2WTJA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
287
Chain Sequence
MSVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CHECKPOINT KINASE 2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 287
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtjA01
4RPVA 4N0SA 4KS8A 4MHAA 3AC2A 3TZ8A 4AOIA 2YDKA 2PVJA 3FMJA 1J1BA 3QCSA 3W33A 4AU8A 2GHLA 1UA2A 3Q9YA 2W1GA 3U51A 1OL7A 4D4YA 3BGQA 3PY0A 3LFSA 4PL5A 3BHUA 1ZXEA 3LQ8A 1YHSA 3E64A 4J53A 4QMMA 5B7VA 5HU9A 1RDQE 2B9JA 5KE0A 4HVHA 4PX6A 4NM5A 1PYXA 1XWSA 2R3HA 5DFPA 1H26A 3RM6A 2XNBA 5HKMA 4O0XA 2HIWA 3KL8A 5KMMA 1PY5A 2XEYA 5DWRA 5F20A 2P33A 3R2BA 2VV9A 5AADA 5E8TA 3NUNA 4CNHA 5GIOE 2IO6A 3R7IA 2VTAA 3SLSA 2J0LA 4BICA 5B2MA 5E8WA 4FE2A 3COIA 4XUFA 3G9LX 3CR0A 3I81A 3NNVA 4FIFA 4NL0A 3FY2A 3AT4A 5CXZA 4I22A 2VWVA 2BAJA 5CX9A 4GT5A 3MN3A 5DEYA 4C61A 1MUOA 5J79A 4GJ3A 5JT2A 3SA0A 3RPVA 4C2WA 3RNYA 1Q4LA 4RBLA 4Z55A 4R7BA 3QYZA 3PXFA 4BKYA 4YHFA 5TF9A 4K9YA 1YI6A 4ZLZA 5GJDA 4B7TA 3NUUA 3ANRA 1K9AA 3EJ1A 4A9SA 4DTBA 1T46A 4FNYA 4UMPA 3A8WA 3KF4A 4M13A 4RA5A 5KMKA 3FXXA 2JDOA 2ITTA 1FVRA 1VJYA 1V0OA 4QMUA 4C62A 4YJOA 4BCJA 4EH4A 2C1BA 1ZY4A 2Y4PA 2XNNA 3JR1A 5DG5A 5EQEA 4CTBA 4YJTA 3PYYA 4XHKB 5H8BA 2JFMA 3BU5A 4BCIA 2ZV2A 3I7CA 3ORPA 4FKUA 4V0GB 3ORXA 3ULIA 3H4JA 5DRDA 3L9NA 2WEIA 2I7QA 4ENYA 4QNYA 3EYHA 2BHEA 5AR7A 3PPKA 4QMNA 4G34A 3ZRLA 4WSQA 4R7IA 4ZTSA 4A4LA 1OL1A 3E87A 1U4DA 3OCTA 5K5NA 3Q4UA 5KMNA 3NNWA 3VBXA 4TWCA 3W16A 3LFQA 1YI4A 2G2IA 3RWQA 4E6QA 4EH9A 4F1OA 4CG8A 1FOTA 2CJMA 4RWKA 2YZLA 5C9CA 5HCYA 4TY1A 3MDYA 3Q9ZA 2RF9A 2OWBA 5D9HA 3T8OA 1YOLA 4IAZA 4KBCA 4RLKA 3V8SA 3WZJA 2XCKA 2GNFA 3O51A 4EC8A 4F7LA 3DB8A 2J0KA 4C02A 4FIEA 2UZDA 3E8NA 4WSYA 1XBBA 4E8AA 4M15A 1V1KA 2GQSA 3CXWA 3KK8A 3HX4A 2CSNA 3G2FA 3KRJA 5ANGA 5FG8A 3QQHA 4MD9E 5EHLA 3AG9A 5DGZA 4U81A 5AM7A 4FC0A 2XVDA 3H0YA 3ANQA 2W06A 3FZRA 5E9EA 4ACCA 1GJOA 5CAPA 3RM7A 4DFUA 4S33A 2HELA 5DVRA 4HVGA 5FXRA 2VWWA 4EC9A 3A7HA 2UVYA 1M7NA 4NM7A 5IU2A 2YIXA 4GFOA 2R3LA 3QBNA 5EW3A 4C0TA 3EN9A 4BBFA 4YURA 3F3UA 3CTJA 2GNHA 3FI4A 3NZ0A 2YAAA 4FG8A 5LMAA 3VS1A 4ZZOA 4PRJA 4M69B 5IA3A 3SG8A 1OUYA 4PP9A 2A1AB 3FBVA 4ZY4A 2Y6MA 5DH3A 3L8SA 4NSTA 1L3RE 4PNIA 4JQEA 4R6VA 2YCQA 4HPTE 3G0EA 2WIPA 2J5FA 3R02A 4BCGA 5L4QA 3NAYA 3DXPA 5J1WA 1ZARA 3LFAA 3QC9A 3OUKA 3DCVA 1DI9A 3BHTA 3DKOA 4BDFA 2XEZA 5AWMA 1ZOEA 4E93A 5IMEA 4JQ7A 4RWJA 5CF8A 3CP9A 5HVJA 2C6EA 2Z60A 4FSMA 2WKMA 1OL6A 1FINA 1GZOA 3K5UA 5CTPA 3DBCA 4CLIA 4FOCA 3FKOA 2OIDA 2VTQA 4FNZA 2QOFA 3O50A 4IW0A 4NM3A 2A4LA 2VWBA 3ETAA 5I3OA 3NYNA 2X0GA 4AUAA 2ZYBA 2I0YA 2XF0A 4BTFA 2E9NA 3OY1A 2W17A 5HO6A 3E62A 3VUGA 4D5HA 5BPYA 2W99B 1DM2A 3CJFA 4IXPA 2RL5A 1APME 3A60A 1SMHA 5AP2A 3TCPA 5IKWA 1OECA 2QO2A 1XR1A 3GU8A 3OVVA 4NTSA 3F82A 2PMOX 3DK3A 3KXXA 2QOCA 3Q5ZA 4CFNA 4C36A 1JNKA 3CEKA 3FL5A 3ZFYA 4TYHB 2W1CA 5AP0A 3DKFA 5EM6A 2X7GA 2XIKA 4G6OA 1OKVA 3W18A 2ZVAA 3FQEA 3IONA 4FIIA 3RPSA 2XRWA 5HG9A 2IPXA 4DCEA 2BRBA 2XIYA 4KBKA 4V04A 5EQYA 2YITA 3BHVA 3LXNA 2O0UA 3KN6A 3Q2JA 3GENA 5I9UA 3V04A 1ZYLA 2OJ9A 2XK9A 4DINA 2Q0BA 4NEUA 3RPYA 1J7UA 5HQ0A 2OZAA 4FTCA 4WNMA 1Q97A 3F5XA 2VWYA 2C5XA 3TI1A 5AAEA 1M2QA 2QI8A 1GZKA 3FLSA 2QOIA 2YWPA 4WBOA 3V5WA 4A9RA 2J4ZA 5DR2A 1PRYA 3OFMA 2FO0A 5DBXA 5J9ZA 1MRYA 5C8MA 4E26A 3DTCA 4UMRA 1ZYJA 5JRQA 5KMLA 3W2SA 5M51A 2I1MA 4BDHA 2FB8A 4G5JA 4J1RA 4X2NA 3S1HA 4JDJA 5BNJA 2F9GA 3O0GA 4QMOA 4L00A 3AGLA 3EQPA 4CV9A 1MP8A 3LJ1A 4O0VA 1FMKA 2UVXA 5IUHA 5JQ8A 1UNHA 2W9ZB 2OK1A 2YJSA 4JRVA 3KULA 2A0CX 4X3JA 4EH5A 4F7SA 3FXZA 4IWDA 4NKSA 4C4GA 2I0VA 3QXOA 5CNNA 3LXPA 4MXZA 2WU6A 4FTAA 3OWJA 4FTLA 4EYMA 2UZNA 1I44A 4FTQA 2VX3A 4ZOGA 3CC6A 1FGKA 1IR3A 1XHAA 2ETMA 4DCAA 2UW8A 4RT7A 5ETFA 3QUEA 1M14A 3VS5A 2PU8A 2WMTA 1KWPA 3TT0A 4KB8A 5DHJA 4ZTMA 4XP0A 4WRGA 4O84A 2JBPA 4X3FC 2HZ0A 5DRBA 3NPCA 5C26A 4IM2A 4QPAA 2GTNA 4E6AA 2C0IA 2PUIA 2OICA 4E7WA 5CEPA 3AC5A 4J99A 3QTRA 4L8MA 3RAKA 4NM0A 1NW1A 3GQLA 4JG7A 5EI8A 4AOJA 3I5ZA 3UZTA 5HD7A 4BCQA 2BILB 3Q32A 2GQGA 3POOA 3NR9A 1H27A 3NGAA 4FZFB 5M09A 3MY0A 4HVIA 3JY0A 3FHRA 3OEFX 5CT0A 4RIWB 5JFSA 3VNTA 4IWQA 5IEYA 3KRXA 2EVAA 4BN1A 1RJBA 4B4LA 2XIZA 2B53A 2X4FA 2B7AA 5C27A 1BX6A 3TKUA 3DLSA 3PY3A 3EQCA 1JBPE 3NYVA 3OXZA 3NDMA 5M53A 4YGAA 2QOKA 4KINA 4X6QC 2XA4A 3CY3A 1EH4A 4O22A 2VTOA 4WNKA 5KX8A 1UWJA 5J1VA 3D5UA 2JLDA 4LOOA 1BMKA 4X3FB 1URWA 3DLZA 1OBDA 2UVZA 3D15A 4XH6A 1A48A 4FKVA 3HMNA 2R3RA 3VW8A 5C1QB 4LV5A 2BMCA 3PXQA 5FUTA 3W32A 2WHBA 1AGWA 4EJ7A 1Q24A 2C6TA 3GGFA 3G15A 4IX6A 1WBSA 2O64A 4NTTA 3RINA 4F0GA 3V6RA 2LGCA 3EFLA 1ZMUA 4GYGA 2GNJA 3QA0A 4QMZA 3KF7A 5DE2A 4TYIA 4B8MA 5AV4A 2QOLA 4QTBA 1BI8A 1OITA 5BVNA 3UO5A 4RFMA 4LRJA 3R28A 3ZLYA 4F65A 3BPRA 5HZNA 3C4CA 5J95A 4YU2A 3IG7A 2ITOA 4HJOA 1UNGA 3E7VA 3QL8A 4QQCA 2WZJA 2OXYA 2GS2A 2VTNA 3MYGA 3V5PA 2A2AA 4D9TA 2QG7A 4PL4A 1R78A 5D7AA 4D4VA 4EJNA 2R3OA 3LLAA 3BE2A 1YOMA 2BFXA 4J52A 4YJNA 3P0MA 2RFEA 4F6WA 5CU4A 5H2UA 5ITAA 4GK4A 4XOZA 3MW1A 4OLIA 3CJGA 5F1ZA 3EH9A 4UN0C 5EM8A 4M8TA 2PE2A 4GT4A 2VTMA 4A9YA 1IRKA 4AE9A 5HTIA 4NWMA 2PULA 3F5GA 4UB7A 2EB2A 4FR4A 1XBAA 4C7TA 2PZIA 3SXRA 5HICA 4RFZA 4QTEA 2ITVA 2PTKA 2PE1A 3KGAA 2X8EA 1FVTA 3MI9A 1YXVA 2WMAA 4G5PA 3O8UA 4UZHA 3C51A 4LL5A 4BI0A 3TV6A 2BZJA 4A9UA 1G3NA 2B52A 2NPQA 2GFCA 2FA2A 5HX8A 5CEOA 3FZOA 4Y83A 4AGUA 3C4XA 4IB3A 4RIYA 3QZHA 2OLCA 3ACJA 4CFWA 1YVJA 2UZBA 1PMEA 1CM8A 3D7ZA 2WGJA 3TZ9A 4R5YA 2PUUA 4DA5A 3OCBA 3QD2B 1AQ1A 4J71A 1P2AA 2R3PA 1MQBA 5EYCA 3OW3A 2OZOA 3SOAA 4ACHA 2PUPA 4XNEA 3GBZA 3H3CA 4ID7A 3D83A 1KOBA 1IA8A 3G90X 1Q61A 2WTKC 2C6OA 4TYEA 4HZRA 4WG4A 1BI7A 3WILA 4BCKA 3LE6A 3L9LA 4Y8DA 3EN6A 4DBXA 2B54A 2CDZA 4FEQA 4KD1A 4MVFA 2OFVA 2J90A 4I5MA 4DBNA 1PXKA 3C0HA 4CXAA 4BCPA 2VTHA 4AP7A 5JKGA 2G9XA 2J5EA 3ZMMA 4DGLC 3ZO3A 4ANNA 1S9JA 2R4BA 4I21A 4YMJA 2HENA 3ZXTA 1QPEA 4O38A 1GY3A 5CENA 2AYPA 5AP4A 4L42A 4WIHA 1M17A 4FTTA 2C68A 2I40A 3FSKA 3OROA 2JBOA 3NRMA 3PTGA 3R22A 3ODZX 3DK6A 4MH7A 1YHVA 2VTRA 3VN9A 5C01A 1BKXA 2VTSA 4QMWA 2ESMA 3VS7A 4C2VA 2ITQA 4M67A 3RMFA 2WMUA 4AZSA 4WNOA 4G2FA 3COKA 3TG1A 2AC3A 5L2WA 1VYWA 4ONAA 3FMDA 3KCKA 5HORA 1JKKA 3Q6UA 5EHOA 4W8EA 4CRSA 4I41A 3W1FA 2ZOQA 2BALA 2WTKB 2YM5A 3LPBA 4M84A 3LW0A 5JRSA 2OH0E 2BRMA 2PVRA 3VRYA 5IA0A 3T3UA 2XYNA 5FTQA 3G51A 4E5WA 1XQZA 2Y8OA 1G5SA 3LFNA 4FKIA 4TN6A 4QTAA 3VC4A 4UY9A 4YJUA 4CTCA 4FTRA 2YIRA 4G31A 2F2CB 5TR6A 3KCFA 3QLGA 3BQRA 1QPJA 4IB0A 4UMQA 3R8PA 2R0IA 5AUXA 5AP1A 3KQ7A 2YERA 3QCXA 1W7HA 3R7EA 4CZYB 2PVHA 2VD5A 1Q41A 3DJ5A 4WD5A 3RJCA 2V7AA 3TJDA 4AAAA 3IDBA 3P1AA 5JZNA 1PXNA 3AD5A 4BYJA 3TWJA 4KKEA 4LI5A 5I3RA 2C0OA 3OCSA 3NUXA 4KBAA 4NH1A 4JDIA 4RJ3A 2C3LA 4E20A 4JR3A 2GCDA 5CF6A 3AC3A 3ZYAA 3D7TB 4K1BA 4PNKA 2JDRA 3R63A 4W4YA 1U46A 3DNEA 4YSMA 3RVGA 4DGMA 3FI8A 4G3GA 4Q9SA 1HOWA 4QPMA 5HHWA 3SRVA 4E3CA 4UZDA 2XBJA 3IDCA 4ZJIA 4FV7A 4DE4A 2R64A 2XNEA 5M57A 3OP5A 1V0PA 4AT4A 1UNLA 3PA5A 5D1JA 3FSFA 3PA4A 4A4XA 4RJ6A 2GTMA 2W5BA 3MA3A 4PDPA 1JWHA 5M44A 4L46A 3R1YA 4UMUA 2FSMX 4IAFA 3ZO2A 1OL2A 3QTSA 3F61A 5CU6A 3CGFA 1JVPP 4J96A 4PPAA 3FDNA 4QQ5A 3FKNA 4IHPA 4TZRA 4Z16A 4ZAUA 5C8KA 4ERKA 5DR6A 4IAAA 1JLUE 1G8AA 2IVVA 4WG5A 2R7BA 4U43A 4IZAA 1SVGA 3O23A 5LXMA 1SNXA 4BCFA 1OI9A 4KKGA 2JEDA 4EUUA 2DQ7X 2EB3A 3GU4A 1ZYCA 4PMPA 3V5LA 1WBWA 2E2BA 3BYMA 4NK9A 4NW5A 4KUJA 1PXLA 3EIDA 4DEHA 3O17A 4GUBA 4RZWA 5AAFA 3C5UA 5CEQA 5IDNA 5ACBC 4PPBA 3LCKA 3UVQA 1REJA 3LZBA 1OIRA 2V7OA 3LCOA 4MX9A 2GDOA 2WU7A 3QZFA 4XG9A 3UP7A 5JEBA 5IQCA 3WE8A 3ODYX 3MTFA 3I6WA 3GT8A 3HP5A 3PXYA 3QKMA 3WARA 3MA6A 4IEBA 2GS7A 4DC2A 3UO4A 2ERZE 3DKCA 4LV8A 3RI1A 3UG1A 4EOKA 3PDTA 1H8FA 5M08A 3HECA 5HBJA 2CGVA 2NNWB 5HI2A 4EUTA 3FWQA 3ORLA 4QP2A 2GNLA 3F3WA 4GJ2A 4PQNA 2OF2A 4B8LA 3ZFXA 4WKQA 4O0WA 5HG5A 1GZNA 1YDTE 4FKQA 4YTIA 3UDBA 3T3VA 5HOAA 4A07A 4L3JA 3HKOA 4F99A 2BR1A 2HWOA 5F94A 2PVFA 2CKOA 2Z7QA 4I20A 5LWNA 5EDQA 3BQCA 3RPRA 5EG3A 4EH8A 3KMWA 4O86A 1WVWA 3F5PA 3PVGA 1OKWA 2VO0A 4O0UA 4PWNA 4TWPA 4CFXA 2WMQA 2W7XA 4D4SA 5E1SA 3PP0A 5CEIA 4DEAA 3PUPA 4E73A 3LKMA 3HA6A 2YCRA 3FE3A 2V22A 2B9IA 2QO9A 2UZVA 5J5TA 1GAGA 4BBEA 1OVEA 3REPA 2R3KA 3MY5A 3PA3A 4IVAA 5LARA 1DS5A 4EHVA 5LQFA 5BX0A 3VUIA 4RFYA 2CGWA 4MXCA 1S9IA 5FM3A 5D12A 3ZU7A 4QP8A 2V5QA 1YQJA 2C3JA 3W55A 3WZDA 2QU6A 1YWVA 3I7BA 4KIPA 3NUSA 2J6MA 4RWIA 2ACXA 3POZA 4I0RA 5LVLA 4GVJA 2BIKB 2YIWA 4FA2A 3UJGA 4ZTQA 4LUEA 3PIYA 5FLFA 5JK3A 3UO6A 3ALOA 3GC0A 4RJ4A 3BRBA 4N6ZA 3V5JA 4TT7A 5C4LA 4DAWA 2C69A 3UE4A 4IADA 4D0WA 3FL4A 5KBRA 3QQFA 1XH7A 3NW7A 4U9AA 2C5YA 2F7XE 3OTUA 4O7VA 3KRWA 4PTCA 3WIGA 4FSYA 2EXEA 2FSLX 1UU9A 3FYKX 1SVHA 3FY0A 4FV6A 4G17A 4MK0A 4YC8A 3TKIA 4DYMA 5L6PA 3C5IA 1Y91A 4PMSA 4IQ6A 1YXXA 1H25A 4L45A 5JGBA 4TYJA 4Y95A 5EM5A 1YDSE 1Q8WA 3A62A 4B99A 2DWBA 2Y6OA 5CSWA 2IW6A 4FZ6A 4A06A 2DYLA 2GSFA 4Y5QA 5CWZA 2XNGA 2WELA 3LFFA 5GIPE 1H4LA 3R0TA 4EOLA 3OXIA 3Q96A 3OW4A 2XCHA 3CBLA 3DB6A 4OTRA 3CQWA 4PV0A 4XV9A 3HL7A 1GZ8A 3BV3A 5KO1A 3WYYA 3KK9A 3S0OA 5AIRA 1UKHA 4AN3A 1VR2A 3TUCA 4GYIA 2YN8A 3FMHA 4AA5A 3CPBA 3QTQA 3GNIB 4FZAB 1RQQA 3KY2A 1J3HA 3NEWA 5TT7A 2O2UA 3NUYA 2XNOA 3UG2A 5HIDA 4D58A 3HUBA 4QP1A 5I9ZA 2H96A 4AX8A 2R9SA 3CLYA 4GCJA 1RE8A 3GP0A 5HG8A 5IQIA 4YLKA 4MYGA 4N4SA 2ONLA 4AZVA 2ITNA 3SAYA 3DXNA 5K3YA 4ANLA 4F70A 4TWNA 3LMHA 4FTMA 4JIKA 4N70A 5CAOA 3LJ2A 2OJIA 5E7RA 5CQWA 3HMPA 4MNEA 2R5TA 5E8VA 4WNPA 3PPZA 3QX2A 5L8KA 2GHMA 3E63A 3KB7A 3IKAA 3LHJA 4O82A 4O0SA 2PHKA 1KE8A 5HESA 3D94A 5FBOA 2C5NA 3ZUTA 2UW0A 3EFJA 4FTNA 5IA4A 3MVJA 3MGYA 2P2HA 4M68A 1JAMA 3AQVA 2X2MA 3DPKA 3A4OX 3DNDA 5EYDA 5KNJA 4PTGA 1B6CB 4R77A 4AQCA 3SQQA 3VS4A 4M3QA 3GB2A 2OJFE 5FM2A 4KAOA 4U8ZA 4YPDA 3QF9A 4L68A 3GCSA 3F7WA 2ITWA 3TKHA 5KKRC 4FF8A 4DG2E 2QR7A 2VU3A 3A7JA 3CTQA 3A61A 3P78A 4M7IA 4U97A 3DDPA 1JSVA 2HYYA 2ZV8A 5J7HA 4YR8A 4GK3A 1PKGA 1UKIA 4HGEA 4LGDA 3TNQB 4S32A 4W9XA 2WMVA 4C59A 5LOHA 3KXGA 4EQMA 3FZTA 2WFYA 2W96B 4AZTA 3A2CA 1UU8A 4DFBA 5GNKA 3HMMA 3WF5A 1R39A 4H05A 3R7VA 1F5QA 2C6MA 3OHTA 1TQMA 4CMUA 4UWYA 2IVUA 2CPKE 4BZNA 5IQBA 3HDMA 5ANOA 3SDJA 4FSWA 3PWYA 4H39A 2BKZA 2ETRA 4BCMA 4NFMA 5AV1A 3RAIA 5GHVA 5CAUA 4UYNA 5FQDC 4M66A 1FMOE 3FLWA 4WHZA 3EWHA 3KFAA 4TWOA 4CLJA 4FV4A 4L6QA 3QU0A 3R9RA 1OM1A 3BHYA 1WBNA 3ORIA 4C3PA 2QHNA 3UOKA 4ITIA 2Z2WA 5KKRB 3DBQA 4H1JA 2XBAA 3HV7A 4FL3A 3SV0A 3KXNA 4O7NA 4DEGA 4RIXB 2WMRA 4BDGA 3EN4A 1H24A 5AUTA 1WAKA 2BDWA 3I1AA 3HEGA 2JKQA 2XIRA 4IX4A 4U3YA 5EM7A 3I6UA 3BV2A 4CCUA 3OOGA 4Q5EA 4Z7GA 3UMXA 2BHHA 3ZLSA 1YXUA 5EOLA 1LR4A 4RVKA 3ZRKA 3ACKA 4C57A 4FTIA 4PUZA 4CFUA 4S30A 2ERKA 5EI2A 4HZSA 4ZEGA 3FMLA 4XLIA 2CN5A 3O2MA 4FI1A 4QT1A 2C0TA 2BVAA 3CQEA 3II5A 4X0MA 4CVAA 1RW8A 3RAHA 3GC7A 4D2WA 2RSVA 4U41A 3E8CA 3OTVA 2FSOX 4M0ZA 4RZVA 4YJVA 1V0BA 3PSDA 4XV3A 5LMKC 5J9YA 2W1EA 3FYJX 2G1TA 4YJPA 3VBVA 2BPMA 4IACA 4CYJA 3IPHA 4NCTA 2PZ5A 3M2WA 5L2TA 2NRYA 3EQHA 3UQCA 4P4CA 1YDRE 3PSBA 4YC3A 4FL2A 3ZM4A 4AT5A 1OBGA 2JITA 3C50A 4CFVA 4EOJA 3DBDA 4FT3A 4R3PA 3UC3A 2AC5A 5I9YA 4D4RA 4CEGA 3M11A 4V01A 3RK7A 1Y6AA 3NNUA 4I5PA 4YZDA 4D2SA 4LYNA 2P0CA 4BL1A 4E4NA 3F2RA 2OG8A 5AV2A 4C4EA 5AIKA 3EQIA 3DU8A 4PTEA 4H3BA 4JT3A 4QP7A 3ORMA 5K0XA 3QC4A 4LGGA 2C6KA 4H3PA 5LMKA 4C37A 2QU5A 3UVRA 5CY3A 5ANJA 3VUKA 4IAKA 4RX8A 4BWXA 5HU3A 5LVPA 3TEIA 2WD1A 4F64A 2PVMA 4HVDA 2QKWB 4M14A 4O2ZA 4FG9A 2UW5A 2QVSE 3R6XA 5AUUA 3TV4A 5JFWA 4IWPA 1H00A 5EDRA 3V6SA 2PK9A 4QQTA 2EUFB 1XKKA 1H1QA 3AT3A 3GU5A 1P5EA 3R7GA 4FKPA 4JG6A 2B9FA 5CSHA 3QX4A 2E9PA 5HBEA 3C9WA 2JDTA 4FKSA 3NCGA 2VTTA 2G2FA 5FP6A 5L6WL 2Z02A 4QP6A 4AG8A 2IG7A 3W8LA 2X8IA 3FQSA 2CCHA 4WOVA 5E8YA 4JBVA 3VBWA 4G1WA 4YPSA 3Q4CA 1OKYA 3BLQA 4EHZA 4JQ8A 4F0FA 5M06A 4I6HA 4OBOA 3BHHA 2G01A 2PPQA 5FDXA 4GKIA 5EQPA 4I1ZA 5DNRA 5A46A 4CRLA 4ITJA 5D41A 5ETIA 3VS6A 4B9DA 1O9UA 4XCUA 3R83A 2P3GX 1BYGA 3LCDA 3WYXA 2CKQA 4WT6A 4AW2A 3PJ1A 4TTHB 3V3VA 2VWUA 4FKGA 3VUMA 4D1SA 5I5ZA 5JZJA 4YBKA 5AR2A 3NSZA 4FTKA 4TKSA 4D55A 1GIJA 4P5QA 3SOCA 1DAWA 3QQUA 4L3PA 5EKOA 4AWIA 3ENMA 2XK4A 4FKWA 4YBJA 3W10A 4AZFA 4IBMA 4I5CA 3IOPA 2IZSA 2XJ1A 3SG9A 3GQIA 3COMA 3P79A 5EYMA 4CGAA 2BZHB 5M4UA 3R8UA 1JSTA 4MF0A 3CSVA 3HAMA 4QMTA 4BCHA 3WE4A 3A8XA 3FEGA 2XKCA 3MFUA 4QOXA 4F09A 2HCKA 2CGUA 2X7FA 4BZDA 5AP6A 3SD0A 3PLAE 4BTKA 2QO7A 3LLTA 4O6LA 4ALVA 1XH8A 2BAQA 4OBPA 3R9HA 3ID6C 3PG1A 2J51A 3TIYA 4C34A 5CAQA 4UBAA 4FIJA 4DEBA 2WQEA 3Q6WA 4FKJA 3UQGA 5A4QA 2OU7A 3DJ7A 3R00A 4QP9A 3UPZA 4ORKA 3RTPA 3PP1A 4XOYA 3UP2A 3RPOA 3P5KA 2XK8A 3BU6A 5HCZA 4BHZA 4JDHA 5FEEA 4E5BA 3IW5A 4FGRA 2YZAA 4IDTA 3MIYA 2R3IA 4XV1A 1LP4A 1R0EA 2YM3A 3AD4A 4IZYA 4OBQA 3TN8A 1CKJA 4XX9A 3RK5A 2VX1A 4Y5HA 4ZLYA 1BLXA 1YI3A 3CPCA 3N9XA 4KIKA 2OJJA 2BCJA 4ZZNA 2FUMA 3ZUVA 1F0QA 3THBA 4RC4A 4QYHA 4NFNA 5M56A 4I6BA 1UVRA 3KRRA 3NYOA 5EI6A 5EW8A 5B2KA 4NYEA 3DKGA 1Y8GA 5EDPA 3DZOA 1KV1A 3LQ5A 4O0RA 4HPUE 2J9MA 3V5TA 3IS5A 4FSTA 2ETKA 4JX3A 3BEAA 4O2PA 3U4UA 3KREA 3I5NA 2HZNA 4FK6A 3C4ZA 5A4LA 4EEVA 5BVWA 4FNWA 4PDOA 4FT7A 4U79A 2Z7SA 4L53A 4FEVA 3PPJA 3TNIA 1J1CA 4L43A 4IX3A 2VTLA 2GQRA 2JKKA 5CSXA 3SW7A 2J0JA 4QYFA 4DEDA 3C4EA 4QP3A 1U54A 2JKOA 3HMOA 3QQKA 1E1VA 4I3ZA 4O1OA 4U5JA 3OUNB 3H9FA 4L52A 4YZBA 3E8EA 4O21A 4W4XA 4YHTA 4OAVB 3TUBA 4S34A 4KRCA 3BZ3A 2WTCA 5CI7A 4LUDA 1QL6A 2YCFA 4FOBA 3S2PA 1K3AA 2JFLA 4EH3A 3FZSA 4O7RA 5CXHA 5DOSA 1Z57A 4FV9A 2ITPA 4YZCA 2YABA 5AR3A 3RCJA 4FSNA 4YP8A 2UW9A 4EOMA 4BDBA 5FD2A 2JIUA 4X2GA 4FEUA 2JIVA 2CNQA 5CZHA 5BUEA 5IEVA 3QD0A 5CU2A 4BDDA 2F4JA 2X9EA 3HV5A 4IVDA 4ALUA 5AP7A 2YA9A 3SVVA 4MD7E 3W2PA 2O5KA 2VO3A 4RC2A 4RVTA 3RZFA 5IUGA 2FSTX 4IDVA 1XH6A 4KA3A 5KHXA 3I0OA 4TPTA 3CTHA 5G1XA 1F3MC 3EOCA 4BDAA 4IAYA 3E7OA 5J7BA 4L01A 2X4ZA 2XKFA 1HCLA 5JN2A 4FKOA 2ZM1A 3ZDIA 4FX3A 3HDNA 4UXQA 4EOQA 5DPVA 3BLRA 1UWHA 1H1WA 4RX9A 3OBGA 4BTJA 5L8LA 2F7EE 2R3FA 4IB5A 4O7TA 4WBBB 2OF4A 3HRBA 5BVKA 4GU9A 3FC1X 3FKLA 3W2RA 2CKEA 4I92A 4DH8A 2H6DA 5BMMA 1J7LA 2GU8A 4JX7A 3FPMA 4OGRA 5IA1A 1J7IA 4DFYA 3BELA 1OGUA 3S4QA 2R3MA 5CQUA 1Y8YA 3MV5A 4OW8A 2JD5A 3JYAA 3LFBA 2QG5A 2VRXA 5IA2A 4CZTA 5DYJA 4W4VA 5CNOA 5E1EA 2VTIA 2OGVA 2PSQA 2WTWA 2XP2A 4F9AA 2EWAA 3PXRA 2WO6A 4FV2A 4XBUA 4EKKA 4O83A 5ETCA 3MPAA 1JSUA 5BYZA 5M4IA 4O7LA 4DF3A 3H9OA 3ORKA 4FTOA 2GNGA 3DT1A 3GFWA 4GUEA 4LGHA 4WUAA 5AP3A 4AGDA 4QYGA 5BMSA 2QNJA 3ZZWA 5IQHA 5AV3A 4BB4A 1WBOA 2OH4A 3BCEA 5GJGA 4U80A 4GKHA 1XH4A 2R0UA 4EHGA 4EQUA 1CTPE 3QRUA 4USEA 2WOUA 4KIOA 4OTQA 3TACA 3R8LA 5J5SA 2C4GA 3ORTA 3OWLA 5ACKA 3BYUA 3JVRA 4R7HA 1B38A 4FMQA 4J8MA 4NJDA 4IZ5A 5FP5A 2OZAB 4P5ZA 3O7LB 5HE3A 3DS6A 2HAKA 3R71A 5JH6A 4QMLA 1I09A 5HO8A 1WMKA 3ATSA 2XJ2A 1Q62A 4O6EA 5IUIA 1ERKA 3BI6A 4R8QA 5EH0A 5B0XA 3VIDA 2CNUA 4JBOA 3NCZA 3LM5A 3LM0A 4R1YA 3MVHA 3C4FA 5CASA 2BIYA 4C3FA 2OW3A 3OT8A 5BYYA 2XKEA 4BVUA 3P7CA 3L8XA 4ZK5A 3I4BA 1NVQA 3ZXZA 3EN7A 4APPA 4OTDA 4K77A 4NIFA 4RJ7A 3DAKA 3P86A 4FVPA 5CVHA 4JBPA 2J7TA 3CD3A 4YTHA 4G3DA 2UW6A 3R01A 2GPHA 4IE9A 4HYIA 4R1VA 5CS6A 4JXFA 3RP9A 3QUDA 1CMKE 3S3IA 1ZAOA 3V8WA 4G16A 3QHWA 4D5KA 3AMYA 3WBLA 4UYAA 3W8QA 2BDFA 5HG7A 1UU3A 2YISA 3VBYA 4I23A 4G6NA 4XV2A 5CVGA 2ZMCA 3VW6A 1H01A 1ZLTA 4QD6A 2F2UA 4H36A 4N57A 1P14A 3AD6A 5T3QA 3CKXA 2PUNA 5HLNA 3ROCA 1B39A 3ATTA 4MNFA 3B2WA 2E9UA 4DLJA 3HA8A 3HGKA 2XH5A 2H8HA 4FSRA 4O96A 4ZP5A 5HNGA 4AFEA 4DFLA 3Q2MA 5A6NA 5EYKA 2YM4A 3D0EA 1PXOA 4BI1A 4Z9LA 3AC4A 5H8EA 5CU0A 4L7SA 5M4FA 4BDCA 4Y72A 3RK9A 3ZRMA 1Q8UA 2O8YA 3DJ6A 3BX5A 1W0XC 3WZKA 4EK6A 4MEDA 2QODA 3UOLA 3F5UA 3NWWA 5HTCA 3L9MA 4D2VA 3TTIA 4FSQA 3R8VA 3EYGA 4QRCA 3QZIA 4EK8A 5FTGA 2YAKA 3R7UA 3CIKA 4JAIA 2VGPA 4CZUA 4XJ0A 5AFVA 5T6KA 4M0YA 2X7OA 3P7AA 2Y9QA 3ULZA 2UW3A 2ZAZA 4RVMA 1JKLA 3RHXA 4MQ1A 5HLWA 2VTJA 4ANSA 4QQJA 4XG4A 3R2YA 2XIXA 3KVXA 1PMUA 1GNGA 5K0KA 5DT3A 5BVEA 3EKKA 2BZKB 3IQ7A 3L8PA 3QUPA 4CCBA 4LRMA 3FPQA 3PY1A 3PIXA 1M2PA 4EYJA 3IW8A 2YM7A 3ZS5A 4BDEA 4U3ZA 4RX7A 2QKRA 4GSBA 4NZWB 4WA9A 3OZ6A 3BWJA 1W8CA 4BDKA 5CU3A 5DLSA 3TV7A 2Q83A 1ZZLA 3HRFA 1ZMVA 3ZHPC 1XH5A 5H9BA 4IVBA 4Z7HA 3ZLXA 3VBQA 2ZB0A 5IA5A 5M07A 4KSPA 2X2LA 3ERKA 1Q3DA 3FUPA 2GS6A 2I0EA 2JC6A 3ZSGA 1Y6BA 5DT0A 3ZH8A 3ROYA 4F9YA 5DEWA 2YM8A 3PIZA 3F3VA 3FLZA 4RSSA 2VX0A 2WPAA 2WAJA 2WMWA 4QYYA 5L6OA 3VHKA 2LAVA 4HYSA 4CQEA 4EKLA 1JKSA 2YIQA 3OXTA 5K5XA 2VTPA 1A9UA 2W1IA 3N51A 3OEZA 1KE9A 2QR8A 4K0YA 3RZBA 5J87A 5IISA 5CAVA 1MRUA 4FTUA 5BUIA 5IEXA 4ANOA 2JAMA 2W1FA 3GOKA 3WF6A 1LPUA 2WNTA 3PWDA 4F6UA 4BIDA 4Y73A 3MB7A 3U54A 1OPLA 2BROA 4RIYB 3F3TA 2HW7A 3UC4A 4IAIA 5A4EA 5IQAA 3RNIA 3QZGA 2UV2A 3VWAA 3DXQA 5JMSA 1NXKA 4D1XA 1KE5A 2OO8X 4NUSA 4EK5A 1NA7A 2FVDA 1G8SA 3HV4A 3GCQA 3QRJA 1KSWA 3UODA 5LVNA 5KBQA 2ZB1A 2Y4IC 4RA4A 4BHNA 3ZSIA 4AS0A 3OD6X 4D28A 4CQGA 2C3IB 3PRIA 3G6HA 5CF4A 3ZONA 2PYWA 1OL5A 2X8DA 4FSZA 2C5OA 3LOKA 3CKWA 5KHWA 2WQBA 3OOMA 4FTJA 2UZEA 3ELJA 3K5VA 2YJRA 4ASXA 3QRTA 1QCFA 3HVCA 4QMSA 5FWKK 3RAWA 5IZFA 1KUTA 2JIIA 3V8TA 4IJ9A 5E8XA 4IVCA 2W1HA 2YLFA 3JUHA 1W82A 5JFXA 4AOTA 4PDSA 3UBDA 4O27B 4EZ3A 3C0GA 4Y85A 2W9FB 4DH1A 5FRIA 4DGGA 3HZTA 4ITHA 2F57A 4USDA 1WBTA 4BC6A 3E93A 5IH6A 3MESA 3UZPA 4TL0A 1P4FA 3ENHA 4XS2A 4XRLA 1ZY5A 3DK7A 4V0GA 4ACDA 2VWIA 1K2PA 3IW6A 4CKRA 4XG8A 4Y46A 4GH2A 4K8AA 3O8TA 2P2IA 2O65A 1WBVA 2Y4IB 3QGYA 3ZC5A 4B0GA 3IK3A 2PVKA 4QO9A 4XG3A 3OMVA 4IIRA 2R7IA 3TNWA 5B2LA 4ZXTA 5K4IA 5A54A 4R3CA 4PF4A 3R1SA 4EH7A 4A9TA 1M7QA 3RBWA 5IQFA 2V62A 1PXJA 3G0FA 2YDIA 4FGBA 2ITUA 3QTZA 3WZUA 4F6SA 4WUNA 4LG4A 2W1DA 4ZZMA 3N4VA 1W83A 5CT7A 3OY3A 3KMMA 2V55A 4M12A 3QWJA 5A6OA 3M42A 1BL7A 2SRCA 2B9HA 4O0TA 4K6ZA 5CYIA 3FI2A 4YTCA 3HV6A 5IH4A 4GMYA 5C03A 4NW6A 2CLXA 5HNIX 4QPSA 4I0SA 1NVSA 1H1PA 4JDKA 3MVLA 4FYNA 3BBWA 4I4EA 3EQFA 2BFYA 3MPMA 3B8RA 4W9WA 3L9PA 4EQCA 4HGSA 3HLLA 1Q3WA 3WIKA 4CT2A 3UOHA 1E1XA 1OIUA 3MH0A 4FT5A 4DITA 4CMTA 3FZ1A 4FV3A 4BY9E 2Z7RA 3ZBXA 4L3LA 2NP8A 1U5RA 1CKPA 4ERWA 4KKHA 4ZLOA 4YNOA 5IQGA 3SRVB 4BIBA 1AD5A 3LXLA 3GCPA 3Q9WA 1BUHA 4M69A 1MRVA 3I79A 4EOSA 1SZMA 4XG6A 1CKIA 2VZ6A 5HNBA 2REIA 1OUKA 5AAGA 5TKDA 4TYGA 2UZUE 3GUBA 3GU6A 3FLNC 2P55A 1BL6A 4EK3A 5E4HA 2XK3A 3Q3BA 4FIHA 3V01A 1H1RA 2C6IA 4AW5A 5E92A 1YKRA 2ZDTA 4X2FA 3BE9A 4CKIA 1DI8A 2GNIA 3CQUA 1PXPA 3T9IA 3D9VA 3QD3A 3SXSA 1LEZA 3ITZA 5AA9A 2XK7A 4AGCA 5L3AA 3N4TA 2YCSA 5HCXA 1IAHA 1GOLA 4AFJA 4EL9A 4LOPA 4FICA 5IPJA 4BCOA 3DV3A 4EHEA 4ZTRA 4GEOA 4ZSJA 3D14A 4UALA 2W5AA 3R1NA 4YC6A 3WF9A 3ZM9A 5T68A 2BAKA 2BDJA 4HGTA 5HIBA 2XYUA 4YO6A 4CMOA 5E90A 1E9HA 2QOBA 3K3IA 1WCCA 3PJ3A 3MJ2A 1O6YA 3MPTA 4DG3E 4IC8A 3RHKA 1QMZA 3ZLWA 4BGGA 5IH5A 1ZRZA 2OKRA 3O8PA 2WIHA 1IEPA 2FH9A 1PYEA 4CFMA 4C8BA 3FQHA 5GZ9A 3D5XA 3ZEWA 2A19B 3KC3A 2GFSA 4IH8A 3CD8A 1STCE 3MFTA 4ZSAA 5JGDA 3ZSHA 4H58A 4AZWA 4KRDA 4TYHA 4FV1A 4OT5A 3DTWA 3LIJA 4XG2A 2PVNA 2W1ZA 4IM3A 4MTAA 3PLSA 4XP3A 3R9OA 4E6DA 1PXIA 3VULA 3U9CA 3FC2A 3VQUA 3L1SA 4C3RA 3VVHA 4CFFA 4CV8A 1NVRA 4ANQA 2GMXA 3PE2A 2AUHA 4KNBA 3S00A 5BYLA 1QPCA 3R7OA 3UTOA 4H1MA 4XMOA 2Z8CA 4O0YA 3ZUUA 2C5VA 5FXSA 3BYVA 5F4NA 1PF8A 3LJ0A 2QLUA 2OJGA 4OTPA 4XEYA 3DQWA 3QTUA 4EOIA 5KCVA 5J9LA 4XLVA 1Q8ZA 3UPXA 1IAJA 3NMUF 2E9VA 4F4PA 2QOHA 5FEQA 3OWKA 4X7QA 4MXAA 1O6KA 4MXYA 3IGOA 4F1MA 3WF8A 3NIEA 4FK3A 1SVEA 4QMYA 4R3RA 3BEGA 3ZCLA 5BVOA 3H0ZA 5JFVA 5CANA 4PMMA 3AMAA 2X39A 4U42A 3B2TA 4GK2A 3QWKA 5AR8A 3MH3A 2J50A 2WQOA 4JG8A 5DI1A 1HCKA 4UMTA 4ASDA 3ZO4A 3QKLA 3EL8A 4Q2AA 4YLLA 4GVAA 2B55A 4P90A 4LFIA 4QYEA 5AEPA 2OSCA 5JGAA 3DY7A 5F9EA 3BIZA 3KXMA 3Q52A 4MXXA 2CCIA 4YZNA 4FT9A 3UQFA 3MB6A 4K18A 4GV1A 3QQJA 1JPAA 4O1PA 2CNVA 2GHGA 3H10A 5KUPA 1Z5MA 5CZIA 5EHYA 4P7EA 2XNPA 3GI3A 4RLLA 3A7IA 2ONLC 2WMSA 3FJQE 4DG0E 5HO7A 4HYHA 4OTIA 4GRBA 2WOTA 1Q8TA 2ZM3A 3VF8A 4DTAA 3A4PA 2IVTA 2C30A 2OIQA 3EKNA 3FLQA 4II5A 4BCNA 5L2SA 1SYKA 2EXCX 2ZV7A 3F2NA 5C4KA 5TE0A 4H3QA 2Q0NA 5AUWA 4Q9ZA 2WXVA 4YUQA 1PKDA 3LXKA 4G3EA 4DEIA 4EH2A 5LCKA 1WFCA 3F3ZA 3BKBA 3ZBFA 3OBJA 5E8UA 3IW7A 1UU7A 3W2QA 1ZMWA 4K2RA 4FNXA 4CKJA 3PZEA 2WTJA 4R5SA 4XP2A 1KOAA 4BDIA 4F9WA 3U4WA 4TNBA 3DOGA 2BUJA 5CSPA 4RIWA 4BR3A 3VAPA 2C47A 3R1QA 2CGXA 4FEWA 5LJJA 4S2ZA 3U9NA 3R30A 3DAJA 1U5QA 5IMXA 3UMWA 4FEXA 3MIAA 2W4JA 3U87A 3AGMA 4ZS4A 4FG7A 4GIHA 3T9TA 5I9WA 4DH3A 5DMZA 1P4OA 3QKKA 3ZOSA 4APCA 2X81A 4JLCA 3ZC6A 3F6XA 3KU2A 5CVFA 4QMXA 4MNEB 3MVMA 2OIBA 4GT3A 4M97A 3QQLA 3TNHA 3PJ8A 4GFGA 4MWIA 1LUFA 4X3FA 4ZTLA 4ASZA 4WO5A 4RIOA 1YRPA 3HRCA 4ZMFA 3AC8A 3LMGA 3K54A 3NAXA 1ND4A 4YZ9A 4EK4A 4HVSA 3DA6A 2NO3A 4IZ7A 5E91A 1FPUA 4R78A 5A9UA 4U44A 5ANDA 2OI4X 3FI3A 3QTIA 4GW8A 2QC6A 3UNKA 3FZPA 3O7LD 5GJFA 4OTWA 5HEZA 4AW1A 4XRJA 3BLHA 3R9NA 4ZSEA 3VRZA 1JQHA 1PJKA 2KTYA 2R2PA 1H07A 3E3BX 2IVSA 2HXLA 2YFXA 3MJ1A 3Q4TA 3EZRA 3D2IA 5H8GA 4G3FA 4UXLA 3HYHA 2PY3A 4EONA 4F9CA 3NUAA 3D5WA 2EXMA 1YOJA 2R3NA 4AA4A 2CKPA 2W4KA 2IWIA 4YZMA 4ARKA 4ZTHA 3ET7A 1TQPA 1NT2A 4C4IA 5CI6A 2XZSA 4E4MA 1ZOGA 1YW2A 2PMNX 5AJQA 4BRXA 3COHA 4C4JA 2VGOA 2RG6A 4GL9A 4GS6A 4HGLA 4MWHA 4P2KA 5I9XA 4DN5A 5AR5A 5AX9A 2J2IB 3UIBA 2XB7A 5I4NA 3G5DA 5AV0A 4BIEA 1FGIA 1Z9XA 5AA8A 2RFDA 5TO8A 4MCVA 3TXOA 4O7YA 3AXWA 5AMNA 4EORA 2O3PA 3EZVA 4QMVA 3LFCA 4JR7A 4DH5A 4NCTC 5KZ0A 3PE1A 3LCSA 4ACMA 4IFCA 4J7BA 3AOXA 3W2CA 4MKCA 3AT2A 4BWPA 3CCNA 4BGQA 3F7ZA 3IOKA 4K33A 1SNUA 5L2IA 5HGIA 2RFNA 1GIIA 4USFA 3VQHA 2ITXA 5CF5A 3GXLA 3R21A 4C35A 2KULA 3TUDA 3MFSA 4ZJVA 3PVWA 1H0VA 4IANA 4F0IA 5CALA 4TXCA 4D0XA 3EHAA 3EFWA 4RMZA 4EBVA 4TNDA 2OFUA 4XG7A 3U6IA 5A4TA 4L67A 5HE2A 5EW9A 3QHRA 3VF9A 3NUPA 4EH6A 3R73A 3R8MA 2E9OA 3QLFA 3IW4A 2YLEA 4YJQA 2IZUA 1LEWA 4HYUA 1OB3A 3IECA 4X2JA 3ORZA 4ENXA 1KV2A 3LFDA 2JAVA 2YDJA 3C7QA 1PMVA 4WG3A 3R9DA 4ALWA 4U6RA 5EK7A 4FV5A 1H28A 2XK6A 4ZMEA 3EQBA 1ZYSA 4EZ7A 3HMIA 5ANEA 3WI6A 4FKLA 3TDVA 4LQMA 4CYIA 4ACGA 2UZWE 4JIAA 4YHJA 5BVFA 2RKUA 2PZYA 4BKJA 5I0BA 1WVXA 2QOOA 1PHKA 4QNAA 3FAAA 5AM6A 3KMUA 2V0DA 4UWBA 5J8IA 4IWOA 3TJCA 2VUWA 3IGGA 4WRSA 5AR4A 3UNJA 4BF2A 4HOKA 2O63A 4FODA 2CLQA 3R8ZA 1XO2B 4LL0A 2QLQA 2WB8A 5D11A 1H0WA 2NRUA 3KA0A 3PJ2A 4NU1A 4ZIMA 4D2RA 3F69A 3UIXA 1R1WA 2B4SB 1U59A 2YACA 4GG5A 4I6QA 3L8VA 1ZYDA 4DH7A 3NIZA 1IA9A 4FVRA 3GVUA 4F08A 3C0IA 3TNPC 4DGOA 2Z7LA 1OIYA 4AW0A 3JXWA 1WVYA 2PVYA 2PMLX 1OPJA 2BKKA 3ORNA 4MXOA 3JY9A 4UEUA 3VJNA 2J0IA 2XRUA 3I0QA 4MD8E 2XS0A 3F88A 1JOWB 3D7TA 2VAGA 1PXMA 4FIGA 3RCDA 3PSCA 3MWUA 3UNZA 2ITYA 4YNEA 2X1NA 4I0TA 4FZDB 4LMUA 4F63A 3HAVA 2EU9A 3DZQA 4I5HA 3DFCB 3DQXA 3JPVA 2HZIA 4D9UA 4IM0A 3U6HA 4TW9A 2XJ0A 4A7CA 3B8QA 1XJDA 4JVGA 1Q8YA 3O96A 2ZV9A 4DFZE 4F7JA 2VO6A 4GIIA 4X6RA 3UIMA 1FQ1B 3HP2A 5HE1A 3LFEA 4S31A 1VEBA 3S95A 3NX8A 1O6LA 4CSVA 2IW9A 3P7BA 2VWZA 2W0JA 4DT9A 4UX9A 1Q99A 5DIAA 1J91A 3HV3A 3R7YA 4IC7A 4W8DA 4BI2A 4FUYA 5BUJA 3EN5A 3VHEA 2RIOA 2PE0A 1H08A 2HY81 4O91A 3QD4A 3OC1A 4EWHA 1VYZA 4XYFA 4BYIA 4ZY6A 3TZ7A 1YWNA 3FXWA 3SGCA 3FV8A 3Q04A 1H1SA 3TL8A 3SX9A 5K4JA 3D5VA 4MQ2A 4ZJJA 4RWLA 3TDWA 1XH9A 4UV0A 3MH2A 3ZZEA 3EQRA 2BRNA 3HNGA 4I93A 4QP4A 4G3CA 1OPKA 4GFMA 2PVLA 5IQDA 2BRGA 3G9NA 3CE3A 5AUVA 5AUYA 4AT3A 4OR5A 1REKA 2X6EA 2I6LA 4I6FA 3PVBA 5D7VA 5EKNA 4RVLA 3E8DA 3C13A 3SKCA 5HD4A 3MY1A 3PJCA 4ANMA 2XNMA 1ATPE 1Q5KA 3VS0A 1ZWSA 2ITZA 3CGOA 3VO3A 4ZS0A 2YWVA 2J0MB 1YXSA 4AA0A 3EL7A 4NKAA 4RQVA 4X21A 3ZEPA 3A99A 5I9VA 5DN3A 3BU3A 3U6JA 5IQEA 1UV5A 5DT4A 4O7ZA 4NJ3A 4AF3A 2HY0A 2W4OA 1ZOHA 2WMXA 2DUVA 4QTCA 3KULB 2VNWA 4HCTA 4HNFA 4DFXE 4PL3A 3N4UA 3OG7A 1X8BA 4DHFA 4UWCA 1R3CA 3EQDA 4KIKB 3QA8A 5H3QA 4AN2A 3E88A 2XM8A 2C6LA 5HE0A 4O7WA 1M52A 2HZ4A 3O71A 3AC1A 4RJ8A 5DR9A 3D4QA 4JNWA 4EWQA 2YIYA 4JRNA 2BTRA 4IX5A 3TTJA 4D2PA 3U55A 4FT0A 4DGNA 3JVSA 3PRFA 4K11A 5FEDA 5C8NA 3MTLA 1FBNA 2VO7A 1YWRA 2R3GA 3KXHA 1TQIA 2WMBA 3IO7A 3QRIA 3EQGA 3ALNA 4MBIA 4TRLA 5ANIA 5FBNC 5EFQA 3WF7A 4QMQA 5KZIA 2VWXA 1OZ1A 3UVPA 4YO4A 4FUXA 2ZDUA 4PPCA 4FZ7A 3OT3A 3BYOA 4J8NA 3LAUA 3MH1A 5FTOA 3JS2A 1U54B 5IDPA 3LMIA 4LRKA 3MFRA 5ETAA 4ANBA 4G9CA 1CDKA 4MBLA 5A14A 4EOOA 3MBLA 5IF1A 3GCUA 4FBXA 3QTWA 2QD9A 3GCVA 4J98A 3VJOA 4YLJA 1KE6A 4FV8A 5JQ5A 4A4OA 4O81A 2VN9A 2UUEA 3GC8A 3NVKI 2ZM4A 3SHEA 3FMEA 4FL1A 4PY1A 4YJRA 4YJSA 2XM9A 4F1TA 4PP7A 3UGCA 4RJ5A 3FMNA 5AUZA 3W2OA 4KIQA 3KRLA 5CSVA 3V51A 5TOZA 1OMWA 4JS8A 4U0IA 5KMIA 2PL0A 2QOQA 3P08A 4IJPA 4ZY5A 5CEKA 3UZRA 3SC1A 4G9RA 3OF0A 5HLPA 4EBWA 4EZ5A 2UW4A 3QQGA 4CT1A 4BDJA 4BKZA 5ANKA 5G6VA 3VUDA 5EOBA 3UOJA 2UZOA 1XBCA 3OWPA 3PFQA 4JOAA 4MAOA 1W84A 2H34A 3E3PA 4AACA 2HW6A 1PW2A 1IASA 3BBTB 3QCYA 3QRKA 2WTVA 5AP5A 2ZJWA 4OTFA 3RGFA 2JDVA 3D2KA 5ICPA 4QTDA 3Q9XA 4I94A 4AGWA 5A3XA 2C6DA 3RALA 2F49A 3WOWA 3F66A 2W5HA 3P4KA 3TIZA 1GIHA 5AX3A 3LVPA 2BTSA 2UZLA 3PXZA 3NVMB 5GZAA 4L7FA 4C4FA 4RQKA 2IJMA 3PVUA 5HVYA 5LVOA 4C33A 1M2RA 4BFMA 4C38A 4LOQA 2YM6A 5F95A 3RWPA 3QAME 4KWPA 4C58A 4BWKA 3DBFA 5FXQA 3VS3A 3DFAA 3PG3A 2G15A 4U40A 2QQ7A 4BGHA 2IW8A 2IZRA 2YHVA 2QURA 3AMBA 1TKIA 5E8SA 4C4HA 1R0PA 4IMYA 5E8ZA 4PDYA 2OBJA 5LMBA 4B6LA 4U45A 2VNYA 2X6DA 3EB0A 3WZEA 3DDQA 1QPDA 5LVMA 2C1AA 4F7NA 2QHMA 2IN6A 2ZMDA 3GEQA 3NLBA 3R04A 3SW4A 2YEXA 3K3JA 4N6YA 5M4CA 1A06A 2WQMA 3G33A 3BGPA 4KABA 4EI4A 5D10A 2IZTA 3ZO1A 2UZTA 1SM2A 4E4XA 3ZDUA 1NY3A 4RC3A 1KE7A 5IG1A 4HW7A 4QMPA 1PMNA 1ZZ2A 5M55A 3BYSA 4L44A 2HOGA 5FGKA 2JDSA 4NT4A 2PMIA 4BZOA 4AN9A 2X2KA 3E92A 2JGZA 3V5QA 1TVOA 1YXTA 3QGWA 2X9FA 4JL9A 4OAUC 2CHLA 5HBHA 4OTGA 5CLPA 4OT6A 2JKMA 5LWMA 3NS9A 4FYOA 4DEEA 4F9BA 5FDPA 2WTDA 3EMGA 3I60A 3MS9A 2C3KA 3P23A 4RG0A 4V05A 2A27A 4AZEA 5KMOA 2B0QA 3CS9A 5L8JA 4E5AX 3G6GA 4HNIA 2R3QA 3HUCA 4NIFB 3BGZA 2XUUA 3QTXA 1Y57A 2QCSA 1VZOA 3K2LA 3PXKA 2P4IA 3OCGA 2DS1A 2UW7A 2WQNA 3DBEA 4GU6A 2RFSA 4I4FA 3M1SA 2XMYA 4MBJA 3UYTA 4E4LA 4D2TA 4IB1A 4OTHA 4ZSGA 3SXFA 2FYSA 5KMJA 2CMWA 2HK5A 1W98A 4HCUA 3FHIA 3PZHA 2F7ZE 3UYSA 4D1ZA 4EOPA 4DLIA 2WEVA 4YTFA 3E5AA 3P9JA 4IFGA 3OS3A 4ASEA 3Q5IA 4FKTA 5HTBA 3VUHA 3TZMA 2I0HA 4XBRA 3U8WA 2B1PA 2QONA 4ZTNA 2WTIA 3VUTA 4CD0A 4E1ZA 5HVKA 4RIXA 5K9IA 3LCTA 1OKZA 2G2HA 4BTMA 2R3JA 3GU7A 4KSQA 3QYWA 3IDPA 3BWFA 3QFVA 3QXPA 4JJRA 4DTKA 1MQ4A 4FVQA 4HCVA 3Q4ZA 3KEXA 5GZ8A 1JKTA 2BRHA 3FMMA 3NW6A 3NYXA 4L9IA 3MSSA 4PMTA 3A7GA 4MF1A 3GOPA 5L2QA 5HIEA 2PZRA 1URCA 3H30A 4DT8A 1FVVA 4JI9A 3FMKA 3NW5A 3DGKA 4FSUA 5HX6A 2FGIA 4LM5A 4CG9A 3DAEA 4J95A 2Y0AA 3CY2A 2W05A 4BBMA 4OUCA 1OIQA 1T45A 3NNXA 1IG1A 3Q53A 3ZTXA 4RRVA 3KVWA 4O7SA 2OXXA 2RGPA 2OXDA 3C1XA 3FLYA 4I24A 4Q5HA 4U7ZA 5DA3A 3H9RA 3QALE 4RX5A 1WZYA 2PZPA 2XKDA 4E6CA 3UIUA 4FV0A 1WBPA 3ZFMA 4DFNA 4G6LA 4LMNA 4J97A 4KS7A 1YHWA 4FKRA 5CEMA 2HXQA 2Y7JA 3F2AA 3EFKA 3QCQA 3A7FA 3Q60A 2RG5A 3KN5A 4YSJA 5BVDA 2BZIB 2PWLA 3KKVA 4AXAA 5GINE 2HWPA 3RKBA 5A4CA 1CSNA 5LCJA 4GG7A 3KXZA 3GC9A 1L8TA 1DAYA 3VBTA 2CN8A 4AE6A 4ZSLA 5BQ0A 3TM0A 3VS2A 5JSMA 3LQ3A 3GFEA 3C4WA 3F9NA 2H9VA 4W4WA 4JBQA 4X2KA 4RGJA 4Z3VA 4JAJA
chains in the Genus database with same CATH superfamily
4RPVA 4N0SA 4KS8A 4MHAA 3AC2A 3TZ8A 4AOIA 2YDKA 2PVJA 3FMJA 1J1BA 3QCSA 3W33A 4AU8A 2GHLA 1UA2A 3Q9YA 2W1GA 3U51A 1OL7A 4D4YA 3BGQA 3PY0A 3LFSA 4PL5A 3BHUA 1ZXEA 3LQ8A 1YHSA 3E64A 4J53A 4QMMA 5B7VA 5HU9A 1RDQE 2B9JA 5KE0A 4HVHA 4PX6A 3VONA 4NM5A 1PYXA 1XWSA 2R3HA 5DFPA 1H26A 3RM6A 2XNBA 5HKMA 4O0XA 2HIWA 3KL8A 5KMMA 1PY5A 2XEYA 5DWRA 5F20A 2P33A 3R2BA 2VV9A 5AADA 5E8TA 3NUNA 4CNHA 5GIOE 2IO6A 3R7IA 2VTAA 3SLSA 2J0LA 4BICA 5B2MA 5E8WA 4FE2A 3W0QA 3COIA 4XUFA 3G9LX 3CR0A 3I81A 3NNVA 4FIFA 4NL0A 3FY2A 3AT4A 5CXZA 4I22A 2VWVA 2BAJA 5CX9A 4GT5A 3MN3A 5DEYA 4C61A 1MUOA 5J79A 4GJ3A 5JT2A 3SA0A 3RPVA 4C2WA 3RNYA 1Q4LA 4RBLA 4MUQA 4Z55A 4R7BA 3QYZA 3PXFA 4BKYA 4YHFA 5TF9A 4K9YA 1YI6A 4ZLZA 5GJDA 4B7TA 3NUUA 3ANRA 1K9AA 3EJ1A 4A9SA 4DTBA 1T46A 4FNYA 4UMPA 3A8WA 3KF4A 4M13A 4RA5A 5KMKA 3FXXA 2JDOA 2ITTA 1FVRA 1VJYA 1V0OA 4QMUA 4C62A 4YJOA 4BCJA 4EH4A 2C1BA 1ZY4A 2Y4PA 2XNNA 3JR1A 5DG5A 5EQEA 4CTBA 4YJTA 3PYYA 4XHKB 5H8BA 2JFMA 3BU5A 4BCIA 2ZV2A 3I7CA 3ORPA 4FKUA 4V0GB 3ORXA 3ULIA 3H4JA 5DRDA 3L9NA 2WEIA 2I7QA 4ENYA 4QNYA 3EYHA 2BHEA 5AR7A 3PPKA 4QMNA 4G34A 3ZRLA 4WSQA 4R7IA 4ZTSA 4A4LA 1OL1A 3E87A 1U4DA 3OCTA 5K5NA 3Q4UA 5KMNA 3NNWA 3VBXA 4TWCA 3W16A 3LFQA 1YI4A 2G2IA 3RWQA 4E6QA 4EH9A 4F1OA 4CG8A 1FOTA 2CJMA 4RWKA 2YZLA 5C9CA 5HCYA 4TY1A 3MDYA 3Q9ZA 2RF9A 2OWBA 5D9HA 3T8OA 1YOLA 4IAZA 4KBCA 4RLKA 3V8SA 3WZJA 2XCKA 2GNFA 3O51A 4EC8A 4F7LA 3DB8A 2J0KA 4C02A 4FIEA 2UZDA 3E8NA 4WSYA 1XBBA 4E8AA 4M15A 1V1KA 2GQSA 3CXWA 3KK8A 3HX4A 2CSNA 3G2FA 3KRJA 5ANGA 5FG8A 3QQHA 4MD9E 5EHLA 3AG9A 5DGZA 4U81A 5AM7A 4FC0A 2XVDA 3H0YA 3ANQA 2W06A 3PUFC 3FZRA 5E9EA 4ACCA 1GJOA 5CAPA 3RM7A 4DFUA 4S33A 2HELA 5DVRA 4HVGA 5FXRA 2VWWA 4EC9A 3A7HA 2UVYA 1M7NA 4NM7A 5IU2A 2YIXA 4GFOA 2R3LA 3QBNA 5EW3A 4C0TA 3EN9A 4BBFA 4YURA 3F3UA 3CTJA 2GNHA 3FI4A 3NZ0A 2YAAA 4FG8A 5LMAA 3VS1A 4ZZOA 4PRJA 4M69B 5IA3A 2XANA 1OUYA 4PP9A 2A1AB 3FBVA 4ZY4A 2Y6MA 5DH3A 3L8SA 4NSTA 1L3RE 4PNIA 4JQEA 4R6VA 2YCQA 4HPTE 3G0EA 2WIPA 2J5FA 3R02A 4BCGA 5L4QA 3NAYA 3DXPA 5J1WA 1ZARA 3LFAA 3QC9A 3OUKA 3DCVA 1DI9A 3BHTA 3DKOA 4BDFA 2XEZA 5AWMA 1ZOEA 4E93A 5IMEA 4JQ7A 4RWJA 5CF8A 3CP9A 5HVJA 2C6EA 2Z60A 4FSMA 2WKMA 1OL6A 1FINA 1GZOA 3K5UA 5CTPA 3DBCA 4CLIA 4FOCA 3FKOA 2OIDA 2VTQA 4FNZA 2QOFA 3O50A 4IW0A 4NM3A 2A4LA 2VWBA 3ETAA 5I3OA 3NYNA 2X0GA 4AUAA 2ZYBA 2I0YA 2XF0A 4BTFA 2E9NA 3OY1A 2W17A 5HO6A 3E62A 3VUGA 4D5HA 5BPYA 2W99B 1DM2A 3CJFA 4IXPA 2RL5A 1APME 3A60A 1SMHA 5AP2A 3TCPA 5IKWA 1OECA 2QO2A 1XR1A 3GU8A 3OVVA 4NTSA 3F82A 2PMOX 3DK3A 3KXXA 2QOCA 3Q5ZA 4CFNA 4C36A 1JNKA 3CEKA 3FL5A 3ZFYA 4TYHB 2W1CA 5AP0A 3DKFA 4I6LA 5EM6A 2X7GA 2XIKA 4G6OA 1OKVA 3W18A 2ZVAA 3FQEA 3IONA 4FIIA 3RPSA 2XRWA 5HG9A 2IPXA 4DCEA 2BRBA 2XIYA 4KBKA 4V04A 5EQYA 2YITA 3BHVA 3LXNA 2O0UA 3KN6A 3Q2JA 3GENA 5I9UA 3V04A 1ZYLA 2OJ9A 2XK9A 4DINA 2Q0BA 4NEUA 3RPYA 1J7UA 5HQ0A 2OZAA 4FTCA 4WNMA 1Q97A 3F5XA 2VWYA 2C5XA 3TI1A 5AAEA 1M2QA 2QI8A 1GZKA 3FLSA 2QOIA 2YWPA 4WBOA 3V5WA 4A9RA 2J4ZA 5DR2A 1PRYA 3OFMA 2FO0A 5DBXA 5J9ZA 1MRYA 5C8MA 4E26A 3DTCA 4UMRA 1ZYJA 5JRQA 5KMLA 3W2SA 5M51A 2I1MA 4BDHA 2FB8A 4G5JA 4J1RA 4X2NA 3S1HA 4JDJA 5BNJA 2F9GA 3O0GA 4QMOA 4L00A 3AGLA 3EQPA 4CV9A 1MP8A 3LJ1A 4O0VA 1FMKA 2UVXA 5IUHA 5JQ8A 1UNHA 2W9ZB 2OK1A 2YJSA 4JRVA 3KULA 2A0CX 4X3JA 4EH5A 4F7SA 3FXZA 4IWDA 4NKSA 4C4GA 2I0VA 3QXOA 5CNNA 3LXPA 4MXZA 2WU6A 4FTAA 3OWJA 4FTLA 4EYMA 2UZNA 1I44A 4FTQA 2VX3A 4ZOGA 3CC6A 1FGKA 1IR3A 1XHAA 2ETMA 4DCAA 2UW8A 4RT7A 5ETFA 4BJJA 3QUEA 1M14A 3VS5A 2PU8A 2WMTA 1KWPA 3TT0A 4KB8A 5DHJA 4ZTMA 4XP0A 4WRGA 4O84A 2JBPA 4X3FC 2HZ0A 5DRBA 3NPCA 5C26A 2X0OA 4IM2A 4QPAA 2GTNA 4E6AA 2C0IA 2PUIA 2OICA 4E7WA 5CEPA 3AC5A 4J99A 3QTRA 4L8MA 3RAKA 4NM0A 1NW1A 3GQLA 4JG7A 5EI8A 4AOJA 3I5ZA 3UZTA 5HD7A 4BCQA 2BILB 3Q32A 2GQGA 3POOA 3NR9A 1H27A 3NGAA 4FZFB 5M09A 3MY0A 4HVIA 3JY0A 3FHRA 3OEFX 5CT0A 4RIWB 5JFSA 3VNTA 4IWQA 5IEYA 3KRXA 2EVAA 4BN1A 1RJBA 4B4LA 2XIZA 2B53A 2X4FA 2B7AA 5C27A 1BX6A 3TKUA 3DLSA 3PY3A 3EQCA 1JBPE 3NYVA 3OXZA 4QDVA 3NDMA 5M53A 4YGAA 2QOKA 4KINA 4X6QC 2XA4A 3CY3A 1EH4A 4O22A 2VTOA 4WNKA 5KX8A 1UWJA 5J1VA 3D5UA 2JLDA 4LOOA 1BMKA 4X3FB 1URWA 3DLZA 1OBDA 2UVZA 3D15A 4XH6A 1A48A 4FKVA 3HMNA 2R3RA 3VW8A 5C1QB 4LV5A 2BMCA 3PXQA 5FUTA 3W32A 2WHBA 1AGWA 4EJ7A 1Q24A 2C6TA 3GGFA 3G15A 4IX6A 1WBSA 2O64A 4NTTA 3RINA 4F0GA 3V6RA 2LGCA 3EFLA 1ZMUA 4GYGA 2GNJA 3QA0A 4QMZA 3KF7A 5DE2A 4TYIA 4B8MA 5AV4A 2QOLA 4QTBA 1BI8A 1OITA 5BVNA 3UO5A 4RFMA 4LRJA 3R28A 3ZLYA 4F65A 3BPRA 5HZNA 3C4CA 5J95A 4YU2A 3IG7A 2ITOA 4HJOA 1UNGA 3E7VA 3QL8A 4QQCA 2WZJA 2OXYA 2GS2A 2VTNA 3MYGA 3V5PA 2A2AA 4D9TA 2QG7A 4PL4A 1R78A 5D7AA 4D4VA 4EJNA 2R3OA 3LLAA 3BE2A 1YOMA 2BFXA 4J52A 4YJNA 3P0MA 2RFEA 4F6WA 5CU4A 5H2UA 5ITAA 4GK4A 4XOZA 3MW1A 4OLIA 3CJGA 3AKJA 5F1ZA 3EH9A 4UN0C 5EM8A 4M8TA 2PE2A 4GT4A 2VTMA 4A9YA 1IRKA 4AE9A 5HTIA 4NWMA 2PULA 3F5GA 4UB7A 2EB2A 4FR4A 1XBAA 4C7TA 2PZIA 3SXRA 5HICA 4RFZA 4QTEA 2ITVA 2PTKA 2PE1A 3KGAA 2X8EA 1FVTA 3MI9A 1YXVA 2WMAA 4G5PA 3O8UA 4UZHA 3C51A 4LL5A 4BI0A 3TV6A 2BZJA 4A9UA 1G3NA 2B52A 2NPQA 2GFCA 2FA2A 5HX8A 5CEOA 3FZOA 4Y83A 4AGUA 3C4XA 4IB3A 4RIYA 2XARA 3QZHA 2OLCA 3ACJA 4CFWA 1YVJA 2UZBA 1PMEA 1CM8A 3D7ZA 2WGJA 3TZ9A 4R5YA 2PUUA 4DA5A 3OCBA 3QD2B 1AQ1A 4J71A 1P2AA 2R3PA 1MQBA 5EYCA 3OW3A 2OZOA 3SOAA 4ACHA 2PUPA 4XNEA 3GBZA 3H3CA 4ID7A 3D83A 1KOBA 1IA8A 1W2CA 3G90X 1Q61A 2WTKC 2C6OA 4TYEA 4HZRA 4WG4A 1BI7A 3WILA 4BCKA 3LE6A 3L9LA 4Y8DA 3EN6A 4DBXA 2B54A 2CDZA 4FEQA 4KD1A 4MVFA 2OFVA 2J90A 4I5MA 4DBNA 1PXKA 3C0HA 4CXAA 4BCPA 2VTHA 4AP7A 5JKGA 2G9XA 2J5EA 3ZMMA 4DGLC 3ZO3A 4ANNA 1S9JA 2R4BA 4I21A 4YMJA 2HENA 3ZXTA 1QPEA 4O38A 1GY3A 5CENA 2AYPA 5AP4A 4L42A 4WIHA 1M17A 4FTTA 2C68A 2I40A 3FSKA 3OROA 2JBOA 3NRMA 3PTGA 3R22A 3ODZX 3DK6A 4MH7A 1YHVA 2VTRA 3VN9A 5C01A 1BKXA 2VTSA 4QMWA 2ESMA 3VS7A 4C2VA 2ITQA 4M67A 3RMFA 2WMUA 4AZSA 4WNOA 4G2FA 3COKA 3TG1A 2AC3A 5L2WA 1VYWA 4ONAA 3FMDA 3KCKA 5HORA 1JKKA 3Q6UA 5EHOA 4W8EA 4CRSA 4I41A 3W1FA 2ZOQA 2BALA 2WTKB 2YM5A 3LPBA 4M84A 3LW0A 5JRSA 2OH0E 2BRMA 2PVRA 3VRYA 5IA0A 3T3UA 1W2FA 2XYNA 3G51A 5FTQA 4E5WA 1XQZA 2Y8OA 1G5SA 3LFNA 4FKIA 4TN6A 4QTAA 3VC4A 4UY9A 4YJUA 4CTCA 4FTRA 2YIRA 4G31A 2F2CB 5TR6A 3KCFA 3QLGA 3BQRA 1QPJA 4IB0A 4UMQA 3R8PA 2R0IA 5AUXA 5AP1A 3KQ7A 2YERA 3QCXA 1W7HA 3R7EA 4CZYB 2PVHA 2VD5A 1Q41A 3DJ5A 4WD5A 3RJCA 2V7AA 3TJDA 4AAAA 3IDBA 3P1AA 5JZNA 1PXNA 3AD5A 4BYJA 3TWJA 4KKEA 4LI5A 5I3RA 2C0OA 3OCSA 3NUXA 4KBAA 4NH1A 4JDIA 4RJ3A 2C3LA 4E20A 4JR3A 2GCDA 5CF6A 3AC3A 3ZYAA 3D7TB 4K1BA 4PNKA 2JDRA 3R63A 4W4YA 1U46A 3DNEA 4YSMA 3RVGA 4DGMA 3FI8A 4G3GA 4Q9SA 1HOWA 4QPMA 5HHWA 3SRVA 4E3CA 4UZDA 2XBJA 3IDCA 4ZJIA 4FV7A 4DE4A 4AAYA 2R64A 2XNEA 5M57A 3OP5A 1V0PA 4AT4A 1UNLA 3PA5A 5D1JA 3FSFA 3PA4A 4A4XA 4RJ6A 2GTMA 2W5BA 3MA3A 4PDPA 1JWHA 5M44A 4L46A 3R1YA 4UMUA 2FSMX 4IAFA 3ZO2A 1OL2A 3QTSA 3F61A 5CU6A 3CGFA 1JVPP 4J96A 4PPAA 3FDNA 4QQ5A 3FKNA 4IHPA 4TZRA 4Z16A 4ZAUA 5C8KA 4ERKA 5DR6A 4IAAA 1JLUE 1G8AA 2IVVA 4WG5A 2R7BA 2X0QA 4U43A 4IZAA 1SVGA 3O23A 5LXMA 3W0OA 1SNXA 4DHZA 4BCFA 1OI9A 4KKGA 2JEDA 4EUUA 2DQ7X 2EB3A 3GU4A 1ZYCA 4PMPA 3V5LA 1WBWA 2E2BA 3BYMA 4NK9A 4NW5A 4KUJA 1PXLA 3EIDA 4DEHA 3O17A 4GUBA 4RZWA 5AAFA 3W0NA 3C5UA 5CEQA 5IDNA 5ACBC 4PPBA 3LCKA 3UVQA 1REJA 3LZBA 1OIRA 2V7OA 3LCOA 4MX9A 2GDOA 2WU7A 3QZFA 4XG9A 3UP7A 5JEBA 5IQCA 3WE8A 3ODYX 3MTFA 3I6WA 3GT8A 3HP5A 3PXYA 3QKMA 3WARA 3MA6A 4IEBA 2GS7A 4DC2A 3UO4A 2ERZE 3DKCA 4LV8A 3RI1A 3UG1A 4EOKA 3PDTA 1H8FA 5M08A 3HECA 5HBJA 2CGVA 2NNWB 5HI2A 4EUTA 3FWQA 3ORLA 4QP2A 2GNLA 3F3WA 4GJ2A 4PQNA 2OF2A 4B8LA 3ZFXA 4WKQA 4O0WA 5HG5A 1GZNA 1YDTE 4FKQA 4YTIA 3UDBA 3T3VA 5HOAA 4A07A 4L3JA 3HKOA 4F99A 2BR1A 2HWOA 5F94A 2PVFA 2CKOA 2Z7QA 4I20A 5LWNA 5EDQA 3BQCA 3RPRA 5EG3A 4EH8A 3KMWA 4O86A 1WVWA 3F5PA 3PVGA 1OKWA 2VO0A 4O0UA 4PWNA 4TWPA 4CFXA 4JMQA 2WMQA 2W7XA 4D4SA 1VLRA 5E1SA 3PP0A 5CEIA 4DEAA 3PUPA 4E73A 3LKMA 3HA6A 2YCRA 3FE3A 2V22A 2B9IA 2QO9A 2UZVA 5J5TA 1GAGA 4BBEA 1OVEA 3REPA 2R3KA 3MY5A 3PA3A 4IVAA 5LARA 1DS5A 4EHVA 5LQFA 5BX0A 3VUIA 4RFYA 2CGWA 4MXCA 1S9IA 5FM3A 5D12A 3ZU7A 4QP8A 2V5QA 1YQJA 2C3JA 3W55A 3WZDA 2QU6A 1YWVA 3I7BA 4KIPA 3NUSA 2J6MA 4RWIA 2ACXA 3POZA 4I0RA 5LVLA 4GVJA 2BIKB 4DDGA 2YIWA 4FA2A 3UJGA 4ZTQA 4LUEA 3PIYA 5FLFA 5JK3A 3UO6A 3ALOA 3GC0A 4RJ4A 3BRBA 4N6ZA 3V5JA 4TT7A 5C4LA 4DAWA 2C69A 3UE4A 4IADA 3BL7A 4D0WA 3FL4A 4AXCA 5KBRA 3QQFA 1XH7A 3NW7A 4U9AA 2C5YA 2F7XE 3OTUA 4O7VA 3KRWA 4PTCA 3WIGA 4FSYA 2EXEA 2FSLX 1UU9A 3FYKX 1SVHA 3FY0A 4FV6A 4G17A 4MK0A 4YC8A 3TKIA 4DYMA 5L6PA 3C5IA 1Y91A 4PMSA 4IQ6A 1YXXA 1H25A 4L45A 5JGBA 4TYJA 4Y95A 5EM5A 1YDSE 1Q8WA 3A62A 4B99A 2DWBA 2Y6OA 5CSWA 2IW6A 4FZ6A 4A06A 2DYLA 2GSFA 4Y5QA 5CWZA 2XNGA 2WELA 3LFFA 5GIPE 1H4LA 3R0TA 4EOLA 3OXIA 3Q96A 3OW4A 2XCHA 3AKKA 3CBLA 3DB6A 4OTRA 3CQWA 4PV0A 4XV9A 3HL7A 1GZ8A 4LV7A 3BV3A 5KO1A 3WYYA 3KK9A 3S0OA 5AIRA 1UKHA 4AN3A 1VR2A 3TUCA 4GYIA 2YN8A 3FMHA 4AA5A 3CPBA 3QTQA 3GNIB 4FZAB 1RQQA 3KY2A 1J3HA 3NEWA 5TT7A 2O2UA 3NUYA 2XNOA 3UG2A 5HIDA 4D58A 3HUBA 4QP1A 5I9ZA 2H96A 4AX8A 2R9SA 3CLYA 4GCJA 1RE8A 3GP0A 5HG8A 5IQIA 4YLKA 4MYGA 4N4SA 2ONLA 4AZVA 2ITNA 3SAYA 3DXNA 5K3YA 4ANLA 4F70A 4TWNA 3LMHA 4FTMA 4JIKA 4N70A 5CAOA 3LJ2A 2OJIA 5E7RA 5CQWA 3HMPA 4MNEA 2R5TA 5E8VA 4WNPA 3PPZA 3QX2A 5L8KA 2GHMA 3E63A 3KB7A 3IKAA 3LHJA 4O82A 4O0SA 2PHKA 1KE8A 5HESA 3D94A 5FBOA 2C5NA 3ZUTA 2UW0A 3EFJA 4FTNA 5IA4A 3MVJA 3MGYA 4FJVA 2P2HA 4M68A 1JAMA 3AQVA 2X2MA 3DPKA 3A4OX 3DNDA 5EYDA 5KNJA 4PTGA 1B6CB 4R77A 4AQCA 3SQQA 3VS4A 4M3QA 3GB2A 2OJFE 5FM2A 4KAOA 4U8ZA 4YPDA 3QF9A 4L68A 3GCSA 3F7WA 2ITWA 3TKHA 5KKRC 4FF8A 4DG2E 2QR7A 2VU3A 3A7JA 3CTQA 3A61A 3P78A 4M7IA 4U97A 3DDPA 1JSVA 2HYYA 2ZV8A 5J7HA 4YR8A 5BV3A 4GK3A 1PKGA 1UKIA 4HGEA 4LGDA 3TNQB 4S32A 4W9XA 2WMVA 4C59A 5LOHA 3KXGA 4EQMA 3FZTA 2WFYA 2W96B 4AZTA 3A2CA 1UU8A 4DFBA 5GNKA 3HMMA 3WF5A 1R39A 4H05A 3R7VA 1F5QA 2C6MA 3OHTA 1TQMA 4CMUA 4UWYA 2IVUA 2CPKE 4BZNA 5IQBA 3HDMA 5ANOA 3SDJA 4FSWA 3PWYA 4H39A 2BKZA 2ETRA 4BCMA 4NFMA 5AV1A 3RAIA 5GHVA 5CAUA 4UYNA 5FQDC 4M66A 1FMOE 3FLWA 4WHZA 3EWHA 3KFAA 4TWOA 4CLJA 4FV4A 4L6QA 3QU0A 3R9RA 1OM1A 3BHYA 1WBNA 3ORIA 4C3PA 2QHNA 3UOKA 4ITIA 2Z2WA 5KKRB 3DBQA 4H1JA 2XBAA 3HV7A 4FL3A 3SV0A 3KXNA 4O7NA 4DEGA 4RIXB 2WMRA 4BDGA 3EN4A 1H24A 5AUTA 1WAKA 2BDWA 3I1AA 3HEGA 2JKQA 2XIRA 4IX4A 4U3YA 5EM7A 3I6UA 3BV2A 4CCUA 3OOGA 4Q5EA 4Z7GA 3UMXA 2BHHA 3ZLSA 1YXUA 5EOLA 1LR4A 4RVKA 3ZRKA 3ACKA 4C57A 4FTIA 4PUZA 4CFUA 4S30A 2ERKA 5EI2A 4HZSA 4ZEGA 3FMLA 4XLIA 2CN5A 3O2MA 4FI1A 4QT1A 2C0TA 2BVAA 3CQEA 3II5A 4X0MA 4CVAA 1RW8A 3RAHA 3GC7A 4D2WA 2RSVA 4U41A 3E8CA 3OTVA 2FSOX 4M0ZA 4RZVA 4YJVA 1V0BA 3PSDA 4XV3A 5LMKC 5J9YA 2W1EA 3FYJX 2G1TA 4YJPA 3VBVA 2BPMA 4IACA 4CYJA 3IPHA 4NCTA 2PZ5A 3M2WA 5L2TA 2NRYA 3EQHA 3UQCA 4P4CA 1YDRE 3PSBA 4YC3A 4FL2A 3ZM4A 4AT5A 1OBGA 2JITA 3C50A 4CFVA 4EOJA 3DBDA 4DDIA 4FT3A 4R3PA 3UC3A 2AC5A 5I9YA 4D4RA 4CEGA 3M11A 4V01A 3RK7A 1Y6AA 1XMLA 3NNUA 4I5PA 4YZDA 4D2SA 4LYNA 2P0CA 4BL1A 4E4NA 3F2RA 2OG8A 5AV2A 4C4EA 5AIKA 3EQIA 3DU8A 4PTEA 4H3BA 4JT3A 4QP7A 3ORMA 5K0XA 3QC4A 4LGGA 2C6KA 4H3PA 2IF8A 5LMKA 4C37A 2QU5A 3UVRA 5CY3A 5ANJA 3VUKA 4IAKA 4RX8A 4BWXA 5HU3A 5LVPA 3TEIA 2WD1A 4F64A 2PVMA 4HVDA 2QKWB 4M14A 4O2ZA 4FG9A 2UW5A 2QVSE 3R6XA 5AUUA 3TV4A 5JFWA 4IWPA 1H00A 5EDRA 3V6SA 2PK9A 4QQTA 2EUFB 1XKKA 1H1QA 3AT3A 3GU5A 1P5EA 3R7GA 4FKPA 4JG6A 2B9FA 5CSHA 3QX4A 2E9PA 5HBEA 3C9WA 2JDTA 4FKSA 3NCGA 2VTTA 2G2FA 5FP6A 5L6WL 2Z02A 4QP6A 4AG8A 2IG7A 3W8LA 2X8IA 3FQSA 2CCHA 4WOVA 5E8YA 4JBVA 3VBWA 4G1WA 4YPSA 3Q4CA 1OKYA 3BLQA 4EHZA 4JQ8A 4F0FA 5M06A 4I6HA 4OBOA 3BHHA 2G01A 2PPQA 5FDXA 4GKIA 5EQPA 4I1ZA 5DNRA 5A46A 4CRLA 4ITJA 5D41A 5ETIA 3VS6A 4B9DA 1O9UA 4XCUA 3R83A 2P3GX 1BYGA 3LCDA 3WYXA 2CKQA 4WT6A 4AW2A 3PJ1A 4TTHB 3V3VA 2VWUA 4FKGA 3VUMA 4D1SA 5I5ZA 5JZJA 4YBKA 5AR2A 3NSZA 4FTKA 4TKSA 4D55A 1GIJA 4P5QA 3SOCA 1DAWA 3QQUA 4L3PA 5EKOA 4AWIA 3ENMA 2XK4A 4FKWA 4YBJA 3W10A 4AZFA 4IBMA 4I5CA 3IOPA 2IZSA 2XJ1A 3SG9A 3GQIA 3COMA 3P79A 5EYMA 4DHIB 4CGAA 2BZHB 5M4UA 3R8UA 1JSTA 4MF0A 3CSVA 3HAMA 4QMTA 4BCHA 3WE4A 3A8XA 3FEGA 2XKCA 3MFUA 4QOXA 4F09A 2HCKA 2CGUA 2X7FA 4BZDA 5AP6A 3SD0A 3PLAE 4BTKA 2QO7A 3LLTA 4O6LA 4ALVA 1XH8A 2BAQA 4OBPA 3R9HA 3ID6C 3PG1A 2J51A 3TIYA 4C34A 5CAQA 4UBAA 4FIJA 4DEBA 2WQEA 3Q6WA 4FKJA 3UQGA 5A4QA 2OU7A 3DJ7A 3R00A 4QP9A 3UPZA 4ORKA 3RTPA 3PP1A 4XOYA 3UP2A 3RPOA 3P5KA 2XK8A 3BU6A 5HCZA 4BHZA 3NFGB 4JDHA 5FEEA 4E5BA 3IW5A 4FGRA 2YZAA 4IDTA 3MIYA 2R3IA 4XV1A 1LP4A 1R0EA 2YM3A 3AD4A 4IZYA 4OBQA 3TN8A 1CKJA 4XX9A 3RK5A 2VX1A 4Y5HA 4ZLYA 1BLXA 1YI3A 3CPCA 3N9XA 4KIKA 2OJJA 2BCJA 4ZZNA 2FUMA 3ZUVA 1F0QA 3THBA 4RC4A 4QYHA 4NFNA 5M56A 4I6BA 1UVRA 3KRRA 3NYOA 5EI6A 5EW8A 5B2KA 4NYEA 3DKGA 1Y8GA 5EDPA 3DZOA 1OGYA 1KV1A 3LQ5A 4O0RA 4HPUE 2J9MA 3V5TA 3IS5A 4FSTA 2ETKA 4JX3A 3BEAA 4O2PA 3U4UA 3KREA 3I5NA 2HZNA 4FK6A 3C4ZA 5A4LA 4EEVA 5BVWA 4FNWA 4PDOA 4FT7A 4U79A 2Z7SA 4L53A 4FEVA 3PPJA 3TNIA 1J1CA 4L43A 4IX3A 2VTLA 2GQRA 2JKKA 5CSXA 3SW7A 2J0JA 4QYFA 4DEDA 3C4EA 4QP3A 1U54A 2JKOA 3HMOA 3QQKA 1E1VA 4I3ZA 4O1OA 4U5JA 3OUNB 3H9FA 4L52A 4YZBA 3E8EA 4O21A 4W4XA 4YHTA 4OAVB 3TUBA 4S34A 4KRCA 3BZ3A 2WTCA 5CI7A 4LUDA 1QL6A 2YCFA 4FOBA 3S2PA 1K3AA 2JFLA 4EH3A 3FZSA 4O7RA 3UDTA 5CXHA 5DOSA 1Z57A 4FV9A 2ITPA 4YZCA 2YABA 5AR3A 3RCJA 4FSNA 4YP8A 2UW9A 4EOMA 4BDBA 5FD2A 2JIUA 4X2GA 4FEUA 2JIVA 2CNQA 5CZHA 5BUEA 5IEVA 1G8JA 3QD0A 5CU2A 4BDDA 2F4JA 2X9EA 3HV5A 4IVDA 4ALUA 5AP7A 2YA9A 3SVVA 4QDEA 4MD7E 3W2PA 3AKLA 2O5KA 2VO3A 4RC2A 4RVTA 3RZFA 5IUGA 2FSTX 4IDVA 1XH6A 4KA3A 5KHXA 3I0OA 4TPTA 3CTHA 5G1XA 1F3MC 3EOCA 4BDAA 4IAYA 3E7OA 5J7BA 4L01A 2X4ZA 2XKFA 1HCLA 5JN2A 4FKOA 2ZM1A 3ZDIA 4FX3A 3HDNA 4UXQA 4EOQA 5DPVA 3BLRA 1UWHA 1H1WA 4RX9A