2WTJA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
287
Chain Sequence
MSVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHECKPOINT KINASE 2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 287
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtjA01
2PZRA 1JPAA 2YZAA 3RI1A 4XV9A 3V3VA 1BUHA 4BCIA 5C9CA 4A9TA 3ORKA 5B7VA 3SD0A 1ATPE 1OKVA 4G6NA 4JNWA 5FGKA 5KKRC 4E73A 5AP0A 4C0TA 4DH5A 4RA5A 4CLIA 4QMUA 2ITTA 2YN8A 4JX7A 4C58A 1O6KA 4AACA 1YI3A 3OW3A 3DDPA 5AR8A 5FBNC 1I09A 3FI8A 4ASXA 4D58A 3GXLA 4DFXE 3ENMA 4TYIA 4BDAA 3FXWA 4G16A 4X3JA 1MRYA 1KSWA 2A2AA 4JDHA 2GQGA 2OW3A 2VX1A 3C4ZA 4U8ZA 2YZLA 3MI9A 2JKKA 2WOTA 2Q83A 3P0MA 1ZY5A 4AN9A 4E1ZA 4BY9E 2Y8OA 4O7VA 3FUPA 3LM5A 3MBLA 5AUUA 4CCUA 3S0OA 3ATSA 3S95A 3ZCLA 4CXAA 3UIMA 5I9YA 4AUAA 5HBHA 4KSQA 4FOCA 4OTFA 3WZJA 3P5KA 4QMWA 2YAAA 4OGRA 3PVGA 3Q96A 2BKKA 2HW7A 5HX6A 3SDJA 2I1MA 4I93A 4CT2A 3PLAE 3QFVA 2WQEA 4ZY4A 1HCKA 1UU8A 3GI3A 3RPRA 3F82A 5LCJA 4FZ7A 3ZO4A 3CD3A 4GU6A 4BCJA 1KOBA 1UWJA 4FA2A 4OW8A 1OKYA 2VNWA 4CFVA 2VO3A 3R28A 2WFYA 1Q8UA 4I0TA 4OTWA 4AOTA 5HLNA 3R9RA 1FINA 3KRLA 4L52A 4E4MA 2C6IA 4OR5A 3V5LA 4FC0A 2G2FA 2V7AA 4ASDA 1OI9A 4J8NA 5M4UA 3IOPA 1F0QA 2WQNA 3PVWA 4P7EA 3VBTA 1UU3A 1J1CA 3FL4A 3MY0A 2IVSA 3L9NA 1TKIA 5LJJA 4GYIA 2A1AB 3D7TA 3DTWA 1W82A 4HZRA 5AP2A 2C0IA 4ZJJA 4UALA 1JBPE 2QHNA 2PZYA 2JBPA 4V05A 5JKGA 3ORMA 1GY3A 2PWLA 5B2KA 3DQWA 2C68A 2C5XA 2C47A 3WYXA 4ACDA 4TYHB 2R64A 5AUYA 3QCXA 2WTKC 3NDMA 4I6BA 5HIDA 3FC1X 3D4QA 4R5YA 4K11A 3NEWA 2JAMA 5EYKA 2VWVA 3BHHA 1IRKA 1SVHA 3HA6A 5DWRA 1VJYA 3R71A 3H10A 5CEOA 4X7QA 1J7UA 4LG4A 3N51A 2R3RA 3F9NA 4EH6A 3Q3BA 5EM8A 5HNBA 4ANLA 2YISA 4HOKA 3U4WA 4JDIA 5J7BA 4QTBA 5L6OA 4DITA 2XNPA 2A27A 3CQWA 4WNOA 2OJ9A 4G2FA 4XBRA 5AAEA 2YJRA 1NW1A 3M42A 3VW6A 2QO2A 4F9BA 5A54A 4Z7HA 3TV7A 3CD8A 2VTJA 4V04A 4RFYA 1H28A 5DI1A 4CVAA 2Z02A 3BU5A 2OJJA 3EZVA 3A60A 1XH4A 4FNYA 3TCPA 5C8KA 3ET7A 5AA9A 1JQHA 4FTCA 3PIZA 4QT1A 4AW1A 3LMGA 3QD0A 4J98A 1Q41A 3MVHA 4XEYA 4APCA 3SG9A 2EB2A 1QPDA 3MGYA 4C37A 2FSLX 3MVLA 3QLGA 5KHXA 5LVPA 3ID6C 4N0SA 3ANRA 3NUUA 4NIFA 1E9HA 3WZEA 3ANQA 4CZUA 4FZ6A 3R8UA 2XK3A 3F61A 5CQUA 4NCTC 4AX8A 1L8TA 1YXTA 3B2TA 3QRJA 4JBQA 4GIHA 2B55A 2F7XE 3A7HA 2Y4PA 4CMUA 4EONA 4TY1A 2R3PA 3SOCA 1QPCA 4U40A 4E4XA 5HGIA 3H9RA 3NR9A 4S2ZA 4BIDA 4RFMA 2X6EA 3VS2A 4NWMA 5JGAA 2R4BA 2XEZA 1LP4A 3JPVA 5IQFA 4E5BA 2IZRA 2ETMA 3FMLA 3PY0A 3R04A 4MNEB 5KMJA 4HPUE 3FXZA 4BDHA 4FTUA 4C02A 4U41A 2I6LA 4EI4A 5AA8A 3PY3A 4HYIA 5HIBA 1XBBA 4YLLA 1K3AA 3DS6A 4ZP5A 1O9UA 3E3PA 2GNHA 1Y6AA 4GV1A 5AUWA 3DK3A 4QO9A 3DAKA 2LGCA 3A7IA 1RW8A 3HDMA 4R3RA 2IZUA 4KB8A 4YO6A 4R77A 5KBRA 1I44A 1WBWA 2GU8A 3FHIA 3VF9A 4X6QC 2ITWA 1YHWA 2FSOX 2OH4A 2B53A 3IKAA 4FSYA 3CKWA 2WTVA 3HMPA 3WZDA 4EK5A 4HVDA 3Q2JA 4KABA 3WF8A 3G9NA 5JGDA 5ETFA 2W99B 3LM0A 3UMWA 4HCTA 3R8ZA 3ZFXA 2WPAA 3FYKX 3H9FA 3RM7A 1LEZA 3ZUVA 4MXXA 2YIXA 2PZ5A 3IECA 3BBWA 2QU5A 4IADA 2HXQA 4GIIA 5L6WL 3U9CA 3WBLA 3TZMA 1XBAA 4Z16A 5KNJA 2VTLA 5FDPA 2YCRA 4JBPA 4F0FA 2OLCA 2GS6A 3L9LA 3PA5A 2P33A 1R0PA 3ZBFA 3ORIA 1H1QA 5I4NA 2RKUA 3ZC5A 4U9AA 4BB4A 2ZV7A 2F7ZE 3HUBA 4AE6A 5FRIA 2PY3A 4UWBA 3UVPA 2C5NA 3V5QA 2ERKA 3BZ3A 3LFDA 2YERA 2VTMA 2Z7QA 3R22A 4M7IA 3HP2A 4O91A 4KKEA 3KXXA 2EWAA 4DEBA 1V1KA 1OVEA 5C26A 2XM8A 4BC6A 4CYIA 4PDOA 4TKSA 3EN5A 4O82A 4GK3A 4C62A 1OL1A 1XH5A 3QQKA 3VQUA 2ETKA 4J96A 5CEPA 3Q4TA 3LQ3A 1IR3A 1AQ1A 5KHWA 4CGAA 3NW6A 4ZTMA 2HOGA 2X2KA 4CFUA 2FGIA 3IK3A 4GW8A 4ZTLA 5IQDA 4UXQA 2H9VA 4H3PA 4CEGA 1KE7A 5IA1A 4X21A 4ALVA 4GFOA 3HMNA 3FI4A 4IIRA 4J8MA 4BDJA 4NM5A 5D7AA 4EOKA 4Z55A 1R1WA 4O7LA 3E8NA 4PMTA 4EHEA 2HAKA 4AGCA 5ETCA 4TYHA 5HG9A 3D94A 4M66A 4N4SA 4QMSA 4EZ3A 2SRCA 2X4ZA 3G2FA 4DGGA 3QWKA 1GZ8A 1NT2A 4BDIA 5CSVA 4BHZA 4AT4A 1LUFA 3AC2A 2BROA 4DHFA 3DKCA 2BTRA 5IDNA 3UOKA 4GT5A 5HI2A 3TTJA 1IEPA 2C6EA 3LMHA 1H27A 2VZ6A 3F3UA 3PJ1A 3NIZA 5J95A 2GNIA 5CEKA 3H4JA 3G9LX 2NP8A 5J8IA 3RNYA 5C4KA 5M55A 4YJQA 4QMNA 4R7IA 3NYOA 4MH7A 4RVLA 5GNKA 3S4QA 5HU3A 3NCZA 5L2SA 4O7TA 4IZ5A 4AQCA 5HTCA 3OT3A 4FSTA 2W5BA 4L68A 3TIYA 4BCKA 4LQMA 3FY2A 3DK7A 1REJA 3EFLA 5A14A 4WT6A 5L8JA 2H6DA 1YQJA 2F4JA 5T6KA 3DBEA 3F69A 3PP1A 3V6RA 4NL0A 1IASA 4TYJA 5FP6A 4GS6A 3DB8A 2ERZE 1YHSA 1U4DA 5CT0A 5D1JA 1FMOE 4IJ9A 2OIQA 2O2UA 4HYUA 2PZIA 4LFIA 1PMNA 2BUJA 2JDRA 4RSSA 4U5JA 4HVSA 5J1VA 3QCQA 3DZOA 4OTPA 3EYHA 2BRHA 4R3PA 3ALNA 4FYNA 5GHVA 4Y72A 4D2WA 4J95A 4O7WA 2UW9A 2V7OA 4PTGA 3GUBA 4D2TA 2QLQA 4DEIA 5BQ0A 4FV0A 3IW5A 4FKQA 1OIRA 2VRXA 1KV1A 2B1PA 2B9IA 4LGGA 2WTWA 2B4SB 3MFTA 4UBAA 3DKGA 3FDNA 3GCSA 2FB8A 1IA8A 1Q3WA 4I5CA 5C8MA 3W33A 2HY0A 4FKLA 4G3CA 4MNEA 4FUYA 4N70A 2UZEA 2QOIA 2OF2A 4QYHA 4S33A 4DEHA 4WHZA 5HHWA 3ZTXA 5CASA 2YM5A 3QD4A 5AJQA 3SX9A 3NX8A 2E9NA 5H8GA 1Z9XA 3GCPA 3PXKA 1OPJA 4XG3A 3CR0A 3MIAA 5CXZA 4FODA 3OY1A 1SMHA 3TNWA 3AXWA 4D9TA 4WG5A 1SM2A 2ZYBA 5HLPA 3ULIA 5L6PA 4LL5A 4AZTA 4WO5A 5J9YA 4QP8A 2WMUA 4U43A 5CXHA 2BZHB 4PX6A 1GIIA 4XS2A 4YZBA 3RWPA 4EBVA 1H0VA 4GG5A 1ZOGA 5FDXA 5BUIA 5JZJA 2UZVA 4QNAA 3OT8A 1Y6BA 4DFBA 3LCKA 5I9ZA 4KSPA 4FEXA 3IOKA 1JWHA 2QLUA 4ITJA 3HUCA 4XNEA 3QCSA 2YABA 1CKIA 3EJ1A 4PNIA 3V6SA 3VS7A 3O51A 2P55A 4K2RA 3G5DA 5CZIA 4O83A 3TNPC 3DQXA 3HNGA 2B9FA 4F1TA 1YI6A 2I0HA 3AQVA 4D4SA 5IQEA 2WELA 3TN8A 1M7QA 3CE3A 5EW3A 5HQ0A 4PPAA 4QYYA 4YHFA 3HV7A 3IDPA 3JVRA 2X7GA 4MHAA 2OH0E 3P4KA 3CTHA 4XHKB 3EWHA 3KCFA 3OOGA 4FTRA 3SW4A 3G51A 3QQHA 4CCBA 4O1PA 4NH1A 4MXYA 4LV5A 4I6QA 4F9YA 4AG8A 4L67A 3TUCA 4FEWA 5DRBA 2CCHA 2GNJA 3FPMA 3WZKA 3NWWA 3QQJA 4AS0A 4FICA 2JIVA 4O7ZA 2CGVA 4S32A 1YDTE 4RWLA 5BVEA 3U87A 3ZS5A 4IB3A 4IX5A 5HG7A 4CRLA 3G90X 4YLJA 3POOA 2UVZA 1LPUA 3W2PA 2VWIA 2FSTX 4B0GA 5BUJA 5AV3A 3MA6A 4KAOA 4O0TA 2QU6A 1IAHA 4OBQA 3Q4ZA 4G17A 4FTLA 4AAAA 2JITA 2DYLA 4C34A 3F5UA 3UIBA 3R9DA 4QQ5A 5HVJA 3EFWA 4YBKA 4IMYA 3L8SA 1YW2A 2OFUA 4EK6A 3FAAA 4DBNA 5DLSA 4RJ4A 4XP0A 5CU2A 3KXHA 4R1VA 2ZV9A 5IDPA 3PXYA 4XG6A 1MQ4A 3PG3A 5HTBA 2XF0A 3B8RA 3IS5A 3UQGA 5JQ5A 2X81A 3QAME 3O17A 3C0HA 5HE2A 5DEWA 4GUEA 4KIQA 3VBXA 2XRUA 3BHUA 3TKHA 3A4OX 3KA0A 3QX4A 3AD5A 1PW2A 3FEGA 1NVRA 4FGBA 5CU6A 2WMTA 4QPSA 2JDSA 5IZFA 2XJ0A 3R2BA 3KCKA 4R3CA 3JYAA 4FSZA 5L8LA 4CG9A 3QTUA 1H4LA 4H58A 2F7EE 1XWSA 1S9JA 3KGAA 4E5WA 5GZ9A 3ORLA 3AC1A 1Q61A 3E8CA 4F0GA 4U45A 4YJTA 3TJDA 1ZY4A 5BVNA 2W4KA 1O6LA 5M53A 3TM0A 4FNWA 1J3HA 4MVFA 1OM1A 3ZMMA 4L01A 4L46A 3HAMA 4EOQA 2CGXA 1JSUA 2C6DA 2XIKA 4EC8A 3KXMA 2P4IA 4JVGA 1XH7A 4AW5A 2QOLA 3VIDA 1GZKA 5M57A 3CY3A 4ONAA 5AADA 4DCAA 2VGOA 2IZSA 5AMNA 2GNFA 5CYIA 4ZTRA 2OK1A 3CS9A 5JSMA 2E9VA 2HXLA 5ANJA 3FZPA 4F6SA 3TDVA 3B2WA 3E5AA 1DI8A 5CLPA 1MP8A 5DNRA 2Y4IB 4AOJA 4FKTA 4DH8A 4F65A 5FXRA 5H3QA 4ERKA 2Z60A 4L6QA 5AP5A 4J1RA 1HCLA 3GCQA 4WSQA 4U80A 4TNBA 4MQ1A 4W4YA 4CTCA 3W8QA 4NM0A 2JKOA 3MVJA 3L8XA 2OJIA 1H0WA 5JQ8A 3AG9A 2DS1A 5IMXA 4LMNA 4ACCA 4FSRA 4OT5A 5AUZA 3MN3A 4MBJA 3PRFA 2UZUE 3OEZA 1BI8A 4RX7A 5DGZA 2QKWB 2WIPA 4QTCA 4CKJA 5BVDA 1NVQA 3MSSA 2V22A 3PZEA 4FTJA 4XP2A 3DA6A 3UVQA 2W1HA 2CNUA 3GEQA 2WU6A 2Z8CA 3TDWA 2XH5A 4UY9A 1OB3A 4AT5A 3MY5A 3F5GA 5E9EA 4G3GA 2WU7A 4JRNA 4H1JA 4YTHA 1JKSA 2BMCA 4FVPA 4HGLA 2JDTA 4JRVA 1B38A 3FL5A 3A8WA 3ZLXA 4E93A 3QKLA 4M8TA 5HORA 3SXFA 3VULA 2WMRA 3PG1A 1CDKA 4YU2A 5CSWA 1DS5A 4WNMA 4W9WA 4RFZA 2C3JA 1URWA 4H36A 3VAPA 1P14A 2UUEA 4FV3A 2HZNA 4M15A 3ZUUA 3KVXA 5L4QA 3HECA 1BL7A 2BRBA 4RT7A 4EOJA 1A06A 4ORKA 3UPZA 3P7AA 2IPXA 1A9UA 2XUUA 4CFMA 4HYSA 3FZOA 3LLAA 1FPUA 1UKIA 5HE0A 3W10A 2P2HA 4FSQA 2C3IB 5TR6A 4AFEA 3HRFA 2RGPA 5E1SA 4XX9A 3SQQA 5FTOA 3OEFX 4FIGA 4FV2A 5HO7A 4L3PA 4LOPA 4AZSA 4F64A 4QP9A 3FMDA 4HVGA 3R8MA 1MUOA 5HG8A 4RBLA 5BNJA 4JIKA 4OTRA 5IH5A 5FBOA 5FEEA 3MESA 3ZSGA 4X2NA 2QONA 5I3OA 3BCEA 1Y8GA 2J50A 3HL7A 2HELA 2C1BA 2HYYA 2VAGA 4FT3A 1WBNA 2RIOA 1F3MC 3FQEA 2VWYA 3KL8A 4GYGA 4JS8A 3UIUA 3BHVA 2J0MB 3F3TA 2BILB 3ZEPA 3W55A 3KXZA 3LLTA 5B0XA 4IB5A 4PUZA 3RK7A 3VS5A 5IA4A 5IQHA 3DBDA 4FVQA 4ZSAA 3TNIA 2IW8A 4LL0A 4IDVA 4ZTSA 1LEWA 4FKWA 3NPCA 1WVWA 4A4XA 2UVXA 4YJPA 1QL6A 2FSMX 3PJCA 3VS1A 4BGQA 3JY9A 3S00A 2R3MA 4WRGA 5AR7A 1URCA 3BE2A 3HZTA 3BX5A 3EIDA 5BMSA 3BPRA 3QYZA 2PVMA 4J99A 4RIXB 4XV2A 4C33A 3R01A 4FV8A 4O6EA 5IUIA 3FKOA 4YNEA 1QPEA 3SOAA 4QYFA 3ZO3A 3D7TB 4GT4A 2UZOA 2C3KA 2XNGA 1JKLA 1U5RA 2FO0A 3VS0A 1FMKA 2KTYA 4P4CA 2ONLA 3CBLA 3QD2B 3VC4A 4HCVA 4ZJIA 2XM9A 3TL8A 2VWBA 2W7XA 3SW7A 1YOLA 2G1TA 1FVVA 3HLLA 4ZY6A 4R1YA 2OO8X 4K18A 3O50A 3N9XA 3JXWA 3QRIA 2R3GA 2CN5A 4QD6A 5TKDA 3NYXA 4FEUA 4QMMA 4GL9A 5AUXA 1Q8TA 3ORPA 3MB7A 4YC6A 2QURA 5IKWA 2VV9A 3DDQA 2CKOA 2I0YA 4W8EA 4UZDA 4X2GA 5D7VA 3H9OA 3QRKA 2XCHA 4AN3A 2YEXA 5AP3A 4R8QA 5IEYA 4TNDA 1YXUA 2XYNA 4KS8A 2QO9A 5J87A 4BDCA 3D9VA 5LMBA 5HKMA 1BKXA 3NCGA 3CP9A 4RQKA 4F9CA 2JIUA 3KK8A 3UGCA 4ACGA 2X8IA 5AR3A 5L3AA 4M69B 4Y95A 5EKNA 4LGHA 4C7TA 2J0LA 3OFMA 5AM7A 2XNBA 4JIAA 5CU0A 2X2MA 2Z7SA 4NU1A 3RZFA 3CPBA 5FTQA 2W1ZA 3E3BX 3VRYA 2AC3A 5LVMA 1PMVA 2F2UA 4DH1A 3BQRA 5F1ZA 3EHAA 3NAYA 5A3XA 1Q3DA 4YTCA 2W1DA 1RE8A 4H05A 2VD5A 3DU8A 3T8OA 4RA4A 2HIWA 3HV5A 3QQUA 4ACHA 3DGKA 3FHRA 3ZC6A 4KRDA 5KMIA 4OTQA 4QP7A 1PJKA 4J52A 3ROYA 3BYVA 2H96A 4JLCA 3K5VA 4ZMEA 3LMIA 4UMPA 2QOCA 2WXVA 3QUEA 5K3YA 4M0ZA 4FSWA 2PVHA 2PVNA 2J9MA 3QZHA 4NKSA 4NJDA 3C50A 2W5HA 3DFCB 4YTFA 3KFAA 1WBTA 1ZOEA 5C01A 4DH7A 2J0KA 4F7JA 4LOOA 4NYEA 3LQ8A 5JFSA 3OXTA 4FV7A 2XA4A 4YHJA 4BVUA 3FZTA 1Q8WA 4TTHB 1E1XA 5LMKC 4L44A 4ZZMA 1RQQA 4C4FA 3CLYA 3R02A 1VYWA 4FIFA 4KKHA 4TRLA 4YPDA 5AM6A 4E26A 3QTWA 4CRSA 4EWQA 5HBJA 3GENA 3MTLA 4UMRA 4IC8A 4BTJA 5LCKA 3LE6A 3VQHA 2UW0A 4FV9A 3VHKA 2XRWA 4FUXA 3BYMA 5EI8A 4FTNA 4CV9A 1Q8YA 1YXSA 5CI7A 4MWIA 3W32A 4DN5A 4BCFA 3TNQB 2Z7RA 5FG8A 4FX3A 5HICA 4E4LA 5A4EA 2PMIA 2YWPA 2PULA 5DHJA 2ZB1A 4RMZA 4D5KA 1QCFA 5FXQA 2IN6A 3QGWA 4WKQA 5IQCA 3HVCA 4IANA 4YPSA 4I24A 5D12A 2C3LA 4CQGA 3I6UA 2UW8A 3PFQA 3ZXZA 3ELJA 2R3LA 3V04A 4GKIA 4IBMA 4ZS4A 3PP0A 2J6MA 4DGMA 1B39A 3JS2A 4ASEA 4AZEA 1APME 2RFNA 3ORNA 1JKKA 5D9HA 1Y91A 2QKRA 4FT0A 5FD2A 2QOHA 1SNXA 4WUNA 1T46A 2CPKE 3R1NA 3VUDA 2JDVA 3V5TA 3VJNA 3Q6UA 1BX6A 2W05A 3JVSA 4YJNA 1YWVA 4EOLA 5KMKA 3QHRA 4FG8A 2J5FA 2GMXA 1VYZA 3F88A 3QUDA 1GOLA 2XB7A 4KA3A 4O27B 4IFGA 5EYMA 4BI2A 3FKNA 2GSFA 3MB6A 3R73A 4D4YA 4RIXA 4O86A 2XIYA 4CLJA 3UOJA 4BTKA 2R3FA 4BHNA 1WCCA 3D5UA 5AV0A 3U4UA 4CQEA 4EQMA 4AFJA 1YDRE 3FC2A 4PMMA 3VF8A 4C57A 4F0IA 3ZYAA 3V5PA 4I4FA 5F94A 5KMNA 2V55A 3K54A 5G6VA 3JY0A 4BDFA 5EQPA 3OTVA 1U59A 3SLSA 3P1AA 3VBVA 4IEBA 2CGUA 4IQ6A 4QTEA 4RVKA 4JOAA 4C3RA 4YSMA 4ZSGA 1H01A 2WB8A 5JZNA 3I0OA 4FKOA 1ZWSA 3GQLA 3QZGA 2R7IA 2W0JA 5BUEA 1PF8A 4GRBA 3C9WA 2YIYA 3I81A 4NZWB 5AR4A 4E8AA 3KKVA 2ITZA 5AR5A 3RNIA 2HWOA 3COHA 3WE4A 3HP5A 4RC4A 3FZ1A 4DC2A 4NFNA 4O7RA 3BBTB 4UB7A 5I5ZA 4AXAA 1V0OA 2B7AA 1Y57A 5CVGA 3GQIA 3OXIA 3RBWA 3CC6A 3OROA 4FV5A 3R21A 4M69A 3ZH8A 4AWIA 5DT3A 3LCDA 3UOLA 3HEGA 2WIHA 2ITVA 3G0EA 2CN8A 1PXPA 2XNNA 5AP4A 2XJ2A 4BDBA 4D55A 4PPCA 4ZIMA 2C5VA 4JXFA 4EYJA 1OZ1A 3MA3A 4G5JA 4ALUA 2W1CA 3PTGA 1CKPA 3GCUA 5HVKA 1R3CA 2BDFA 3P7BA 3PVBA 3TI1A 4GMYA 2BZJA 3FV8A 4G3EA 3BELA 4FIEA 3P79A 4PL5A 4U6RA 2JGZA 3D5WA 5E8XA 4NM3A 4XLVA 5EM7A 1H00A 2R0UA 4Y83A 3ZO1A 3G15A 2BIYA 4NEUA 4KIKB 3SVVA 3D5XA 4WSYA 4R7HA 5C03A 4RLLA 2BPMA 2X9FA 3IQ7A 3I60A 4JG7A 3UJGA 5T68A 3MFSA 5ITAA 4CFFA 2RSVA 3R9HA 4BICA 3WILA 5FTGA 3NNUA 3RKBA 2B9HA 4EKKA 3E8EA 2ITUA 4L7SA 2C6OA 4BCHA 4EHGA 3LFEA 5A4QA 1TQIA 3FLQA 2GTNA 3AOXA 3DLZA 3EN9A 3RINA 3AGLA 1H1WA 1T45A 4CG8A 2NPQA 4A9YA 3Q60A 4L53A 4FT5A 2WTDA 3EQGA 4J97A 4IW0A 4IE9A 4E6QA 3P78A 4ZSJA 2Y7JA 4M13A 3V8SA 4BBMA 4BBEA 3LJ1A 2R3OA 1PHKA 4AGWA 5E92A 2XEYA 2VX0A 2EXMA 3GC7A 2XNMA 3KN5A 4FV6A 4MNFA 3DKFA 1EH4A 2J2IB 5JFVA 3RMFA 5E4HA 3RPOA 2W9FB 3OZ6A 2WKMA 3E92A 4RWKA 4KIOA 3PPJA 2BRGA 5M4FA 1PRYA 3DLSA 2ZDTA 2Y9QA 3V01A 3N4VA 4MWHA 2XKEA 4YP8A 2WO6A 5EG3A 3EN6A 3PSCA 5DR9A 3UVRA 3MDYA 4D2VA 3GU4A 2X1NA 4IH8A 5DFPA 2V62A 4F1OA 4W4XA 5HNIX 2REIA 3OWKA 3ORTA 4DYMA 1OPLA 3AT2A 5EM6A 5M56A 5DT0A 4O21A 3MIYA 2I0VA 3AMBA 5KZIA 2QODA 2BCJA 3A2CA 4QRCA 2XYUA 1G5SA 1OL7A 3HYHA 2UW3A 3KK9A 4JT3A 2ACXA 4UEUA 2ZMDA 3QD3A 5HBEA 4XOYA 4FIJA 2KULA 4XBUA 3RVGA 5EYCA 4E20A 3C5UA 4IWDA 5KO1A 3F6XA 4JJRA 5D10A 4X2FA 4Y5QA 2ZV8A 2J5EA 3C7QA 4G1WA 4D2SA 4X3FB 5KE0A 4D28A 1VEBA 3FQSA 1YI4A 3OS3A 4RWJA 3R7YA 4FI1A 1CTPE 2BFYA 1H08A 2QOQA 2VTAA 3C4WA 5HESA 3PRIA 5HD7A 3WARA 2XCKA 2W06A 4WNKA 4YTIA 4OTGA 4FKJA 3GOPA 5LOHA 3UMXA 5AX9A 4I23A 3F3ZA 5I9XA 4BR3A 3SV0A 4FKIA 4DFYA 3PA3A 3HDNA 3TACA 3AD6A 4C2WA 4O2PA 2RL5A 4FSMA 5J9LA 3MH2A 4G31A 4KINA 4YJUA 3TG1A 4DFZE 4DFUA 4MF1A 3I0QA 5FLFA 2OZAB 4H39A 4UWYA 2VTHA 3ZLSA 1K2PA 4FKRA 4C36A 4KUJA 2FA2A 2ZM4A 3TJCA 1OL5A 4Z7GA 4LV8A 5JEBA 3Q32A 3LIJA 3R1QA 1H24A 3NNVA 4C8BA 3R1YA 5HO8A 3RK5A 5JK3A 1R78A 3S1HA 3BWJA 5HTIA 4FTKA 3C13A 3ZEWA 3PXQA 2RFEA 4ZS0A 2E9UA 4MD8E 3VBQA 3GU5A 4JDKA 4BTFA 5M06A 3QC9A 4GK2A 2IZTA 4M68A 1OKWA 4PDSA 3R7EA 2VN9A 3BQCA 4A9UA 4AZVA 3OCSA 3R8PA 4AOIA 1SVGA 3OCTA 4P90A 4TXCA 2LAVA 3DAEA 3NIEA 3BI6A 4DEDA 3BGZA 5AUTA 5ETAA 4WIHA 2BIKB 1G8AA 1GAGA 2BDJA 2JFMA 3ZDUA 1GJOA 3KF7A 2NRUA 3ZFMA 4BKYA 2YHVA 3O71A 4YGAA 4CKIA 5J79A 4AP7A 4RJ8A 2GS2A 3OW4A 4JBOA 3AC8A 2AC5A 5JT2A 4Q5EA 3KEXA 4IVBA 4AA4A 4RVMA 5IEVA 1H1RA 3DY7A 3DFAA 5EKOA 4NKAA 4UXLA 3K3JA 3WYYA 1ZMWA 4KIKA 3CKXA 3NS9A 5CVHA 5CSPA 3BRBA 2PE1A 3WI6A 3SC1A 3ZLWA 4XG2A 3UPXA 4F99A 5LXMA 1NXKA 1BI7A 1UKHA 1MRVA 2UV2A 4RWIA 3FMNA 3FPQA 3TNHA 4J7BA 5H9BA 5IPJA 3ZZWA 3OY3A 5LARA 5DVRA 3ITZA 5DRDA 4GJ3A 2F2CB 2YJSA 3C1XA 1X8BA 2BAQA 5CS6A 3TV6A 4F7NA 4EHZA 5M07A 4O0XA 4AGDA 4B99A 3OBGA 3ZXTA 3R7OA 4F1MA 3KRWA 3OUKA 5EI2A 4ALWA 4IAFA 3OTUA 3FE3A 4NSTA 5DH3A 2VU3A 2WTIA 4TL0A 2G2HA 1P5EA 2IVTA 4RJ3A 3O96A 5CF5A 3R30A 1JOWB 4CSVA 2AUHA 4R5SA 3IGOA 3BYUA 3LJ0A 1PXOA 3DBCA 3QU0A 4A9SA 4JI9A 1OBDA 3CSVA 2YCQA 1XQZA 2ZM3A 4QMPA 4ZAUA 4RRVA 4YJVA 4ZTHA 4J71A 3MPAA 4ZY5A 2WTCA 3KY2A 3TWJA 3LZBA 4L00A 3BV2A 4QTAA 3NW7A 3ERKA 5EHLA 4MBIA 4FIHA 2BHHA 3F2AA 2GDOA 2XJ1A 3NRMA 4G3FA 4K0YA 3MH1A 2W17A 2XK6A 2O8YA 4IHPA 4N6ZA 4P2KA 3ORZA 3GCVA 5IUGA 3MH0A 3R9OA 3B8QA 4LRMA 4HZSA 4QMOA 3NYVA 5AIRA 2HK5A 2ITQA 4EH7A 4DFLA 2BALA 1M7NA 4AT3A 3Q53A 5A6OA 4MQ2A 4I5PA 3TTIA 5TE0A 1QPJA 2VWXA 3ZU7A 4EK3A 4TWOA 5G1XA 4DGNA 2J4ZA 2ETRA 2ITNA 4RX9A 3PDTA 2GFSA 3SG8A 3Q4UA 5DN3A 3ZM9A 2W9ZB 3DXPA 3QBNA 4KNBA 3RTPA 4QMTA 3NUYA 4X3FA 4U3ZA 4IX3A 5EM5A 3ROCA 2YM8A 3DB6A 4I6HA 3RZBA 2GPHA 4ZZNA 3LW0A 2H34A 3OC1A 4U79A 2PVJA 3MVMA 4F63A 3N4UA 4BDGA 1OBGA 4RIYB 1XHAA 2CCIA 3DCVA 1YOMA 4DH3A 4D1SA 1J91A 2UW5A 3LCSA 5CU3A 1ZRZA 4FGRA 2ZB0A 3H3CA 3AC3A 2C0TA 1FGIA 4IAIA 4ZLOA 1FVTA 4LI5A 3REPA 4CZYB 1ZYLA 5HE3A 5IA2A 2HW6A 2XNEA 3W2SA 2OIDA 3MWUA 4UMTA 1KOAA 2O5KA 4G9RA 3THBA 2BZIB 3UG2A 4QQCA 2E2BA 2OZAA 4BBFA 4O96A 4YO4A 3DXQA 2XBAA 3ZZEA 5CAUA 5BPYA 5A4CA 4PDYA 5CF4A 4EOMA 4OAUC 3T3UA 3L9MA 3OD6X 3KXNA 3ZHPC 2G15A 3LHJA 3QHWA 5IH6A 4I6FA 3CJGA 3FLZA 3KXGA 5E8TA 2WQOA 1KE8A 4ANQA 4F7LA 5CEMA 5IU2A 1PMUA 2PE0A 4JL9A 2PVFA 2CNQA 3NAXA 4I0SA 5LVLA 4EH4A 2C6LA 5AR2A 2VO0A 4FZFB 4Y5HA 3ZLYA 1G3NA 5HCZA 4TN6A 4RLKA 2XIRA 4MKCA 5IA3A 2XK8A 5GZ8A 2DUVA 2VWWA 4DGLC 2QR7A 2R3QA 4IZ7A 1FOTA 4JQ8A 4XYFA 4IVDA 3DPKA 5CTPA 5FM2A 2UW4A 3LFFA 4U7ZA 5EDQA 3PJ3A 5LVOA 2BZKB 2QOOA 4TWNA 2YITA 3EFJA 5CNOA 5BVFA 3KU2A 4OTDA 5EHYA 5DR6A 2GS7A 4OAVB 4QPMA 4AZWA 2WOUA 4BRXA 4BKZA 4W8DA 3RCDA 4RQVA 1KWPA 2YM6A 4E6CA 4MTAA 3TKIA 1XO2B 4N57A 4KD1A 2NO3A 3EQPA 4I5HA 4FKUA 3DZQA 3KMMA 2VWZA 3R2YA 4V0GB 5ACKA 3WE8A 4RG0A 4IB1A 3ZUTA 1E1VA 4M0YA 4ANBA 2H8HA 4ARKA 3F3VA 2WMBA 4FSUA 4C4IA 3HAVA 4FKVA 1J7LA 2JBOA 4I5MA 1YDSE 3A7GA 3I1AA 3ULZA 3C4EA 1PYXA 1PXIA 2X2LA 4FNXA 4GSBA 4ZSLA 2OG8A 4EZ7A 3DK6A 2VTQA 3K3IA 5FWKK 4YC8A 1SZMA 3TKUA 3FLYA 3RAWA 4AW0A 4F9WA 5J7HA 4DCEA 5IF1A 3DBFA 3HRBA 3LOKA 4BYJA 5AAGA 4Q2AA 3ORXA 3QWJA 2C5OA 4D2PA 4PTCA 1F5QA 4GCJA 2W96B 5DE2A 2ZAZA 2C4GA 3QALE 4AN2A 5CSHA 1GZOA 2W1EA 1PY5A 1KE6A 2YCFA 3KREA 1PXJA 2F57A 3PJ8A 4K1BA 3RK9A 3P08A 5CI6A 1BLXA 1FQ1B 2I0EA 2FYSA 3R0TA 3O0GA 4IAZA 2UZNA 4U42A 5K5XA 3PE2A 3AC4A 3EYGA 3FZRA 4C3FA 3Q5ZA 2IVUA 2XNOA 2ZVAA 4I4EA 4FNZA 1ND4A 1NA7A 2GQRA 5JRSA 5ANKA 3KRJA 3D83A 3Q9ZA 4A7CA 5DT4A 4YJSA 1PMEA 2WD1A 4NTSA 2QG5A 5DIAA 3W2RA 4B7TA 4MD7E 4QQJA 3VW8A 3D2IA 3P86A 5E91A 5GJDA 3PWDA 4G6LA 3QQGA 5AP6A 1YXXA 4PL4A 2JKQA 4EJ7A 3EKKA 4EEVA 4KKGA 3NZ0A 2XBJA 4ID7A 2J0IA 3NLBA 4O0YA 3FLNC 3QUPA 5CX9A 5GJGA 2EU9A 4TZRA 2OXDA 3DJ5A 3CXWA 3UO4A 3OCGA 5AWMA 2WHBA 3AGMA 3BGQA 3BHTA 3R00A 3QRUA 4C4EA 2VO7A 2BAJA 2OI4X 3PIYA 4EC9A 2WMVA 3OHTA 4L8MA 4I21A 4FT9A 3PPZA 3LFSA 3FJQE 4MXZA 1YKRA 4EH9A 4KBCA 1WBVA 2Q0BA 3IW4A 4Z9LA 3IW6A 3SKCA 1YWNA 3E87A 3BU3A 3BYSA 4HJOA 2UZDA 4LUDA 1PKGA 4QYGA 4U81A 4RIYA 4X6RA 5CANA 2CLXA 1ZARA 3NNXA 4D1XA 4QP4A 3ATTA 2QCSA 2VUWA 4IWPA 4BCGA 5I9VA 5H8BA 3QC4A 5K9IA 2UZTA 2ZV2A 2NNWB 4FTAA 3PJ2A 4L45A 5DEYA 4O0SA 5M09A 3PZHA 4ITIA 4K33A 3TIZA 2G2IA 3VO3A 3LJ2A 5FEQA 3GC0A 3QTIA 2QI8A 5ANEA 3ZRLA 3BLQA 3G0FA 2X8DA 3IDCA 2CKQA 4EH5A 2XKDA 4NJ3A 1GIHA 4PMPA 4BCOA 5M44A 5KCVA 4ENXA 4FL3A 4QMVA 3PLSA 5F95A 2PSQA 2JLDA 3LFAA 4QP1A 5AP7A 4DT9A 4EOIA 4DF3A 5TF9A 3DNEA 3FMKA 1Z57A 3MPTA 4GG7A 5L8KA 4FSNA 4C3PA 4HNIA 3EOCA 5DMZA 2O0UA 3LFQA 3PSDA 4DEEA 3VHEA 2BAKA 4O7YA 4ZTQA 4PPBA 2WMWA 4Y85A 4DEGA 4C4GA 2HZ4A 1ZMVA 2GHMA 3KN6A 4FEQA 3HV3A 5D11A 2YCSA 5K5NA 3N4TA 3CCNA 2VNYA 3WF6A 4B6LA 3VBYA 4E3CA 5HIEA 5J1WA 1W98A 1ZYJA 1UNLA 4YJRA 2WEIA 4EH8A 1H25A 4FIIA 3EQRA 2VTTA 3E7VA 2A0CX 5K4JA 5CALA 4O7NA 3NGAA 2C1AA 2YDIA 3ZDIA 4NCTA 3VUHA 4EOOA 2BRNA 3NW5A 4QYEA 4BIEA 3OG7A 3PY1A 4HPTE 3BEGA 4XG4A 4XV1A 3RWQA 5HCXA 3VN9A 3A99A 3TUBA 3U6HA 4HCUA 2PUUA 5F9EA 4CV8A 5C4LA 4ANNA 4NT4A 3GT8A 4FL2A 3DXNA 1WZYA 1WBOA 3W2OA 2GNGA 3C51A 4LM5A 4QMXA 4BYIA 3EQCA 1JSTA 3BEAA 4IWOA 3UOHA 4JR3A 4V0GA 3FMMA 3UBDA 3MFUA 3JR1A 4D9UA 4ITHA 3Q52A 4M14A 3VUTA 4D0XA 4DG3E 3R83A 1XBCA 5ICPA 1REKA 3QA8A 4WG4A 4RPVA 4DGOA 4ZJVA 4UZHA 2JFLA 2QO7A 3OBJA 4H3QA 2B54A 1S9IA 1KV2A 4A07A 5FUTA 3MS9A 3ETAA 3M11A 4IWQA 1GIJA 2XMYA 4WA9A 4FMQA 2OF4A 3FWQA 3IW8A 4O0VA 4V01A 4E6DA 4AA5A 1W0XC 3ZSIA 5EW8A 3QQLA 3MYGA 2YIRA 3DJ6A 1VZOA 3QTQA 3T3VA 3COKA 3LQ5A 2B52A 3Q9XA 4QOXA 2YACA 3FSKA 4U3YA 4U44A 5EOLA 4USFA 3SHEA 1H1SA 3QL8A 4I0RA 2ZOQA 2VX3A 4A4LA 3PUPA 1OKZA 3RPSA 1KUTA 3DT1A 3Q9WA 5M4IA 2XIZA 2O3PA 3IG7A 2PUNA 2FUMA 5JMSA 2YM7A 4FOBA 4BI0A 3OWLA 1OL6A 3LFCA 4GEOA 4D0WA 3UNJA 4MYGA 3CY2A 3MTFA 5IQGA 4F9AA 3TV4A 2IW6A 4GFGA 3A62A 4HVIA 2GHGA 2QNJA 4XUFA 3HMMA 3QX2A 4XRJA 1UU9A 2BRMA 4EYMA 1Y8YA 1ZYSA 4YLKA 2PK9A 5IQBA 5FQDC 3CTQA 2YFXA 3GVUA 3R1SA 4GJ2A 4IZAA 5LWNA 1M2QA 4IB0A 4NM7A 3NUAA 2OGVA 4YR8A 2VTOA 4I92A 4KWPA 3COIA 3UNKA 3UP7A 4GFMA 3R7IA 4BWKA 3ZM4A 3EL8A 1BYGA 4DLJA 4C61A 1W84A 4CMTA 4BI1A 2X39A 4BGHA 2ITXA 4R7BA 3FYJX 5E7RA 5HCYA 4EUUA 3U6IA 2ZM1A 1J7IA 1H07A 5CU4A 5KMLA 4YURA 4M12A 4O0RA 5K4IA 3NNWA 2EXCX 2PZPA 2ZJWA 2YWVA 5EQEA 2EVAA 2R3KA 3C4CA 1NY3A 5L2TA 3QXOA 1W8CA 3WF5A 2BKZA 3I7BA 3WIGA 4BN1A 3O8TA 4PWNA 3ZBXA 2ITYA 1ZMUA 2J51A 3FLWA 5E8ZA 3E88A 3OUNB 3ZRMA 2ITPA 5A46A 5DBXA 3WIKA 2O65A 3F3WA 3L9PA 2O64A 1SVEA 3KVWA 2R3IA 2I40A 4IZYA 4RGJA 4XG8A 3UP2A 4IM0A 5CY3A 3OXZA 4EOPA 2X0GA 4PV0A 3BLRA 2IJMA 2R2PA 4KBAA 4OTHA 4XLIA 2WMAA 1Q97A 5E8UA 4C38A 4FTOA 2RFSA 4NW6A 2B9JA 3BWFA 2X7FA 5AAFA 4BFMA 4QMQA 3V8WA 4LOQA 4BWPA 1WBSA 2BHEA 5CENA 4E6AA 2HENA 3GGFA 5E1EA 1G8SA 2YIWA 5IQIA 1UWHA 4FTMA 5GJFA 4DG2E 5IH4A 2HCKA 4YZCA 1XH8A 4JG8A 4USEA 5B2LA 4GU9A 4XCUA 1JKTA 5EDPA 4ZSEA 4NK9A 3D0EA 4FZAB 3OF0A 5IMEA 5GIPE 4FK3A 2UVYA 2A19B 5HX8A 1DI9A 1RDQE 2OU7A 2OZOA 2RF9A 3KC3A 1H26A 3ACKA 2RG6A 3QZFA 3ZSHA 4G9CA 3GU6A 3W2CA 2J7TA 5F20A 1JLUE 3GU7A 3UO5A 4BF2A 4R78A 4RJ5A 2P0CA 3R9NA 3FZSA 3RAKA 4YC3A 1M2RA 1M14A 4QP6A 1JNKA 5KX8A 4FYOA 4DINA 3UYSA 3EH9A 3L1SA 5AEPA 4F6UA 4DG0E 3Q9YA 3CIKA 3Q2MA 4GKHA 3KMUA 4HYHA 5AFVA 2J0JA 2C5YA 5CAQA 4O1OA 4YMJA 3LPBA 1Q4LA 4FVRA 5KZ0A 3L8VA 2PL0A 3IW7A 4I20A 4JG6A 3NVMB 3OOMA 2QD9A 1AD5A 3PE1A 3HMIA 2Z2WA 3Q4CA 4YSJA 4K6ZA 4EK4A 1OITA 2QQ7A 3LAUA 4YUQA 4EUTA 3HV4A 4W4WA 3QLFA 2ONLC 3F66A 2WZJA 4DFNA 4UMUA 4ERWA 2HY81 3E8DA 1U54B 2R3JA 2XS0A 5C8NA 4BCNA 3I5NA 2ZDUA 4OTIA 2XK9A 3O8UA 4HW7A 4K9YA 5E8SA 1YOJA 3Q6WA 4B4LA 4GH2A 3QYWA 5HZNA 4C35A 2IG7A 3W1FA 1FGKA 4PMSA 4XMOA 2HZ0A 4QMZA 1QMZA 4E7WA 5AX3A 3PSBA 1PXNA 3MFRA 3RM6A 3VNTA 1WMKA 2QOFA 5DYJA 4X2KA 2Y4IC 3MV5A 3M1SA 2G9XA 3SAYA 3GB2A 3ZRKA 1WBPA 4II5A 5I9UA 4RZVA 4BWXA 4JX3A 4ZMFA 1KE5A 3EZRA 3UTOA 4JBVA 2EB3A 5EW9A 4IX4A 4BZNA 1R0EA 4L43A 3SA0A 3QCYA 2B0QA 3F7ZA 3E62A 4H3BA 4OLIA 5LMAA 1ZZLA 3QQFA 4BIBA 4CNHA 3P23A 5ANOA 3QRTA 5I3RA 3EQBA 4GT3A 2Z7LA 5GINE 2OSCA 3K2LA 5ETIA 2C6MA 4FKGA 2A4LA 2WMSA 1XH6A 3ACJA 5GZAA 2WMXA 4S34A 1U46A 5A4LA 1DAYA 3TT0A 4CMOA 4EJNA 2CGWA 2ESMA 2QR8A 4FG7A 2YLFA 4N6YA 3Q5IA 4EQCA 3FLSA 4CYJA 5AIKA 3BU6A 5FEDA 3KRRA 5H8EA 4Z3VA 3UODA 4BTMA 3UC4A 4PRJA 5JGBA 3FMEA 4EORA 3AMAA 2QHMA 3DV3A 4EOSA 3KMWA 3QKMA 4PTEA 4A06A 5J5TA 4MXAA 2W5AA 3KRXA 2PVLA 3PXFA 1OUKA 2BDWA 2PMNX 1H8FA 3V5JA 4FV4A 3R7VA 2UW7A 4WRSA 4CFXA 4O84A 3E63A 4O22A 2GFCA 1XH9A 2JDOA 3E93A 4M84A 2UZLA 1FVRA 5H2UA 5ANDA 3PYYA 1UV5A 4RX8A 1YHVA 3RPVA 1KE9A 4KIPA 1P4OA 5IG1A 4UMQA 3U6JA 3V51A 3U51A 3R8VA 3A4PA 3CPCA 4PNKA 5CF8A 2YM4A 4QMYA 1UNGA 3PWYA 4XH6A 3DTCA 3EKNA 4OBPA 4EHVA 3O8PA 3AD4A 3UYTA 3NUNA 3QTXA 2X8EA 1ZYDA 4BZDA 4RC3A 5GIOE 1UNHA 3H0ZA 3ODZX 4NTTA 3W8LA 4JQ7A 2PHKA 3QTSA 4KS7A 3UQFA 4YZNA 5CT7A 4HGTA 4ZLYA 3UO6A 5EYDA 1ZLTA 4MK0A 5HLWA 1WAKA 3DAJA 4F70A 3S2PA 4FKPA 3C0IA 4RIWB 3BIZA 1RJBA 1ZYCA 2RG5A 1DM2A 3LXLA 3OWPA 3MH3A 5E8WA 4NFMA 4W9XA 5JRQA 1STCE 2XKCA 4M97A 1Q24A 2BFXA 4PF4A 1SYKA 4EH3A 3FKLA 3QKKA 3SGCA 3GOKA 3SXSA 3AC5A 3QXPA 4F7SA 3AMYA 2Q0NA 3HMOA 2ZMCA 4EK8A 3HX4A 3CJFA 3FMJA 4DAWA 4CT1A 3A61A 4X2JA 3U8WA 5CAOA 5BVOA 1Q8ZA 5D41A 3FBVA 4H1MA 4K8AA 4DTBA 3TZ7A 3IGGA 2WMQA 4B9DA 4RJ7A 3R6XA 4MXOA 5EK7A 4I3ZA 3VS3A 5J5SA 3V5WA 4IAYA 1OPKA 4FZDB 4LRKA 3F5PA 4UN0C 3E7OA 3EL7A 2VGPA 2PMOX 3G33A 3GNIB 4YZ9A 2J90A 1U54A 2PTKA 3FSFA 3GU8A 4MD9E 4XV3A 5KUPA 4CD0A 3V8TA 4TWCA 3KQ7A 3FI3A 1V0PA 4BDEA 5IEXA 1ERKA 2YM3A 2C6KA 5KMOA 2PUIA 5KKRB 4L3LA 3VRZA 4DTAA 4UV0A 2P3GX 5EQYA 3O2MA 3JUHA 4FEVA 2E9PA 3HGKA 2CMWA 5DG5A 3CQEA 3I4BA 3VS6A 4PL3A 2CHLA 4JAIA 3SRVB 3BGPA 5CSXA 2VWUA 4K77A 3BKBA 4B8LA 2BTSA 3QTZA 5A6NA 1H1PA 3EQDA 3BLHA 4QP2A 5BYZA 5M4CA 3R7GA 2OIBA 4EH2A 1PXLA 3MJ1A 2FH9A 2C69A 4IFCA 4XG7A 5CZHA 5DA3A 2F9GA 3RAHA 5KBQA 2ITOA 3ZOSA 4D1ZA 3D14A 2O63A 1LR4A 4GVAA 3CQUA 4IX6A 2AYPA 5FP5A 4KBKA 4ANSA 4D4VA 3ZFYA 3FMHA 1M52A 2OXXA 3DJ7A 4F4PA 4L3JA 3OMVA 1R39A 4YHTA 3UZTA 5HOAA 3HRCA 3NUPA 5M51A 4EBWA 4EL9A 2PE2A 1XR1A 2JD5A 3SXRA 4G3DA 2R3HA 3A7FA 4ASZA 3FY0A 2GHLA 1OUYA 4JR7A 5HG5A 4BCPA 1M2PA 2QOKA 3UZRA 1OIUA 1ZOHA 2XK4A 4AF3A 5F4NA 3L8PA 2VTIA 5BYLA 3UG1A 3TEIA 4USDA 4O81A 4AA0A 4DTKA 2IWIA 4MAOA 3WF7A 3O7LB 4LRJA 4IC7A 4ZK5A 5HU9A 3PXRA 4BDDA 4FKSA 5IA0A 4FK6A 3QF9A 1ZZ2A 4IDTA 3EB0A 5ACBC 5CAPA 3LXPA 2OKRA 3NSZA 4RJ6A 3LKMA 3I79A 1SNUA 4ZZOA 4D2RA 1YRPA 4O0UA 3BV3A 2OJFE 2C0OA 2UW6A 3VUKA 3D7ZA 1GZNA 2R0IA 2QOBA 4DEAA 2X6DA 4QMLA 3F5XA 2OBJA 2IW9A 5TO8A 2PVRA 3TZ8A 1YVJA 2WTKB 4HVHA 4WG3A 3EMGA 5BX0A 2VTRA 1WVYA 2E9OA 2EXEA 4QTDA 4FE2A 1CKJA 3CGFA 4HNFA 4C59A 2W4OA 3NUXA 4I94A 4QNYA 3HV6A 4WNPA 2HZIA 4XRLA 3EQHA 4FTTA 3VJOA 5C1QB 1ZXEA 4R6VA 5IISA 3M2WA 4ENYA 2VO6A 3PIXA 5EHOA 4HGSA 5LQFA 5JN2A 4IVCA 3LCOA 4RIWA 2WTJA 3VUIA 4BCQA 4WBOA 4LMUA 3H30A 1W83A 3OCBA 4I22A 2OXYA 3COMA 4ACMA 4IAKA 3RP9A 4IAAA 5CF6A 5A4TA 4XP3A 4PQNA 1OMWA 1UVRA 3BE9A 4ZXTA 5L2IA 4MF0A 1PXKA 4DLIA 4YZMA 2FVDA 3F2RA 4WOVA 4EQUA 1BL6A 1XJDA 2NRYA 2XVDA 3O23A 3PVUA 4LGDA 4MEDA 4UYNA 4G5PA 4JAJA 3RJCA 5HE1A 4A4OA 4D4RA 2WQMA 3W2QA 3OVVA 5L2QA 2PYWA 3TXOA 5I0BA 4NW5A 4JDJA 1WVXA 5HD4A 4F09A 3BYOA 2OICA 4TW9A 4TWPA 5BVKA 2JC6A 4O7SA 3I5ZA 3I6WA 3D15A 4LUEA 3IONA 4BGGA 3QA0A 1PXMA 5HNGA 2XP2A 3GBZA 4L42A 1IG1A 4LYNA 4EKLA 2F49A 4PP7A 3MJ2A 2WQBA 2CJMA 3RPYA 3U9NA 3GP0A 3R63A 5ANGA 3ZO2A 4AW2A 2JAVA 5E8YA 4RC2A 3UZPA 2R3NA 2JIIA 3W18A 5CEQA 2JEDA 4DBXA 2DQ7X 1L3RE 3DBQA 3A7JA 3UIXA 3S3IA 3D5VA 3EFKA 4P5QA 3BHYA 3QZIA 5FXSA 3LXNA 5TOZA 4BKJA 5EOBA 1U5QA 4NUSA 5E8VA 3UC3A 2VTPA 5LMKA 3SRVA 3C0GA 3RALA 5J9ZA 1IA9A 2PVYA 2YDJA 5LWMA 4UWCA 5AV1A 2WEVA 4ZOGA 4S30A 2UZBA 3I7CA 1OGUA 1Q5KA 1OL2A 1M17A 1CMKE 4AE9A 2X4FA 3NYNA 2CKEA 2WAJA 2YAKA 4YJOA 2CKPA 3LVPA 3NUSA 2BVAA 2CSNA 4IVAA 4M3QA 3A8XA 2BR1A 2PVKA 1Q62A 5BVWA 4BZOA 5C27A 3POZA 5BMMA 3UQCA 5DOSA 5CAVA 4PY1A 5CQWA 3GFEA 3W16A 4O38A 5K0XA 3PA4A 3U54A 2XK7A 1MQBA 2C30A 4O6LA 3K5UA 4BL1A 3G6GA 4DT8A 2Y6OA 1K9AA 3C4XA 1MRUA 3C4FA 4IJPA 4W4VA 3KULB 3WF9A 3FI2A 3TZ9A 3ENHA 2P2IA 2YIQA 4GVJA 3U55A 3CTJA 3G6HA 4Y46A 5CNNA 5AV4A 4TYGA 5T3QA 2R7BA 1IAJA 4FG9A 1B6CB 4D5HA 3VWAA 4ANOA 3OP5A 3MW1A 1OIQA 2OFVA 3P9JA 4QPAA 4WUAA 3R8LA 3UDBA 2XZSA 2W1IA 4YNOA 2G01A 4B8MA 1CM8A 4OUCA 2RFDA 4RVTA 2PMLX 1O6YA 3E64A 3RAIA 1V0BA 3NMUF 3P7CA 3WOWA 4E5AX 3AT4A 3ODYX 3NVKI 4J53A 1JAMA 1TVOA 4Y8DA 3UE4A 5A9UA 2W1FA 4CKRA 2GQSA 3OWJA 4AGUA 4FTQA 1P4FA 5CVFA 3QGYA 4I41A 3GFWA 4ZLZA 4OBOA 4TT7A 3FQHA 4U97A 3IO7A 2Y6MA 5K0KA 4QQTA 5TT7A 3UNZA 2R5TA 5HVYA 4FBXA 2PUPA 1A48A 5E90A 4CFWA 4U0IA 4XG9A 4C4HA 2PU8A 4IM3A 5JFWA 2V0DA 3ALOA 3IDBA 4JQEA 3IPHA 4F08A 3EQIA 2YLEA 3RCJA 4A9RA 1W7HA 1OECA 3HA8A 5JFXA 3EN4A 4BCMA 2X7OA 1UA2A 4DA5A 3KF4A 1DAWA 3O7LD 4FTIA 2GCDA 4OT6A 2I7QA 3D2KA 4GUBA 2CNVA 4YZDA 3LFNA 1TQMA 4Q5HA 5EDRA 2OJGA 5IQAA 1PYEA 4FV1A 1WFCA 2HWPA 3T9IA 4RX5A 5IUHA 4FT7A 3VBWA 3PXZA 3DOGA 1BMKA 4TYEA 2IVVA 5HO6A 1VR2A 5DPVA 4ANMA 4FF8A 1XKKA 5DR2A 4MX9A 5ANIA 5B2MA 4UX9A 1FBNA 2W4JA 1HOWA 1OIYA 1P2AA 3PPKA 4G34A 2GNLA 4RZWA 4XOZA 3VS4A 4E4NA 1YWRA 4X3FC 2R9SA 4C4JA 3TUDA 4Q9SA 2PPQA 2IO6A 2V5QA 3EN7A 3DKOA 5FM3A 4CFNA 1JVPP 2WGJA 1NVSA 3VUMA 1CSNA 3AT3A 1PKDA 3GC8A 3RGFA 4C2VA 4MXCA 4APPA 3ZONA 5I9WA 4G6OA 4FR4A 5BYYA 4PDPA 2GTMA 1TQPA 5IA5A 1Q99A 3LXKA 1YXVA 4ZTNA 3QTRA 4L7FA 4MBLA 5AUVA 3T9TA 4X0MA 4CTBA 3RHKA 5HEZA 2C6TA 3WZUA 3R7UA 3EQFA 4XJ0A 1Z5MA 3VVHA 2W1GA 3DNDA 2VTSA 3LCTA 4Y73A 3KB7A 2QVSE 5EH0A 4WBBB 4RIOA 4WD5A 1AGWA 3II5A 1J1BA 2YDKA 4YBJA 4MCVA 4FL1A 1ZAOA 4IACA 4HGEA 4IXPA 4QP3A 5LVNA 4AZFA 3C5IA 2YA9A 5M08A 4PP9A 3CEKA 2CLQA 4GK4A 5CWZA 4UYAA 2XIXA 2X9EA 5AV2A 1JSVA 3GC9A 2UZWE 4L9IA 3LFBA 1UU7A 4F6WA 3MPMA 3Q04A 4I1ZA 4ZEGA 5EFQA 3H0YA 2OWBA 4BDKA 2EUFB 3FXXA 4O0WA 5CEIA 3F7WA 4EWHA 5JH6A 4IM2A 3MY1A 2JKMA 3F2NA 2QG7A 4NIFB 4EZ5A 4Q9ZA 5AP1A 4O2ZA 3HKOA 2DWBA 2QC6A 5EI6A 2Y0AA 3RHXA 5KMMA 1GNGA 4DE4A 4P5ZA 2VTNA 4KRCA 2WNTA 3KULA 2XKFA 4AU8A 4CZTA 5L2WA 3CGOA 3VUGA 2CDZA 4M67A 4S31A 4TPTA
chains in the Genus database with same CATH superfamily
2PZRA 1JPAA 2YZAA 1TFFA 3RI1A 4XV9A 3V3VA 1BUHA 4BCIA 5C9CA 4A9TA 3ORKA 5B7VA 3SD0A 1ATPE 1OKVA 4G6NA 4JNWA 5FGKA 5KKRC 4E73A 5AP0A 4C0TA 4DH5A 4RA5A 4CLIA 4QMUA 2ITTA 2YN8A 4JX7A 4C58A 1O6KA 4AACA 1YI3A 3OW3A 3DDPA 5AR8A 5FBNC 1I09A 3FI8A 4ASXA 4D58A 3GXLA 4DFXE 3ENMA 4TYIA 4BDAA 3FXWA 4G16A 4X3JA 1MRYA 1KSWA 2A2AA 4JDHA 2GQGA 2OW3A 2VX1A 3C4ZA 4U8ZA 2YZLA 3MI9A 2JKKA 2WOTA 2Q83A 3P0MA 1ZY5A 4AN9A 4E1ZA 4BY9E 2Y8OA 4O7VA 3FUPA 3LM5A 3MBLA 5AUUA 4CCUA 3S0OA 3ATSA 3S95A 3ZCLA 4CXAA 3UIMA 5I9YA 4AUAA 5HBHA 4KSQA 4FOCA 4OTFA 3WZJA 3P5KA 4QMWA 2YAAA 4OGRA 3PVGA 3Q96A 2BKKA 2HW7A 5HX6A 3SDJA 2I1MA 4I93A 4CT2A 3PLAE 3QFVA 2WQEA 4ZY4A 1HCKA 1UU8A 3GI3A 3RPRA 3F82A 5LCJA 4FZ7A 3ZO4A 3CD3A 4GU6A 4BCJA 1KOBA 1UWJA 4FA2A 4OW8A 1OKYA 2VNWA 4CFVA 2VO3A 3R28A 2WFYA 1Q8UA 4I0TA 4OTWA 4AOTA 5HLNA 3R9RA 1FINA 3KRLA 4L52A 4E4MA 2C6IA 4OR5A 3V5LA 4FC0A 2G2FA 2V7AA 4ASDA 1OI9A 4J8NA 5M4UA 3IOPA 1F0QA 2WQNA 3PVWA 4P7EA 3BLAA 3VBTA 1UU3A 1J1CA 3FL4A 3MY0A 2IVSA 3L9NA 1TKIA 5LJJA 4GYIA 2A1AB 3D7TA 3DTWA 1W82A 4HZRA 5AP2A 2C0IA 4ZJJA 4UALA 1XMMA 1JBPE 2QHNA 2PZYA 2JBPA 4V05A 5JKGA 3ORMA 1GY3A 2PWLA 5B2KA 3DQWA 2C68A 2C5XA 2C47A 3WYXA 4ACDA 4TYHB 2R64A 5AUYA 3QCXA 2WTKC 3NDMA 4I6BA 5HIDA 3FC1X 4O4EA 3D4QA 4R5YA 4K11A 3NEWA 2JAMA 5EYKA 2VWVA 3BHHA 4F78A 1IRKA 1SVHA 3HA6A 5DWRA 1VJYA 3R71A 3H10A 5CEOA 4X7QA 1J7UA 4LG4A 3N51A 2R3RA 3F9NA 4EH6A 3Q3BA 5EM8A 5HNBA 4ANLA 2YISA 4HOKA 3U4WA 4JDIA 5J7BA 4QTBA 5L6OA 4DITA 2XNPA 2NYAA 2A27A 3CQWA 4WNOA 2OJ9A 4G2FA 4XBRA 5AAEA 2YJRA 1NW1A 3M42A 3VW6A 2QO2A 4F9BA 5A54A 4Z7HA 3TV7A 3CD8A 2VTJA 4V04A 4RFYA 1H28A 5DI1A 4CVAA 2Z02A 3BU5A 2OJJA 3EZVA 3A60A 1XH4A 4FNYA 3TCPA 5C8KA 3ET7A 5AA9A 1JQHA 4FTCA 3UDTA 3PIZA 4QT1A 4AW1A 3LMGA 3QD0A 4J98A 1Q41A 3MVHA 4XEYA 4APCA 3SG9A 2EB2A 1QPDA 3MGYA 4C37A 2FSLX 3MVLA 3QLGA 5KHXA 5LVPA 3ID6C 4N0SA 3ANRA 3NUUA 4NIFA 1E9HA 3WZEA 3ANQA 4CZUA 4FZ6A 3R8UA 2ZFYA 2XK3A 3F61A 5CQUA 4NCTC 4AX8A 1L8TA 1YXTA 3B2TA 3QRJA 4JBQA 4GIHA 2B55A 2F7XE 3A7HA 2Y4PA 4CMUA 4EONA 4TY1A 2R3PA 3SOCA 1QPCA 4U40A 4E4XA 5HGIA 3H9RA 3NR9A 4S2ZA 4BIDA 4RFMA 2X6EA 3VS2A 4NWMA 5JGAA 2R4BA 2XEZA 1LP4A 3JPVA 5IQFA 4E5BA 2IZRA 2ETMA 3FMLA 3PY0A 3R04A 4MNEB 5KMJA 4HPUE 3FXZA 4BDHA 4FTUA 4C02A 4U41A 2I6LA 4EI4A 5AA8A 3PY3A 4HYIA 5HIBA 1XBBA 4YLLA 1K3AA 3DS6A 4ZP5A 1O9UA 3E3PA 2GNHA 1Y6AA 4GV1A 5AUWA 3DK3A 4QO9A 3DAKA 2LGCA 3A7IA 1RW8A 3HDMA 4R3RA 2IZUA 4KB8A 4YO6A 4R77A 5KBRA 1I44A 1WBWA 2GU8A 3FHIA 3VF9A 4X6QC 2ITWA 1YHWA 2FSOX 2OH4A 2B53A 3IKAA 4FSYA 3CKWA 2WTVA 3HMPA 3WZDA 4EK5A 4HVDA 3Q2JA 4KABA 3WF8A 3G9NA 5JGDA 5ETFA 2W99B 3LM0A 3UMWA 4HCTA 3R8ZA 3ZFXA 2WPAA 3FYKX 3H9FA 3RM7A 1LEZA 3ZUVA 4MXXA 2YIXA 2PZ5A 3IECA 3BBWA 2QU5A 4IADA 2HXQA 4GIIA 5L6WL 3U9CA 3WBLA 3TZMA 1XBAA 4Z16A 5KNJA 2VTLA 5FDPA 2YCRA 4JBPA 4F0FA 2OLCA 2GS6A 3L9LA 3PA5A 2P33A 1R0PA 3ZBFA 3ORIA 1H1QA 2XAMA 5I4NA 2RKUA 3ZC5A 4U9AA 4BB4A 2ZV7A 2F7ZE 3HUBA 4AE6A 5FRIA 2PY3A 4UWBA 3UVPA 2C5NA 3V5QA 2ERKA 3BZ3A 3LFDA 2YERA 2VTMA 2Z7QA 3R22A 4M7IA 3HP2A 4O91A 4KKEA 3KXXA 2EWAA 4DEBA 1V1KA 3AKKA 1OVEA 5C26A 2XM8A 4BC6A 4CYIA 4PDOA 4TKSA 3EN5A 4O82A 4GK3A 4C62A 1OL1A 1XH5A 3QQKA 3VQUA 2ETKA 4J96A 5CEPA 3Q4TA 3LQ3A 1IR3A 1AQ1A 5KHWA 4CGAA 3NW6A 4FJVA 4ZTMA 2HOGA 2X2KA 4CFUA 2FGIA 3IK3A 4GW8A 4ZTLA 5IQDA 4UXQA 2H9VA 4H3PA 4CEGA 1KE7A 5IA1A 4X21A 4ALVA 4GFOA 3HMNA 3FI4A 4IIRA 4J8MA 4BDJA 4NM5A 5D7AA 4EOKA 4Z55A 1R1WA 4O7LA 3E8NA 4PMTA 4EHEA 2AEGA 2HAKA 4AGCA 5ETCA 4TYHA 5HG9A 3D94A 4M66A 4N4SA 4QMSA 4EZ3A 2SRCA 2X4ZA 3G2FA 4DGGA 3QWKA 1GZ8A 1NT2A 4BDIA 5CSVA 4BHZA 4AT4A 1LUFA 3AC2A 2BROA 4DHFA 3DKCA 2BTRA 5IDNA 3UOKA 4GT5A 5HI2A 3TTJA 1IEPA 3W0RA 2C6EA 3LMHA 1H27A 2VZ6A 3F3UA 3PJ1A 3NIZA 5J95A 2GNIA 5CEKA 3H4JA 3G9LX 2NP8A 5J8IA 3RNYA 5C4KA 5M55A 4YJQA 4QMNA 4R7IA 3NYOA 4MH7A 4RVLA 5GNKA 3S4QA 5HU3A 3NCZA 5L2SA 4O7TA 4IZ5A 4AQCA 5HTCA 3OT3A 4FSTA 2W5BA 4L68A 3TIYA 4BCKA 4LQMA 3FY2A 3DK7A 1REJA 3EFLA 5A14A 4WT6A 5L8JA 2H6DA 1YQJA 2F4JA 5T6KA 3DBEA 3F69A 3PP1A 3V6RA 4NL0A 1IASA 4TYJA 5FP6A 4GS6A 3DB8A 2ERZE 1YHSA 1U4DA 5CT0A 5D1JA 1FMOE 4IJ9A 2OIQA 2O2UA 4HYUA 2PZIA 4LFIA 1PMNA 2BUJA 2JDRA 4RSSA 4U5JA 4HVSA 5J1VA 3QCQA 3DZOA 4OTPA 3EYHA 2BRHA 4R3PA 3ALNA 4AXFA 4FYNA 5GHVA 4Y72A 4D2WA 4J95A 4O7WA 2UW9A 2V7OA 4PTGA 3GUBA 4D2TA 2QLQA 4DEIA 5BQ0A 4FV0A 3IW5A 4FKQA 1OIRA 2VRXA 1KV1A 2B1PA 2B9IA 4LGGA 2WTWA 2B4SB 3MFTA 4UBAA 3DKGA 3FDNA 3GCSA 1TZDA 2FB8A 1IA8A 1Q3WA 4I5CA 5C8MA 3W33A 2HY0A 4FKLA 4G3CA 4MNEA 4FUYA 4N70A 2UZEA 2QOIA 2OF2A 4QYHA 4S33A 4DEHA 4WHZA 5HHWA 3ZTXA 5CASA 2YM5A 3QD4A 5AJQA 3SX9A 3NX8A 2E9NA 5H8GA 1Z9XA 3GCPA 3PXKA 1OPJA 4XG3A 3CR0A 3MIAA 5CXZA 4FODA 3OY1A 1SMHA 3TNWA 3AXWA 4D9TA 4WG5A 1SM2A 2ZYBA 5HLPA 3ULIA 5L6PA 4LL5A 4AZTA 4WO5A 5J9YA 4QP8A 2WMUA 4U43A 5CXHA 2BZHB 4PX6A 1GIIA 4XS2A 4YZBA 3RWPA 4EBVA 1H0VA 4GG5A 1ZOGA 5FDXA 5BUIA 5JZJA 2UZVA 4QNAA 3OT8A 1Y6BA 4DFBA 3LCKA 5I9ZA 4KSPA 4FEXA 3IOKA 1JWHA 2QLUA 4ITJA 3HUCA 4XNEA 3QCSA 2YABA 1CKIA 3EJ1A 4PNIA 3V6SA 3VS7A 3O51A 2P55A 4K2RA 3G5DA 5CZIA 4O83A 4DHJA 3TNPC 3DQXA 3HNGA 2B9FA 4F1TA 1YI6A 2I0HA 3AQVA 4D4SA 5IQEA 2WELA 3TN8A 1M7QA 3CE3A 5EW3A 5HQ0A 4PPAA 4QYYA 4YHFA 3HV7A 3IDPA 3JVRA 2X7GA 4MHAA 2OH0E 3P4KA 3CTHA 4XHKB 3EWHA 3KCFA 3OOGA 4FTRA 3SW4A 3G51A 3QQHA 4CCBA 4O1PA 4NH1A 4MXYA 4LV5A 4I6QA 4F9YA 4AG8A 4L67A 3TUCA 4FEWA 5DRBA 2CCHA 2GNJA 3FPMA 3WZKA 3NWWA 3QQJA 4AS0A 4FICA 2JIVA 4O7ZA 2CGVA 4S32A 1YDTE 4RWLA 5BVEA 3U87A 3ZS5A 4IB3A 4IX5A 5HG7A 4CRLA 3G90X 4YLJA 3POOA 2UVZA 1LPUA 3W2PA 2VWIA 2FSTX 4B0GA 5BUJA 5AV3A 3MA6A 4KAOA 4O0TA 2QU6A 1IAHA 4OBQA 3Q4ZA 4G17A 4FTLA 4AAAA 2JITA 2DYLA 4C34A 3F5UA 3UIBA 3R9DA 4QQ5A 5HVJA 3EFWA 4YBKA 4IMYA 3L8SA 1YW2A 2OFUA 4EK6A 3FAAA 4DBNA 5DLSA 4RJ4A 4XP0A 5CU2A 3KXHA 4R1VA 2ZV9A 5IDPA 3PXYA 4XG6A 1MQ4A 3PG3A 5HTBA 2XF0A 3B8RA 3IS5A 3UQGA 5JQ5A 2X81A 3QAME 3O17A 3C0HA 5HE2A 4O4DA 5DEWA 4GUEA 4KIQA 3VBXA 2XRUA 3BHUA 3TKHA 3A4OX 3KA0A 3QX4A 3AD5A 1PW2A 3FEGA 1NVRA 4FGBA 5CU6A 2WMTA 4QPSA 2JDSA 5IZFA 2XJ0A 3R2BA 3KCKA 4R3CA 3JYAA 3UDSA 4FSZA 5L8LA 4CG9A 3QTUA 1H4LA 4H58A 2F7EE 1XWSA 1S9JA 3KGAA 4E5WA 5GZ9A 3ORLA 3AC1A 1Q61A 3E8CA 4F0GA 4U45A 4YJTA 3TJDA 1ZY4A 5BVNA 2W4KA 1O6LA 5M53A 3TM0A 4FNWA 1J3HA 4MVFA 1OM1A 3ZMMA 4L01A 4L46A 3HAMA 4EOQA 2CGXA 1JSUA 2C6DA 2XIKA 4EC8A 3KXMA 2P4IA 4JVGA 1XH7A 4AW5A 2QOLA 3VIDA 1GZKA 5M57A 3CY3A 4ONAA 5AADA 4DCAA 2VGOA 2IZSA 5AMNA 2GNFA 5CYIA 4ZTRA 2OK1A 3CS9A 5JSMA 2E9VA 2HXLA 5ANJA 3FZPA 4F6SA 4LV7A 3TDVA 3B2WA 3E5AA 1DI8A 5CLPA 1MP8A 5DNRA 2Y4IB 4AOJA 4FKTA 4DH8A 4F65A 5FXRA 5H3QA 4ERKA 2Z60A 4L6QA 5AP5A 4J1RA 1HCLA 3GCQA 4WSQA 4U80A 4TNBA 4MQ1A 4W4YA 4CTCA 3W8QA 4NM0A 2JKOA 3MVJA 3L8XA 2OJIA 1H0WA 5JQ8A 3AG9A 2DS1A 5IMXA 4LMNA 4ACCA 4FSRA 4OT5A 5AUZA 3MN3A 4MBJA 3PRFA 2UZUE 3OEZA 1BI8A 4RX7A 5DGZA 2QKWB 2WIPA 4QTCA 4CKJA 5BVDA 1NVQA 3MSSA 2V22A 3PZEA 4FTJA 4XP2A 3DA6A 3UVQA 2W1HA 2CNUA 3GEQA 2WU6A 2Z8CA 3TDWA 2XH5A 4UY9A 1OB3A 4AT5A 3MY5A 3F5GA 5E9EA 4G3GA 2WU7A 4JRNA 4H1JA 4YTHA 1JKSA 2BMCA 4FVPA 4HGLA 2JDTA 4JRVA 1B38A 3FL5A 3A8WA 3ZLXA 4E93A 3QKLA 4M8TA 5HORA 3SXFA 3VULA 2WMRA 3PG1A 1CDKA 4YU2A 5CSWA 1DS5A 4WNMA 4W9WA 4RFZA 2C3JA 1URWA 4H36A 3VAPA 1P14A 2UUEA 4FV3A 2HZNA 4M15A 3ZUUA 3KVXA 5L4QA 3HECA 1BL7A 2BRBA 4RT7A 4EOJA 1A06A 4ORKA 3UPZA 3P7AA 2IPXA 1A9UA 2XUUA 4CFMA 4HYSA 3FZOA 3LLAA 1FPUA 1UKIA 5HE0A 3W10A 2P2HA 4FSQA 2C3IB 5TR6A 4AFEA 3HRFA 2RGPA 5E1SA 4XX9A 3SQQA 1ST4A 5FTOA 3OEFX 4FIGA 4FV2A 5HO7A 4L3PA 4LOPA 4AZSA 4F64A 4QP9A 3FMDA 4HVGA 3R8MA 1MUOA 5HG8A 4RBLA 5BNJA 4JIKA 4OTRA 5IH5A 5FBOA 5FEEA 3MESA 3ZSGA 4X2NA 2QONA 5I3OA 3BCEA 1Y8GA 2J50A 3HL7A 2HELA 2C1BA 2HYYA 2VAGA 4FT3A 1WBNA 2RIOA 1F3MC 3FQEA 2VWYA 3KL8A 4GYGA 4JS8A 3UIUA 3BHVA 2J0MB 3F3TA 2BILB 3ZEPA 3W55A 3KXZA 3LLTA 5B0XA 4IB5A 4PUZA 3RK7A 3VS5A 5IA4A 5IQHA 3DBDA 4FVQA 4ZSAA 3TNIA 2IW8A 4LL0A 4IDVA 4ZTSA 1LEWA 4FKWA 3NPCA 1WVWA 4A4XA 2UVXA 4YJPA 1QL6A 2FSMX 3PJCA 3VS1A 4BGQA 3JY9A 3S00A 2R3MA 4WRGA 5AR7A 1URCA 3BE2A 3HZTA 3BX5A 3EIDA 5BMSA 3BPRA 3QYZA 2PVMA 4J99A 4RIXB 4XV2A 4C33A 3R01A 4FV8A 4O6EA 5IUIA 3FKOA 4O4CA 1QPEA 4YNEA 3SOAA 4QYFA 3ZO3A 3D7TB 4GT4A 2UZOA 2C3KA 2XNGA 1JKLA 1U5RA 2FO0A 3VS0A 1FMKA 2KTYA 4P4CA 2ONLA 3CBLA 3QD2B 3VC4A 4HCVA 4ZJIA 2XM9A 3TL8A 2VWBA 2W7XA 3SW7A 1YOLA 2G1TA 1FVVA 3HLLA 4ZY6A 4R1YA 2OO8X 4K18A 3O50A 3N9XA 3JXWA 3QRIA 2R3GA 2CN5A 4QD6A 5TKDA 3NYXA 4FEUA 4QMMA 4GL9A 5AUXA 1Q8TA 3ORPA 3MB7A 4YC6A 2QURA 5IKWA 2VV9A 3DDQA 2CKOA 2I0YA 4W8EA 4UZDA 4X2GA 5D7VA 3H9OA 3QRKA 2XCHA 4AN3A 2YEXA 5AP3A 4R8QA 5IEYA 4TNDA 1YXUA 2XYNA 4KS8A 2QO9A 5J87A 4BDCA 3D9VA 5LMBA 5HKMA 1BKXA 3NCGA 3CP9A 4RQKA 4F9CA 2JIUA 3KK8A 3UGCA 4ACGA 2X8IA 5AR3A 5L3AA 4M69B 4Y95A 5EKNA 4LGHA 4C7TA 2J0LA 3OFMA 5AM7A 2XNBA 4JIAA 5CU0A 2X2MA 2Z7SA 4NU1A 3RZFA 3CPBA 5FTQA 2W1ZA 3E3BX 3VRYA 2AC3A 5LVMA 1PMVA 2F2UA 4DH1A 3BQRA 5F1ZA 3EHAA 3NAYA 5A3XA 1Q3DA 4YTCA 4MUQA 2W1DA 1RE8A 4H05A 2VD5A 3DU8A 3T8OA 3TMOA 4RA4A 2HIWA 3HV5A 3QQUA 4ACHA 3DGKA 3FHRA 3ZC6A 4KRDA 5KMIA 4OTQA 4QP7A 1PJKA 4J52A 3ROYA 3BYVA 2H96A 4JLCA 3K5VA 4ZMEA 3LMIA 4UMPA 2QOCA 2WXVA 3QUEA 5K3YA 4M0ZA 4FSWA 2PVHA 2PVNA 2J9MA 3QZHA 4NKSA 3P5JC 4NJDA 3C50A 2W5HA 3DFCB 4YTFA 3KFAA 1WBTA 1ZOEA 5C01A 3TYKA 4DH7A 2J0KA 4F7JA 4LOOA 4NYEA 3LQ8A 5JFSA 3OXTA 4FV7A 2XA4A 4YHJA 4BVUA 3FZTA 1Q8WA 4TTHB 1E1XA 5LMKC 4L44A 4ZZMA 1RQQA 4C4FA 3CLYA 3R02A 1VYWA 4FIFA 4KKHA 4TRLA 4YPDA 5AM6A 4E26A 3QTWA 4CRSA 4EWQA 5HBJA 3GENA 3MTLA 4UMRA 4IC8A 4BTJA 5LCKA 3LE6A 3VQHA 2UW0A 4FV9A 3VHKA 2XRWA 4FUXA 3BYMA 5EI8A 4FTNA 4CV9A 1Q8YA 1YXSA 5CI7A 4MWIA 3W32A 4DN5A 4BCFA 3TNQB 2Z7RA 5FG8A 4FX3A 5HICA 4E4LA 5A4EA 2PMIA 2IEWA 2YWPA 5DHJA 2ZB1A 2PULA 4RMZA 4D5KA 1QCFA 5FXQA 2IN6A 3QGWA 4WKQA 5IQCA 3HVCA 4IANA 4YPSA 4I24A 5D12A 2C3LA 4CQGA 3I6UA 2UW8A 3PFQA 3ZXZA 3ELJA 2R3LA 3V04A 4GKIA 4IBMA 4ZS4A 3PP0A 2J6MA 4DGMA 1B39A 3JS2A 4ASEA 4AZEA 1APME 2RFNA 3ORNA 1JKKA 4FRFA 5D9HA 1Y91A 2QKRA 1W2CA 4FT0A 5FD2A 2QOHA 1SNXA 4WUNA 1T46A 2CPKE 3R1NA 3VUDA 2JDVA 3V5TA 3VJNA 3Q6UA 1BX6A 2W05A 3JVSA 4YJNA 1YWVA 4EOLA 5KMKA 3QHRA 4FG8A 2J5FA 2GMXA 1VYZA 3F88A 3QUDA 1GOLA 2XB7A 4KA3A 1OGYA 4O27B 4IFGA 5EYMA 4BI2A 3FKNA 2GSFA 3MB6A 3R73A 4D4YA 4RIXA 4O86A 2XIYA 4CLJA 3UOJA 4BTKA 2R3FA 4BHNA 1WCCA 3D5UA 5AV0A 3U4UA 4CQEA 4EQMA 4AFJA 1YDRE 3FC2A 4PMMA 3VF8A 4C57A 4F0IA 3ZYAA 3V5PA 4I4FA 5F94A 5KMNA 2V55A 3K54A 5G6VA 3JY0A 4BDFA 5EQPA 3OTVA 1U59A 3SLSA 3P1AA 3VBVA 4IEBA 2CGUA 4IQ6A 4QTEA 4RVKA 4JOAA 4C3RA 4YSMA 4ZSGA 1H01A 2WB8A 5JZNA 3I0OA 4FKOA 1ZWSA 3GQLA 3QZGA 2R7IA 2W0JA 5BUEA 1PF8A 4GRBA 3C9WA 2YIYA 3I81A 4NZWB 5AR4A 4E8AA 3KKVA 2ITZA 5AR5A 3RNIA 4DHIB 2HWOA 3COHA 3WE4A 3HP5A 4RC4A 3FZ1A 4DC2A 4NFNA 4O7RA 3BBTB 4UB7A 5I5ZA 4AXAA 1V0OA 2B7AA 1Y57A 5CVGA 3GQIA 3OXIA 3RBWA 3CC6A 3OROA 4FV5A 3R21A 4M69A 3ZH8A 4AWIA 5DT3A 3LCDA 3UOLA 3HEGA 2WIHA 2ITVA 3G0EA 2CN8A 1PXPA 2XNNA 5AP4A 2XJ2A 4BDBA 4D55A 4PPCA 4ZIMA 2C5VA 4JXFA 4EYJA 1OZ1A 3MA3A 4G5JA 4ALUA 2W1CA 3PTGA 1CKPA 3GCUA 5HVKA 1R3CA 2BDFA 3P7BA 3PVBA 3TI1A 4GMYA 2BZJA 1W2FA 3FV8A 4G3EA 3BELA 4FIEA 3P79A 4PL5A 4U6RA 2JGZA 3D5WA 5E8XA 4NM3A 4XLVA 5EM7A 1H00A 2R0UA 4Y83A 3ZO1A 3G15A 2BIYA 4NEUA 4KIKB 3SVVA 3D5XA 4WSYA 4R7HA 5C03A 4RLLA 2BPMA 2X9FA 3IQ7A 3I60A 4JG7A 3UJGA 5T68A 4AXDA 3MFSA 5ITAA 4CFFA 2RSVA 3R9HA 4BICA 3WILA 5FTGA 3W0PA 3NNUA 3RKBA 2B9HA 4EKKA 3E8EA 2ITUA 4L7SA 2C6OA 4BCHA 4EHGA 3LFEA 5A4QA 1TQIA 3FLQA 2GTNA 3AOXA 3DLZA 3EN9A 3RINA 3AGLA 1H1WA 1T45A 4CG8A 2NPQA 4A9YA 3Q60A 4L53A 4FT5A 2WTDA 3EQGA 4J97A 4IW0A 4IE9A 4E6QA 3P78A 4ZSJA 2Y7JA 2IF8A 4M13A 3V8SA 4BBMA 4BBEA 3LJ1A 2R3OA 1PHKA 4AGWA 5E92A 2XEYA 2VX0A 2EXMA 4I6LA 3GC7A 2XNMA 3KN5A 4FV6A 4MNFA 3DKFA 1EH4A 2J2IB 5JFVA 3RMFA 5E4HA 3RPOA 2W9FB 3OZ6A 2WKMA 3E92A 4RWKA 4KIOA 3PPJA 2BRGA 5M4FA 1PRYA 3DLSA 2ZDTA 2Y9QA 3V01A 3N4VA 4MWHA 2XKEA 4YP8A 2WO6A 5EG3A 3EN6A 3PSCA 5DR9A 3UVRA 3MDYA 4D2VA 3GU4A 2X1NA 4IH8A 5DFPA 2V62A 4F1OA 4W4XA 5HNIX 2REIA 3OWKA 3ORTA 4DYMA 1OPLA 3AT2A 5EM6A 5M56A 5DT0A 4O21A 3MIYA 2I0VA 2X0PA 3AMBA 5KZIA 2QODA 2BCJA 3A2CA 4QRCA 2XYUA 1G5SA 1OL7A 3HYHA 2UW3A 3KK9A 4JT3A 2ACXA 4UEUA 2ZMDA 3QD3A 5HBEA 3NFGB 4XOYA 4FIJA 2KULA 4XBUA 3RVGA 5EYCA 4E20A 3C5UA 4IWDA 5KO1A 3F6XA 4JJRA 5D10A 4X2FA 4Y5QA 2ZV8A 2J5EA 3C7QA 4G1WA 4D2SA 4X3FB 5KE0A 4D28A 4QDEA 1VEBA 3FQSA 1YI4A 3OS3A 4RWJA 3R7YA 4FI1A 1CTPE 4DDGA 2BFYA 1H08A 2QOQA 2VTAA 3C4WA 5HESA 3PRIA 5HD7A 3WARA 2XCKA 3W0OA 2W06A 4WNKA 4YTIA 4OTGA 4FKJA 3GOPA 5LOHA 3UMXA 5AX9A 4I23A 3F3ZA 5I9XA 4BR3A 3SV0A 4FKIA 4DFYA 3PA3A 3HDNA 3TACA 3AD6A 4C2WA 4O2PA 2RL5A 4FSMA 5J9LA 3MH2A 4G31A 4KINA 4YJUA 3TG1A 4DFZE 4DFUA 4MF1A 3I0QA 5FLFA 2OZAB 4H39A 4UWYA 2VTHA 3ZLSA 1K2PA 4FKRA 4C36A 4KUJA 2FA2A 2ZM4A 3TJCA 1OL5A 4Z7GA 4LV8A 5JEBA 4AXEA 3Q32A 3LIJA 3R1QA 1H24A 3NNVA 4C8BA 3R1YA 5HO8A 3RK5A 5JK3A 1R78A 3S1HA 3BWJA 5HTIA 4FTKA 3C13A 3ZEWA 3PXQA 2RFEA 4ZS0A 2E9UA 4MD8E 3VBQA 3GU5A 4JDKA 4BTFA 5M06A 3QC9A 4GK2A 2IZTA 4M68A 1OKWA 4PDSA 3R7EA 2VN9A 3BQCA 4A9UA 4AZVA 4AQKA 3OCSA 3R8PA 4AOIA 1SVGA 3OCTA 4P90A 4TXCA 2LAVA 3DAEA 3NIEA 3BI6A 4DEDA 3BGZA 5AUTA 5ETAA 4WIHA 2BIKB 1G8AA 1GAGA 2BDJA 2JFMA 3ZDUA 1GJOA 3KF7A 2NRUA 3ZFMA 4DHZA 4BKYA 2YHVA 3O71A 4YGAA 4CKIA 5J79A 4AP7A 4RJ8A 2GS2A 3OW4A 4JBOA 3AC8A 2AC5A 5JT2A 4Q5EA 3KEXA 4IVBA 4AA4A 4RVMA 5IEVA 1H1RA 3DY7A 3DFAA 5EKOA 4NKAA 4UXLA 3K3JA 3WYYA 3BL7A 3PFYA 1ZMWA 4KIKA 3CKXA 3NS9A 5CVHA 5CSPA 3BRBA 2PE1A 3WI6A 3SC1A 3ZLWA 4XG2A 3UPXA 4F99A 5LXMA 1NXKA 1BI7A 1UKHA 1MRVA 2UV2A 4RWIA 3FMNA 3FPQA 3TNHA 4J7BA 5H9BA 5IPJA 3ZZWA 3OY3A 5LARA 5DVRA 3ITZA 5DRDA 4GJ3A 2F2CB 2YJSA 3C1XA 1X8BA 2BAQA 5CS6A 3TV6A 4F7NA 4EHZA 5M07A 4O0XA 4AGDA 4B99A 3OBGA 3ZXTA 3R7OA 4F1MA 3KRWA 3OUKA 5EI2A 4ALWA 4IAFA 3OTUA 3FE3A