5J95A

Map4k4 in complex with inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
296
structure length
284
Chain Sequence
b'DLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title MAP4K4 in complex with inhibitor
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 84
structure length 284
sequence length 296
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j95A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5j95A01
3R2YA 4RG0A 4XBRA 2OI4X 3UBDA 4E6DA 4EI4A 4YC3A 4Z9LA 1OBGA 5DYJA 3PY0A 4TKSA 3AMAA 3R7UA 3C0GA 4I94A 3ATTA 4FT0A 2EB3A 3R2BA 3V5LA 3ZM4A 5AP4A 2Z2WA 4EYMA 5TE0A 2XK7A 4P7EA 4Y85A 2QU6A 2ITYA 2W9FB 3HZTA 3EHAA 3W2CA 2OZAA 3RZFA 2X7FA 1UV5A 3BEAA 3PA5A 5K3YA 3VW6A 4IEBA 3QCQA 4O96A 3RCDA 3VUKA 5BVDA 2XNEA 1WVWA 3BHVA 2IPXA 5J79A 4ALUA 3FL5A 4IWQA 3NUXA 5BNJA 4GSBA 4JLCA 2KULA 2JDTA 4L53A 4I24A 3PWDA 3Q9YA 2V7OA 3R8MA 3EZVA 4CFVA 2UW3A 3R73A 5E8TA 5AR3A 2W1ZA 2UW6A 5CYIA 2UVXA 3OT3A 3UIUA 3I81A 2RF9A 1P4FA 1CTPE 4G1WA 2E2BA 2YDJA 3P0MA 3U87A 3UIBA 4HVHA 4HGLA 3FXXA 5A4LA 3AC2A 3PP1A 3Q2MA 3JY0A 4BDBA 4FEQA 3VO3A 2CGXA 3GU4A 1ZOEA 3LFAA 2JDOA 2R3MA 4RC3A 4AE6A 4FNXA 4AP7A 4C0TA 4E5AX 4PTCA 1U4DA 2OIDA 2PZ5A 1Y57A 4YJNA 1NXKA 2VUWA 4RVTA 3ZLYA 4F1MA 1SM2A 4FUYA 3LFQA 4EOLA 3L9PA 3OWLA 3V04A 4EWHA 4C7TA 1W7HA 4IACA 4YBJA 3ROYA 1NY3A 4JIKA 1L8TA 3OUNB 3HMPA 1OI9A 4YC8A 1Q5KA 3HKOA 4ZTQA 5KHXA 4B4LA 2QODA 4WUNA 4FSUA 4BCQA 1OB3A 4A9RA 1BI8A 3H9OA 4PDSA 4OTHA 4RT7A 5BUJA 4LOOA 2GNJA 3F2AA 4KIPA 5EKNA 4C4GA 3C13A 3NYNA 3OWPA 4JBVA 4UWBA 1Q24A 3OBJA 4AOIA 1V0PA 3CTQA 3WBLA 4Y95A 1ND4A 4D1XA 2XRUA 3PVWA 5AAEA 5AUVA 3NCZA 4NJDA 2GNGA 3BGQA 4O0TA 4BCGA 4DH5A 5IU2A 5EYKA 3Q6WA 1ZY5A 3IQ7A 5E8YA 3LFDA 3UIMA 3C50A 4XMOA 1OBDA 4F6SA 2CLQA 2IZRA 3GFEA 3PYYA 4FOBA 2RG6A 5IQCA 5AV2A 4KKHA 3WYXA 3KVXA 4U79A 5CU6A 3FMMA 1WBOA 2XYUA 2XEYA 3QTXA 4HJOA 4ITHA 4UB7A 2OIQA 2PVMA 3F2NA 3EN5A 3GENA 3SA0A 3U55A 4BR3A 2ZOQA 3BQCA 2BILB 3IW4A 4A06A 1W98A 4RMZA 2WTKB 2C6KA 4YJQA 4N0SA 3IGOA 5AR5A 4AT4A 4D5HA 2WMAA 2YCRA 4YJOA 1HOWA 2YCSA 4I0RA 2C5NA 3V5PA 3CLYA 3FLQA 4JVGA 4DGLC 3BX5A 1FVTA 3UQGA 4YJVA 3HV5A 3PXQA 2QOHA 4QYEA 4BDGA 4CQEA 5DEWA 4EK3A 5IA3A 5IQBA 5J1VA 4HYHA 2WZJA 1CDKA 2J9MA 4E4LA 4GS6A 1IR3A 4O0VA 3F2RA 5CF5A 3DAJA 4CD0A 3AQVA 4RQVA 4C36A 3R63A 4D4SA 4XBUA 4R1YA 3V3VA 2XKEA 3FI3A 3LFEA 1GZKA 4K0YA 5M51A 2F7ZE 3MJ2A 1KE9A 2YDKA 4I20A 4FVRA 3PE2A 4IB0A 4PNIA 4JT3A 4RGJA 5ETCA 4BCKA 4CFUA 4NW6A 5FEQA 3NUYA 4QTBA 5LCKA 4TZRA 4D2PA 3CJGA 3UNZA 4TNBA 1ZY4A 5AADA 2ETKA 3DZOA 4FIFA 4M68A 1YDRE 2PE0A 4MCVA 2RFSA 4AN2A 4EH2A 1H8FA 4AACA 3SW7A 1Q99A 3ITZA 2UZNA 4O0XA 4QTEA 5EH0A 4JG6A 5HE1A 4F1OA 5BX0A 5HTCA 5IQFA 2WOUA 3HA8A 3UMXA 3PIZA 5HLNA 5M56A 2HW6A 5DN3A 4RX8A 2BUJA 3DBFA 3WF7A 4FIGA 5DR9A 3RPVA 4DEIA 1WCCA 3BV2A 3G2FA 2BVAA 3GFWA 5CU2A 5M4UA 3FPMA 4LRJA 1H0VA 3QCSA 2OXYA 4ANNA 1PXNA 4S34A 2PZPA 4RIWB 1SMHA 3TNPC 4AT3A 3BU5A 2JBOA 4MX9A 4IVDA 3GBZA 4O7LA 3FDNA 5HU9A 2UZEA 4UX9A 5DGZA 4FTIA 3UC3A 3COHA 5A14A 4DTAA 3LM0A 3QZHA 5J5SA 3N4UA 5AR7A 3Q2JA 4PP9A 5IA1A 1NW1A 4GK3A 2NO3A 1JAMA 3AMYA 4XG3A 3OOMA 1Q8YA 1JKSA 4TY1A 3HRFA 3PXYA 2BRGA 3ET7A 2ITNA 4O82A 4EC9A 4PL3A 3HNGA 3K54A 3VF8A 3KK8A 3R1QA 5AM7A 3T9TA 2PVKA 2WELA 4ID7A 2C1AA 2H6DA 5JZNA 5L8JA 2JEDA 3N4VA 4ZTNA 3LJ1A 2WFYA 1Y91A 2F2UA 3LFBA 3JVRA 3R71A 3D94A 2X7OA 2OFVA 5CI7A 5LQFA 4GK2A 5T6KA 4PNKA 4Q9ZA 1YI6A 5TT7A 3QKLA 2V5QA 4EUTA 1GZOA 1APME 1REJA 3BE2A 3GC8A 4B8MA 2YM8A 4A4XA 2YWPA 4OTIA 3DTCA 3EJ1A 5JGDA 4LMUA 5L3AA 4O2PA 5A4QA 4RIXA 1Y6AA 2UW5A 4FIEA 4MXOA 3QQFA 5IQEA 5BVNA 4FGBA 2C68A 4MD8E 4GG5A 3TT0A 4DAWA 1CM8A 3FZPA 4LOQA 2ITOA 5HE0A 3WZEA 3QLFA 1KUTA 5JGBA 4ACDA 4FSRA 1IA9A 1W83A 3RNYA 5AA8A 3CY3A 4UWYA 4IAYA 4IB5A 3OT8A 3R8VA 1PRYA 4E1ZA 3FMDA 2BZJA 3PXRA 5ETFA 3DBDA 1MRYA 4ARKA 5HX6A 4AOJA 3G51A 4CRSA 2XK8A 1OIQA 4D5KA 2J2IB 3BCEA 4RBLA 3TJDA 3GUBA 3BIZA 5E8XA 4KB8A 3F5PA 4L7FA 1YXSA 3IONA 4YP8A 4FSQA 4IXPA 3P23A 1F3MC 4CG9A 4ZAUA 3C51A 1MRUA 2HK5A 5CEMA 4H05A 2P2IA 2JC6A 5HIBA 1PXLA 3QTZA 2XCKA 3GNIB 4EK6A 4CKJA 1YQJA 4QP2A 5JFSA 5I9ZA 1HCLA 5HG7A 2PUUA 5C01A 4YNEA 2DS1A 3BU3A 2JFLA 3MYGA 4FTRA 4FKIA 4MNEA 4KD1A 2DWBA 4MAOA 1Z5MA 2W1CA 5IA4A 2WO6A 4PMTA 3S00A 3MFSA 2C6MA 3VUTA 3AGMA 3F3TA 1WBTA 3FY0A 4RVKA 4NW5A 4KSQA 2Q0BA 2YEXA 3FQSA 1MRVA 2QO7A 4UMUA 2LGCA 3NAXA 4WOVA 3K3IA 2XJ2A 2PE1A 3MVHA 2CKPA 4FR4A 2UZBA 2YIXA 3UG2A 1Q3DA 5TO8A 4YPDA 2OICA 3ALNA 5FXSA 5I9UA 2I0VA 2FGIA 4L00A 4U8ZA 2W17A 3SX9A 4R7IA 5AUZA 2GS2A 4HNIA 3Q60A 4G3DA 3QBNA 2J50A 2HENA 3EYHA 4MXAA 4BY9E 5F20A 4HOKA 3KA0A 1M52A 2XIRA 1STCE 2GHMA 1MUOA 2VTTA 3C0IA 4KINA 4AQCA 2YAAA 2E9VA 2WQEA 4CQGA 5L6PA 5FUTA 1YXUA 3OHTA 4ANQA 4L3LA 2IN6A 3DAKA 3L9MA 3PJ1A 5CI6A 2Y4IB 3QYWA 5DNRA 5ANJA 4ZLZA 1ZLTA 3E8NA 1VR2A 1H00A 3DK7A 4EOQA 2R0IA 3VUGA 5IEVA 4YJRA 5J9YA 1E1VA 1ZWSA 2QNJA 3PFQA 4ZS4A 2GDOA 4CYIA 3NEWA 1ZMVA 3Q52A 3C5IA 5H8BA 5IA2A 4NZWB 5GJDA 3RCJA 4Q5HA 4D0XA 4WNKA 4F6WA 1YOJA 4CFFA 4CTCA 4OW8A 3I1AA 4F0FA 1KOAA 3FPQA 2W7XA 4NK9A 3F7ZA 2QOOA 3L9NA 3QQKA 4MK0A 5E8UA 4D4VA 2BROA 1AQ1A 2QD9A 3F7WA 5J5TA 3KXXA 5CEOA 2O0UA 3RNIA 4FT3A 4G3GA 3UIXA 4PRJA 3OXTA 4BZOA 3Q9ZA 1OITA 3SXRA 4TPTA 1J1CA 3EIDA 2FH9A 1OMWA 1MQBA 2PE2A 4X6QC 3UNKA 5EQEA 3A2CA 2W99B 5ANEA 2E9UA 4ACGA 3A4OX 3TCPA 5K4JA 5L2QA 3ZBFA 5M4IA 3QRKA 4FTMA 5B2KA 3R7IA 2AC3A 3F3UA 3KMUA 4J7BA 4BCHA 4R5YA 1H1QA 2H34A 3ZEWA 2QR7A 4YSJA 5A54A 5HD4A 1H25A 3FZRA 3RAWA 2J90A 4JOAA 4MD9E 2ITUA 2OH4A 2UW4A 2UVYA 2GFCA 3VVHA 4FKVA 2Y0AA 1G8AA 4O7RA 3ZLXA 3KB7A 1SVHA 4KSPA 4LYNA 2CGWA 3LCSA 3FAAA 5BVEA 4BN1A 2C47A 1JBPE 4JNWA 4RFYA 4WHZA 4XS2A 5FP6A 2X8IA 2VTQA 1KE8A 3P86A 4FV7A 3SVVA 5M55A 4KNBA 3WF5A 4LUDA 4PV0A 2BRNA 2YDIA 2EUFB 3I0OA 4ZY5A 3PIYA 5ANKA 4QRCA 3ZZEA 3KREA 2ZMCA 2HXQA 2CKQA 3P5KA 3QUPA 2F9GA 5CY3A 4ONAA 4DEDA 3UE4A 4WD5A 2C3KA 2BKZA 4ZJIA 3RM6A 3UP2A 4F7JA 2WTIA 4U9AA 5I9WA 1UU7A 4KRDA 3V5QA 1YWRA 3ORNA 3AG9A 3MY0A 5CVHA 3D7ZA 5F95A 4C4HA 4CRLA 3KMWA 4HPUE 4QPAA 3NW7A 3QWJA 4O0WA 3W8QA 1OKVA 2EXMA 3FMJA 2ZV7A 4ZEGA 4K8AA 4FKWA 4J8NA 2YZAA 4HVDA 3BYVA 3FMNA 4C4IA 1TVOA 1OECA 2A19B 3CQEA 3IECA 4LRKA 2ZJWA 2X2KA 2UZWE 3A8XA 1PXIA 5IISA 4FTNA 3MB6A 5CQUA 1E9HA 3BI6A 2R3RA 5DPVA 3VC4A 4M14A 4MXXA 5HIEA 1KOBA 3FMLA 3OTVA 4R3RA 5CU3A 4FE2A 4WNOA 3WZUA 3TTIA 3GEQA 4QTDA 3ZSIA 5ETAA 3LOKA 5EHOA 2EXCX 2VO7A 5DT0A 4EWQA 3QQGA 2NPQA 5AV4A 5H8EA 4C59A 2AUHA 2J4ZA 2QQ7A 3CXWA 3MA3A 2JKOA 3P08A 3P7BA 3RWQA 3S95A 4L43A 5EI2A 1QPCA 3A62A 2P33A 5BUEA 4R5SA 2CNUA 3OS3A 1QPDA 2G9XA 2GPHA 2WD1A 2CNVA 2PWLA 4ZSGA 5KBQA 2Y8OA 4O22A 5B7VA 2PYWA 4NKSA 3IPHA 4C58A 5CXHA 1S9JA 3UO4A 3F5GA 2QHNA 5DLSA 3S1HA 3UQFA 3MV5A 3QRUA 1O9UA 3BLRA 2J0KA 5CVFA 2WTVA 3C0HA 2AYPA 1R0EA 4U81A 4U43A 3U9NA 5E4HA 4MQ1A 2XJ1A 3RPOA 3TV4A 4G16A 4GU9A 4UBAA 3U4UA 4U44A 5CSPA 3QD4A 1Z9XA 3DPKA 3VBWA 4EZ5A 4BCIA 3HA6A 2C5XA 2X4ZA 1GIHA 2W1FA 3R9RA 2OK1A 4AA5A 4EEVA 3EFKA 4IZYA 5KX8A 4O83A 4L8MA 3CC6A 2VWXA 1XHAA 2OG8A 4XLIA 4YNOA 3ROCA 4J52A 4ZS0A 3D5WA 4H1JA 4TRLA 5AV1A 4FMQA 1M14A 1IRKA 5A4TA 4HGEA 4XX9A 1BL6A 3MWUA 3PSDA 4GJ2A 4FTLA 3E63A 4GL9A 4WG5A 3QFVA 3KF4A 3BZ3A 4ANLA 4D55A 3RKBA 4MXZA 4E5WA 5HORA 4UV0A 4HZRA 5CU0A 4XUFA 3QTSA 4FSMA 2BRHA 4XG2A 4Z7HA 2J0LA 2J5FA 3DZQA 4U97A 4FICA 1J91A 5HTBA 2BMCA 1OZ1A 3QLGA 4L46A 3KULB 5CNOA 2PMNX 3U8WA 4E8AA 4G6OA 1UNHA 4L01A 4W8DA 2RGPA 4JDIA 2UZUE 5CLPA 4O81A 4MBJA 3VWAA 4F70A 3AC5A 3JY9A 1PXOA 2ERZE 2XNBA 3E5AA 4MBIA 4RJ3A 3LCOA 3C1XA 5KMOA 1J7UA 3LMHA 4GH2A 1J7LA 3ORZA 4JBQA 2XM9A 3FLSA 1OPJA 2YM5A 4IX5A 2FSLX 4NFMA 4KIQA 4K1BA 2Z7RA 4J8MA 4DINA 3UVQA 5IMEA 3IK3A 5K0KA 2PULA 4N6ZA 1M7QA 5AX9A 5GHVA 4CMTA 4PP7A 2VGOA 2X9EA 4BDKA 3C7QA 2GMXA 3CTHA 4U7ZA 4N57A 4DH7A 4DITA 2O2UA 2OJGA 5JSMA 4U45A 3TUCA 2RIOA 5GIOE 4UYAA 5CXZA 5D11A 3HDNA 4YZMA 3NUSA 4C4JA 3KXGA 5FG8A 4QTCA 4DLJA 4GT5A 4IAZA 4YLJA 4EHEA 3A7GA 3FLNC 4FOCA 2QC6A 4P5ZA 3NNXA 3GOPA 3QX4A 3MIYA 4PMSA 3VQUA 2QOQA 2QOBA 4YPSA 2XNMA 2C0TA 2HY81 4RLLA 3BELA 2BDWA 5I9XA 2FA2A 3LLAA 1PYXA 4B0GA 4BGGA 3GI3A 3DBEA 3G9NA 1YOLA 5CALA 3MBLA 1WMKA 4TYEA 3UO6A 5BMMA 4C38A 4E5BA 1JWHA 2VX0A 4FKGA 2PVNA 3OOGA 3EYGA 3L9LA 1UKHA 3CPBA 2A4LA 4GW8A 1YRPA 5EKOA 4M69B 3ZZWA 5I4NA 3QTWA 1NT2A 2CN8A 3BQRA 3ZC6A 4JR7A 4L67A 5M08A 2QI8A 1ZZ2A 3MTLA 4PMMA 4RIYA 3POOA 2I6LA 3Q53A 4YTFA 4PPBA 3VBQA 2IO6A 4QD6A 1RJBA 4L6QA 2W1EA 3LHJA 3GCUA 4FKUA 4MH7A 3SXFA 1FMKA 5L6OA 4XP0A 3GCSA 3NMUF 5AFVA 4TYIA 2WMSA 2VWVA 1J1BA 5EG3A 2IVTA 2E9OA 4N6YA 1XO2B 1RQQA 5LVNA 4TYGA 2VAGA 4YGAA 2RSVA 1XBAA 3JPVA 5BMSA 3CGOA 5KBRA 4EH3A 5CF6A 5IDPA 3TNQB 5KMJA 5IQHA 4R8QA 5I0BA 1P2AA 1E1XA 1Q61A 4U42A 5HQ0A 1W8CA 2PVRA 3O2MA 4IE9A 3UNJA 2OJFE 3DJ6A 4ALVA 2VWIA 5L8KA 3DXQA 2HAKA 4E6AA 1BYGA 3MB7A 3ORPA 5J8IA 2EB2A 4HGTA 1Q8ZA 1T46A 5AR2A 4S2ZA 3ZU7A 3VUIA 4I23A 3E7OA 3R00A 2JBPA 4NIFA 3NW6A 2B52A 2B9HA 4WG3A 2C6OA 5D1JA 3BYUA 4QMYA 2XKFA 1ZYLA 2QOIA 3TIZA 2BDFA 5FTOA 3KRLA 4CG8A 1ZYJA 2BZHB 2H8HA 5CZIA 4B99A 3CD8A 5CAPA 2R2PA 4MKCA 4O7TA 3G6GA 2PK9A 4ITIA 3QXPA 3EOCA 3QQHA 2I7QA 4U3ZA 3R0TA 2WEVA 1VZOA 2XZSA 2QOFA 4HVSA 5JQ5A 4F9AA 2XUUA 4ERKA 3TKUA 2GSFA 4BWKA 2JITA 4J95A 3OD6X 2IJMA 2ITXA 5HESA 4XP2A 4WRGA 4Y72A 5CT0A 5EI8A 3PXZA 4DBXA 5CWZA 2PVLA 4FYNA 4DTBA 5CU4A 5CEIA 3SXSA 4FTKA 2QKWB 5LMBA 2Q83A 1H26A 4EOJA 3VS2A 4G5PA 4S30A 4OTFA 2W4KA 3ENHA 4LG4A 3CQUA 3LXKA 4X3FC 3U9CA 1YI3A 3I7BA 3ZUTA 1XKKA 4E4NA 5AEPA 2YM7A 3F3VA 2PU8A 2C5VA 5GJFA 4RWIA 4OR5A 3FSKA 4E20A 1YW2A 3HX4A 1WFCA 1YHWA 4IZ5A 3EN9A 3QTIA 3MDYA 4RFMA 4UXLA 4F09A 2YCFA 5AP6A 4TYHA 4K11A 2OLCA 1BI7A 4ZTLA 2CGVA 5HCZA 4QT1A 3P7AA 4K2RA 4TTHB 3EFLA 4BWXA 3U6HA 3NUUA 4MWHA 5DBXA 4KKGA 4UYNA 2HCKA 3FI2A 3QTUA 4RWJA 1HCKA 4EK8A 2BZIB 1EH4A 4ZOGA 4PL5A 4DFYA 1OIRA 3GU7A 4FK6A 5BPYA 4QPMA 3NSZA 4F9BA 3GCQA 4F99A 3QZGA 4XNEA 4FV1A 5C4KA 3ZXZA 4LOPA 3FHRA 2UZDA 2NRYA 4FG9A 4QP6A 5DIAA 4A07A 4CV8A 4WNPA 5CSVA 5IH4A 1PW2A 4DG3E 5K9IA 5BVFA 2G15A 1XJDA 4QMXA 1KV1A 3C4CA 3IDBA 5GJGA 4GG7A 5ITAA 2IW8A 3QRJA 2JAMA 4CT1A 3R8UA 3UZPA 2Y4PA 3DTWA 1W82A 2QOCA 5FM2A 5CAOA 2OZOA 4NU1A 3PXKA 3ODZX 5AP5A 3NW5A 5AV3A 3V6SA 3O8TA 3AD5A 4P90A 1OPLA 4H1MA 3EH9A 3UYTA 2Z7QA 4AZVA 1OL2A 2JKKA 4X3FA 4O21A 3S4QA 3THBA 1F0QA 3AXWA 3CCNA 3VS3A 4LRMA 3ORTA 4EK4A 4PF4A 4CVAA 4YHJA 4CEGA 4YTHA 3MPMA 4WUAA 2UW8A 2JDSA 5BYYA 3ERKA 1PKGA 4ALWA 1DM2A 2JD5A 3D5XA 1XH9A 4QNAA 3OG7A 4D58A 3Q6UA 5A4EA 5J7BA 5M53A 3NVMB 4JL9A 3REPA 1ZYSA 3QU0A 4EH8A 4FV6A 2IZSA 1IG1A 2W96B 4IH8A 4IFCA 2I40A 2BALA 4YLLA 4QMSA 2WNTA 4LI5A 3UJGA 4DN5A 1ZZLA 3UZRA 4KABA 3LXNA 1TQIA 3F61A 4D2TA 2X2LA 2VTRA 5ANOA 2P0CA 4I5HA 1GAGA 3FZSA 3V5WA 4GMYA 3TUDA 4I6FA 4OTDA 4GRBA 4Y5HA 3UOHA 4MTAA 4AA0A 5K0XA 4M15A 5CS6A 5J9ZA 5GZ9A 1QPJA 2VV9A 3DBCA 3ZO4A 2YLFA 4U40A 1ZOGA 4O0SA 3RVGA 4F7NA 3BBWA 4NWMA 5EYCA 3G90X 1B6CB 2E9NA 4M3QA 5EDPA 1SVGA 1YWNA 3ULZA 2XA4A 3QF9A 4AOTA 3W2PA 4AW0A 5KKRB 5AUUA 2P55A 2VTLA 1REKA 4H3BA 5EW3A 5HNIX 1M2RA 2WMWA 5KMLA 4BKZA 5LVOA 3ZFYA 2F2CB 4U80A 1QMZA 2JIUA 3HDMA 2OSCA 4R78A 1FVRA 3HMMA 2B7AA 4NJ3A 2YITA 3OCTA 2WU6A 3A60A 1XH6A 3MH1A 3KMMA 3DDPA 5C26A 3TUBA 1QCFA 4KS8A 4DGOA 3PVBA 4HYSA 2P4IA 2WTCA 1WZYA 4FEWA 2WTDA 3BYOA 5AWMA 4BDFA 2IZUA 3T9IA 3R7VA 4A9UA 4XJ0A 3I7CA 1CKPA 4QP3A 4BCFA 3CS9A 3E88A 1LEZA 3UZTA 4PDPA 3U54A 3MIAA 4DBNA 5HO7A 4LGHA 1CKJA 4O0UA 3M1SA 2X0GA 4TWPA 3D0EA 2QVSE 4C02A 4USFA 2UZTA 4YJUA 4M8TA 4IVCA 2VTHA 4ZLOA 1A48A 1KWPA 3RINA 1AD5A 3DLZA 5EM7A 2WQMA 4MBLA 4XG9A 3Q4UA 1TKIA 3FWQA 5JN2A 3EFWA 2VTNA 4B7TA 1U5RA 2IVVA 4H3PA 4DFXE 3H9RA 2O8YA 4KBAA 4RJ4A 1A06A 2B9FA 2YHVA 4I5PA 4M0YA 4ZY6A 4D1ZA 3HAMA 3R1NA 3U51A 5AP2A 4YR8A 5M06A 3COMA 1DAYA 1OVEA 3MFUA 4JAIA 3QKKA 2XNOA 1CSNA 1VEBA 2GNIA 4K33A 2FSTX 5FQDC 3RP9A 2QG7A 4WKQA 3ZRLA 3OW3A 5JFVA 4YJTA 4I6QA 1JKTA 1JVPP 4ZTMA 1R78A 3WE8A 4RA4A 3ZRKA 4GIHA 2WIHA 3OFMA 3KRRA 4Q2AA 3RAIA 2G2HA 1BUHA 3GGFA 3NRMA 3W33A 4JX3A 2CN5A 3D2IA 4KBKA 4QP8A 1FQ1B 1WBWA 3ALOA 4Y73A 2WMTA 5JFWA 2Z7LA 2HWOA 2RFEA 3OBGA 4XG4A 5AIKA 3RK7A 4PTGA 5A3XA 4BDCA 5EM5A 3TKHA 4TL0A 1PJKA 3DAEA 3UVPA 4BIDA 4D1SA 4DGMA 5AR8A 1PXJA 1GIJA 3H9FA 4DG2E 5D9HA 3V8TA 4L68A 3PVUA 4RQKA 4NM7A 4FA2A 3R01A 3WZKA 3H3CA 1H1WA 2OJ9A 3MFTA 1KE6A 3QGWA 2XIKA 4G3CA 3QAME 3FV8A 3NWWA 2HOGA 5HLWA 4LFIA 2C0OA 4M13A 5JEBA 2R7IA 4WSQA 3MS9A 4DEBA 3R9OA 1IAJA 2JFMA 4FSZA 2WKMA 1Q8WA 3MVJA 4K9YA 4BCMA 4YU2A 5ACBC 4AW1A 5IQAA 4IM2A 3E93A 3KRXA 3ZLSA 5EM8A 2R7BA 3BU6A 3HMOA 3PIXA 4DG0E 2J6MA 3KN6A 2V0DA 3D5VA 4JRVA 4KKEA 4O7ZA 2R3HA 4W8EA 3LXLA 4HNFA 3MPTA 5E92A 1OGUA 4NCTC 4AS0A 4GUEA 3DB8A 2VO6A 4HYIA 1H1SA 3EQCA 3NPCA 4E3CA 5E8SA 3EL7A 2J0JA 2XKDA 3NR9A 4ZTSA 3FKLA 5HG8A 4YZDA 4CZUA 3UOKA 2XP2A 3G15A 4W4WA 2OIBA 1F5QA 3AOXA 3EQBA 4FKLA 3BHHA 4IJ9A 5LVLA 4FV5A 4GUBA 4C4FA 4I1ZA 4ASDA 4XRLA 5HTIA 4IIRA 4AGDA 3PZEA 5A46A 4H3QA 3UYSA 3QCYA 4B8LA 4FNZA 3FBVA 5E1EA 4BKJA 4KIOA 2JAVA 1GIIA 3GT8A 3E8EA 4J71A 2HZ0A 3F66A 4M7IA 4FEXA 3OVVA 2R5TA 3VULA 4DEGA 4O0RA 4AFJA 1V0OA 2GTMA 2JKQA 2XM8A 5CZHA 5L6WL 3IW8A 3BLQA 4MEDA 4PL4A 1R3CA 4QYYA 5ACKA 3JYAA 3MVLA 1Q4LA 4KRCA 4JDHA 1PXPA 5HLPA 4MF1A 1OL1A 1Q3WA 3T3VA 3LCTA 3LM5A 5HZNA 3NIZA 2WB8A 4IADA 4ASXA 3SGCA 1R39A 2VWUA 5DE2A 5JFXA 4OBQA 3BEGA 4QTAA 5AUXA 3GCVA 4NTTA 4ZZOA 3Q4CA 4ANOA 2GQRA 4FTAA 5E8ZA 5FD2A 3TI1A 5IQIA 3R8ZA 3WILA 3CP9A 5KCVA 4DLIA 2C0IA 2XBAA 2W5AA 3HV4A 4ITJA 3WI6A 2HZ4A 2B9JA 3CKXA 3RWPA 2QR8A 3M2WA 4K6ZA 2CPKE 4FF8A 3VHKA 3MH3A 3ZXTA 5JT2A 3CSVA 2HIWA 4M97A 4OTQA 1PF8A 4M12A 3CY2A 4RJ6A 4OTGA 4NCTA 5DFPA 4FSYA 3QALE 2WOTA 1CKIA 3KKVA 4AZTA 4AG8A 3PJCA 3QCXA 4EK5A 2WGJA 3R83A 1YXXA 4IX6A 1FMOE 2BCJA 4I93A 5DT4A 4NUSA 2VWYA 4QQ5A 4F9YA 4F9WA 2IVUA 3NZ0A 3R30A 2PMIA 1O6YA 2XS0A 2AC5A 2W9ZB 4AZEA 5JK3A 4I3ZA 3BHYA 2GNHA 4O2ZA 5DWRA 4EUUA 2BHEA 2X1NA 4UN0C 3D5UA 5KE0A 4ZJVA 3OW4A 4FSTA 2CHLA 3ZEPA 4Z7GA 2XCHA 2XVDA 3E62A 3LFSA 4O91A 4FBXA 3EWHA 3W10A 1BL7A 2PPQA 4FTQA 4W4YA 3NGAA 2B55A 2VTIA 4GEOA 5EDRA 1FVVA 4FZ7A 5BQ0A 4F63A 3CPCA 5C4LA 3L8SA 2F4JA 3A4PA 3NLBA 4RLKA 3TDVA 4B6LA 2VGPA 3ZS5A 3OEFX 3JS2A 2OJJA 3VS5A 1OUYA 2W4JA 5JH6A 3ZM9A 5JRQA 4QMOA 2C6TA 3MFRA 3Q32A 3QKMA 4OLIA 1P4OA 4XLVA 5E8VA 2YIRA 5CEKA 3FXWA 4TW9A 2YACA 3N4TA 3NUAA 3GVUA 3PY3A 5H8GA 5D41A 4I6BA 4EKLA 3GCPA 4DFNA 4GKIA 3OWKA 4M67A 4UEUA 2PHKA 3MA6A 5C9CA 3TWJA 4QQCA 1GY3A 3PPZA 5CAQA 5HEZA 4EJNA 3DKGA 5I3RA 2ZVAA 2X6EA 3R7EA 5IMXA 4D2VA 2W06A 2ZDTA 5AUWA 4BCOA 3F5UA 3AC4A 2VO3A 4JXFA 3IW6A 5EK7A 2YISA 3AC8A 4ZSLA 3ZTXA 3OXZA 3LE6A 4RFZA 2UW9A 4I0SA 3BGPA 4YBKA 4QMLA 1I09A 4II5A 3A7FA 2ZB1A 3R9NA 4C35A 1PMNA 2F49A 2UUEA 5HGIA 5KZIA 4BL1A 5TKDA 4CKRA 4Y46A 3OEZA 2OF4A 3B8QA 3SG8A 5DRBA 5FBOA 2R4BA 4F7SA 4QMVA 2UZVA 3EQDA 2X2MA 2JDVA 3HVCA 4F65A 1RW8A 2GHGA 2VU3A 2XNNA 4CXAA 4QP9A 4YZBA 3H4JA 4G6LA 2BKKA 2OJIA 4ENYA 4XG8A 2OF2A 1ZOHA 4DE4A 3UPZA 5KNJA 5M09A 5GINE 4FTCA 3DJ7A 3ZO2A 3QL8A 3D2KA 3RALA 2B1PA 2XBJA 4QP1A 2RFDA 2XNGA 2UZLA 2YLEA 4BGHA 3R22A 4O7WA 3KY2A 4PQNA 4BKYA 1XH8A 4X2GA 5BUIA 4E26A 1JOWB 4NKAA 5HICA 3VS1A 3FQEA 3E92A 3KULA 3QD0A 3QWKA 2Y6MA 3MTFA 4FV4A 4BDHA 3H0YA 3A8WA 5E91A 4CLJA 2V55A 4WG4A 3RPRA 2C69A 1UU8A 3R8PA 2B9IA 4PPCA 3TACA 3TIYA 3EL8A 2EU9A 1YDTE 4V04A 1BMKA 4DYMA 3HV3A 3OP5A 4AGCA 1H24A 1T45A 2YIYA 3KXZA 4HGSA 4MD7E 4MVFA 5KZ0A 3W2RA 5CSXA 3OTUA 4EH4A 4FI1A 3R9HA 1WBVA 1G3NA 3LAUA 3MN3A 4KBCA 2BAQA 5IQGA 5HCXA 1BX6A 2PVYA 2XRWA 5AUTA 4CZTA 3PJ3A 4FZ6A 3DS6A 3TL8A 4NM0A 4FKRA 4WIHA 3T3UA 3NIEA 4EOSA 5HX8A 4LUEA 5IH6A 3D7TB 4USEA 4AAAA 3ZFXA 5BYZA 2HXLA 1Q62A 3PVGA 3OCGA 1G8SA 3PSCA 3FC1X 2GTNA 4I4EA 4NM5A 2C1BA 2QONA 2A1AB 2HW7A 3I6UA 3LFNA 3HP5A 1B39A 2BIYA 5CSHA 2ZYBA 4QMPA 3DNDA 4RC2A 4C2WA 4FK3A 1IA8A 4UMPA 3KQ7A 2X8DA 2HZIA 4AZWA 2BPMA 4FL2A 2I0YA 4EC8A 3I60A 3FHIA 4IQ6A 3UG1A 4GFGA 1UWJA 4DHFA 1SNUA 2ITPA 4YLKA 5FGKA 2XK4A 4GT4A 3F3WA 4ORKA 2F7EE 4IZAA 2GU8A 2GNFA 4KWPA 3RHXA 4I92A 3SV0A 3G9LX 3C4FA 1URCA 3KU2A 2OFUA 1JQHA 1OM1A 3VAPA 2VWWA 4CSVA 5HG5A 5CTPA 3HRBA 3BHUA 5KHWA 4CGAA 3TEIA 5M07A 4YSMA 2VTAA 3R1YA 1FBNA 1Q97A 3TXOA 2ITQA 4KIKB 2VTPA 2O64A 2WQBA 4LQMA 4O27B 4RX7A 3ZLWA 4D9TA 3OY3A 2YABA 4DFBA 4AGUA 2C5OA 4WSYA 2Y7JA 2R0UA 3QQJA 5M44A 1Q41A 2C6LA 4MXCA 5GNKA 1NVRA 4A9TA 3P4KA 4CZYB 5KMMA 2B53A 4UZDA 3DA6A 1VYWA 1U46A 2XEZA 3ODYX 5DHJA 4ZSJA 4BF2A 2YWVA 4O38A 5HIDA 3QRTA 3MY1A 4G3FA 5DI1A 3WF8A 2XMYA 3UODA 3EZRA 5DMZA 1YWVA 4FSNA 2YA9A 2VZ6A 3TKIA 3JXWA 3LMIA 1YXVA 2ZV9A 1P5EA 3CR0A 4FX3A 4ZP5A 4DH1A 5M57A 4U6RA 5LMAA 4A4OA 2WTJA 5DG5A 3ZC5A 4A7CA 1XH7A 2O3PA 3PLSA 4IHPA 3RK9A 2OBJA 5LXMA 1RDQE 3VJOA 5HO6A 2REIA 2IZTA 4DFUA 1R1WA 5L2IA 3K3JA 2JLDA 3FI4A 2JKMA 5AAGA 4AA4A 4A9SA 3UP7A 3FJQE 1OL6A 4I4FA 5TOZA 4FTTA 3ORXA 4BTKA 3R6XA 2C6IA 4JG7A 4PMPA 3N51A 3SG9A 4X2KA 3FYJX 4IDVA 3Q9WA 5CANA 4FEUA 3IW5A 1JSUA 3VBYA 5H9BA 4AW2A 2PTKA 3CD3A 1ZYCA 4EHZA 3CE3A 3C4EA 4FYOA 5E7RA 5EHLA 1SZMA 1JLUE 1FGKA 2X9FA 4AW5A 3O96A 3L8PA 3EQFA 3PG1A 2J0IA 1OKZA 4I5MA 5EHYA 5FBNC 4AFEA 4EL9A 3PWYA 4HVIA 2HYYA 2GFSA 3LQ5A 3WARA 3P78A 4G31A 4CFWA 4E6CA 2RFNA 2R3NA 3A7IA 4NYEA 4BFMA 3FMKA 2SRCA 3EKKA 3RBWA 4GK4A 4BTFA 1H08A 5DA3A 1O6KA 2VTOA 3U6IA 2W5HA 2PVFA 1GZNA 3IDCA 3I5NA 5FTQA 3OCSA 3RAKA 4DCAA 1ZXEA 2OXXA 3AD6A 3QA0A 2W5BA 1SNXA 3OUKA 3VS6A 3VBVA 2ZM3A 3FZOA 5CX9A 4FTUA 3TNHA 3FZTA 1OUKA 4P2KA 4V0GB 5A9UA 4FGRA 4IB1A 5FXRA 1H1RA 4MQ2A 2LAVA 4EQCA 2R3GA 1B38A 2IVSA 3EFJA 3PUPA 4XV2A 4YURA 4IWPA 2Z8CA 2GCDA 5AUYA 3KRJA 4XOYA 4L3JA 2WTKC 1AGWA 2UV2A 1Q8UA 3ANRA 3S3IA 3E87A 4D28A 5E1SA 3LKMA 1PKDA 5BVOA 4ZXTA 1S9IA 2W1DA 2IW6A 4BDJA 4LM5A 4JDKA 1JKLA 4C8BA 4EOOA 4XV1A 5TR6A 3PA3A 5DH3A 4M84A 4W4VA 5I5ZA 4PDOA 3K2LA 4QMTA 4I0TA 4C57A 5I9YA 3SRVB 4QYFA 4S31A 3NCGA 1LEWA 4NFNA 4YHFA 3WYYA 2ZM1A 4H39A 3F9NA 3SOCA 3FQHA 5T3QA 2OH0E 5CT7A 3G0FA 1ZMUA 4BCJA 3AD4A 3OCBA 4UXQA 4BTMA 3IKAA 3COKA 3O8UA 4G34A 3BKBA 4QNYA 4QMUA 1ZRZA 2W1IA 4BRXA 3DBQA 3QRIA 5LOHA 5EQPA 3ANQA 4CNHA 1PMUA 4FIHA 5AMNA 3DFAA 3DQWA 4JR3A 1JPAA 1WVXA 4RC4A 1UU9A 1OL5A 4RIYB 4E93A 2CSNA 2CMWA 2P3GX 5KO1A 3UO5A 1YVJA 3UOJA 4TXCA 2XYNA 2C3LA 1DI9A 4RWKA 2IW9A 3MSSA 4E4XA 4G17A 2VTJA 3QX2A 3C4XA 3DY7A 3FMHA 4FTOA 3NAYA 3CBLA 4UMTA 2VX3A 2VWBA 3F69A 4BCPA 2WHBA 3SDJA 4A9YA 1OIUA 3ACKA 3SD0A 4D4YA 2OXDA 4R7HA 4Z16A 5IQDA 3WIGA 3QYZA 4E6QA 2XIZA 3R7YA 1NVQA 1U54B 3V51A 3VN9A 4P5QA 3PJ8A 1K2PA 5C8NA 3FEGA 1ERKA 1KE5A 3PRFA 2PUPA 3ATSA 1PXMA 5D7VA 3G0EA 4JAJA 3B2WA 3R1SA 2BTRA 4EKKA 2X81A 4JDJA 1XH5A 1DAWA 4JX7A 5DVRA 4D9UA 2WU7A 3QXOA 1J7IA 4ZSAA 5G6VA 4FKJA 4U5JA 2JIIA 2A0CX 5HG9A 3C4WA 4JBPA 3TNWA 3VF9A 2O5KA 3ID6C 3O51A 2CKOA 2XKCA 2O65A 1JNKA 1V1KA 3UTOA 4C3RA 5ANDA 4ACMA 4BB4A 3DCVA 2W1HA 1PXKA 3H0ZA 4NIFB 5LWMA 4DH3A 4FIIA 4AZFA 2I0HA 5HE3A 4LV5A 3S0OA 4RWLA 2J0MB 2CCIA 3IG7A 5EOLA 3RTPA 3ZDUA 2B4SB 3PTGA 4MNFA 4U41A 2VD5A 3GB2A 3AMBA 4GT3A 4RZWA 5K5NA 3QZFA 3FKOA 5DR6A 4QMMA 4CFMA 3BWJA 1UWHA 3DXNA 3ZO3A 4CLIA 2C4GA 1IAHA 1QL6A 5BVWA 3W8LA 4S33A 4LGDA 4X2JA 4R7BA 1KE7A 4I5CA 4K18A 3BWFA 2WMBA 3DKFA 2IG7A 2YN8A 3UQCA 4L3PA 4FT9A 2CJMA 2ITZA 3LQ8A 3RI1A 4C4EA 5FP5A 4IX4A 4QYHA 3TTJA 4O1OA 4MHAA 2ACXA 4RPVA 1UA2A 4TWNA 4IZ7A 3F88A 5DRDA 5AX3A 4ENXA 4XYFA 5EQYA 1V0BA 2QG5A 3SC1A 4LMNA 2G1TA 4DEHA 4EH9A 2OZAB 5CENA 2UZOA 4DH8A 1DS5A 3QC4A 5IF1A 2R3QA 3JVSA 3ZSHA 3OZ6A 3PRIA 4RIOA 4F64A 4O1PA 1OKWA 4FODA 4FV3A 1Y8GA 4HW7A 3A61A 4R3CA 4RJ7A 5ETIA 1TQPA 4JRNA 4JQEA 4MF0A 3QUDA 4BBFA 2FYSA 4RIWA 4M0ZA 3F5XA 3BV3A 2X8EA 4YUQA 2R3OA 1ZAOA 1YHVA 3BYMA 5D7AA 4XOZA 3E64A 3TZ8A 3PY1A 3WIKA 4FV0A 5A6NA 3O50A 4D0WA 2CNQA 3K5VA 2BFYA 2H9VA 3HV7A 2R3KA 3KGAA 3R02A 4TYHB 4WT6A 4XV3A 2I0EA 4YHTA 3D15A 3UVRA 3V5JA 4DFZE 4IJPA 1U59A 5CNNA 4GIIA 2DQ7X 5E90A 5CF8A 5KMKA 5L8LA 4CV9A 3DGKA 3DKOA 3U4WA 5HOAA 3QD3A 3MJ1A 2QOLA 4C61A 4QMWA 3O0GA 4WRSA 4WBOA 2VRXA 1WBSA 3FYKX 4YJPA 2VNWA 4N4SA 2QO9A 3ORMA 3CJFA 3VHEA 4BVUA 4ZLYA 4FUXA 4C3FA 4E73A 4BBEA 5ANGA 3OY1A 5E9EA 2CCHA 5HBEA 1H0WA 2XJ0A 2XB7A 5C27A 4AWIA 4JG8A 4W4XA 4FV2A 3COIA 4G2FA 3PJ2A 2HWPA 4KUJA 3ULIA 4TWCA 4DTKA 1QPEA 3LFCA 3NX8A 3BGZA 4E7WA 3EQPA 1GOLA 4BDIA 4FKQA 4GV1A 3VJNA 4KA3A 4FZAB 3KVWA 1GNGA 1L3RE 4BBMA 3LIJA 4D2RA 5LMKC 1GJOA 1W0XC 1UU3A 1GZ8A 1IEPA 4EOIA 5L4QA 5EFQA 2YIWA 3FZ1A 3MW1A 3WZDA 5HCYA 2Y4IC 2V62A 4DGGA 3LXPA 4NT4A 3AT4A 3AGLA 4QYGA 4X3FB 3LMGA 3POZA 5F94A 2IWIA 2RL5A 3K5UA 3LJ0A 3FY2A 1PY5A 1Q8TA 3D83A 1XBBA 2C3IB 4RZVA 3A99A 4ZZNA 2JDRA 3NYVA 3QUEA 4L44A 5LVPA 4ZJJA 3SW4A 4L42A 3JR1A 2PUIA 1M17A 5IEYA 4IX3A 3D14A 4CKIA 4FVQA 1PMEA 5IH5A 2GQSA 3WOWA 4ANSA 3KL8A 4CCBA 2WQOA 1M2QA 2W4OA 3DKCA 4XG7A 5BYLA 4D2SA 2WMRA 3A7JA 4YTIA 3R8LA 4QQTA 1W84A 4GKHA 4WBBB 4R1VA 4RX5A 3MY5A 4G6NA 4Y8DA 3V6RA 4EBWA 4JJRA 4J1RA 3NS9A 1LUFA 3TN8A 5JZJA 4FG7A 3TNIA 4BHZA 1U5QA 3EQIA 5L2SA 2G2FA 2W05A 3C5UA 3W1FA 3OXIA 3FXZA 3GC7A 3VNTA 5AP0A 3FMEA 2PSQA 2P2HA 4X6RA 5I9VA 3ZYAA 3DQXA 5J9LA 4Z3VA 4B9DA 4FNYA 4MXYA 2XIXA 4FV8A 4IDTA 1G5SA 3NUPA 4UZHA 3KXNA 1XBCA 3S2PA 4JQ7A 2JGZA 5B0XA 3RMFA 3VRZA 4ZIMA 1ZMWA 4BI0A 1KSWA 4GFMA 4RRVA 2GQGA 4AF3A 4AN9A 4IAAA 5LMKA 4OUCA 5CAVA 4OAVB 2WMQA 3R7OA 3LCDA 3CKWA 5CQWA 5HD7A 4TWOA 3SKCA 3ZH8A 2VX1A 2Y6OA 4EH5A 5HBHA 4Z55A 2YJSA 3HL7A 4O7NA 1VJYA 3DK6A 4RA5A 4BDAA 5JRSA 5C8MA 4APPA 2V7AA 3E8DA 3IOKA 2BIKB 3VS4A 5L2WA 4CTBA 4ASEA 5EYDA 1H4LA 5HO8A 5FXQA 3RGFA 4BZDA 3O8PA 4QQJA 4ZZMA 1M2PA 2J7TA 2XK3A 3QHWA 3ACJA 5IDNA 4BGQA 4Q9SA 2ZDUA 2WMXA 3CEKA 3LZBA 4CMOA 2H96A 4NTSA 4HCUA 2C6EA 2VTSA 3DK3A 4ZK5A 4FIJA 2C30A 5M4CA 4WA9A 3KN5A 4V05A 5A6OA 5IUHA 4O86A 1H1PA 3EN6A 4J99A 3CTJA 4JI9A 3HAVA 4L7SA 3IO7A 1XWSA 2PZRA 3MVMA 2QU5A 3MH2A 3E8CA 2HZNA 2BTSA 3FUPA 2R3PA 3BYSA 5HNGA 3PP0A 3KRWA 4UMQA 3VRYA 2PZIA 2XNPA 3RM7A 1WVYA 4IBMA 3OMVA 1UKIA 4BZNA 3M42A 3UPXA 5IG1A 5LCJA 4O6LA 4PX6A 2NNWB 4AGWA 1FOTA 4FNWA 3KCKA 4ACCA 3R28A 4NSTA 3R9DA 3F82A 1ATPE 4H36A 3GC0A 2G2IA 2BAKA 4HYUA 4PDYA 5ICPA 1XH4A 2FUMA 3D9VA 4TYJA 1WAKA 4GFOA 4X0MA 1H28A 3FI8A 3H30A 3PG3A 5CASA 2BR1A 4AUAA 2WQNA 4BI2A 3ZUUA 4CYJA 5AIRA 2BHHA 2QHMA 3QHRA 2WXVA 5EW8A 4EZ7A 2XK6A 3FL4A 5L2TA 4RIXB 4TT7A 4YZNA 3PA4A 3BPRA 3HEGA 5AP3A 4YMJA 5IEXA 2PVHA 1I44A 4UALA 3NYOA 3IOPA 3MH0A 3EQHA 4GYGA 2C5YA 3HP2A 3ZCLA 3KXMA 4BIBA 3W2QA 4F6UA 3MPAA 5DT3A 3PDTA 5GIPE 3FC2A 1UNLA 3FKNA 4J98A 4IFGA 4BYIA 1PMVA 1H27A 1OPKA 4KAOA 4CFNA 4BC6A 3SAYA 4FEVA 3VUMA 2DUVA 3W2OA 3B8RA 2ONLC 2X6DA 1YDSE 4IC7A 5I3OA 5E8WA 5EW9A 4C3PA 3KEXA 4HPTE 4A4LA 2BFXA 4L9IA 3HMIA 4JQ8A 4O7YA 5B2LA 3LFFA 4JIAA 4DEAA 3RZBA 4NL0A 5J7HA 3OROA 3AC3A 4CFXA 4EHGA 3Q4TA 3F3ZA 3EMGA 2FSMX 3EN7A 2ERKA 4OAUC 4I21A 5C8KA 1O6LA 3SOAA 2ITVA 3TV7A 4P4CA 4WNMA 4RX9A 3D4QA 3DV3A 5JGAA 2Y9QA 4BIEA 1LR4A 5HE2A 5J87A 2XIYA 4MNEB 5AR4A 3P1AA 4IWOA 3WF9A 1OIYA 1NVSA 5C03A 1SVEA 2BRMA 2R3JA 2PL0A 3GU8A 3FLYA 3Q5ZA 4TN6A 4CMUA 3KK9A 4F9CA 5CF4A 4EYJA 3V5TA 4PY1A 2KTYA 3FLZA 4IAFA 4AE9A 1MQ4A 5LVMA 3GC9A 3TM0A 2PUNA 4GVAA 1YXTA 4O0YA 4EQMA 4IAIA 2PVJA 3BHTA 5J95A 4L52A 3SHEA 4IW0A 4F08A 4JS8A 2CDZA 3I6WA 1DI8A 4HCVA 3NNVA 4QP4A 3TG1A 2G01A 3E7VA 4PTEA 4YZCA 5AA9A 3QTQA 5C1QB 4IB3A 5GZAA 4RVMA 3EQRA 3PLAE 4LL0A 4APCA 3UOLA 4PUZA 3WE4A 2UVZA 2V22A 1Y8YA 2QLUA 3BRBA 4ZTHA 2Z60A 4S32A 3HYHA 2UW7A 1URWA 2YM3A 3W2SA 4BYJA 4Y5QA 1K9AA 3CIKA 3L8VA 5AAFA 5DEYA 5CAUA 3DFCB 3RHKA 4FG8A 2R64A 5F9EA 2X39A 3RAHA 4OT6A 3ZMMA 4BWPA 2ONLA 4X2NA 5EDQA 4EZ3A 2QCSA 3B2TA 1BKXA 3UMWA 2QOKA 4TNDA 4XCUA 5T68A 4O7VA 4NH1A 2ZV8A 4AN3A 4FKSA 5JKGA 3UDBA 5HKMA 3TJCA 4E4MA 3QQLA 4NEUA 2NP8A 3D7TA 2GHLA 4QMZA 4BHNA 3DJ5A 4I41A 5IKWA 4IVBA 1LP4A 4H58A 5CEQA 4EORA 5IZFA 3ORKA 4M66A 5FM3A 2ZV2A 2RKUA 3GQLA 2C3JA 2Z7SA 4ZSEA 4F0IA 5KUPA 4O7SA 3F6XA 3BBTB 3O17A 4CT2A 3UC4A 3EB0A 3WZJA 4ZMEA 2QO2A 4C33A 4EH7A 2J51A 1JKKA 3KF7A 2RG5A 2ITWA 4G3EA 3VUDA 3Q04A 4X3JA 2BRBA 2X7GA 5H2UA 5IUIA 3TZMA 5CEPA 3W16A 4FZDB 5GZ8A 2QLQA 1XQZA 3HLLA 4FZFB 3ZUVA 3R04A 4EJ7A 2B54A 4OTRA 3L1SA 4YTCA 3KXHA 3P79A 5AP1A 4D4RA 2WMUA 4IANA 2OU7A 2VNYA 1YHSA 1JSTA 4YZ9A 5LWNA 2OO8X 4KIKA 3ENMA 2CGUA 5B2MA 3HMNA 4GU6A 3MI9A 4EQUA 4C62A 3GQIA 5HU3A 3V01A 3H10A 2OW3A 3RPSA 4K77A 3ZFMA 3PSBA 3EN4A 1K3AA 2A27A 3VUHA 2FSOX 3GU5A 3CGFA 3VQHA 2HELA 4CCUA 1WBPA 3W55A 5FRIA 4ERWA 4LL5A 4AU8A 3L8XA 2XH5A 3E3BX 4XRJA 3LCKA 4ANBA 2WIPA 1Z57A 2C6DA 4C2VA 3BLHA 3OC1A 4FTJA 4QMQA 3DNEA 4EONA 2PY3A 3HGKA 4X21A 3HUBA 4EOKA 2X4FA 3AT3A 3AT2A 3N9XA 5TF9A 4OBOA 1XR1A 3NVKI 2OGVA 1YI4A 2PZYA 3M11A 4BTJA 2F57A 5IUGA 4BICA 4DT8A 4RJ8A 3HV6A 4MYGA 4RSSA 5IA0A 1A9UA 4D2WA 3MESA 3P9JA 5HBJA 4Q5EA 3DOGA 3U6JA 3GU6A 2DYLA 4R3PA 3ZOSA 3VBTA 3DLSA 1FINA 4FKPA 4J97A 2VO0A 4QPSA 3OF0A 2GNLA 2GS7A 3QD2B 3WF6A 5K5XA 2BZKB 3IW7A 5EM6A 3E3PA 1KV2A 5AV0A 3QA8A 4V01A 4GJ3A 4M69A 3Q3BA 4X2FA 3O7LD 5D12A 4GCJA 2GS6A 4W9WA 3G5DA 2XK9A 2YJRA 2A2AA 5HVJA 3VS0A 3PXFA 5HNBA 4EBVA 3LQ3A 4RVLA 4FT7A 1CMKE 2FO0A 2YCQA 2PMLX 4DGNA 2JIVA 1RE8A 5F1ZA 3Q96A 4F4PA 1P14A 1H07A 2ZM4A 1YOMA 4MWIA 1WBNA 3ORLA 3W32A 3QTRA 4GYIA 4C37A 4FKOA 4FL1A 2F7XE 4F0GA 3ZSGA 1PYEA 3ZBXA 5CSWA 4BCNA 3KCFA 3TZ9A 3ORIA 4FSWA 4XEYA 5ANIA 4AX8A 3QC9A 3QQUA 2VN9A 3DB6A 4OBPA 3TDWA 5DOSA 4DFLA 1R0PA 3NNUA 3SQQA 3KC3A 1Y6BA 5EOBA 5HHWA 4IM3A 3UGCA 3LPBA 1FGIA 4QO9A 1X8BA 3QGYA 4Y83A 5H3QA 4ZTRA 2VTMA 4LGGA 5HVYA 4JBOA 4FT5A 5JQ8A 3LJ2A 4UMRA 4USDA 4V0GA 5A4CA 1PHKA 4DEEA 4HVGA 1FPUA 1MP8A 3FSFA 3GXLA 4O84A 4BDDA 2W1GA 5D10A 1H01A 4YJSA 2YAKA 4IM0A 4HZSA 3PPJA 1SYKA 2VWZA 3KFAA 4FV9A 2YIQA 2ETMA 4YO6A 1VYZA 3BE9A 1NA7A 5F4NA 5FLFA 3O71A 4R77A 3EQGA 3OWJA 3V8WA 2B0QA 1UNGA 2ZAZA 3G33A 4XV9A 2ETRA 3C4ZA 3RPYA 4DC2A 3GP0A 3NUNA 5BVKA 4F7LA 2ESMA 1OKYA 3PZHA 4IVAA 4QOXA 4ZY4A 3C9WA 4HCTA 2Q0NA 3VBXA 4ZMFA 3Q5IA 4YO4A 4EH6A 4OTPA 4G9RA 1ZYDA 3QZIA 3RJCA 5CVGA 2I1MA 3RK5A 3VS7A 3SRVA 2WMVA 5LARA 3DT1A 3NYXA 2OWBA 4IAKA 1TQMA 4UWCA 5IPJA 4AZSA 4OTWA 2EVAA 3HUCA 3HECA 4J96A 5M4FA 3TZ7A 3I4BA 3HRCA 3R7GA 4IMYA 3IDPA 5AP7A 2CLXA 5LJJA 2FB8A 3NNWA 3DDQA 4KS7A 3TV6A 1IASA 3ETAA 4N70A 4C34A 4EOMA 5J1WA 2QKRA 3I0QA 4BDEA 3A7HA 3LW0A 5K4IA 4IC8A 1YKRA 2W0JA 4DA5A 4G9CA 3JUHA 4W9XA 2R3FA 2WPAA 5JMSA 3LLTA 4R6VA 3ZO1A 4XG6A 2WTWA 2J5EA 4QP7A 3SLSA 4ACHA 2HY0A 3CQWA 3PPKA 4DCEA 2QURA 3FE3A 4NM3A 3G6HA 3P7CA 4X7QA 3IGGA 5FEDA 3I5ZA 2YFXA 5IA5A 2OKRA 2ZMDA 3VW8A 4FVPA 2YM6A 4U0IA 3VIDA 1M7NA 2WEIA 2YERA 1OL7A 4L45A 4AXAA 3R21A 3LVPA 4ANMA 3V8SA 3DXPA 2YM4A 5EI6A 3W18A 2BDJA 5HI2A 3IS5A 1U54A 3ELJA 4IWDA 5AM6A 4EOPA 1UVRA 2Z02A 4RJ5A 4GVJA 3O23A 4XP3A 4OT5A 4DT9A 4G5JA 2E9PA 4I6HA 4PPAA 2FVDA 5KMNA 5KMIA 5G1XA 4DF3A 1ZARA 1J3HA 4I22A 2ITTA 4WO5A 5FDPA 5FTGA 4O6EA 4FKTA 4FL3A 4EHVA 2YZLA 3Q9XA 3EKNA 2O63A 5FDXA 4F1TA 4BI1A 2ZB0A 2XF0A 2EWAA 3I79A 3ZONA 1LPUA 3AC1A 2R9SA 2WAJA 5AJQA 1BLXA 2BAJA 2NRUA 4LV8A 4J53A 5HVKA 3PE1A 3ZRMA 3Q4ZA 1JSVA 4PWNA 4XH6A 3ZDIA 5KKRC 3FLWA 2EXEA 3DU8A 4YC6A 3T8OA 2PMOX 5EYMA 5FWKK 2R3LA 3GOKA 3NDMA 4AT5A 4QMNA 4OGRA 4U3YA 5FEEA 4UY9A 5DR2A 4XHKB 4ASZA 3II5A 2CKEA 3MGYA 3O7LB 2R3IA 4FC0A 3ZHPC 2UW0A
chains in the Genus database with same CATH superfamily
3R2YA 4RG0A 4XBRA 2OI4X 3UBDA 4E6DA 4EI4A 4YC3A 4Z9LA 1OBGA 5DYJA 3PY0A 4TKSA 3AMAA 3R7UA 3C0GA 4I94A 3ATTA 4FT0A 2EB3A 3R2BA 3V5LA 3ZM4A 5AP4A 2Z2WA 4EYMA 5TE0A 2XK7A 4P7EA 4Y85A 2QU6A 2ITYA 2W9FB 3HZTA 3EHAA 3W2CA 2OZAA 3RZFA 2X7FA 1UV5A 3BEAA 3PA5A 5K3YA 3VW6A 4IEBA 3QCQA 4O96A 3RCDA 3VUKA 5BVDA 2XNEA 1WVWA 3BHVA 2IPXA 5J79A 4ALUA 3FL5A 4IWQA 3NUXA 5BNJA 4GSBA 4JLCA 2KULA 2JDTA 4L53A 4I24A 3PWDA 3Q9YA 2V7OA 3R8MA 3EZVA 4CFVA 2UW3A 3R73A 5E8TA 5AR3A 2W1ZA 4DHIB 2UW6A 5CYIA 2UVXA 3OT3A 3UIUA 3I81A 2RF9A 1P4FA 1CTPE 4G1WA 2E2BA 2YDJA 3P0MA 3U87A 3UIBA 4HVHA 4HGLA 3FXXA 5A4LA 3AC2A 3PP1A 3Q2MA 3JY0A 4BDBA 4FEQA 3VO3A 2CGXA 3GU4A 1ZOEA 3LFAA 2JDOA 2R3MA 4RC3A 4AE6A 4FNXA 4AP7A 4C0TA 4E5AX 4PTCA 1U4DA 2OIDA 2PZ5A 1Y57A 4YJNA 1NXKA 2VUWA 4RVTA 3ZLYA 4F1MA 1SM2A 4FUYA 3LFQA 4EOLA 3L9PA 3OWLA 3V04A 4EWHA 4C7TA 1W7HA 4IACA 4YBJA 3ROYA 1NY3A 4JIKA 1L8TA 3OUNB 3HMPA 1OI9A 4YC8A 1Q5KA 3HKOA 4ZTQA 5KHXA 4B4LA 2QODA 4WUNA 4FSUA 4BCQA 1OB3A 4A9RA 1BI8A 3H9OA 4PDSA 4OTHA 4RT7A 5BUJA 4LOOA 2GNJA 3F2AA 4KIPA 5EKNA 4C4GA 3C13A 3NYNA 3OWPA 4JBVA 4UWBA 1Q24A 3OBJA 4AOIA 1V0PA 3CTQA 3WBLA 4Y95A 1ND4A 4D1XA 2XRUA 3PVWA 5AAEA 5AUVA 3NCZA 4NJDA 2GNGA 3BGQA 4O0TA 4BCGA 4DH5A 5IU2A 5EYKA 3Q6WA 1ZY5A 3IQ7A 5E8YA 3LFDA 3UIMA 3C50A 4XMOA 1OBDA 4F6SA 2CLQA 2IZRA 3GFEA 3PYYA 4FOBA 2RG6A 5IQCA 5AV2A 4KKHA 3WYXA 3KVXA 4U79A 5CU6A 3FMMA 1WBOA 2XYUA 2XEYA 3QTXA 4HJOA 4ITHA 4UB7A 2OIQA 2PVMA 3F2NA 3EN5A 3GENA 3SA0A 3U55A 4BR3A 2ZOQA 3BQCA 2BILB 3IW4A 4A06A 1W98A 4RMZA 2WTKB 2C6KA 4YJQA 4N0SA 3IGOA 5AR5A 4AT4A 3PUFC 4D5HA 2WMAA 2YCRA 4YJOA 1HOWA 2YCSA 4I0RA 2C5NA 3V5PA 3CLYA 3FLQA 4JVGA 4DGLC 3BX5A 1FVTA 3UQGA 4YJVA 3HV5A 3PXQA 2QOHA 4QYEA 4BDGA 4CQEA 5DEWA 4EK3A 5IA3A 5IQBA 5J1VA 4HYHA 2WZJA 1CDKA 2J9MA 4E4LA 4GS6A 1IR3A 4O0VA 3F2RA 5CF5A 3DAJA 4CD0A 3AQVA 4RQVA 4C36A 3R63A 4D4SA 4XBUA 4R1YA 3V3VA 2XKEA 3FI3A 3LFEA 1GZKA 4K0YA 5M51A 2F7ZE 3MJ2A 1KE9A 2YDKA 4I20A 4FVRA 3PE2A 4IB0A 4PNIA 4JT3A 4RGJA 5ETCA 4BCKA 4CFUA 4NW6A 5FEQA 3NUYA 4QTBA 5LCKA 4TZRA 4D2PA 3CJGA 3UNZA 4TNBA 1ZY4A 5AADA 2ETKA 3DZOA 4FIFA 4M68A 1YDRE 2PE0A 4MCVA 2RFSA 4AN2A 4EH2A 4FRFA 1H8FA 4AACA 3SW7A 1Q99A 3ITZA 2UZNA 4O0XA 4QTEA 5EH0A 4JG6A 5HE1A 4F1OA 5BX0A 5HTCA 5IQFA 2WOUA 3HA8A 3UMXA 3PIZA 3UDZA 5HLNA 5M56A 2HW6A 5DN3A 4RX8A 2BUJA 3DBFA 3WF7A 4FIGA 5DR9A 3RPVA 4DEIA 1WCCA 3BV2A 3G2FA 2BVAA 3GFWA 5CU2A 5M4UA 4BJJB 3FPMA 4LRJA 1H0VA 3QCSA 2OXYA 4ANNA 1PXNA 4S34A 2PZPA 4RIWB 1SMHA 3TNPC 4AT3A 3BU5A 2JBOA 4MX9A 4IVDA 3GBZA 4O7LA 3FDNA 5HU9A 2UZEA 4UX9A 5DGZA 4FTIA 3UC3A 3COHA 5A14A 4DTAA 3LM0A 3QZHA 5J5SA 3N4UA 3W0QA 5AR7A 3Q2JA 4PP9A 5IA1A 1NW1A 4GK3A 2NO3A 1JAMA 3AMYA 4XG3A 3OOMA 1Q8YA 1JKSA 4TY1A 3HRFA 3PXYA 2BRGA 3ET7A 2ITNA 4O82A 4EC9A 4PL3A 3HNGA 3K54A 3VF8A 3KK8A 3R1QA 5AM7A 3T9TA 2PVKA 2WELA 4ID7A 2C1AA 2H6DA 5JZNA 5L8JA 2JEDA 3N4VA 4ZTNA 3LJ1A 2WFYA 1Y91A 2F2UA 3LFBA 3JVRA 3R71A 3D94A 2X7OA 2OFVA 5CI7A 5LQFA 4GK2A 5T6KA 4PNKA 4Q9ZA 2AQXA 1YI6A 5TT7A 3QKLA 2V5QA 4EUTA 1GZOA 1APME 1REJA 3BE2A 3GC8A 4B8MA 2YM8A 4A4XA 2YWPA 4OTIA 3DTCA 3EJ1A 5JGDA 4LMUA 5L3AA 4O2PA 5A4QA 4RIXA 1Y6AA 2UW5A 4FIEA 4MXOA 3QQFA 5IQEA 5BVNA 4FGBA 2C68A 4MD8E 4GG5A 3TT0A 4DAWA 1CM8A 3FZPA 4LOQA 2ITOA 5HE0A 3WZEA 3QLFA 1KUTA 5JGBA 4ACDA 4FSRA 1IA9A 1W83A 3RNYA 5AA8A 3CY3A 4UWYA 4IAYA 4IB5A 3OT8A 3R8VA 1PRYA 4E1ZA 3FMDA 2BZJA 3PXRA 5ETFA 3DBDA 1MRYA 4ARKA 5HX6A 4AOJA 3G51A 4CRSA 2XK8A 1OIQA 4D5KA 2J2IB 3BCEA 4RBLA 3TJDA 3GUBA 3BIZA 5E8XA 4KB8A 3F5PA 4L7FA 1YXSA 3IONA 4YP8A 4FSQA 4IXPA 3P23A 1F3MC 4CG9A 4ZAUA 3C51A 1MRUA 2HK5A 5CEMA 4H05A 2P2IA 2JC6A 5HIBA 1PXLA 3QTZA 2XCKA 3GNIB 4EK6A 4CKJA 1YQJA 4QP2A 5JFSA 5I9ZA 1HCLA 5HG7A 2PUUA 5C01A 4YNEA 2DS1A 3BU3A 2JFLA 3MYGA 4FTRA 4FKIA 4MNEA 4KD1A 2DWBA 4MAOA 1Z5MA 2W1CA 5IA4A 2WO6A 4PMTA 3S00A 3MFSA 2C6MA 3VUTA 3AGMA 3F3TA 1WBTA 3FY0A 4O4DA 4RVKA 4NW5A 4O4BB 4KSQA 2Q0BA 2YEXA 3FQSA 1MRVA 4DDIA 2QO7A 4UMUA 2LGCA 3NAXA 4WOVA 3K3IA 2XJ2A 2PE1A 3MVHA 2CKPA 4FR4A 2UZBA 2YIXA 3UG2A 1Q3DA 5TO8A 4YPDA 2OICA 3ALNA 5FXSA 2A98A 5I9UA 2I0VA 2FGIA 4L00A 4U8ZA 2W17A 3SX9A 4R7IA 5AUZA 2GS2A 4HNIA 3Q60A 4G3DA 3QBNA 2J50A 2HENA 3EYHA 4MXAA 4BY9E 5F20A 4HOKA 3KA0A 1M52A 2XIRA 1STCE 2GHMA 1MUOA 2VTTA 3C0IA 4KINA 4AQCA 2YAAA 2E9VA 2WQEA 4CQGA 5L6PA 5FUTA 1YXUA 3OHTA 4ANQA 4L3LA 2IN6A 3DAKA 3L9MA 3PJ1A 5CI6A 2Y4IB 3QYWA 5DNRA 5ANJA 4ZLZA 1ZLTA 3E8NA 1VR2A 1H00A 3DK7A 4EOQA 2R0IA 3VUGA 5IEVA 4YJRA 5J9YA 1E1VA 1ZWSA 2QNJA 3PFQA 4ZS4A 2GDOA 4CYIA 3NEWA 1ZMVA 3Q52A 3C5IA 5H8BA 5IA2A 4NZWB 5GJDA 3RCJA 4Q5HA 4D0XA 4WNKA 4F6WA 1YOJA 4CFFA 4CTCA 4OW8A 3I1AA 4F0FA 1KOAA 3FPQA 2W7XA 4NK9A 3F7ZA 2QOOA 3L9NA 3QQKA 4MK0A 5E8UA 4D4VA 2BROA 1AQ1A 2QD9A 3F7WA 5J5TA 3KXXA 5CEOA 2O0UA 3RNIA 4FT3A 4G3GA 3UIXA 4PRJA 3OXTA 4BZOA 3Q9ZA 1OITA 3SXRA 4TPTA 1J1CA 3EIDA 2FH9A 1OMWA 1MQBA 2PE2A 4X6QC 3UNKA 5EQEA 3A2CA 2W99B 5ANEA 2E9UA 4ACGA 3A4OX 3TCPA 5K4JA 5L2QA 3ZBFA 5M4IA 3QRKA 4FTMA 5B2KA 3R7IA 2AC3A 3F3UA 3KMUA 4J7BA 4BCHA 4R5YA 1H1QA 2H34A 3ZEWA 2QR7A 4YSJA 5A54A 5HD4A 1H25A 3FZRA 3RAWA 2J90A 4JOAA 4MD9E 2ITUA 2OH4A 2UW4A 2UVYA 2GFCA 3VVHA 4FKVA 2Y0AA 1G8AA 4O7RA 3ZLXA 3KB7A 1SVHA 4KSPA 4LYNA 2CGWA 3LCSA 3FAAA 5BVEA 4BN1A 2C47A 1JBPE 4JNWA 4RFYA 4WHZA 4XS2A 5FP6A 2X8IA 3TMOA 2VTQA 1KE8A 3P86A 4FV7A 3SVVA 4QEBA 5M55A 4KNBA 3WF5A 4LUDA 4PV0A 2BRNA 2YDIA 2EUFB 3I0OA 4ZY5A 3PIYA 5ANKA 4QRCA 3ZZEA 3KREA 2ZMCA 2HXQA 2CKQA 3P5KA 3QUPA 2F9GA 5CY3A 4ONAA 4DEDA 3UE4A 4WD5A 2C3KA 2BKZA 4ZJIA 3RM6A 3UP2A 4F7JA 2WTIA 4U9AA 5I9WA 1UU7A 4KRDA 3V5QA 1YWRA 3ORNA 3AG9A 3MY0A 5CVHA 3D7ZA 5F95A 4C4HA 4CRLA 3KMWA 4HPUE 4QPAA 3NW7A 3QWJA 4O0WA 3W8QA 1OKVA 2EXMA 3FMJA 2ZV7A 4ZEGA 4K8AA 4FKWA 4J8NA 2YZAA 4HVDA 3BYVA 3FMNA 4C4IA 1TVOA 1OECA 2A19B 3CQEA 3IECA 4LRKA 2ZJWA 2X2KA 2UZWE 3A8XA 1PXIA 5IISA 4FTNA 3MB6A 5CQUA 1E9HA 3BI6A 2R3RA 5DPVA 3VC4A 4M14A 4MXXA 5HIEA 1KOBA 3FMLA 3OTVA 4R3RA 5CU3A 4FE2A 4WNOA 3WZUA 3TTIA 3GEQA 4QTDA 3ZSIA 5ETAA 3LOKA 5EHOA 2EXCX 2VO7A 5DT0A 4EWQA 3QQGA 2NPQA 5AV4A 5H8EA 4C59A 2AUHA 2J4ZA 2QQ7A 3CXWA 3MA3A 2JKOA 3P08A 3P7BA 3RWQA 3S95A 4L43A 5EI2A 1QPCA 3A62A 2P33A 5BUEA 4R5SA 2CNUA 3OS3A 1QPDA 2G9XA 2GPHA 2WD1A 2CNVA 2PWLA 4ZSGA 5KBQA 2Y8OA 4O22A 5B7VA 2PYWA 4NKSA 3IPHA 4C58A 5CXHA 1S9JA 3UO4A 3F5GA 2QHNA 5DLSA 3S1HA 3UQFA 3MV5A 3QRUA 1O9UA 3BLRA 2J0KA 5CVFA 2WTVA 3C0HA 2AYPA 1R0EA 4U81A 3W0SA 4U43A 3U9NA 5E4HA 4MQ1A 2XJ1A 3RPOA 3TV4A 4G16A 4GU9A 4UBAA 3U4UA 4U44A 5CSPA 3QD4A 1Z9XA 3DPKA 3VBWA 4EZ5A 4BCIA 3HA6A 2C5XA 2X4ZA 1GIHA 2W1FA 3R9RA 2OK1A 4AA5A 4EEVA 3EFKA 4IZYA 5KX8A 4O83A 4L8MA 3CC6A 2VWXA 1XHAA 2OG8A 4XLIA 4YNOA 3ROCA 4J52A 4ZS0A 3PFYA 3D5WA 4H1JA 4TRLA 5AV1A 4FMQA 1M14A 1IRKA 5A4TA 4HGEA 4XX9A 1BL6A 3MWUA 3PSDA 4GJ2A 4FTLA 3E63A 4GL9A 4WG5A 3QFVA 3KF4A 3BZ3A 4ANLA 4D55A 3RKBA 4MXZA 4E5WA 5HORA 4UV0A 4HZRA 5CU0A 4XUFA 3QTSA 4FSMA 2BRHA 4XG2A 4Z7HA 2J0LA 2J5FA 3DZQA 4U97A 4FICA 1J91A 5HTBA 2BMCA 1OZ1A 3QLGA 4L46A 3KULB 5CNOA 2PMNX 3U8WA 4E8AA 4G6OA 1UNHA 4L01A 4W8DA 2RGPA 4JDIA 2UZUE 5CLPA 4O81A 4MBJA 3VWAA 4F70A 3AC5A 3JY9A 1PXOA 2ERZE 2XNBA 3E5AA 4MBIA 4RJ3A 3LCOA 3C1XA 5KMOA 1J7UA 3LMHA 4GH2A 1J7LA 3ORZA 4JBQA 2XM9A 3FLSA 1OPJA 2YM5A 4IX5A 2FSLX 4NFMA 4KIQA 4K1BA 2Z7RA 4J8MA 4DINA 3UVQA 5IMEA 3IK3A 5K0KA 2PULA 4N6ZA 1M7QA 5AX9A 5GHVA 4CMTA 4PP7A 2VGOA 2X9EA 4BDKA 3C7QA 2GMXA 3CTHA 4U7ZA 4N57A 4DH7A 4DITA 2O2UA 2OJGA 5JSMA 4U45A 3TUCA 2RIOA 5GIOE 4UYAA 5CXZA 5D11A 3HDNA 4YZMA 3NUSA 4C4JA 3KXGA 5FG8A 4QTCA 4DLJA 4GT5A 4IAZA 4YLJA 4EHEA 3A7GA 3FLNC 4FOCA 2QC6A 4P5ZA 3NNXA 3GOPA 3QX4A 3MIYA 4PMSA 3VQUA 2QOQA 2QOBA 4YPSA 1XMLA 2XNMA 2C0TA 2HY81 4RLLA 3BELA 2BDWA 5I9XA 2FA2A 3LLAA 1PYXA 4B0GA 4BGGA 3GI3A 3DBEA 3G9NA 1YOLA 5CALA 3MBLA 1WMKA 4TYEA 3UO6A 5BMMA 4C38A 4E5BA 1JWHA 2VX0A 4FKGA 2PVNA 3OOGA 3EYGA 3L9LA 1UKHA 3CPBA 2A4LA 4GW8A 1YRPA 5EKOA 4M69B 3ZZWA 5I4NA 3QTWA 1NT2A 2CN8A 3BQRA 3ZC6A 4JR7A 4L67A 5M08A 2QI8A 1ZZ2A 3MTLA 4PMMA 4RIYA 3POOA 2I6LA 3Q53A 4YTFA 4PPBA 3VBQA 2IO6A 4QD6A 1RJBA 4L6QA 2W1EA 3LHJA 3GCUA 4FKUA 4MH7A 3SXFA 1FMKA 5L6OA 4XP0A 3GCSA 3NMUF 5AFVA 4TYIA 2WMSA 2VWVA 1J1BA 5EG3A 2IVTA 2E9OA 4N6YA 1XO2B 1RQQA 5LVNA 4TYGA 2VAGA 4YGAA 2RSVA 1XBAA 3JPVA 5BMSA 4QDEA 3CGOA 5KBRA 4EH3A 5CF6A 5IDPA 3TNQB 5KMJA 5IQHA 4R8QA 5I0BA 1P2AA 1E1XA 1Q61A 4U42A 5HQ0A 1W8CA 2PVRA 3O2MA 4IE9A 3UNJA 2OJFE 3DJ6A 4ALVA 2VWIA 5L8KA 3DXQA 2HAKA 4E6AA 1BYGA 3MB7A 3ORPA 5J8IA 2EB2A 4HGTA 1Q8ZA 1T46A 5AR2A 4S2ZA 3ZU7A 3VUIA 4I23A 3E7OA 3R00A 2XAMA 2JBPA 4NIFA 3NW6A 4FJVA 2B52A 2B9HA 4WG3A 2C6OA 5D1JA 3BYUA 4QMYA 2XKFA 1ZYLA 2QOIA 3TIZA 2BDFA 5FTOA 3KRLA 4CG8A 1ZYJA 2BZHB 1VLRA 2H8HA 5CZIA 4B99A 3CD8A 5CAPA 2R2PA 4MKCA 4O7TA 3G6GA 2PK9A 4ITIA 3QXPA 3EOCA 3QQHA 2I7QA 4U3ZA 3R0TA 2WEVA 1VZOA 2XZSA 2QOFA 4HVSA 5JQ5A 4F9AA 2XUUA 4ERKA 3TKUA 2GSFA 4BWKA 2JITA 4J95A 3OD6X 2IJMA 2ITXA 5HESA 2NYAA 4XP2A 4WRGA 4Y72A 5CT0A 5EI8A 3PXZA 4DBXA 5CWZA 2PVLA 4FYNA 4DTBA 5CU4A 5CEIA 3SXSA 4FTKA 2QKWB 5LMBA 2Q83A 1H26A 3W0RA 4EOJA 3VS2A 4G5PA 4S30A 4OTFA 2W4KA 3ENHA 4LG4A 3CQUA 3LXKA 4X3FC 3U9CA 1YI3A 3I7BA 3ZUTA 1XKKA 4E4NA 5AEPA 2YM7A 3F3VA 2PU8A 2C5VA 5GJFA 4RWIA 4OR5A 3FSKA 4E20A 1YW2A 3HX4A 1WFCA 1YHWA 4IZ5A 3EN9A 3QTIA 3MDYA 4RFMA 4UXLA 4F09A 2YCFA 5AP6A 4TYHA 4K11A 2OLCA 1BI7A 4ZTLA 2CGVA 5HCZA 4QT1A 3P7AA 4K2RA 4TTHB 3EFLA 4BWXA 3U6HA 3NUUA 4MWHA 5DBXA 4KKGA 4UYNA 2HCKA 3FI2A 3QTUA 4RWJA 1HCKA 4EK8A 2BZIB 1EH4A 4ZOGA 4PL5A 4DFYA 1OIRA 3GU7A 4FK6A 5BPYA 4QPMA 3NSZA 4F9BA 3GCQA 4F99A 3QZGA 4XNEA 4FV1A 5C4KA 3ZXZA 4LOPA 3FHRA 2UZDA 2NRYA 4FG9A 4QP6A 5DIAA 4A07A 4CV8A 4WNPA 5CSVA 5IH4A 1PW2A 4DG3E 5K9IA 5BVFA 2G15A 1XJDA 4QMXA 1KV1A 3C4CA 3IDBA 5GJGA 4GG7A 5ITAA 2IW8A 3QRJA 2JAMA 4CT1A 3R8UA 3UZPA 3KIOC 2Y4PA 3DTWA 1W82A 2QOCA 5FM2A 5CAOA 2OZOA 4NU1A 3PXKA 3ODZX 5AP5A 3NW5A 5AV3A 3V6SA 3O8TA 3AD5A 4P90A 1OPLA 4H1MA 3EH9A 3UYTA 2Z7QA 4AZVA 1OL2A 2JKKA 4X3FA 4O21A 3S4QA 3THBA 1F0QA 3AXWA 3CCNA 3VS3A 4LRMA 3ORTA 4EK4A 4PF4A 4CVAA 4YHJA 4CEGA 4YTHA 3MPMA 4WUAA 2UW8A 2JDSA 5BYYA 3ERKA 1PKGA 4ALWA 1DM2A 2JD5A 3D5XA 1XH9A 4QNAA 3OG7A 4D58A 3Q6UA 5A4EA 5J7BA 5M53A 3NVMB 4JL9A 3REPA 1ZYSA 3QU0A 4EH8A 4FV6A 2IZSA 1IG1A 2W96B 4IH8A 4IFCA 2I40A 2BALA 4YLLA 4QMSA 2WNTA 4LI5A 3UJGA 4DN5A 1ZZLA 3UZRA 4KABA 3LXNA 1TQIA 3F61A 4D2TA 2X2LA 2VTRA 5ANOA 2P0CA 4I5HA 1GAGA 3FZSA 3V5WA 4GMYA 3TUDA 4I6FA 4OTDA 4GRBA 4Y5HA 3UOHA 4MTAA 4AA0A 5K0XA 4M15A 5CS6A 5J9ZA 5GZ9A 1QPJA 2VV9A 3DBCA 3ZO4A 2YLFA 4U40A 1ZOGA 4O0SA 3RVGA 4F7NA 3BL9A 3BBWA 4NWMA 5EYCA 3G90X 1B6CB 2E9NA 4M3QA 5EDPA 1SVGA 1YWNA 3ULZA 2XA4A 3QF9A 4AOTA 3W2PA 4AW0A 5KKRB 5AUUA 2P55A 2VTLA 1REKA 4H3BA 5EW3A 5HNIX 1M2RA 2WMWA 5KMLA 4BKZA 5LVOA 4O4EA 3ZFYA 2F2CB 4U80A 1QMZA 2JIUA 3HDMA 2OSCA 4R78A 1FVRA 3HMMA 2B7AA 4NJ3A 2YITA 3OCTA 2WU6A 3A60A 1XH6A 3MH1A 3KMMA 3DDPA 5C26A 3TUBA 1QCFA 4KS8A 4DGOA 3PVBA 4HYSA 2P4IA 2WTCA 1WZYA 4FEWA 2WTDA 3BYOA 5AWMA 4BDFA 2IZUA 3T9IA 3R7VA 4A9UA 4XJ0A 3I7CA 1CKPA 4QP3A 4BCFA 3CS9A 3E88A 1LEZA 3UZTA 4PDPA 3U54A 4JMQA 3MIAA 4DBNA 5HO7A 2XARA 4LGHA 1CKJA 4AQKA 4O0UA 3M1SA 2X0GA 4TWPA 3D0EA 2QVSE 4C02A 4USFA 2UZTA 4YJUA 4M8TA 4IVCA 2VTHA 4ZLOA 1A48A 1KWPA 3RINA 1AD5A 3DLZA 5EM7A 2WQMA 4MBLA 4XG9A 3Q4UA 1TKIA 3FWQA 5JN2A 3EFWA 2VTNA 4B7TA 1U5RA 2IVVA 4H3PA 4DFXE 3H9RA 2O8YA 4KBAA 4RJ4A 1A06A 2B9FA 2YHVA 4I5PA 4M0YA 4ZY6A 4D1ZA 3HAMA 3R1NA 3U51A 5AP2A 4YR8A 5M06A 3COMA 1DAYA 1OVEA 3MFUA 4JAIA 3QKKA 2XNOA 1CSNA 1VEBA 2GNIA 4K33A 2FSTX 5FQDC 3RP9A 2QG7A 4WKQA 3ZRLA 3OW3A 5JFVA 4YJTA 4I6QA 1JKTA 1JVPP 4ZTMA 1R78A 3WE8A 4RA4A 3ZRKA 4GIHA 2WIHA 3OFMA 3KRRA 4Q2AA 3RAIA 2G2HA 1BUHA 3GGFA 3NRMA 3W33A 4JX3A 2CN5A 3D2IA 4KBKA 4QP8A 1FQ1B 1WBWA 3ALOA 4Y73A 2WMTA 5JFWA 2Z7LA 2HWOA 2RFEA 3OBGA 4XG4A 5AIKA 3RK7A 4PTGA 5A3XA 4BDCA 5EM5A 3TKHA 4AXFA 4TL0A 1PJKA 3DAEA 3UVPA 4BIDA 4D1SA 4DGMA 5AR8A 1PXJA 1GIJA 3H9FA 4DG2E 5D9HA 3V8TA 4L68A 3PVUA 4RQKA 4NM7A 4FA2A 3R01A 3WZKA 3H3CA 1H1WA 2OJ9A 3MFTA 1KE6A 3QGWA 2XIKA 4G3CA 3QAME 3FV8A 3NWWA 2HOGA 5HLWA 4LFIA 2C0OA 4M13A 5JEBA 2R7IA 4WSQA 3MS9A 4DEBA 3R9OA 1IAJA 2JFMA 4FSZA 2WKMA 1Q8WA 3MVJA 4K9YA 4BCMA 4YU2A 5ACBC 4AW1A 5IQAA 4IM2A 3E93A 3KRXA 3ZLSA 5EM8A 2R7BA 3BU6A 3HMOA 3PIXA 4DG0E 2J6MA 3KN6A 2V0DA 3D5VA 4JRVA 4KKEA 4O7ZA 2R3HA 4W8EA 3LXLA 4HNFA 3MPTA 5E92A 1OGUA 4NCTC 4AS0A 4GUEA 3DB8A 2VO6A 4HYIA 1H1SA 3EQCA 3NPCA 4E3CA 5E8SA 3EL7A 2J0JA 2XKDA 3NR9A 4ZTSA 1TZDA 3FKLA 5HG8A 4YZDA 4CZUA 3UOKA 2XP2A 3G15A 4W4WA 2OIBA 1F5QA 3AOXA 3EQBA 4FKLA 3BHHA 4IJ9A 5LVLA 4FV5A 4GUBA 4C4FA 4I1ZA 4ASDA 4XRLA 5HTIA 4IIRA 4AGDA 3PZEA 5A46A 4H3QA 3UYSA 3QCYA 4B8LA 4FNZA 3FBVA 5E1EA 4BKJA 4KIOA 2JAVA 1GIIA 3GT8A 3E8EA 4J71A 2HZ0A 3F66A 4M7IA 4FEXA 3OVVA 2R5TA 3VULA 4DEGA 4O0RA 4AFJA 1V0OA 2GTMA 2JKQA 2XM8A 5CZHA 5L6WL 3IW8A 3BLQA 4MEDA 4PL4A 1R3CA 4QYYA 5ACKA 3JYAA 3MVLA 1Q4LA 4KRCA 4JDHA 1PXPA 5HLPA 4MF1A 1OL1A 3TYKA 1Q3WA 3T3VA 3LCTA 3LM5A 5HZNA 3NIZA 2WB8A 4IADA 4ASXA 3SGCA 1R39A 2VWUA 5DE2A 5JFXA 4OBQA 3BEGA 4QTAA 5AUXA 3GCVA 4NTTA 4ZZOA 3Q4CA 4ANOA 2GQRA 4FTAA 5E8ZA 5FD2A 3TI1A 5IQIA 3R8ZA 3WILA 3CP9A 5KCVA 4DLIA 2C0IA 2XBAA 2W5AA 3HV4A 4ITJA 3WI6A 2HZ4A 2B9JA 4I6LA 3CKXA 3RWPA 2QR8A 3M2WA 4K6ZA 2CPKE 4FF8A 3VHKA 3MH3A 3ZXTA 5JT2A 3CSVA 2HIWA 4M97A 4OTQA 1PF8A 4M12A 3CY2A 4RJ6A 4OTGA 4NCTA 5DFPA 4FSYA 3QALE 2WOTA 1CKIA 3KKVA 4AZTA 4AG8A 3PJCA 3QCXA 4EK5A 2WGJA 3R83A 1YXXA 4IX6A 1FMOE 2BCJA 4I93A 5DT4A 4NUSA 2VWYA 4QQ5A 4F9YA 4F9WA 2IVUA 3NZ0A 3R30A 2PMIA 1O6YA 2XS0A 2AC5A 2W9ZB 4AZEA 5JK3A 4I3ZA 3BHYA 2GNHA 4O2ZA 5DWRA 4EUUA 2BHEA 2X1NA 4UN0C 3D5UA 5KE0A 4ZJVA 3OW4A 4FSTA 2CHLA 3ZEPA 4Z7GA 2XCHA 2XVDA 3E62A 3LFSA 4O91A 4FBXA 3EWHA 3W10A 1BL7A 2PPQA 4FTQA 4W4YA 3NGAA 2B55A 2VTIA 4GEOA 5EDRA 1FVVA 4FZ7A 5BQ0A 4F63A 3CPCA