 4U5JA 5KZIA 2JLDA 3EQDA 3QRTA 2HELA 3RNYA 5L4QA 1TFFA 5DE2A 3TJCA 3HMNA 3O0GA 2VWUA 5CAOA 4YPDA 3BQRA 3UGCA 3BWFA 5C26A 3R01A 1PHKA 4HZRA 4I4EA 4P5QA 4WIHA 2VTSA 5IPJA 4AGWA 4YTCA 4MHAA 5IA4A 3QKMA 1ERKA 1DI9A 3RCJA 4FNWA 3I0OA 5HICA 4EOOA 4RBLA 3QZGA 4GFOA 4F9YA 4NM3A 3A2CA 3MVJA 4DG2E 5JGAA 2OK1A 3C4ZA 4BCQA 4PMSA 3DTWA 4QMMA 5CU2A 5IKWA 4O27B 4D28A 3EQBA 3B8RA 1WMKA 4WSYA 4F08A 5LWMA 1E1VA 4C3FA 3DFCB 2X6DA 2C0OA 4HVIA 3KL8A 5A4LA 4LOOA 3D14A 3WI6A 2OXXA 2ZMCA 3NZ0A 4XG4A 2IVSA 2HK5A 4J8NA 1DS5A 5HOAA 2AQXA 4UXQA 4RIWA 4BCFA 3U9CA 1M52A 1R3CA 2QD9A 4ZS4A 3PXYA 4HOKA 4RFYA 4JQEA 3CY2A 4BGHA 3HUBA 5I5ZA 3NWWA 4ACCA 5CAUA 4BDCA 4XP2A 4L68A 4M13A 4NIFB 4V0GB 5HX8A 1ZYJA 5HE1A 2QOKA 1OL5A 2XNOA 3ACJA 3OXIA 3PXRA 3LQ8A 2XJ2A 2YERA 4QP4A 2YDKA 3OCSA 1Y8YA 3LM5A 3Q4CA 5J79A 5TT7A 4QPMA 5H3QA 3BPRA 4DITA 4PUZA 3EL8A 5LMAA 4BDAA 4DHIB 5BV3A 5EI8A 4S31A 3DGKA 4PDOA 5IEYA 4JDIA 4EUUA 1BLXA 3VUKA 3KXNA 4V04A 2QO9A 2V62A 2Z60A 2JIVA 4CFVA 3UQGA 3W0MA 4FNZA 2XVDA 4FTKA 3F3ZA 3FKLA 3KXMA 2YCQA 4FRFA 3TZMA 4Z3VA 3QTRA 3U8WA 3UVPA 4ANQA 2YIWA 4MVFA 2W9ZB 5AUYA 4XBUA 3LW0A 5EQEA 4RG0A 3SOAA 3G9LX 3VQUA 3PDTA 3ZUVA 3FMNA 3EQCA 2GNGA 4FVRA 3MY0A 3IOPA 5JQ8A 4HGEA 2Z7LA 3E8EA 4EZ7A 3RK5A 1OL6A 2V7AA 2GCDA 5AUVA 3GCPA 3HP2A 3NFGB 2R7BA 3JYAA 4ITHA 3G33A 4MUQA 4LL0A 4EWQA 5HE3A 2YM3A 4O1PA 1IAJA 1XMMA 3PVGA 1P14A 5AJQA 3R1YA 2Z8CA 1MQ4A 1KWPA 1IA8A 5HE0A 4RX7A 5CSHA 2QR7A 4U45A 3T9IA 5M4IA 3PSBA 4NM5A 3HYHA 2I0YA 4DFBA 4QO9A 4G6OA 4CMUA 3R7YA 2PVNA 3QAME 3DBFA 3FI4A 2JKOA 1PF8A 1PYEA 3DB8A 1VYWA 4C8BA 4M97A 5LVMA 4U3YA 4B7TA 5JEBA 3R04A 3RMFA 5HGIA 3O8PA 2Y4PA 4F78A 3LFNA 2BDJA 4ERWA 3F3UA 4MKCA 3GU7A 3NS9A 5J87A 5KKRC 4C4GA 5B2KA 2BALA 3QX2A 3FZRA 5HIDA 2VRXA 1S9IA 3C4CA 4FKGA 4JT3A 4FTIA 4LYNA 4BCIA 3MY1A 1XH4A 2CMWA 3D9VA 4FIIA 5CXZA 2J2IB 4MD7E 5EOBA 4C36A 4DGMA 3PRFA 4MCVA 4EWHA 4QMQA 3G6HA 2W1DA 3CJFA 4B4LA 2C5XA 4HVGA 2GS7A 4QMXA 1NVRA 4FEQA 4C0TA 5FXSA 2J51A 4HCUA 5FEQA 4JX3A 3QUEA 4OTWA 4RVMA 5CS6A 2W1EA 2WO6A 3O96A 5KBRA 2H6DA 4A9YA 4IADA 2W0JA 2FSTX 4BCJA 2A2AA 4PPAA 4RIXB 2BIYA 2J7TA 4Q9ZA 3QQFA 3ZCLA 2HOGA 4O4DA 3JR1A 1H27A 3UIUA 3F88A 1FGIA 3KB7A 3TIZA 2VO3A 4J1RA 1JKSA 3QQJA 4KAOA 4IH8A 3GT8A 3VAPA 3V6SA 3S1HA 2QOHA 2RIOA 3IONA 5FBOA 4O4EA 3H0ZA 5I3OA 3UE4A 2BVAA 3NLBA 4RJ4A 3UZPA 3W8LA 4IEBA 5ANIA 5C8MA 3ELJA 3GQLA 3DBQA 4GFMA 5J8IA 4CFXA 5LVPA 3IW6A 4GVAA 2PL0A 4MAOA 2WMQA 3ANRA 3ET7A 2A98A 2WMXA 4W9WA 3AMAA 3QTUA 4RX9A 4AW5A 4BKJA 2CJMA 4J98A 4LL5A 2OXYA 5I9YA 4O7SA 3LFAA 4FG8A 4I1ZA 3E3PA 2BZKB 4Y5QA 2J0JA 4ZSAA 2OGVA 3FZSA 4XYFA 5F9EA 3PVWA 1SNUA 4CV9A 4R77A 2EB2A 2R3PA 3D7TA 3PJ2A 1OB3A 3WYXA 3D5VA 1TQMA 5AP6A 3W0QA 4ZTHA 2E9NA 3CQEA 4AW1A 2RG5A 4UX9A 4QDEA 3KEXA 1YHWA 5EOLA 4AZSA 2OJGA 2WHBA 4NKAA 2C3LA 5D12A 4AW2A 4EH5A 5E1SA 2WAJA 4DH1A 2QO2A 3GCSA 3PLAE 2VWWA 4MD9E 2C68A 3R8VA 3AQVA 2GHMA 2JD5A 3MV5A 5B2LA 5KO1A 1KE7A 3PTGA 4TWPA 4FA2A 3VRYA 2VO6A 2QI8A 3BHTA 4MNFA 5F4NA 3REPA 3DLSA 3Q60A 4AN3A 4ORKA 3G9NA 3NUXA 1K2PA 2XK8A 2AEGA 5EI2A 1U54B 2JDRA 4CKIA 4O7TA 4Y8DA 4OT6A 5IQDA 4O7YA 4QEBA 4AFEA 4QRCA 4YLJA 5FLFA 4FTLA 4KKEA 4PPBA 2BRMA 4KS8A 4M69B 3LFEA 4CTCA 4FEUA 2X4FA 4BZNA 3ZSHA 2QOBA 1H26A 4BCMA 2YIQA 4R78A 1E1XA 2UW8A 4ALWA 3VS1A 2AC3A 3FMDA 3S4QA 3HP5A 4GVJA 4CGAA 3CTQA 4LRKA 2GMXA 3H9FA 4L3PA 5FEEA 4C4FA 3DJ5A 5ETAA 1BUHA 3MVLA 4IFGA 4ZSEA 2OKRA 2OZOA 4GUBA 4ZZNA 1H0VA 4FOBA 4OTDA 4IB3A 4KKHA 5AEPA 2NNWB 3GCUA 1OIYA 4A9SA 1WVYA 2H8HA 4C4IA 4E6CA 3MI9A 3GU4A 2XIXA 4U6RA 4GCJA 4EBVA 2XJ1A 4FV7A 2W4KA 3UBDA 3F2RA 3RPOA 1PKDA 4EK6A 1URWA 1XH9A 4IB0A 3WZEA 3QXOA 3R1NA 4FZ7A 4O38A 1IR3A 1Z57A 2ITNA 1YW2A 2B52A 3TEIA 3CR0A 4XBRA 4CFNA 1Q61A 2W1FA 4E1ZA 2ZFYA 2JKQA 4F9CA 3LKMA 2YA9A 2W17A 4E4MA 2CLQA 2C6LA 4F99A 2X39A 3BHYA 3QD3A 2W5BA 3ORLA 2E9PA 3FMJA 1KUTA 4QPSA 5D11A 3EFWA 1Q99A 3PY0A 3UG1A 5L2SA 2YM7A 3R9HA 4RVLA 2R7IA 4R8QA 4AAAA 1WBSA 1WVWA 4K77A 3W10A 4YSMA 1JKKA 3A8XA 3QQKA 3QRKA 4I5CA 4R7BA 5BVFA 4DG3E 4QYFA 3E5AA 5L6WL 4AGUA 5A14A 5C03A 4L45A 4EC9A 5JFVA 1Q62A 4E73A 4W9XA 2C1AA 3VN9A 4S33A 2ETMA 5JFSA 3UO5A 4IAYA 1U46A 4UALA 4MNEA 4I4FA 1H1PA 4RIYB 4YHFA 3ROCA 3VS0A 3VS7A 1OITA 2XUUA 4WG4A 4YUQA 3TDVA 2IG7A 3ZH8A 4X3FB 2PZ5A 3FDNA 3QLFA 4AA0A 2C47A 3UOLA 1M2RA 4G5PA 3S2PA 1JLUE 4BCOA 4FTNA 1P2AA 3W16A 2UZWE 3BWJA 3GC9A 2BFXA 4JAIA 4CT2A 4H05A 3E8NA 1H8FA 2OJ9A 4FTUA 3UQFA 1B38A 3P78A 2JDSA 3PJ1A 4LUEA 4NYEA 4KS7A 2ETRA 3BZ3A 4AX8A 4Q9SA 1OIRA 4CMTA 5L2WA 2VTRA 4ZTNA 4A9TA 5K5XA 4QMTA 3FUPA 2B9JA 4IVAA 5CZIA 3Q53A 3UODA 4O2ZA 4FSMA 4C7TA 3QKLA 1H24A 1W7HA 2OLCA 3TJDA 2UW6A 4YO6A 4A06A 1UU7A 4PNKA 2W1IA 2W96B 2XKDA 4J8MA 4OTIA 3H9RA 3LXNA 4EOSA 2H34A 5IEVA 4EYMA 2YZLA 3PZEA 1J3HA 2RFNA 5I9UA 2W1ZA 3E88A 4EK5A 5FP5A 2IEWA 3VW8A 4D9UA 3LFFA 3PUPA 1P4OA 4C4JA 4FTTA 2XK3A 4LGGA 4AE6A 4AT4A 3ZRLA 4AW0A 2YCRA 4QMUA 4YC3A 2BZIB 3AOXA 4AZVA 4FKSA 1G8SA 4BTKA 2R5TA 3II5A 4O4CA 4ERKA 5IH4A 4FV4A 3F5PA 3HEGA 3KULB 4FKOA 2ZDTA 3UP2A 2UW5A 4ZTLA 2GQRA 3R1SA 3N4VA 3PPJA 2OZAB 4MEDA 4M67A 4EH7A 4DINA 4I21A 1OZ1A 3ALNA 3C4EA 4RZWA 1DM2A 3A4OX 1VLRA 1OUYA 5HIBA 4NCTA 2XRUA 4E93A 5IQAA 3MESA 3DJ7A 3FC1X 2PVJA 2GHGA 2IZSA 4BJJB 3AC1A 4RQVA 3UMXA 3V01A 4OBOA 4FJVA 4FKJA 3EL7A 5DR9A 3PPKA 3VJNA 3IDCA 3NIEA 4N6YA 4E4NA 5HNBA 4EONA 4GUEA 4ZLYA 2CNQA 3KU2A 2B4SB 4TRLA 3EYGA 1FVTA 4BKZA 4FV5A 4O84A 5IQEA 4PDPA 3RAIA 1OBGA 3SAYA 3OBGA 4KUJA 3V5TA 4I5PA 3MW1A 5HLNA 4IE9A 4F7JA 3DAEA 4IZ7A 5M55A 3JY9A 2FSOX 3H3CA 2PE0A 5HZNA 2PE2A 4DH7A 3A99A 2OF2A 2XJ0A 5E8YA 3KIOC 4IX6A 3LCDA 3DT1A 4LFIA 3PFQA 1PXLA 4X6RA 3TNQB 2WTKB 3K5UA 5AP3A 3M42A 4C2VA 4JG8A 2G15A 4EUTA 5E4HA 4B99A 4BGGA 5D10A 4Y85A 4R3CA 3EFLA 1YKRA 3AXWA 1LP4A 4Z55A 3C0HA 4GFGA 4E4LA 5L2TA 3SLSA 4RA4A 4M3QA 3A7GA 4NJDA 5ETCA 1M7NA 1O6YA 3QLGA 5LJJA 2FA2A 4AXFA 4FOCA 1IEPA 5TE0A 4TYGA 3FXZA 4GIIA 2YAKA 4O91A 1G8JA 3QCSA 5BUEA 3DLZA 4YTFA 5IF1A 3HRCA 4YJNA 4J52A 4ZMEA 4D0XA 5AUUA 4BDHA 3DXNA 4JIKA 4J7BA 3G15A 4ITIA 3HRFA 3GBZA 3EJ1A 3DQWA 3FKNA 5CXHA 4DF3A 3LMGA 4FIJA 1OPLA 4FT3A 3DDPA 4C2WA 5A54A 4ANSA 3R6XA 2QQ7A 4QMZA 5FXRA 3MN3A 1YI4A 5CU6A 2WELA 3P7CA 5FTQA 5FG8A 3RI1A 4ASDA 2BFYA 2O2UA 4JQ7A 2PWLA 1GY3A 1FVVA 2EXEA 2WQBA 4BDKA 4WNPA 3BL7A 4ITJA 2Y7JA 1GZOA 3NAYA 3OY3A 2Y8OA 2NRYA 2WXVA 5IH5A 2C4GA 5BVOA 4IVCA 3UG2A 5D41A 3BBTB 3AKLA 1PXPA 2QOQA 4EOQA 5IQBA 1OPKA 3GGFA 3R9OA 3SD0A 2FYSA 4BR3A 2QOIA 3FZOA 4N4SA 3DU8A 2OFVA 3UQCA 2Y6OA 2R64A 2XM9A 3OCTA 4GT5A 4X3FC 5TF9A 5LARA 1CM8A 3OWPA 1HCKA 1YI3A 4CYIA 1CKPA 3EZVA 3BHHA 4G9RA 3DV3A 3R9NA 4DH5A 4F6UA 5BMSA 1ZRZA 3MPMA 4JX7A 5CEMA 3KCFA 3MBLA 2PVYA 2EUFB 2YIRA 3AGLA 4YPSA 2G9XA 2VTMA 2CGVA 4O96A 3MFUA 3A62A 3MPAA 4WHZA 1G8AA 1PMVA 4D1SA 3FLQA 2VTNA 3MWUA 5EHLA 3TL8A 2BR1A 2EU9A 4FK3A 2DYLA 3ORNA 4FSNA 5D9HA 1XH8A 3FHRA 2F49A 4RX5A 3NW6A 4DFLA 3SRVB 3OWLA 1UNHA 3VUGA 2ITWA 2WQNA 5DT3A 2PUUA 4O4BB 3CLYA 3OXZA 1CMKE 3VC4A 1LEWA 4IX5A 3Q2JA 5HQ0A 4ZY5A 3SW7A 2PVFA 4L67A 3G6GA 5DRBA 3UVQA 4MBJA 4BDBA 2Z2WA 1CKIA 4AG8A 4NEUA 5EKNA 4XX9A 3ZS5A 5CEQA 2VD5A 5KUPA 2OO8X 2X6EA 3EQFA 4P2KA 2YABA 4L00A 4LV7A 3KY2A 3CJGA 3GENA 5I9XA 4DHZA 3IK3A 4ACMA 3G0EA 4RLKA 5M08A 3OUKA 4YJTA 2IW6A 2XA4A 1Y6BA 1KV1A 2X2LA 3W0OA 4X21A 1F0QA 3UDTA 3QQLA 5E9EA 3JXWA 4ZJJA 2P33A 2C0IA 4BI0A 3WIKA 2W05A 3CGOA 4MXXA 5C8KA 1EH4A 1PW2A 2CKPA 1YQJA 3E87A 3KF7A 4EQMA 4QP1A 2E9VA 3NPCA 4FGBA 2CKQA 1LR4A 2CSNA 3BELA 4EJ7A 4MTAA 2XYNA 2GHLA 3UMWA 3R22A 4DEIA 4DDGA 3LMIA 3CD3A 3C7QA 3GNIB 3RNIA 3UPXA 5IEXA 4I22A 4IAFA 3SVVA 5GINE 4CKRA 3R63A 3ORKA 4G3CA 2NPQA 3Q6WA 1H1RA 2QOLA 3FSFA 4D2PA 1ZMVA 3PA5A 4KIKA 4DTKA 2ITTA 3Q4UA 5TKDA 3A7FA 3PVBA 1A06A 2X4ZA 2WMAA 4TNDA 1GOLA 3BYSA 3NSZA 3PPZA 4Q5EA 4BZOA 2O64A 3Q4ZA 3N51A 4ZOGA 3QBNA 4E7WA 5JFWA 2DUVA 4PL4A 1J7UA 1DAYA 3ORMA 2GNFA 4MYGA 4ZEGA 4C37A 2E9UA 2W99B 4DE4A 5JGBA 4KINA 4FIFA 4NUSA 1REKA 3MTLA 4FNYA 3VBVA 3DK7A 5D7VA 3V5JA 5CY3A 4DG0E 3HNGA 2ZV9A 4CLIA 4F6WA 4DEAA 3KK8A 5EG3A 5AWMA 3W2SA 4OTRA 2WTKC 5EM5A 1YI6A 3ANQA 3UVRA 1BYGA 2A1AB 4GSBA 3ZZWA 3TM0A 2HYYA 4AZEA 4AFJA 4AGCA 4BF2A 1MP8A 3UIMA 5H2UA 5HG9A 4MWHA 2Z7QA 1YXXA 2PZIA 2DWBA 2QG5A 2RFEA 2CHLA 5L8KA 4F6SA 2G2IA 4FKVA 3R71A 4O0XA 5FUTA 2VZ6A 2HY0A 3DB6A 3EOCA 3QXPA 4UB7A 1GAGA 2A19B 2R0UA 3BU5A 4PMTA 5ITAA 1PRYA 4KIOA 4U44A 3F82A 4LV8A 3FEGA 2PY3A 5KZ0A 3ENHA 5DG5A 3C4XA 3RPVA 5TO8A 4UY9A 4EH6A 3ZM9A 4EYJA 4KD1A 2UW3A 5K0XA 3TT0A 3UIXA 5AP2A 2R3JA 3EKNA 1WBVA 3I7BA 3R7GA 4IX3A 4X0MA 3RHKA 5HU9A 1YVJA 5FM3A 3RM7A 2WQMA 2B1PA 1UKHA 4YZNA 1Q24A 4PNIA 4PL5A 3FL5A 1MRUA 3CQUA 1QCFA 5CQUA 4D4RA 1GZNA 3SV0A 5CALA 1OKYA 3DS6A 3L9NA 3PE2A 4GMYA 4L01A 3C13A 4FTRA 4ONAA 1T46A 4QTDA 5FTOA 2CDZA 3PA3A 4FV0A 4JI9A 4M0YA 1OVEA 3DJ6A 4XP0A 4C35A 3BYUA 1JVPP 2O0UA 4FKUA 5EYKA 5HG5A 4C34A 3U6IA 2X0GA 3TTIA 5CSWA 5FTGA 2O63A 3BU3A 1WAKA 4UYAA 4BFMA 4I23A 4CD0A 3RAHA 3M2WA 4RJ8A 4BDFA 3EWHA 4CRLA 3KCKA 3I7CA 5CQWA 1A9UA 2JGZA 4EBWA 4D4SA 4K18A 1WBWA 4U81A 3BL9A 3WF9A 5CWZA 3CS9A 5AR3A 5CU4A 3OROA 5H8BA 1U4DA 5T6KA 4O82A 5LMBA 3FPMA 4DEEA 4FICA 4R7IA 2XP2A 2O8YA 3OWKA 4PTCA 2NRUA 3P1AA 2WB8A 2W9FB 2PULA 3U4UA 4QYHA 3GU6A 5KHWA 3MJ1A 4G6NA 5M09A 4R6VA 2X7GA 5HNGA 4AACA 5K9IA 4JQ8A 2QO7A 4N70A 4BYJA 5B0XA 4DYMA 4M12A 3UDBA 1PXNA 4FL3A 3V5LA 2FGIA 3AGMA 1YRPA 3BIZA 2BAKA 4PPCA 4RT7A 4FNXA 2WQEA 3TV6A 2XNGA 5H8EA 2HZIA 3PSCA 4O6LA 1PYXA 3LFQA 5AADA 1OGUA 5AV4A 1YWVA 2BRHA 2IJMA 4YC6A 3TZ9A 2JBPA 5BX0A 4N6ZA 3HGKA 3VBYA 5AA9A 2C69A 1MQBA 5DT0A 3E62A 4YHJA 2HIWA 3SC1A 3V8SA 3VS3A 3VBXA 3ZEPA 2ZM1A 2I0EA 2X0PA 3AD6A 3NX8A 4KBAA 4DGNA 2BPMA 4O7RA 4N0SA 3FMEA 5IA1A 2IWIA 4IANA 1OUKA 4OR5A 2QLQA 3AC2A 4YJRA 2EWAA 4D2RA 3D4QA 3R0TA 4XG8A 2FUMA 2XKFA 4XG6A 2C5YA 5AUTA 4L42A 1OECA 3FY0A 4EHVA 4JS8A 5HESA 3V04A 5DGZA 4BWKA 3QZIA 1H28A 2C30A 1Y6AA 4L7SA 5CT7A 4ANBA 3Q4TA 2UZTA 4X3JA 4XLIA 3MGYA 4ASXA 4IZAA 3RCDA 4C3PA 5LVOA 4H3PA 1S9JA 3B8QA 5C01A 3W0NA 2WMVA 3LVPA 2J4ZA 1AGWA 1VYZA 4NSTA 3ODZX 3R2YA 4EOIA 2WMUA 1YDSE 4AOIA 4DGGA 4AP7A 3TIYA 2VGOA 3PRIA 1UNLA 2UZBA 2YM5A 3U54A 4FK6A 3R8PA 1RJBA 2QCSA 3PZHA 4CFFA 4EORA 5J9YA 4A4LA 3WZKA 4BTJA 1UNGA 3EIDA 2ERZE 4EI4A 4IBMA 3COKA 4R7HA 5JZNA 2IO6A 3F5GA 3KXXA 1ZMUA 2Y6MA 3L8PA 2F7ZE 5HD7A 2BDFA 2W5HA 3EN6A 5L6OA 4RJ6A 4M0ZA 2WMWA 4L6QA 4G2FA 4TXCA 4NIFA 4V0GA 4KRDA 2FSMX 4ZLZA 1OL7A 5HU3A 4XEYA 2GNLA 3LXPA 3NGAA 2YIYA 5CLPA 3NYXA 2G01A 3DCVA 1W2FA 2A27A 3IW5A 4YJPA 4AXEA 3OW3A 1WVXA 4BHNA 2A0CX 4M68A 2YLEA 2YWVA 4CSVA 5AUZA 5HBJA 1UA2A 3IDPA 1OGYA 3LXLA 2UW9A 2UVZA 5BPYA 3FHIA 4MXZA 1CKJA 3ERKA 3P0MA 3QA8A 4FX3A 4L7FA 3F7ZA 1W84A 3C5UA 4QQJA 4WT6A 4CFUA 5B7VA 4FL2A 2X1NA 3E7VA 4D5KA 1BI8A 1XKKA 3BHVA 4E6DA 5J7HA 2HW7A 2RF9A 5IUGA 3N4UA 3I79A 4QMYA 1APME 3CSVA 5AX9A 3DY7A 4E5BA 4CFMA 4WG3A 2QLUA 4RGJA 4QQCA 3FI8A 1H00A 3IW4A 4U0IA 3OY1A 5AR8A 4I0TA 1CDKA 4U41A 4DN5A 3EFJA 2J5EA 4PRJA 2YN8A 5E8WA 3UO4A 4E3CA 2F2CB 2ITXA 2WTDA 5LMKC 2JC6A 3KRLA 3W2OA 3GUBA 1WBTA 1W2CA 3D7TB 3CPCA 4RFMA 2J90A 4NK9A 4EZ3A 2R3FA 3I1AA 4U7ZA 3QU0A 4PTEA 4QP8A 3V5WA 3HMMA 4C4EA 5I3RA 5LXMA 3PFYA 3HUCA 3F69A 1STCE 1V1KA 4E5AX 3BHUA 3OVVA 4WKQA 3F7WA 3ZFXA 5ANDA 3KQ7A 3AG9A 4G9CA 1PMEA 4RJ3A 5K3YA 5E92A 5CAPA 4RSSA 4DH8A 4BRXA 3P5JC 3Q9ZA 4RC2A 3RAKA 3TV7A 2W1GA 4ZY6A 4CXAA 3IS5A 4XJ0A 4FZAB 3ZUTA 4EOMA 5GZAA 4WUAA 1JOWB 3KA0A 1PXIA 3HECA 4BIEA 4BWXA 2UV2A 3BQCA 4YGAA 5CEIA 2IW8A 3ZDUA 5AAEA 4FSWA 5JN2A 2BUJA 3QX4A 3NYOA 4FG9A 4YJOA 1YXSA 1SM2A 4IFCA 5E8TA 3RZFA 1UKIA 3AC8A 5IQHA 3BE2A 5CNOA 5DHJA 3R1QA 5AV3A 4HGLA 2W4JA 4TYHA 1JPAA 4QMOA 3TNPC 3ZLSA 3BYMA 4QMPA 4E8AA 5EM6A 4BL1A 2BTSA 1JKTA 4NFMA 4XRLA 3RTPA 2PVKA 2VNYA 5CVFA 1XBAA 2I0VA 3LCSA 2PUPA 5EDPA 3L9MA 3AC5A 5E91A 3ZDIA 3QTIA 4ZZOA 2IN6A 3QHWA 2BAQA 3FYKX 4JR3A 1R78A 3WILA 2BTRA 2GPHA 3K3JA 3PY3A 2R9SA 4PP9A 2H9VA 2QKWB 1ZY4A 3ML1A 4XOZA 4CNHA 5HO6A 3ZONA 4EOLA 1H07A 1WBPA 5FRIA 5BYZA 2ONLA 1FBNA 4O2PA 4QMVA 3VS4A 2YISA 3D94A 2OW3A 3AMBA 2UZNA 3FL4A 2JIIA 4HGTA 3ULIA 2IVUA 3NUUA 3CE3A 3JVSA 3ORPA 2WEVA 2IW9A 3RK9A 5L3AA 2RG6A 3A7HA 3LFDA 4O7ZA 3BU6A 4IAIA 5JQ5A 4OTQA 5GZ9A 4WUNA 5JFXA 3GXLA 1OKWA 3ZO2A 4B8LA 2O3PA 2C6KA 1YDRE 3OCGA 4K33A 3KRJA 3KRXA 2XMYA 2ETKA 1PXOA 3D5XA 2PVMA 4K11A 4NWMA 1OM1A 3ODYX 3OHTA 4M7IA 3OS3A 4S32A 4XHKB 5EQYA 4Z9LA 2HWPA 4CFWA 2BRNA 3GEQA 3LCKA 2VTOA 4KIQA 5E8VA 5A6NA 5KMJA 1OKVA 4JJRA 2HZNA 3PP1A 4FI1A 3FLZA 3PXKA 3V5QA 3ZO1A 3OT3A 5KMKA 2R3KA 5EH0A 5AP0A 3L8XA 3E93A 2JIUA 3MVHA 3BEGA 3R83A 4CCBA 5FQDC 3NUSA 4MNEB 4LG4A 2P0CA 4PF4A 2VWYA 4IVBA 5FD2A 3SKCA 4D2VA 5ACBC 3VIDA 4YMJA 4ZMFA 2YEXA 3CTJA 3TUBA 4WOVA 3F3WA 3BGZA 1ZYCA 5GJGA 4DC2A 2YHVA 4CZYB 5BUIA 4PY1A 4FSTA 4WO5A 3DAKA 2BHHA 1BX6A 3HMIA 2VTQA 2ITPA 3FI2A 4Y83A 2B55A 3WF5A 1U54A 3LLTA 1XBBA 4JL9A 3VUTA 4YU2A 4XV3A 3IW7A 1ZWSA 4EK4A 3OFMA 4LGHA 3PUFC 1FGKA 3FQHA 2B54A 3O23A 3ZFMA 1RDQE 4YLKA 5CSXA 4FT5A 4IAAA 4KSPA 4WBBB 5HKMA 1UV5A 3VHEA 3GP0A 3W33A 3EYHA 4WA9A 3E92A 2CN8A 3BCEA 2QOOA 3O50A 1Q4LA 2GDOA 3S3IA 4BYIA 2C5OA 3KVWA 3F5UA 3UYSA 2WU7A 3W2QA 3DFAA 2R3IA 5GIOE 3EMGA 4ZAUA 3KC3A 4GW8A 2PVHA 3RM6A 3MFTA 5KMOA 4MX9A 4I0RA 2Q0BA 4RX8A 3ZU7A 2V55A 4H3BA 1ZOEA 2VWBA 4U9AA 1ZYDA 3S95A 4GT3A 4MWIA 4IZ5A 2QHMA 1KE5A 3B2WA 4KA3A 3EHAA 3W32A 3FXWA 4DH3A 4OGRA 4USEA 3WF7A 1W83A 4JDJA 4RVKA 4BBMA 2UUEA 4JIAA 3MH0A 3A7IA 3UO6A 4IM3A 3I6WA 3QYZA 1KE6A 4RVTA 1R1WA 4F7LA 5LVNA 4II5A 3UIBA 1NY3A 3BX5A 4PMMA 4BDDA 1G8KA 4ZXTA 4AN2A 3U51A 2C5NA 4FTQA 3OCBA 1R39A 1IG1A 3UPZA 4EOPA 4FEXA 1UWHA