2WTJA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
304
structure length
287
Chain Sequence
b'MSVYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHECKPOINT KINASE 2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 287
sequence length 304
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtjA01
2YDJA 3BYMA 3D14A 4GJ3A 4NWMA 5HVYA 5A4CA 4PNIA 1H00A 5DBXA 3GU7A 3REPA 3UVQA 5DMZA 4DGOA 3GXLA 4YC3A 1UWJA 2J51A 2X7FA 4QMZA 2QQ7A 3ZUVA 2XZSA 1K2PA 1JBPE 2UW4A 4IFGA 3DDQA 3MH2A 4EH5A 3RHXA 5EKNA 3BPRA 2WQEA 3BHVA 3R02A 5DH3A 4MF1A 4N0SA 2R3MA 2QC6A 4C35A 1OMWA 4QPSA 4KBKA 4W4YA 3LQ8A 3C5IA 5FLFA 1FQ1B 4CNHA 3ZMMA 2CGXA 5JZNA 4C37A 5CI6A 4AA4A 4G3EA 4PTGA 4J98A 4BI0A 1DS5A 4K77A 3UNJA 3DBCA 4FTTA 4O0SA 2YN8A 3D5WA 3T8OA 2Y4IC 3IOKA 4M69A 3KRWA 4G34A 3I6WA 1J7UA 2PTKA 4ALVA 2J0IA 5HCZA 3SXSA 3LJ2A 4O27B 3E8NA 3L9PA 4O2PA 3LE6A 2W99B 3O71A 4I4FA 4ZOGA 5LARA 3LFNA 5AIRA 5BVNA 4H05A 4IWQA 2ZV9A 1KOBA 2XKFA 5F95A 4DITA 2PU8A 4AZWA 3DFCB 3Q2JA 5JFXA 3ZONA 4CKRA 1W8CA 2AYPA 2CPKE 4FIGA 4EK4A 5CEMA 1WBSA 3K54A 5JRQA 2VU3A 4FV2A 2QG7A 2QODA 4CD0A 4YPSA 1PJKA 2XA4A 3GC8A 3AG9A 1WFCA 5KMLA 5CEOA 4M67A 5EYCA 1PXIA 3SHEA 4RWKA 3ZLXA 4O7WA 4QP8A 4RVKA 5HE2A 4YTFA 5EM7A 1V0OA 3NWWA 2ZM3A 4DFUA 4F1TA 3CIKA 4USEA 1ZMWA 2O2UA 3IW8A 5ANEA 5AFVA 2W1HA 4K2RA 3MB7A 4A9RA 5HG9A 1JAMA 4K9YA 4QNYA 3O8PA 3KN5A 4E4LA 1PRYA 3CLYA 3CEKA 5EOBA 4EOQA 4IIRA 4AT4A 2C5XA 4TW9A 5BVDA 3NVMB 1IEPA 4E93A 3KF7A 4CZYB 1G5SA 2OF4A 4MNEB 3OROA 1WVXA 3GQLA 3KK8A 2XH5A 3HNGA 5LQFA 5J9LA 2V22A 4LYNA 4FA2A 4LMUA 4IACA 2B53A 2C69A 4FTOA 2GCDA 1S9JA 5KBRA 4I0RA 4N57A 5ETIA 3ZC6A 4RT7A 3HMOA 2F7XE 1NXKA 3ATTA 3LMIA 4FVQA 5TF9A 5FDPA 4RWIA 4MD8E 2VGOA 1Z57A 1YOJA 4AGWA 2XIYA 4ZZNA 1OPLA 3F82A 2YIRA 2GNLA 2XNOA 2Y0AA 4DINA 4FZAB 2NO3A 5ANKA 1O9UA 2QOCA 5CVGA 3RPSA 2CLXA 4CMOA 3TZ9A 1E9HA 3IW5A 1G8SA 4D9UA 1VYZA 4EBVA 4OTGA 4QTDA 4E4MA 4QT1A 3P4KA 3HL7A 3ZLWA 4FTMA 4XG6A 1TQIA 2RFNA 4D2RA 4B8LA 3UO5A 4Q5EA 1EH4A 1JNKA 2GQSA 4G6NA 4O0TA 4WSYA 2WTKB 4P5ZA 5AM7A 2XF0A 2BHEA 3QX4A 1QL6A 3TV4A 3ITZA 4YHTA 5M4UA 2OG8A 1FINA 3EN5A 3TDVA 2ZOQA 4FSQA 5DFPA 4QD6A 4YPDA 5HTIA 5D9HA 3KMWA 3M11A 2OJIA 3E5AA 4FTUA 3POOA 5FM2A 2QHMA 5HVKA 3C0GA 1MRVA 4X3JA 3ORLA 2CJMA 4ZP5A 3WIKA 3POZA 2BRNA 4GT3A 2BTSA 3HMIA 5GJGA 4J8NA 3GU6A 3EQCA 2XJ0A 5IA0A 2VWWA 5E8WA 4IW0A 4D4RA 5JFSA 2UW5A 4DEDA 4ERWA 3IQ7A 2FB8A 4DFZE 4E5WA 2QKWB 4WOVA 2Q83A 3DTCA 3FC1X 4YJTA 4IAAA 2CKPA 1LR4A 3TKUA 4E6CA 4DFXE 2QOHA 2CGUA 4LM5A 4E6AA 4I6QA 3PXKA 5BVWA 3CKWA 3VUKA 2GMXA 4EC8A 1P4OA 3H9FA 5DEYA 3ANQA 4UV0A 4UYNA 3FC2A 3C9WA 4FUXA 4M15A 5CEKA 2OW3A 3WARA 4Z16A 3FKOA 1BKXA 3K5UA 4PY1A 1CM8A 2CNQA 3W2CA 5BMSA 5IZFA 2PULA 4TNDA 2HWPA 4DGMA 4W4VA 5GHVA 2J0JA 3N4TA 3WF8A 4GK3A 5AP3A 4RIWA 3TXOA 3R2YA 4EORA 1BI8A 3TZ7A 1CMKE 4A06A 5L8KA 2YIWA 1H0WA 5LWNA 4QQTA 4U8ZA 3PWDA 4ALWA 2PPQA 3PA5A 3O51A 3QKLA 1GZOA 3I6UA 4BI2A 3LLAA 2OXXA 4FIHA 5IEYA 4XH6A 1HCKA 3KMMA 3SDJA 4OAUC 3ORIA 3WYYA 3PVBA 4ERKA 4J71A 3OOMA 3OW3A 1OL6A 4GW8A 2YCFA 3WF5A 2OSCA 3UOJA 4IM3A 2I1MA 3U6JA 4JL9A 1YWRA 4PTCA 3L1SA 2BDJA 4BDBA 4NL0A 4IB1A 4JIAA 4E73A 2Z2WA 3GOPA 4PPBA 4ZTHA 3Q4TA 3ZLYA 4XBRA 3KL8A 3Q2MA 4LUEA 4G3DA 2C0TA 3UJGA 4AZTA 3OS3A 4PNKA 4FIFA 3Q32A 4AOJA 3QRKA 4M97A 3UG1A 2JLDA 4FKVA 3ZO3A 1PKGA 2JDOA 4CQGA 4HPUE 3QTRA 5A54A 5K5XA 2X9EA 5M07A 1RDQE 2AC3A 4NIFB 4EH6A 4QRCA 3IOPA 3FKLA 2ZVAA 3BE2A 3DDPA 2E9NA 3TNHA 4DGGA 4RIYB 2UZTA 5CF5A 5M4IA 4H39A 2ITOA 4NT4A 4U43A 3BYSA 4YZDA 4N70A 2Z8CA 2JDRA 3D7ZA 3DAEA 2IG7A 3UP7A 1GIHA 3CPCA 2P0CA 2ITQA 4A9SA 2OIQA 4IVDA 3LKMA 1ZOEA 5E8ZA 2HIWA 5FD2A 5I0BA 4ZEGA 5HD7A 4X3FB 1H08A 2F7ZE 3NAYA 3GI3A 2W9FB 5EHYA 4CFFA 3BQCA 3KRRA 4TN6A 2B4SB 4C3FA 4V0GB 4RJ6A 3GBZA 2PZYA 4FKUA 3W33A 3EQRA 4ITIA 1O6YA 3SVVA 2VGPA 4FKRA 2Y4IB 3DKCA 3EL7A 3IGGA 3AD5A 4OTHA 1OPJA 2QOIA 3TIYA 4BKYA 3ATSA 3VS4A 2VTSA 4DFYA 4ORKA 3NNVA 4KRCA 4M0ZA 4UMRA 4BWXA 3FBVA 4S33A 4O7RA 3KU2A 5C01A 4NM5A 4FUYA 3LFEA 4YJOA 3TIZA 3UGCA 3UZRA 2UW9A 3AD4A 1XH4A 2X8EA 5CALA 3E64A 3UC4A 3P86A 3Q5ZA 3UOKA 2C47A 3UYSA 3V8WA 2YIXA 4NJDA 3W8QA 3NRMA 4XV9A 1BL6A 4FODA 4I41A 4LRJA 4RJ5A 4YZ9A 5ETAA 4CKIA 4Z55A 5BNJA 1ZXEA 4FGBA 4RRVA 3F66A 2EB3A 1YW2A 2PHKA 3KGAA 3W16A 3MFSA 3ODZX 4LGDA 1B38A 4P7EA 5DN3A 3Q9YA 4E26A 2WU7A 3OF0A 3W8LA 4FL1A 1XHAA 3HRBA 3LPBA 4HCTA 4GIIA 4Y46A 2ITWA 4XP2A 3GT8A 5H3QA 3SGCA 4FTIA 4W8DA 2C68A 2UW8A 5DT0A 5M08A 4OTFA 3Q96A 4O82A 4KS7A 3F5GA 3PY0A 3D2KA 2JKOA 3BV3A 3E7VA 5AUWA 3JXWA 4MBIA 4GUEA 3R7UA 5ACBC 2ITPA 5CVFA 4A4OA 4AQCA 2GQRA 3NYOA 4HOKA 4ZY6A 5KZIA 2GHLA 2R7BA 3FQSA 4UMPA 3LFQA 4ZTNA 3QWKA 3PPJA 4Y73A 4WIHA 5E7RA 2HXLA 4FNWA 3LVPA 3UYTA 2OZOA 4TZRA 2WKMA 4C4EA 5TE0A 3Q9WA 5CEPA 4EEVA 4GJ2A 3ACKA 4AW1A 2WTCA 4ANNA 3EJ1A 2PVHA 3EQHA 1ZYSA 4YURA 4K18A 4F0IA 3O23A 3P78A 4IC8A 3K2LA 4TNBA 3QTQA 3GVUA 3T3VA 5CLPA 2IZSA 3PSCA 3CSVA 1R0PA 4YJSA 1SVHA 2PUUA 3A4PA 5IEXA 2YCRA 5TO8A 4TWCA 5E92A 2UVXA 4BCHA 3GCQA 3KB7A 4PL4A 4E1ZA 2J2IB 4D1SA 5CWZA 2CMWA 4WD5A 4BBEA 3AMAA 4S34A 3PZEA 4QMWA 3DPKA 4RVLA 1Z5MA 3HDNA 5HIBA 2J0LA 2J4ZA 2PVLA 2XKEA 2RGPA 4K8AA 3LXPA 3O7LB 4X2JA 5HKMA 4UXLA 3EQBA 5DEWA 2X0GA 3EN7A 4YMJA 4PP9A 5CXZA 3F7WA 4BTFA 4WNOA 4XOYA 2YEXA 4JI9A 3E88A 1G3NA 4MWHA 4K1BA 4C34A 1YRPA 2XK9A 3FAAA 3UODA 3LQ3A 3MA3A 4G3CA 4YHJA 4F7NA 2QO7A 5IU2A 2YWVA 4HNIA 5EM8A 1ZY5A 5LMBA 4RX7A 4FT5A 4ZSLA 3ZRKA 4DCAA 5E9EA 3QZGA 2R3JA 4GVAA 3R7GA 1H01A 4LFIA 1PMUA 3LXKA 4DF3A 1Q3DA 4M14A 3PJ1A 1SYKA 3NNXA 5FGKA 5KUPA 5C26A 3HKOA 4L01A 5HCYA 2GPHA 5DRBA 1KUTA 2ZM4A 2YM7A 3HV4A 3F3ZA 4FKQA 4OTPA 2XUUA 5AUXA 4C3PA 1ND4A 3DKFA 1JLUE 5EW8A 4W9XA 1V0PA 4O7TA 4H3PA 4TWPA 4XV2A 5DI1A 1NT2A 4IE9A 5I3RA 4EOPA 4OGRA 3PXQA 1XH6A 2YAKA 3TACA 3OWKA 5CASA 5AR8A 3ZEWA 4O7VA 4QQ5A 3KA0A 5KBQA 4AX8A 4NU1A 5HOAA 3OCTA 1MRUA 4KABA 2OLCA 1KSWA 4PL5A 4NKSA 4XG7A 3WE4A 2YM4A 2OF2A 4HYUA 3R6XA 3BX5A 3VN9A 2B9JA 4HPTE 5F9EA 3QD4A 1Q5KA 2JEDA 1YHVA 3EFWA 3QYWA 5D1JA 3RZFA 4EK6A 3FMEA 2PL0A 2QURA 4U44A 3RNYA 2YJSA 4IDTA 2X1NA 1KV1A 5HO8A 1O6KA 4ZAUA 3LFFA 2A27A 4G6LA 5EQPA 3D2IA 3R7VA 3SQQA 3ZFXA 4PV0A 3QC9A 3WI6A 5ACKA 4BIEA 4RJ7A 3QCSA 4ANSA 4AGDA 3NMUF 4YBKA 5M51A 3QTIA 1Q8WA 1FPUA 4KIOA 4CSVA 4ZJIA 5IA5A 4O83A 3QWJA 4EOJA 1OM1A 3OXTA 4UMTA 2DQ7X 2VV9A 2J6MA 1XR1A 3Q52A 2YCQA 3MB6A 4GG5A 4EBWA 1F5QA 3Q04A 4G5JA 3G9NA 4N6YA 4RSSA 2JKQA 4IMYA 2Z7QA 3O8TA 3VAPA 1Q8TA 1ZY4A 4IAKA 5H2UA 2F9GA 3VBYA 3R73A 3W10A 3FZOA 4HCUA 5K4IA 2CCHA 2ZDUA 2I0HA 2ITYA 1JKLA 4MQ1A 2BDFA 3DXQA 4BZNA 4ZMEA 3HMNA 4O0XA 4BWPA 5AM6A 5AP0A 2OJGA 2R3PA 3OWLA 4FV8A 4U42A 4DC2A 2VTNA 2C6KA 4P4CA 4NFNA 2VNWA 4DFLA 4V01A 2YM6A 2Q0BA 3BHTA 1CKPA 2C3LA 2ZDTA 4D55A 2WTDA 1BLXA 2O64A 3PJCA 2WEVA 3BRBA 3LOKA 3NNUA 4FKJA 2XP2A 2R3QA 2FSLX 2EU9A 3FSKA 3MTFA 5HBJA 5J7BA 3W18A 1KE8A 3F5UA 3P23A 3R7YA 4BTKA 4DEGA 3RPVA 4NEUA 3BCEA 2B9HA 2RFEA 2XM8A 2CLQA 2Y9QA 1VEBA 4FIIA 4BIBA 4OTIA 4EK3A 4BBMA 2XK4A 1OBDA 4FVRA 4DGLC 2Z02A 3E63A 3DJ6A 1SVGA 2CNVA 2IVSA 3RNIA 1XJDA 3IECA 3I5NA 4DH8A 5J7HA 2JDTA 3E93A 3R00A 1FBNA 3U6IA 2O63A 5J1WA 3GENA 5HI2A 3RHKA 2DS1A 3HAMA 1UKHA 3LXLA 4BDFA 2VWVA 1J91A 4GU9A 1UNGA 2VX0A 2C1AA 4FL3A 4HZRA 2C5VA 3Q4ZA 4DYMA 4BICA 4BCMA 4BDKA 3FXXA 4WUNA 2WIPA 4H3BA 5HD4A 4Q5HA 4ONAA 3RM6A 2C0IA 3KFAA 5BYYA 3ZXZA 5G1XA 5IQIA 3GCSA 3B2WA 2UZLA 2EXCX 3FI2A 3KVWA 2UV2A 4OBPA 4O1PA 4UB7A 4J7BA 5GZ9A 3TNQB 3ZOSA 1DAYA 5CAVA 5IA1A 4BKJA 1YOMA 4UX9A 4IHPA 4CRSA 2C6EA 4BL1A 2VO7A 2WIHA 3P7BA 4FYNA 3BHHA 4RC3A 3OUKA 3VF9A 3PE2A 3SXFA 5HU3A 4MAOA 5I9WA 4LL0A 2P4IA 2UVYA 4D1ZA 3QUDA 2W5HA 5IQFA 3MS9A 3EHAA 3F2AA 3A7GA 4DBNA 1YWNA 2QLQA 4UWYA 3NCZA 4FV0A 2XYUA 3V01A 2HXQA 3HVCA 5KCVA 3T9IA 3LFDA 4DT9A 4QNAA 3PJ3A 3VW6A 5HLPA 3A60A 4CFUA 2W7XA 4WBBB 2IZRA 4I6HA 4U6RA 3VULA 4LV8A 4AT3A 2Z7LA 5EOLA 2EB2A 5GIPE 4CFNA 4E4NA 3GGFA 1A06A 4QYGA 3IDPA 3NUXA 3Q53A 3ZM4A 2YJRA 4HGTA 2V55A 5KMMA 2QOOA 1IR3A 4TYHB 3RK5A 1XQZA 3Q6WA 4WRSA 4X7QA 3W2SA 4DA5A 1PF8A 3QQUA 2GS2A 4CRLA 2PVKA 3HYHA 3QAME 3I1AA 3R01A 4R1VA 2UZDA 2XJ1A 3GU4A 3KQ7A 4QYEA 4L52A 3MIYA 4CFXA 3TWJA 4G16A 3V5QA 4IAFA 3SA0A 3A2CA 3OBJA 3AOXA 3KMUA 3R83A 4I24A 3R9NA 2XRWA 3OW4A 3RGFA 4R7BA 4GU6A 4QQCA 4AGUA 4X6RA 2YCSA 4ZTMA 2C3KA 3MPTA 4IANA 5HEZA 3OWPA 1KE5A 4FT7A 2CN5A 3R8MA 4CV9A 2UZWE 4FIEA 5DE2A 3QLFA 4CQEA 2JC6A 1J7LA 3QU0A 3C4FA 3ZZEA 4QOXA 4F64A 3NW7A 5AV0A 2WQMA 2QD9A 3W2OA 5GZAA 4X2NA 5T68A 4XOZA 1BI7A 1KWPA 1XH8A 1BUHA 4OTRA 5A6NA 4O84A 4O1OA 3GCVA 1YWVA 3NUYA 3PZHA 3TN8A 5HORA 4FSZA 2AC5A 3SX9A 3I7CA 4U7ZA 2WB8A 2VWIA 2ACXA 2R4BA 2OKRA 4L42A 3BBWA 3L9MA 3BELA 5C27A 1I09A 5CAUA 3PYYA 4HVSA 4I22A 4MNEA 3BU3A 5AUTA 4JVGA 5B2LA 3EH9A 3HEGA 3C0HA 4OW8A 3WZDA 2CKOA 2QOFA 3ULZA 2WU6A 1OKVA 3DGKA 2IVVA 1J3HA 4XNEA 4YZCA 5CF6A 4Y5HA 3AC5A 1NY3A 3OCGA 3FZ1A 3B8RA 4XG2A 5ANJA 5TT7A 2VTTA 4IWOA 4DT8A 4M3QA 4UBAA 4RZVA 3ZBFA 4LI5A 2PZIA 2G9XA 3LCDA 4QTEA 5ICPA 3DAJA 5L2TA 3O96A 4YO6A 1J1BA 3ZLSA 4XRJA 4KWPA 3NAXA 2I7QA 1JOWB 3FMMA 4F9AA 4GT5A 5B7VA 4BCJA 2WNTA 4EC9A 3Q9ZA 3OCBA 5IDNA 4GMYA 5J5SA 3VO3A 3R7EA 5LJJA 3PLSA 2SRCA 4XLIA 3KRJA 3Q6UA 3CY2A 4S2ZA 2GHGA 4ITJA 4IM0A 4XRLA 3ZO1A 3LJ0A 3IG7A 4O0VA 2CKEA 4AE6A 3UZTA 4UYAA 4CCUA 5IUHA 2KULA 3C4CA 5EQYA 2W1ZA 3CJFA 5AUUA 4BVUA 4BR3A 1K9AA 5M56A 3RBWA 3BLRA 3COIA 5BUEA 1FVVA 4BCGA 3A62A 3UIBA 2VD5A 3AMYA 3K5VA 1PY5A 4RQVA 4FSUA 4YLJA 2ZAZA 4ZLZA 2QU6A 4ZS4A 1RQQA 5LVMA 4FOCA 4F9WA 5M4CA 5TKDA 4YJQA 4JBOA 4AAAA 5IH5A 4FEWA 3JY9A 2QOKA 3R7IA 2XNEA 3GP0A 5EI8A 3ETAA 3QCYA 5H8GA 2HZIA 4O81A 4IJPA 4BDJA 3C4XA 2R2PA 2V62A 2ESMA 3PTGA 3E7OA 4M8TA 3MI9A 4NTSA 2JIIA 3LQ5A 1PYEA 4RVTA 4B4LA 3KRLA 4IFCA 2F49A 2PZ5A 3LCKA 4QTCA 4AW2A 4WG5A 1LEZA 4H1JA 4JR3A 4AW0A 3RCDA 4RA5A 3HUCA 3UMWA 4ACDA 2BKKA 2VWYA 3QRIA 4PDYA 1WBTA 3VBXA 3JYAA 1JSTA 1FMKA 4XP0A 3MA6A 3FI4A 4FZ6A 3GU5A 3NX8A 4ZJVA 5FEEA 4ACMA 3P5KA 2PUIA 3TJDA 1ZMVA 2XK7A 1OGUA 5FXQA 4EH9A 3QHRA 3EWHA 4KAOA 3FEGA 3ORPA 4U0IA 5TR6A 4FF8A 4YJNA 3TM0A 3NYXA 2IVUA 4BDCA 3GCUA 3IKAA 1MUOA 3PY3A 3E8DA 3CBLA 5HO7A 3MY5A 4N4SA 3IO7A 2JFMA 3MFUA 5ANDA 5ITAA 4F7JA 5EW9A 1H26A 2J90A 4DCEA 5KE0A 1ZMUA 4L3LA 4MNFA 1R39A 4V05A 2H34A 3ZRLA 5BUIA 3PXYA 4FK6A 3UIMA 4F65A 4O22A 4TYJA 3RTPA 3ORZA 5EKOA 3AT3A 2GU8A 2X2KA 4BTMA 2QG5A 5DVRA 4LMNA 3TL8A 4BTJA 1KOAA 3CD3A 2BHHA 1OUKA 3QX2A 5LCKA 3RAIA 4C62A 1Q4LA 3H4JA 2WMXA 5AP1A 3E92A 2C3JA 5CEIA 4ARKA 1YDTE 5AR3A 2XB7A 3LW0A 4U9AA 3NIEA 3QL8A 4NIFA 2C6LA 4D2VA 2UZNA 2C0OA 2WAJA 4FKTA 5M09A 2C6OA 4S31A 4KIKB 4RX8A 5HCXA 4RIYA 3WE8A 5M55A 4M7IA 3PIXA 5D41A 5JH6A 1H1SA 4DG0E 2C6TA 5E8UA 2V7AA 1R78A 3SC1A 3F7ZA 4HVDA 3UP2A 1MQ4A 2YLFA 3MFRA 4HYIA 3OFMA 4CYJA 2QOQA 3F9NA 4USDA 4IX5A 3E3BX 4HJOA 3V5TA 3SG8A 2GNJA 3MTLA 5M44A 5CNNA 4FYOA 4O6LA 4CXAA 3G5DA 4PMPA 2ONLC 4UN0C 4X3FA 4Z7HA 3WILA 3EIDA 5E90A 3V8TA 3DK6A 4V0GA 5CU4A 1S9IA 2B7AA 3C4EA 4F7SA 3FXZA 2CSNA 5D12A 2R0IA 3PSBA 4MF0A 4BDDA 4FTAA 4FZDB 4MH7A 4ZZOA 5IQAA 3HA6A 2PMNX 5I9XA 3R04A 5CF4A 2WMSA 4JT3A 2FGIA 1XH5A 1T45A 3CC6A 5IPJA 3LXNA 2IW8A 4C8BA 5IH4A 4IB3A 3HDMA 3P79A 4O0WA 1WAKA 5D7AA 3OWJA 5JGAA 1PXJA 2ZV2A 3TNIA 4BCFA 4R8QA 3MN3A 3SV0A 4FE2A 3AGLA 3PSDA 2F7EE 4FICA 5A46A 4QQJA 3TEIA 4QMXA 3DA6A 3UO4A 5L8JA 4CEGA 2NPQA 3TI1A 3VBWA 3UPZA 2OXYA 5EI2A 4IAIA 3TUDA 4G6OA 2OH0E 2OO8X 3U4UA 3JVSA 4NYEA 4DH5A 5AX3A 4FKLA 5FEQA 2BUJA 1Q24A 3SD0A 3ZH8A 4XG9A 3W1FA 2O8YA 3QTWA 5A9UA 3DZQA 2YDIA 1WBPA 3ENMA 4LOPA 1JSUA 5I9UA 4P90A 3DLSA 1SVEA 3IPHA 3NGAA 5IQDA 2VTAA 4GH2A 4IWDA 3A7HA 2WMVA 4L9IA 5F1ZA 4ZLOA 3I60A 4M84A 4AT5A 2W1GA 2PVJA 1JSVA 3LZBA 2GFCA 4FBXA 1HOWA 4GIHA 4EH8A 1AD5A 1LEWA 4EH4A 5KZ0A 1P4FA 3FL5A 5EYKA 3AQVA 4YP8A 3TZMA 3QKMA 2EWAA 3LMGA 4I5PA 4RG0A 4DAWA 2PE2A 1W83A 3V6RA 5JT2A 2DUVA 3L8PA 4JS8A 5E8XA 4H1MA 5K5NA 2W4OA 1H07A 4FIJA 4O2ZA 3HA8A 5HG5A 3VBQA 3OP5A 5KHXA 1F0QA 4XG8A 5CSXA 3QTSA 4RIXA 3BV2A 3R28A 4DH1A 5M57A 4G2FA 5JK3A 2VTJA 2QVSE 3NSZA 3W55A 1DI8A 3WZEA 3I79A 4DLIA 4DBXA 3TTJA 4JG7A 2Y6OA 2YACA 2XBAA 3TKIA 5E8VA 3DB6A 2C5NA 5K9IA 1UVRA 3UG2A 3KREA 5ETFA 3GCPA 3OC1A 3C1XA 4X2GA 2H6DA 3H9RA 2LGCA 4XLVA 2W4JA 3IGOA 1KE7A 4D28A 3S0OA 3HP2A 3IDCA 5D7VA 3MWUA 3DBDA 5ANIA 3E87A 3WYXA 4JDKA 4YSJA 3C5UA 2BFXA 3H10A 3KKVA 2PMOX 4OR5A 3VUTA 4D4YA 4EYJA 5A4LA 3K3IA 3UQFA 5FTGA 2V5QA 5EYMA 4EONA 4OTDA 3NPCA 4I21A 3IW7A 3RALA 3NW6A 2XIRA 3OBGA 2HENA 2PMLX 4KSQA 3FLZA 5LVPA 3MPAA 3LAUA 2GTMA 2I40A 3JR1A 1YI4A 2VO6A 2YAAA 3ZSIA 1H1WA 2JKMA 2YFXA 3BYUA 3PG1A 2OBJA 2VWXA 3F3TA 4I6FA 3ROCA 2GNGA 3UTOA 4ACCA 4Z9LA 4EZ7A 2V7OA 3SLSA 4I5HA 2XKCA 1YOLA 3NR9A 3NVKI 4MX9A 4BDEA 4CTBA 2XIZA 1YQJA 2JDSA 4DEAA 4U3YA 3LIJA 2BRMA 4JX7A 2I0EA 1WCCA 4WNMA 4QP6A 3WZJA 4B6LA 3OHTA 4WA9A 3VRZA 3A7FA 1K3AA 3KF4A 3RK9A 3TT0A 1T46A 4NCTC 1PHKA 3V5LA 3L9NA 1H1PA 2J5EA 2GSFA 4PRJA 3GUBA 3A7JA 3OTVA 4R7HA 4OTQA 4QYYA 5DA3A 5HNIX 4C38A 2JIUA 3FDNA 2VN9A 4IXPA 3HLLA 5I5ZA 3RAWA 4RLLA 4F09A 4WBOA 4MXCA 4BRXA 1ZLTA 2BRBA 1ZOHA 4I92A 2BPMA 4KD1A 4L7SA 4NTTA 4TYIA 3DBFA 5D11A 3A4OX 2BAKA 4A4XA 2HW6A 2YDKA 4QMQA 2YHVA 4RWLA 4ANOA 4ITHA 4GFGA 3F2NA 2OIDA 1M14A 4S32A 2C6DA 3S3IA 3QALE 5DLSA 4JDIA 5EDPA 5AWMA 3KXXA 5KMKA 5C8MA 4C61A 3RVGA 5EM6A 1U5QA 4D2TA 1J7IA 4A7CA 4FEUA 4YJPA 3QQJA 4RX9A 3TDWA 2OU7A 4MYGA 3MGYA 1W82A 4D2SA 5HG8A 2R64A 4RIXB 4PX6A 2ETRA 2WOUA 4MBJA 1Y91A 3GB2A 4RBLA 5FP5A 3ZDUA 4APPA 3TUCA 2BRHA 5CEQA 2W0JA 4EOMA 4I4EA 4IBMA 3DK7A 3QLGA 3PY1A 3VQHA 4HVHA 2VUWA 2R3KA 3VUHA 5K4JA 1V0BA 2R3LA 3BYOA 4DLJA 4YLKA 4Y95A 4QTAA 5A4QA 3ULIA 4EKLA 3ACJA 4K6ZA 1PXNA 2XIXA 3FE3A 2VZ6A 4GRBA 2G2FA 3NUPA 4E6QA 3ALOA 3G6HA 1OIRA 1UKIA 3FZRA 4ACHA 3Q4UA 5IQGA 4ZTQA 3ZXTA 2VTRA 3M42A 5T3QA 4AZEA 4FKOA 1WZYA 5CY3A 3MPMA 4KKEA 2VX1A 5H9BA 4BGHA 2J9MA 4YU2A 5KMIA 2UZVA 2NRUA 1Y57A 2WGJA 2BKZA 5CI7A 4YZBA 2F4JA 1W7HA 3TV6A 4DH3A 2ERKA 2IZUA 2W1EA 4O38A 3CQWA 5HGIA 3FY2A 2I0VA 2IPXA 1H24A 3FV8A 5T6KA 4BCIA 4XJ0A 2X9FA 4FGRA 5KX8A 1OITA 3ODYX 1A48A 2QCSA 1YXTA 3D0EA 3QTXA 4KSPA 1AGWA 4X2FA 3QA8A 4BZDA 5JFWA 5FEDA 3OY3A 4ZLYA 4FT3A 4O21A 4WHZA 5IH6A 1JQHA 4TPTA 5LMKA 4Z7GA 4DHFA 3ZYAA 3VUMA 3ZSHA 4IX6A 2W17A 5J79A 2LAVA 3G51A 2OI4X 5AV1A 4PDPA 4UZHA 2R3HA 3RMFA 3ZFMA 5J5TA 3COMA 2XKDA 4FG8A 3LCTA 5CS6A 5I4NA 5IQEA 2RL5A 4NM0A 2QNJA 1MQBA 4QPMA 5I3OA 3B8QA 2VX3A 3LFSA 1OKYA 2X8DA 1TQMA 4EZ5A 3L8SA 2GS6A 4FG7A 4B9DA 2WMUA 3FKNA 4I20A 5EHOA 4C4GA 4D58A 3CCNA 4FTQA 3SAYA 4V04A 5AV4A 3ZUTA 3ORMA 3KY2A 1ZAOA 2VTIA 4MXZA 2W96B 3QRUA 4L46A 4XV3A 4GYGA 3UQGA 2YIYA 4AA5A 5EDRA 1KE9A 2JGZA 2W1FA 3FMHA 3CE3A 2WMRA 3MY1A 3D4QA 4ZSJA 2QOLA 3VS2A 4A9TA 1ZRZA 3KXZA 3NYNA 2B9FA 4QMOA 4Y5QA 3RAKA 1UU8A 4I6BA 3OY1A 4CZTA 3N4UA 4ZMFA 4DEIA 1I44A 3UDBA 2W4KA 3DZOA 3II5A 1GZKA 1Q8ZA 4L3PA 2W5BA 5EW3A 1CDKA 3A8XA 3UOLA 2R3NA 5E4HA 2E9VA 5AUYA 3HRFA 3MH3A 2QO9A 4HYSA 3OCSA 4YJVA 3RPOA 3RWQA 4F99A 4UWCA 3ZS5A 2R3IA 4A4LA 3U9NA 3BYVA 4RLKA 3I81A 4H3QA 3V8SA 5E8YA 4EKKA 2O0UA 1CKIA 2NRYA 4BCPA 1ZOGA 4EJ7A 4L45A 2JKKA 3A8WA 1TQPA 4F9YA 3U54A 4PPCA 3SRVB 4IX3A 2YWPA 3FLSA 4G3GA 4YSMA 2ERZE 4FKWA 4LL5A 3S00A 5CT7A 1GJOA 5L4QA 2PSQA 4ALUA 4ZSAA 2PUNA 3DK3A 4R5YA 4EUUA 3SG9A 3OUNB 4J97A 4DFBA 3E62A 4B99A 4E5AX 3DBQA 2XS0A 5DOSA 4FNZA 3TG1A 3ZZWA 4FZFB 1YHWA 5B2MA 4OTWA 5HZNA 5J9ZA 3D7TB 5J1VA 5E91A 4MBLA 1XO2B 1M17A 4U40A 3UBDA 5L8LA 1JKSA 2Y8OA 4J52A 3P9JA 4HZSA 4TYHA 2PE0A 2QU5A 4XEYA 2HWOA 5AIKA 2A0CX 4IZAA 4EYMA 3FMLA 5AADA 3F5XA 3P7AA 4O0RA 4BF2A 4E8AA 5KNJA 4QP7A 5DT3A 3MIAA 4JG8A 3R9DA 4QMTA 2WMBA 4AS0A 3N9XA 4AGCA 1P5EA 3D5UA 3G6GA 5AP4A 4C33A 4C58A 2B9IA 2OFUA 4AA0A 5C8NA 4Y85A 2EXEA 5LVOA 2YA9A 4D0XA 4BN1A 4JJRA 5CZHA 3F88A 5AR4A 4N6ZA 3U9CA 1ZYLA 2J0KA 3ORXA 4IDVA 4L43A 3HUBA 3EFJA 4LG4A 3OT8A 4MTAA 4WT6A 4ZTLA 3O50A 5IDPA 3KXMA 4RA4A 3CXWA 4R5SA 5E8SA 1ZARA 3WZUA 4AG8A 1W0XC 2YISA 3W32A 4LOOA 2PWLA 1OL7A 4PUZA 1U4DA 4F0GA 4CFVA 5KMNA 5IQHA 5FBNC 3QGWA 4UXQA 5L2IA 2YZLA 1ZZLA 5AR5A 4IWPA 2WPAA 4BC6A 2OXDA 5CYIA 1U5RA 5L6PA 1Y6AA 3FYJX 3QBNA 3WBLA 5FUTA 3VC4A 3BU6A 4BCOA 4CYIA 2OZAB 4YUQA 3RZBA 4W8EA 2DWBA 2PK9A 4R6VA 2WQBA 4X2KA 2GTNA 2C6MA 2XVDA 3ZDIA 1JPAA 4LRKA 3ZBXA 4AWIA 3U55A 3R1YA 3NUUA 3GEQA 2A1AB 3VWAA 4FEVA 1Q97A 2UW7A 1WBNA 3A61A 4ID7A 2BZJA 4FTLA 2C1BA 3SOAA 4C36A 3FQEA 3RPRA 1U54B 2WD1A 3VUDA 3PWYA 4E20A 3H3CA 4I23A 4O7NA 2Y6MA 5JEBA 3Q4CA 1NVQA 4CV8A 5M06A 3DQXA 2J5FA 4CKJA 4PTEA 5BVOA 2BDWA 5JMSA 1UV5A 4FI1A 2IVTA 3FLNC 3QGYA 3R9HA 3UNZA 5IMXA 3FL4A 3PJ8A 5AUZA 2WMWA 1YHSA 5IG1A 1VJYA 1CKJA 4GK2A 4JBVA 3CGOA 4FSRA 4QMUA 5IISA 4ZJJA 2HYYA 1WVWA 1Y6BA 5IEVA 1QMZA 1LP4A 1XH7A 4TWNA 3PIZA 2WHBA 3BHYA 3EB0A 1U59A 1H0VA 4DFNA 4O0UA 3BBTB 2RFSA 3G9LX 4R78A 1GZNA 4F08A 3PA4A 4F6WA 1RE8A 2ITTA 3O7LD 1PXPA 2VTHA 3P0MA 4AF3A 3MVJA 2UW3A 2VRXA 2WOTA 3HV3A 5HIEA 3BU5A 5HTCA 1PMVA 5KMOA 4MWIA 1WBVA 4ANMA 4CFMA 4FV1A 1M7NA 1YVJA 4I0TA 4QMSA 3VNTA 2W1DA 3EKKA 2WMTA 4HW7A 4BGQA 1M2RA 3OMVA 4WKQA 4CTCA 3R30A 4MXAA 2FO0A 2BZHB 5BVEA 4K0YA 4L44A 4Y83A 1OZ1A 2OICA 2HELA 2C5OA 3CD8A 3PIYA 1R1WA 3PPKA 5DT4A 3VUIA 4EH7A 4DE4A 1XH9A 2B54A 2H8HA 4NW6A 2ZYBA 1OECA 4EHZA 4WG3A 2Z7SA 2GFSA 5IA3A 2KTYA 5HIDA 3V51A 4UWBA 2HCKA 3CTJA 3HMPA 2DYLA 5DYJA 1YXUA 3DLZA 4EL9A 1YXSA 3DNDA 3CTHA 3U51A 2W1IA 2P2IA 1H1RA 2PVRA 2QLUA 2YM8A 4WNKA 3LMHA 5BMMA 2O3PA 1IRKA 1V1KA 4U80A 1FGKA 3FMJA 4NK9A 3SKCA 5K3YA 3PJ2A 2GQGA 3Q9XA 1H28A 4JDJA 5CQWA 1E1VA 2WQOA 3BKBA 4U79A 3DXPA 1QPJA 3DB8A 5F94A 4L68A 5HBHA 3PVGA 5AAEA 4CT2A 4RC2A 5HO6A 2PVYA 2VWZA 4NZWB 5IF1A 5A4TA 4G17A 3QZIA 2HZ0A 3NIZA 1OL1A 4DH7A 2WEIA 3D9VA 3OEFX 4QPAA 5A3XA 3TZ8A 4AN2A 4EHEA 2FSTX 3OOGA 3TV7A 4NJ3A 3KC3A 4JBPA 5HHWA 3QRJA 5FG8A 3THBA 5CTPA 2GNHA 3OG7A 3AT4A 1OIQA 3F69A 4BWKA 4O7YA 1GY3A 1VR2A 4YHFA 3UPXA 2R5TA 1FMOE 1HCLA 4BYIA 1WBWA 3QCXA 2P33A 2WMAA 4FMQA 3RCJA 3ZCLA 4BZOA 3V6SA 2XYNA 1IAHA 4FV9A 2QONA 4KINA 4FTKA 4QP1A 3PUPA 3AMBA 2ZJWA 5J8IA 5BUJA 1Q3WA 4IQ6A 4YZNA 3VS3A 1PXOA 3MVLA 2FYSA 2XK6A 2W1CA 4AOIA 2GDOA 1NVSA 4EHGA 5LOHA 1FOTA 4HGSA 2BFYA 4BHZA 5GNKA 1ZYJA 4PMMA 3PPZA 3BWFA 4AOTA 4FV5A 4XHKB 3O8UA 3KULB 5F20A 2OFVA 1FGIA 3ANRA 3FJQE 3S2PA 4KIKA 4E5BA 2BR1A 3O17A 3KEXA 4QP3A 3FUPA 4J1RA 3VS1A 3ZO2A 4X21A 4LUDA 4DTKA 5CU6A 3HV6A 4JQ7A 3DKGA 3G0EA 3RINA 4D1XA 4OT6A 2OWBA 3C4ZA 5ETCA 4FTJA 3D5XA 4PDOA 1B39A 1MP8A 4WUAA 3CR0A 4BI1A 2B0QA 4YC6A 1PKDA 2FH9A 3FY0A 5CXHA 3R7OA 3UC3A 4BGGA 4EOIA 5IMEA 3R21A 3PRIA 4FKIA 1YI6A 2FUMA 3HMMA 4UALA 2IN6A 2ITUA 4X3FC 3OD6X 1BYGA 4LOQA 5I9YA 2J7TA 5EI6A 2CCIA 5EK7A 3WF6A 2XCKA 3CTQA 4K33A 5AP5A 3ZO4A 5CANA 1RW8A 3GOKA 3I7BA 4EWHA 5DPVA 3NUSA 1NA7A 2ZM1A 4RMZA 3UIUA 1GIJA 2Q0NA 3HX4A 4L00A 2ZMDA 4B8MA 4E4XA 3NUNA 2VTQA 3PXRA 4FV6A 2X2MA 3JS2A 3QRTA 3UIXA 1PXKA 2WZJA 3EN9A 4Q2AA 4AFEA 2JIVA 4XYFA 2R7IA 2FSOX 5CSVA 3VS5A 2JAMA 4IM2A 4FX3A 4EK5A 4FTNA 3HECA 2OH4A 1TKIA 4W4XA 1E1XA 1R0EA 3AGMA 4M12A 3QD0A 4DEBA 1SMHA 4FTRA 4PL3A 3MBLA 4PMSA 4L53A 5AA9A 5LCJA 3AD6A 3EKNA 4QYHA 5HU9A 1P14A 2QR7A 4R3PA 5CQUA 4RIOA 5H8EA 2A2AA 2UZUE 4OBOA 2OJFE 5C9CA 5B0XA 5E1SA 4M66A 1WMKA 2YLEA 4EQUA 1IA8A 4GFMA 5AUVA 2GHMA 2Z60A 3QQGA 4I1ZA 4ZZMA 4EWQA 5HG7A 5KO1A 3OT3A 4F63A 2A19B 5L6WL 4D5HA 3HAVA 3ZC5A 4F70A 3FZPA 2HY0A 3R8UA 5KKRC 3D15A 4RJ3A 1Q61A 4L8MA 2WFYA 5ANGA 3W2PA 2Y4PA 3IK3A 2BIKB 4JRNA 4O96A 5J9YA 2R3GA 3TJCA 3EQFA 3V3VA 1CTPE 4CCBA 2YIQA 5KHWA 3WIGA 4EK8A 4GYIA 2VWUA 3QC4A 2WO6A 3KXGA 4ENYA 2WMQA 4AW5A 3C7QA 5JQ5A 4CG8A 4AN9A 3OEZA 4F1OA 4RFZA 3RM7A 2PVFA 2XM9A 3QTZA 2QHNA 3RP9A 3RPYA 4HVGA 4EH2A 1WVYA 5FBOA 3NEWA 1OB3A 5DR2A 3E8CA 4U81A 1NVRA 1OKZA 3ZRMA 2ZV7A 3QUPA 5E1EA 3COKA 4BB4A 2RSVA 3KVXA 4BYJA 5K0XA 2JAVA 3VRYA 3W2QA 4IZ7A 2HW7A 1OVEA 3A99A 3MDYA 5EDQA 2BVAA 3HP5A 3Q60A 3R8VA 5TOZA 1KE6A 1KV2A 2YM3A 3UVPA 3C4WA 3ZHPC 4CT1A 1UNHA 4BHNA 3PVUA 3MVHA 4C4FA 2VTMA 2CGVA 4GK4A 3CGFA 4O0YA 4GEOA 4M0YA 4PDSA 1IA9A 2HOGA 3ALNA 4W9WA 4C7TA 3UQCA 4GKHA 4YNOA 2HK5A 3FMNA 3FMKA 4YTIA 3H0ZA 4EOSA 3CKXA 4ANQA 4BIDA 4M69B 2O65A 2F2UA 3QD2B 5GZ8A 1BMKA 3FSFA 4MXXA 3VVHA 4ASDA 2VTOA 3QKKA 5AP2A 4YR8A 2EVAA 2Y7JA 2VO3A 2WTWA 4G3FA 1W98A 3ROYA 4EUTA 5L2SA 3MESA 4J8MA 2JFLA 2XRUA 1OPKA 4A9UA 3HRCA 1Q8YA 3BGQA 5HICA 4AN3A 3SXRA 3LJ1A 4C59A 4P2KA 3MVMA 2RIOA 3VHEA 3GFWA 1Y8YA 3EN6A 3FHIA 4CZUA 4FSMA 5LWMA 1YI3A 1GOLA 3AT2A 3F6XA 2R3RA 4CMTA 3ZFYA 1STCE 3TCPA 3DU8A 5EH0A 4MD7E 3LFCA 4QMPA 5D10A 5BPYA 5HTBA 3DNEA 4E6DA 4O7ZA 3HZTA 3R1QA 4O7SA 1DAWA 4OBQA 4WSQA 3CJGA 2CHLA 1DI9A 2RFDA 2XIKA 4UMQA 5EQEA 3DCVA 2BMCA 5JZJA 1URCA 4FV4A 1ZYCA 3AC8A 1R3CA 5IUIA 4F6UA 3QZFA 5FXRA 3C51A 4D2PA 3C0IA 5HESA 3LHJA 4KIPA 5CSPA 1G8AA 3ZU7A 4WRGA 3BE9A 5A4EA 4XV1A 5AA8A 5KMJA 2VO0A 2WTVA 4DEHA 4EOLA 5FM3A 4FK3A 4RFMA 2YERA 1OIUA 1APME 1UU7A 2C3IB 2XCHA 4QP4A 3G33A 3UE4A 4PP7A 2FSMX 2X4ZA 5L6OA 2E9PA 4I5MA 4JOAA 4XBUA 4YBJA 2BTRA 3NNWA 4C57A 4DG3E 3Q3BA 4IC7A 1VYWA 3CQUA 1URWA 2QR8A 3QQKA 2EXMA 4FKPA 4U45A 3PA3A 3IW6A 2VWBA 3F61A 3NUAA 3QTUA 2UVZA 2X7OA 2RG5A 2GNFA 3FYKX 4HGLA 1Q99A 3IDBA 4R7IA 5HNBA 2XK8A 2B1PA 1OL2A 3E8EA 5HLWA 3N51A 5IQBA 4OLIA 4FKSA 3PP0A 4ACGA 3EZRA 1IASA 2GS7A 3VHKA 3PFQA 3PRFA 4LV5A 3IW4A 1XBCA 2G2HA 4J96A 4M13A 2FVDA 3BEAA 5CT0A 4AACA 2PUPA 2PVNA 3NZ0A 4YJRA 5GIOE 3R8ZA 4NM7A 4CG9A 5B2KA 4QMVA 4G9CA 4IZ5A 3MSSA 1OKWA 2HZ4A 3GC9A 4XS2A 3OXZA 3ZTXA 3BGZA 5C03A 3RK7A 3ZM9A 3I0OA 3QXOA 3FXWA 4ANBA 4FZ7A 1VZOA 5CU0A 2UZEA 2HY81 1UNLA 2F57A 4YTHA 2J50A 2QO2A 2ZMCA 5CSWA 4AP7A 3GU8A 1PXMA 2VAGA 4IVAA 4EI4A 3S1HA 4MVFA 1H8FA 5FTOA 3WOWA 2CDZA 3NS9A 1IG1A 4KS8A 1OIYA 3DJ5A 2E2BA 2YZAA 4JBQA 4IJ9A 2X4FA 3JY0A 3EQGA 5AR7A 2ONLA 2BIYA 2C4GA 4ZK5A 4DN5A 5JKGA 1YXVA 4PF4A 1RJBA 4U41A 5EFQA 3VIDA 3V04A 3WZKA 5C8KA 5JSMA 4U97A 2GNIA 5EHLA 1XBAA 4FOBA 1A9UA 3O2MA 2BILB 2ZB0A 4ASZA 3UZPA 3KRXA 1FVRA 2PYWA 3QXPA 4PQNA 2OIBA 2UW0A 3PXFA 3NYVA 4R1YA 4BKZA 4QMMA 5BX0A 1UU9A 4Q9SA 3MJ1A 4IB5A 4FEXA 4KUJA 4FL2A 4FSYA 4C4IA 5LMKC 3R22A 5F4NA 1M2QA 2UW6A 1REKA 4EOOA 2P2HA 5BYZA 1Q8UA 2BCJA 4NW5A 5CU2A 4AFJA 4DGNA 5C4KA 3VUGA 2CN8A 4YGAA 4TYEA 4UMUA 2CKQA 4KRDA 3DJ7A 5HQ0A 2CNUA 2ETMA 4OT5A 5DR6A 3CY3A 3EN4A 4NSTA 3VS0A 2JITA 4IADA 4F7LA 4CLIA 4JG6A 4JNWA 1H27A 4L6QA 4KIQA 4AUAA 1SZMA 4IVBA 1MRYA 3EFKA 4A9YA 4EH3A 4D9TA 1F3MC 2YITA 3DTWA 1PXLA 1BX6A 3NDMA 4RIWB 4Y72A 3U4WA 5LXMA 3DBEA 2JBPA 3PVWA 3R71A 3QA0A 2YM5A 2HZNA 2B55A 3JUHA 4OAVB 2F2CB 5IUGA 2WELA 4O91A 4QYFA 1P2AA 5BVFA 2ITNA 2ITXA 2IWIA 5FRIA 3JPVA 3A7IA 4RVMA 5KKRB 1OI9A 3HGKA 2JD5A 5CU3A 1Z9XA 4JXFA 2VNYA 4LGHA 4YLLA 5A6OA 2W5AA 3P7CA 4GG7A 4ENXA 1PW2A 4II5A 2X6EA 3EZVA 2P55A 4FTCA 2B52A 4FNYA 5AP7A 3ID6C 4QP9A 4J53A 2RKUA 3SRVA 4USFA 3K3JA 4DTAA 5LVNA 3FMDA 4BFMA 3RJCA 4FKGA 4F6SA 5BQ0A 2XEZA 4R3CA 1NW1A 3LLTA 4M68A 5IA2A 3QF9A 4GKIA 1Q41A 3UMXA 3AC4A 3DV3A 4ASEA 3GQIA 2ITVA 4UEUA 4B0GA 3MV5A 3MW1A 3EFLA 3V5JA 4Y8DA 1ZZ2A 4KB8A 3D83A 4XUFA 3VBVA 3D7TA 5I9VA 2XNMA 3E3PA 2WXVA 4RWJA 3FLYA 4L3JA 3I0QA 2QOBA 4YZMA 3DT1A 3VQUA 1PMNA 3EYGA 1M7QA 5G6VA 4IEBA 4JQEA 3VS6A 4D2WA 4KBAA 4L67A 3P1AA 5CVHA 2ZB1A 2PZPA 3KCFA 3L8XA 4HCVA 5CZIA 3S4QA 2VTPA 5JQ8A 1GZ8A 2J0MB 3M2WA 3BWJA 1REJA 1UU3A 1XBBA 3GC0A 4I3ZA 4IAYA 3QQHA 1ATPE 2RF9A 2WTIA 4GS6A 3SW4A 3TTIA 5CSHA 4NKAA 1H4LA 4G5PA 5AR2A 2XNNA 2X39A 3H0YA 2I6LA 3TKHA 4MXOA 3FPQA 3NLBA 4FT9A 3LM0A 2VTLA 1QPCA 4TRLA 2G1TA 4PWNA 1BL7A 2NP8A 3ENHA 3UO6A 1FVTA 4RX5A 4DTBA 1JKKA 2JBOA 2UZBA 5AX9A 3G15A 3QFVA 3G2FA 3R2BA 4NUSA 5EM5A 4LQMA 5HE1A 5LVLA 4AZVA 3UVRA 2PMIA 5DR9A 1QCFA 3C50A 2OZAA 4WG4A 4BCNA 3KXNA 4FNXA 3RI1A 3C13A 3LCSA 2WTJA 1YKRA 2QKRA 2W05A 4D0WA 2Z7RA 3T9TA 4TL0A 1GIIA 4JIKA 5JGBA 5HX6A 2BAQA 4QMYA 4GT4A 2XNBA 3QD3A 2WQNA 2ETKA 2O5KA 3FI3A 4PPAA 5AMNA 4EQCA 4G31A 4AZFA 1U54A 2I0YA 2UZOA 4Z3VA 5GJFA 4NCTA 4F1MA 5EYDA 5BYLA 2P3GX 4TKSA 5HE0A 5CAQA 3VS7A 4H58A 4C2VA 3EOCA 4LGGA 4FSWA 5CF8A 3PXZA 1PYXA 2R0UA 3CS9A 3QZHA 4TT7A 2XNPA 4IB0A 5FXSA 4CLJA 3DS6A 3DKOA 4FG9A 3L8VA 2BZKB 4D4VA 1YDRE 2G01A 4E3CA 4HVIA 3SOCA 4MEDA 3S95A 2XBJA 5HX8A 3FPMA 3OXIA 5L2QA 1XWSA 3BHUA 5CENA 2IJMA 3G90X 2C5YA 3ORKA 5GINE 4S30A 5L3AA 4BDGA 1DM2A 1M52A 4O86A 3H9OA 2PVMA 4TYGA 4BCKA 4EQMA 2E9UA 4O7LA 1QPDA 1OUYA 1JKTA 4MK0A 5M53A 3TNPC 2YABA 2FA2A 3P08A 2V0DA 2HAKA 2REIA 4NM3A 4XG4A 3FI8A 3PP1A 4ASXA 1UA2A 4ZY4A 4AU8A 2XMYA 4LRMA 1QPEA 3VJOA 3WF7A 2X6DA 3KCKA 3H30A 5DNRA 1L3RE 3AXWA 4ZY5A 4FT0A 1TVOA 3VW8A 3W2RA 3JVRA 3R0TA 4DG2E 3DFAA 4KNBA 4C4JA 1WBOA 1IAJA 4RC4A 4C02A 1ZYDA 4MKCA 4QMLA 3DQWA 5DG5A 3EQDA 4XX9A 3RWPA 5IA4A 5HLNA 3ORTA 1X8BA 1ERKA 1Q62A 2QI8A 3FLWA 5HBEA 5JRSA 1O6LA 4FV3A 3LFAA 4CVAA 4J95A 3ET7A 4IH8A 5DWRA 3TUBA 3MH1A 4HYHA 2X7GA 3NW5A 2IZTA 2OJJA 4G9RA 3EQIA 3KXHA 3QCQA 2X2LA 5HNGA 3KN6A 4X0MA 4CFWA 4F9CA 1UWHA 3R9OA 3VJNA 3V5WA 4FSNA 2W06A 4TY1A 4Q9ZA 4XP3A 4JR7A 4TWOA 5BVKA 3M1SA 4GSBA 4F0FA 1L8TA 3GFEA 3FZTA 1OL5A 3R8PA 3U8WA 5DRDA 4W4WA 4C4HA 4IAZA 3IS5A 4A07A 5AV2A 2OJ9A 4FV7A 5AV3A 1YXXA 4RQKA 4JLCA 2C30A 5FTQA 4MXYA 4TXCA 4EHVA 4FVPA 5AAGA 4OUCA 3MJ2A 4NFMA 5DGZA 4BY9E 3BZ3A 3AC1A 2C6IA 3R63A 3D5VA 4FSTA 5H8BA 4I93A 4EOKA 2BAJA 4R77A 4YNEA 4D4SA 4FEQA 4JX3A 4J99A 2H96A 3QHWA 4HGEA 5FQDC 5ANOA 2E9OA 5GJDA 3LCOA 5CAPA 3OZ6A 2X8IA 3ZEPA 3FLQA 4YC8A 3PG3A 4GVJA 3COHA 5JGDA 4NH1A 3EQPA 3HV5A 4F4PA 3N4VA 3HV7A 4X6QC 4O6EA 3DOGA 2IO6A 3EL8A 4U3ZA 4UY9A 3I5ZA 4L7FA 2NNWB 2XNGA 3U6HA 2G15A 5M4FA 4JAIA 4GFOA 3G0FA 3OVVA 1H25A 3CQEA 4ZXTA 4UZDA 3BLQA 3FHRA 4YO4A 3QUEA 4ZSGA 1B6CB 3CPBA 5AP6A 3KULA 1ZWSA 3EYHA 2X81A 4ANLA 4BDHA 3F3VA 5AJQA 5CAOA 2WTKC 5IKWA 4MD9E 3VF8A 4IVCA 2UUEA 2ZV8A 3R8LA 5L2WA 4GV1A 3TNWA 5CNOA 4MCVA 4ZSEA 4RJ8A 5DHJA 5LMAA 3R1SA 5IQCA 1JWHA 3VBTA 3ORNA 4KA3A 5EG3A 4KKHA 4ZTRA 4K11A 2PY3A 1SNXA 5C4LA 3RAHA 2BRGA 4I5CA 4WO5A 4AXAA 1XKKA 2ITZA 2EUFB 2IW6A 4I0SA 4U5JA 4GCJA 4G1WA 3WF9A 3V5PA 3I4BA 1W84A 4R3RA 3DAKA 5JFVA 1Y8GA 3UNKA 5FP6A 3OTUA 4PMTA 5K0KA 4MQ2A 4RPVA 4YTCA 3DY7A 4EJNA 4QO9A 4ZTSA 2RG6A 3F3WA 3R9RA 3IONA 3ZSGA 3SW7A 2XK3A 2PE1A 3BI6A 3FZSA 2CGWA 3Q5IA 3PDTA 1PMEA 3QQFA 4JAJA 1LPUA 3BLHA 4JDHA 3BQRA 4TTHB 2R9SA 4HNFA 4MHAA 4F9BA 2R3OA 5C1QB 5A14A 2PZRA 1JVPP 4QTBA 3D94A 4XMOA 1AQ1A 4BCQA 1YDSE 3MYGA 3U87A 3AC2A 5JN2A 3QQLA 4AE9A 3EMGA 4CMUA 5E8TA 4JRVA 4EZ3A 3MFTA 2OGVA 1GAGA 1OBGA 2A4LA 2H9VA 3BIZA 3RKBA 3BGPA 4H36A 4FR4A 4QP2A 3PE1A 4RFYA 4RJ4A 4CGAA 4YJUA 2XJ2A 1H1QA 4KBCA 4C3RA 4DEEA 4D5KA 4I94A 4BDIA 2G2IA 3LM5A 3GC7A 4IZYA 4APCA 3B2TA 4GL9A 5HE3A 1GNGA 2BALA 3QYZA 4IX4A 5FWKK 5I9ZA 4QMNA 5J95A 3ELJA 3BEGA 3F3UA 3FQHA 3CP9A 3T3UA 4BBFA 1LUFA 1M2PA 2AUHA 3AC3A 3MY0A 1J1CA 1U46A 4XG3A 5AEPA 2W9ZB 3PLAE 4GUBA 4KKGA 5HVJA 3NCGA 3F2RA 1CSNA 3FWQA 5CX9A 3ERKA 3L9LA 3ZUUA 5AAFA 2R3FA 4AZSA 4BDAA 4JQ8A 4XCUA 4FC0A 3MH0A 4P5QA 5DIAA 4C0TA 1SM2A 2BZIB 4RZWA 4WNPA 3GNIB 3LFBA 2JDVA 3R1NA 5J87A 2IW9A 3UOHA 4C2WA 4ZIMA 2OK1A 3F5PA 4E7WA 5FDXA 3O0GA 1SNUA 2XEYA 4RGJA 4B7TA 2BROA 4ZS0A 3DXNA 3KK9A
chains in the Genus database with same CATH superfamily
2YDJA 3BYMA 3D14A 4GJ3A 4NWMA 5HVYA 5A4CA 4PNIA 1H00A 5DBXA 3GU7A 3REPA 3UVQA 5DMZA 4DGOA 3GXLA 4YC3A 1UWJA 2J51A 2X7FA 4QMZA 2QQ7A 3ZUVA 2XZSA 1K2PA 1JBPE 2UW4A 4IFGA 3DDQA 3MH2A 4EH5A 3RHXA 5EKNA 3BPRA 2WQEA 3BHVA 3R02A 5DH3A 4MF1A 4N0SA 2R3MA 2QC6A 4C35A 1OMWA 4QPSA 4KBKA 4W4YA 3LQ8A 3C5IA 5FLFA 1FQ1B 4CNHA 3ZMMA 2CGXA 5JZNA 4C37A 5CI6A 4AA4A 4G3EA 4PTGA 4J98A 4BI0A 1DS5A 4K77A 3UNJA 3DBCA 4FTTA 4O0SA 2YN8A 3D5WA 3T8OA 2Y4IC 3IOKA 4M69A 3KRWA 4G34A 3I6WA 1J7UA 3O5AA 2PTKA 4ALVA 2J0IA 5HCZA 3SXSA 3LJ2A 4O27B 3E8NA 3L9PA 4O2PA 3LE6A 2W99B 3O71A 4I4FA 4ZOGA 5LARA 3LFNA 5AIRA 5BVNA 4H05A 4IWQA 2ZV9A 1KOBA 2XKFA 5F95A 4DITA 2PU8A 4AZWA 3DFCB 3Q2JA 5JFXA 3ZONA 4CKRA 1W8CA 2AYPA 2CPKE 4FIGA 4EK4A 5CEMA 1WBSA 3K54A 5JRQA 2VU3A 4FV2A 2QG7A 2QODA 4CD0A 4YPSA 1PJKA 2XA4A 3GC8A 3AG9A 2IF8A 1WFCA 5KMLA 5CEOA 4M67A 5EYCA 1PXIA 3SHEA 4RWKA 3ZLXA 4O7WA 4QP8A 4RVKA 5HE2A 1G8JA 4YTFA 5EM7A 1V0OA 3NWWA 2ZM3A 4DFUA 4F1TA 3CIKA 4USEA 1ZMWA 2O2UA 3IW8A 5ANEA 5AFVA 2W1HA 4K2RA 3MB7A 4JMQA 4A9RA 5HG9A 1JAMA 4K9YA 4QNYA 3O8PA 3KN5A 4E4LA 1PRYA 3CLYA 3CEKA 5EOBA 4EOQA 4IIRA 4AT4A 2C5XA 4TW9A 5BVDA 3NVMB 1IEPA 4E93A 3KF7A 4CZYB 1G5SA 3P5JC 2OF4A 4MNEB 3OROA 1WVXA 3GQLA 3KK8A 2XH5A 3HNGA 5LQFA 5J9LA 2V22A 4LYNA 4FA2A 3W0SA 4LMUA 4IACA 2B53A 2C69A 4FTOA 2GCDA 1S9JA 5KBRA 4I0RA 4N57A 5ETIA 3ZC6A 4RT7A 3HMOA 2F7XE 1NXKA 3ATTA 3LMIA 4FVQA 5TF9A 5FDPA 4RWIA 4MD8E 2VGOA 1Z57A 1YOJA 4AGWA 2XIYA 4ZZNA 1OPLA 3F82A 2YIRA 2GNLA 2XNOA 2Y0AA 4DINA 4FZAB 2NO3A 5ANKA 1O9UA 2QOCA 5CVGA 3RPSA 2CLXA 4CMOA 3TZ9A 1E9HA 3IW5A 1G8SA 4D9UA 1VYZA 4EBVA 4OTGA 4QTDA 4E4MA 4QT1A 3P4KA 3HL7A 3ZLWA 4FTMA 4XG6A 1TQIA 2RFNA 4D2RA 4B8LA 3UO5A 4Q5EA 1EH4A 1JNKA 2GQSA 4G6NA 4O0TA 4WSYA 2WTKB 4P5ZA 5AM7A 2XF0A 2BHEA 3QX4A 1QL6A 3TV4A 3ITZA 4YHTA 5M4UA 2OG8A 2XARA 1FINA 3EN5A 3TDVA 2ZOQA 4FSQA 5DFPA 4QD6A 4YPDA 5HTIA 5D9HA 3KMWA 3M11A 2OJIA 3E5AA 4FTUA 3POOA 5FM2A 2QHMA 5HVKA 3C0GA 1MRVA 3W0MA 4X3JA 3ORLA 2CJMA 4ZP5A 3WIKA 3POZA 2BRNA 4GT3A 2BTSA 3HMIA 5GJGA 4J8NA 3GU6A 3EQCA 2XJ0A 5IA0A 2VWWA 5E8WA 4IW0A 4D4RA 5JFSA 2UW5A 4DEDA 4ERWA 3IQ7A 2FB8A 4DFZE 4E5WA 2QKWB 4WOVA 2Q83A 3DTCA 3FC1X 4YJTA 4IAAA 2CKPA 1LR4A 3TKUA 4E6CA 4DFXE 2QOHA 2CGUA 4LM5A 4E6AA 4I6QA 3PXKA 5BVWA 3CKWA 3VUKA 2GMXA 4EC8A 1P4OA 3H9FA 5DEYA 3ANQA 4UV0A 4UYNA 3FC2A 3C9WA 4FUXA 4M15A 5CEKA 2OW3A 3WARA 4Z16A 3FKOA 1BKXA 3K5UA 4PY1A 1CM8A 2CNQA 3W2CA 5BMSA 5IZFA 2PULA 4TNDA 2HWPA 2XAOA 4DGMA 4W4VA 5GHVA 2J0JA 3N4TA 3WF8A 4GK3A 5AP3A 4RIWA 3TXOA 3R2YA 4EORA 1BI8A 3TZ7A 1CMKE 4A06A 5L8KA 2YIWA 1H0WA 5LWNA 4QQTA 4U8ZA 3PWDA 3W0PA 4ALWA 2PPQA 3PA5A 3O51A 3QKLA 1GZOA 3I6UA 4BI2A 3LLAA 2OXXA 4FIHA 5IEYA 4XH6A 1HCKA 3KMMA 3SDJA 4OAUC 3ORIA 3WYYA 3PVBA 4ERKA 4J71A 3OOMA 3OW3A 1OL6A 4GW8A 2YCFA 3WF5A 2OSCA 3UOJA 4IM3A 2I1MA 3U6JA 4JL9A 1YWRA 4PTCA 3L1SA 2BDJA 4BDBA 4NL0A 4IB1A 4JIAA 4E73A 2Z2WA 3GOPA 4PPBA 4ZTHA 3Q4TA 1ST4A 3ZLYA 4XBRA 3AKJA 3KL8A 3Q2MA 4LUEA 4G3DA 2C0TA 3UJGA 4AZTA 3OS3A 4PNKA 4FIFA 3Q32A 4AOJA 3QRKA 4M97A 3UG1A 2JLDA 4FKVA 3ZO3A 1PKGA 2JDOA 4CQGA 4HPUE 3QTRA 5A54A 5K5XA 2X9EA 5M07A 1RDQE 2AC3A 4NIFB 4EH6A 4QRCA 3IOPA 3FKLA 2ZVAA 3BE2A 3DDPA 2E9NA 4MUQA 3TNHA 4DGGA 4RIYB 2UZTA 5CF5A 5M4IA 4H39A 2ITOA 4NT4A 4U43A 3BYSA 4YZDA 4N70A 2Z8CA 2JDRA 3D7ZA 3DAEA 2IG7A 3UP7A 1GIHA 3CPCA 2P0CA 2ITQA 4A9SA 2OIQA 4IVDA 3LKMA 1ZOEA 5E8ZA 2HIWA 5FD2A 5I0BA 4ZEGA 5HD7A 4X3FB 1H08A 2F7ZE 3NAYA 3GI3A 2W9FB 5EHYA 4CFFA 3BQCA 3KRRA 4TN6A 2B4SB 4C3FA 4V0GB 4RJ6A 3GBZA 2PZYA 4FKUA 3W33A 3EQRA 4ITIA 1O6YA 3SVVA 2VGPA 4FKRA 2Y4IB 3DKCA 3EL7A 3IGGA 3AD5A 4OTHA 1OPJA 2QOIA 3TIYA 4BKYA 3ATSA 3VS4A 2VTSA 4DFYA 4ORKA 3NNVA 4KRCA 4M0ZA 4UMRA 4BWXA 3FBVA 4S33A 4O7RA 3KU2A 5C01A 4NM5A 4FUYA 3LFEA 4YJOA 3TIZA 3UGCA 3UZRA 2UW9A 3AD4A 1XH4A 2X8EA 5CALA 3E64A 3UC4A 3P86A 3Q5ZA 3UOKA 2C47A 3UYSA 3V8WA 2YIXA 4NJDA 3W8QA 3NRMA 4XV9A 1BL6A 4FODA 4I41A 4LRJA 4RJ5A 4YZ9A 5ETAA 4CKIA 4Z55A 5BNJA 1ZXEA 4FGBA 4RRVA 3F66A 2EB3A 1YW2A 2PHKA 3KGAA 3W16A 3MFSA 3ODZX 4LGDA 1B38A 4P7EA 5DN3A 3Q9YA 4E26A 2WU7A 3OF0A 3W8LA 4FL1A 1XHAA 3HRBA 3LPBA 4HCTA 4GIIA 4Y46A 2ITWA 4XP2A 3GT8A 5H3QA 3SGCA 4FTIA 4W8DA 2C68A 2UW8A 5DT0A 5M08A 2AQXA 4OTFA 3Q96A 4O82A 4KS7A 3F5GA 3PY0A 3D2KA 2JKOA 3BV3A 3E7VA 5AUWA 3BL9A 3JXWA 4MBIA 4GUEA 3R7UA 5ACBC 2ITPA 5CVFA 4A4OA 4AXFA 4AQCA 2GQRA 3NYOA 4HOKA 4ZY6A 5KZIA 2GHLA 2R7BA 3FQSA 4UMPA 2ZFYA 3LFQA 4ZTNA 3QWKA 3PPJA 4Y73A 4WIHA 5E7RA 2HXLA 4FNWA 1VLRA 3LVPA 3UYTA 2OZOA 1XMLA 4TZRA 2WKMA 4C4EA 5TE0A 3Q9WA 5CEPA 4EEVA 4GJ2A 3ACKA 4AW1A 2WTCA 4ANNA 3EJ1A 2PVHA 3EQHA 1ZYSA 4YURA 4K18A 4F0IA 3O23A 3P78A 4IC8A 3K2LA 4TNBA 3QTQA 3GVUA 3T3VA 5CLPA 2IZSA 3PSCA 3CSVA 1R0PA 4YJSA 1SVHA 2PUUA 3A4PA 5IEXA 2YCRA 5TO8A 4TWCA 5E92A 2UVXA 4BCHA 3GCQA 3KB7A 4PL4A 4E1ZA 2J2IB 4D1SA 5CWZA 2CMWA 4WD5A 4BBEA 3AMAA 4S34A 3PZEA 4QMWA 3DPKA 4RVLA 1Z5MA 3HDNA 5HIBA 2J0LA 2J4ZA 2PVLA 2XKEA 2RGPA 4K8AA 3LXPA 3O7LB 4X2JA 5HKMA 4UXLA 3EQBA 5DEWA 2X0GA 3EN7A 4YMJA 4PP9A 5CXZA 3F7WA 4BTFA 4WNOA 4XOYA 2YEXA 4JI9A 3E88A 1G3NA 4MWHA 4K1BA 4C34A 1YRPA 2XK9A 3FAAA 3UODA 3LQ3A 3MA3A 4G3CA 4YHJA 4F7NA 2QO7A 5IU2A 2YWVA 4HNIA 5EM8A 1ZY5A 5LMBA 4RX7A 4FT5A 4ZSLA 3ZRKA 4DCAA 5E9EA 3QZGA 2R3JA 4GVAA 3R7GA 3W0NA 1H01A 4LFIA 1PMUA 3LXKA 4DF3A 1Q3DA 4M14A 3PJ1A 1SYKA 3NNXA 5FGKA 5KUPA 5C26A 3HKOA 4L01A 5HCYA 2GPHA 5DRBA 1KUTA 2ZM4A 2YM7A 3HV4A 3F3ZA 4FKQA 4OTPA 2XUUA 5AUXA 4C3PA 1ND4A 3DKFA 1JLUE 5EW8A 4W9XA 1V0PA 4O7TA 4H3PA 4TWPA 4XV2A 5DI1A 1NT2A 4IE9A 5I3RA 4EOPA 4OGRA 3PXQA 1XH6A 2YAKA 3TACA 3OWKA 5CASA 5AR8A 3ZEWA 4O7VA 4QQ5A 3KA0A 5KBQA 4AX8A 4NU1A 5HOAA 3OCTA 1MRUA 4KABA 2OLCA 1KSWA 4PL5A 4NKSA 4XG7A 3WE4A 2YM4A 2OF2A 4HYUA 3R6XA 3BX5A 3VN9A 2B9JA 4HPTE 5F9EA 3QD4A 1Q5KA 2JEDA 1YHVA 3EFWA 3QYWA 5D1JA 3RZFA 4EK6A 3FMEA 2PL0A 2QURA 4U44A 3RNYA 2YJSA 4IDTA 2X1NA 1KV1A 5HO8A 1O6KA 4ZAUA 3LFFA 2A27A 4G6LA 5EQPA 3D2IA 3R7VA 3SQQA 3ZFXA 4PV0A 3QC9A 3WI6A 5ACKA 4BIEA 4RJ7A 3QCSA 4ANSA 4AGDA 3NMUF 4YBKA 5M51A 3QTIA 1Q8WA 1FPUA 4KIOA 4CSVA 4ZJIA 5IA5A 4O83A 3QWJA 4EOJA 1OM1A 3OXTA 4UMTA 2DQ7X 2VV9A 2J6MA 1XR1A 3Q52A 2YCQA 3MB6A 4GG5A 4EBWA 1F5QA 3Q04A 4G5JA 3G9NA 4N6YA 4RSSA 2JKQA 4IMYA 2Z7QA 3O8TA 3VAPA 1Q8TA 1ZY4A 4IAKA 5H2UA 2F9GA 3VBYA 3R73A 3W10A 3FZOA 4HCUA 5K4IA 2CCHA 2ZDUA 2I0HA 2ITYA 1JKLA 4MQ1A 2BDFA 3DXQA 4BZNA 4ZMEA 3HMNA 4O0XA 4BWPA 5AM6A 5AP0A 2OJGA 2R3PA 3OWLA 4FV8A 4U42A 4DC2A 2VTNA 2C6KA 4P4CA 4NFNA 2VNWA 4DFLA 4V01A 2YM6A 2Q0BA 3BHTA 1CKPA 2C3LA 2ZDTA 4D55A 2WTDA 1BLXA 2O64A 3PJCA 2WEVA 2X0QA 3BRBA 3LOKA 3NNUA 4FKJA 3PUFC 2XP2A 2R3QA 2FSLX 2EU9A 3FSKA 3MTFA 5HBJA 5J7BA 3W18A 1KE8A 3F5UA 3P23A 3R7YA 4BTKA 4DEGA 3RPVA 4NEUA 3BCEA 2B9HA 2RFEA 2XM8A 2CLQA 2Y9QA 1VEBA 4FIIA 4BIBA 4OTIA 4EK3A 4BBMA 2XK4A 1OBDA 4FVRA 4DGLC 2Z02A 3E63A 3DJ6A 1SVGA 2CNVA 2IVSA 3RNIA 1XJDA 3IECA 3I5NA 4DH8A 5J7HA 2JDTA 3E93A 3R00A 1FBNA 3U6IA 2O63A 5J1WA 3GENA 5HI2A 3RHKA 2DS1A 3HAMA 1UKHA 3LXLA 4BDFA 2VWVA 1J91A 4GU9A 1UNGA 2VX0A 2C1AA 4FL3A 4HZRA 2XALA 2C5VA 3Q4ZA 4DYMA 4BICA 4BCMA 4BDKA 3FXXA 4WUNA 2WIPA 4H3BA 5HD4A 4Q5HA 4ONAA 3RM6A 2C0IA 3KFAA 5BYYA 3ZXZA 5G1XA 5IQIA 3GCSA 3B2WA 2UZLA 2EXCX 3FI2A 3KVWA 2UV2A 4OBPA 4O1PA 4UB7A 4J7BA 5GZ9A 3TNQB 1W2FA 1DAYA 3ZOSA 5CAVA 4BKJA 5IA1A 1YOMA 4UX9A 4IHPA 4CRSA 2C6EA 4BL1A 2VO7A 2WIHA 3P7BA 4FRFA 3BHHA 4FYNA 3OUKA 4RC3A 3PE2A 3SXFA 3VF9A 4MAOA 5HU3A 5I9WA 4LL0A 2P4IA 2UVYA 4D1ZA 3QUDA 2W5HA 5IQFA 3MS9A 3EHAA 3F2AA 3A7GA 4DBNA 1YWNA 2QLQA 4UWYA 3NCZA 4FV0A 2XYUA 3V01A 2HXQA 3HVCA 5KCVA 3T9IA 3LFDA 4AAYA 4DT9A 4QNAA 3PJ3A 3VW6A 5HLPA 3A60A 4CFUA 2W7XA 4WBBB 2IZRA 4I6HA 4U6RA 3VULA 4LV8A 4AT3A 2Z7LA 5EOLA 2EB2A 4DHJA 4CFNA 4E4NA 5GIPE 3GGFA 4O4DA 1A06A 4QYGA 3IDPA 3NUXA 3Q53A 3ZM4A 2YJRA 4HGTA 2V55A 5KMMA 2QOOA 1IR3A 4TYHB 3RK5A 1XQZA 3Q6WA 4WRSA 4X7QA 3W2SA 4DA5A 1PF8A 3QQUA 2GS2A 4CRLA 2PVKA 3HYHA 3QAME 3I1AA 3R01A 4R1VA 2UZDA 2XJ1A 3GU4A 3KQ7A 4QYEA 4L52A 3MIYA 4CFXA 3TWJA 4G16A 3V5QA 4FJVA 4IAFA 3SA0A 3A2CA 3OBJA 3AOXA 3KMUA 3R83A 4I24A 3R9NA 2XRWA 3OW4A 3RGFA 4R7BA 4GU6A 4QQCA 4AGUA 4X6RA 2YCSA 4ZTMA 2C3KA 3MPTA 4IANA 5HEZA 3OWPA 1KE5A 4FT7A 2CN5A 3R8MA 4CV9A 2UZWE 4FIEA 5DE2A 3QLFA 4CQEA 2JC6A 1J7LA 3QU0A 3C4FA 3ZZEA 4QOXA 4F64A 3NW7A 5AV0A 2WQMA 2QD9A 3W2OA 5GZAA 4X2NA 5T68A 4XOZA 1BI7A 1KWPA 1XH8A 1BUHA 4OTRA 5A6NA 4O84A 4O1OA 3GCVA 1YWVA 3NUYA 3PZHA 3TN8A 5HORA 4FSZA 2AC5A 3SX9A 3I7CA 4U7ZA 2WB8A 2VWIA 2ACXA 2R4BA 2OKRA 4L42A 3BBWA 3L9MA 3BELA 5C27A 1I09A 5CAUA 3PYYA 4HVSA 4I22A 4MNEA 3BU3A 5AUTA 4JVGA 5B2LA 3EH9A 3HEGA 3C0HA 4OW8A 3WZDA 2CKOA 2QOFA 3ULZA 2WU6A 1OKVA 3DGKA 2IVVA 1J3HA 4XNEA 4YZCA 5CF6A 4Y5HA 3AC5A 1NY3A 3OCGA 3FZ1A 3B8RA 4XG2A 5ANJA 5TT7A 2VTTA 4IWOA 4DT8A 4M3QA 4UBAA 4RZVA 3ZBFA 4LI5A 2PZIA 2G9XA 3LCDA 4QTEA 5ICPA 3DAJA 5L2TA 3O96A 4YO6A 1J1BA 3ZLSA 4XRJA 4KWPA 3NAXA 2I7QA 1JOWB 3FMMA 4F9AA 4GT5A 5B7VA 4BCJA 2WNTA 4EC9A 3Q9ZA 3OCBA 5IDNA 4GMYA 5J5SA 3VO3A 3R7EA 5LJJA 4O4BB 3PLSA 2SRCA 4XLIA 3KRJA 3Q6UA 3CY2A 4S2ZA 2GHGA 4ITJA 4IM0A 4XRLA 3ZO1A 3LJ0A 3IG7A 4O0VA 2CKEA 4AE6A 3UZTA 4BJJA 4UYAA 4CCUA 5IUHA 2KULA 3C4CA 5EQYA 2W1ZA 3CJFA 5AUUA 4BVUA 5BV3A 4BR3A 1K9AA 5M56A 3RBWA 3BLRA 3COIA 5BUEA 1FVVA 4BCGA 3A62A 3UIBA 2VD5A 3AMYA 3K5VA 1PY5A 4RQVA 4FSUA 4YLJA 4DHZA 2ZAZA 4ZLZA 2QU6A 4ZS4A 1RQQA 5LVMA 4FOCA 4F9WA 5M4CA 5TKDA 4YJQA 4JBOA 4AAAA 5IH5A 4FEWA 3JY9A 2QOKA 3R7IA 2XNEA 3GP0A 5EI8A 3ETAA 3QCYA 5H8GA 2HZIA 4O81A 4IJPA 4BDJA 3AKKA 3C4XA 2R2PA 2V62A 2ESMA 3PTGA 3E7OA 4M8TA 3MI9A 4NTSA 2JIIA 3LQ5A 1PYEA 4RVTA 4B4LA 3KRLA 4IFCA 2F49A 2PZ5A 3LCKA 4QTCA 4AW2A 4WG5A 1LEZA 4H1JA 4JR3A 4AW0A 3RCDA 4RA5A 3HUCA 3UMWA 4ACDA 2BKKA 2VWYA 3QRIA 4PDYA 1WBTA 3VBXA 3JYAA 1JSTA 1FMKA 4XP0A 3MA6A 3FI4A 4FZ6A 3GU5A 3NX8A 4ZJVA 5FEEA 4ACMA 3P5KA 2PUIA 3TJDA 1ZMVA 2XK7A 1OGUA 5FXQA 4EH9A 3QHRA 3EWHA 4KAOA 3FEGA 3ORPA 4U0IA 5TR6A 4FF8A 4YJNA 3TM0A 3NYXA 2IVUA 4BDCA 3GCUA 3IKAA 1MUOA 3PY3A 3E8DA 3CBLA 5HO7A 3MY5A 4N4SA 3IO7A 2JFMA 3MFUA 5ANDA 5ITAA 4F7JA 5EW9A 1H26A 2J90A 4DCEA 5KE0A 1ZMUA 4L3LA 4MNFA 1R39A 4V05A 2H34A 3ZRLA 5BUIA 3PXYA 4FK6A 3UIMA 4F65A 4O22A 4TYJA 3RTPA 3ORZA 5EKOA 3AT3A 2GU8A 2X2KA 4BTMA 3NFGB 2QG5A 5DVRA 4LMNA 3TL8A 4BTJA 1KOAA 3CD3A 2BHHA 1OUKA 3QX2A 5LCKA 3RAIA 4C62A 1Q4LA 3H4JA 2WMXA 5AP1A 3E92A 2C3JA 5CEIA 4ARKA 1YDTE 5AR3A 2XB7A 3LW0A 4U9AA 3NIEA 3QL8A 4NIFA 2C6LA 4AXEA 4D2VA 2UZNA 2C0OA 2WAJA 4FKTA 5M09A 2C6OA 4S31A 4KIKB 4RX8A 5HCXA 4RIYA 3WE8A 5M55A 4M7IA 3PIXA 5D41A 5JH6A 4BJJB 1H1SA 4DG0E 2C6TA 5E8UA 2V7AA 1R78A 3SC1A 3F7ZA 4HVDA 3UP2A 1MQ4A 2YLFA 3MFRA 4HYIA 3OFMA 4CYJA 2QOQA 3F9NA 4USDA 4IX5A 3E3BX 4HJOA 3V5TA 3SG8A 2GNJA 3MTLA 5M44A 5CNNA 4FYOA 4O6LA 4CXAA 3G5DA 4PMPA 2ONLC 4UN0C 4X3FA 4Z7HA 3WILA 3EIDA 5E90A 3V8TA 3DK6A 4V0GA 5CU4A 1S9IA 2B7AA 3C4EA 4F7SA 3FXZA 2CSNA 5D12A 2R0IA 3PSBA 4MF0A 4BDDA 4FTAA 4FZDB 4MH7A 4ZZOA 5IQAA 3HA6A 2PMNX 5I9XA 3R04A 5CF4A 2WMSA 4JT3A 2FGIA 1XH5A 1T45A 3CC6A 5IPJA 3LXNA 2IW8A 4C8BA 5IH4A 4IB3A 3HDMA 3P79A 4O0WA 1WAKA 5D7AA 3OWJA 5JGAA 1PXJA 2ZV2A 3TNIA 4BCFA 4R8QA 3MN3A 3SV0A 4FE2A 3AGLA 3PSDA 2F7EE 4FICA 5A46A 4QQJA 3TEIA 4QMXA 3DA6A 3UO4A 5L8JA 4DDIA 4CEGA 2NPQA 3TI1A 3VBWA 3UPZA 2OXYA 5EI2A 4IAIA 3TUDA 4G6OA 2OH0E 2OO8X 3U4UA 3JVSA 4NYEA 4DH5A 5AX3A 4FKLA 5FEQA 2BUJA 1Q24A 3SD0A 3ZH8A 4XG9A 3W1FA 1OGYA 2O8YA 3QTWA 5A9UA 3DZQA 2YDIA 1WBPA 3ENMA 4LOPA 1JSUA 5I9UA 4P90A 3DLSA 1SVEA 3IPHA 3NGAA 5IQDA 2VTAA 4GH2A 4IWDA 3A7HA 2WMVA 4L9IA 5F1ZA 4ZLOA 3I60A 4M84A 4AT5A 2W1GA 2PVJA 1JSVA 3LZBA 2GFCA 4FBXA 1HOWA 4GIHA 4EH8A 1AD5A 1LEWA 4EH4A 5KZ0A 1P4FA 3FL5A 5EYKA 3AQVA 4YP8A 3TZMA 3QKMA 2EWAA 3LMGA 4I5PA 4RG0A 4DAWA 2PE2A 1W83A 3V6RA 5JT2A 2DUVA 3L8PA 4JS8A 5E8XA 4H1MA 5K5NA 2W4OA 1H07A 4FIJA 4O2ZA 3HA8A 5HG5A 3VBQA 3OP5A 5KHXA 1F0QA 4XG8A 5CSXA 3QTSA 4RIXA 3BV2A 3R28A 4DH1A 5M57A 4G2FA 5JK3A 2VTJA 2QVSE 3NSZA 3W55A 1DI8A 3WZEA 3I79A 4DLIA 4DBXA 3TTJA 4JG7A 2Y6OA 2YACA 2XBAA 3TKIA 5E8VA 3DB6A 2C5NA 5K9IA 1G8KA 1UVRA 3UG2A 3KREA 5ETFA 3GCPA 3OC1A 3C1XA 4X2GA 2H6DA 3H9RA 2LGCA 4XLVA 2W4JA 3IGOA 1KE7A 4D28A 3S0OA 3HP2A 3IDCA 5D7VA 3MWUA 3DBDA 5ANIA 3E87A 3WYXA 4JDKA 4YSJA 3C5UA 2BFXA 3H10A 3KKVA 2PMOX 4OR5A 3VUTA 4D4YA 4EYJA 5A4LA 3K3IA 3UQFA 3TYKA 5FTGA 2V5QA 5EYMA 4EONA 4OTDA 3NPCA 4I21A 3IW7A 2IEWA 3NW6A 3RALA 2XIRA 3OBGA 2HENA 2PMLX 4KSQA 3FLZA 5LVPA 3MPAA 3LAUA 2GTMA 2I40A 3JR1A 1YI4A 2VO6A 2YAAA 3ZSIA 1H1WA 2JKMA 2YFXA 3BYUA 3PG1A 2OBJA 2VWXA 3F3TA 4I6FA 3ROCA 2GNGA 3UTOA 4ACCA 4Z9LA 4EZ7A 2V7OA 3SLSA 4I5HA 2XKCA 1YOLA 3NR9A 3NVKI 4MX9A 4BDEA 4CTBA 2XIZA 1YQJA 2JDSA 4DEAA 4U3YA 3LIJA 2BRMA 4JX7A 2I0EA 1WCCA 4WNMA 4QP6A 3WZJA 4B6LA 3W0QA 3OHTA 4WA9A 3VRZA 3A7FA 1K3AA 3KF4A 3RK9A 3TT0A 1T46A 4NCTC 1PHKA 3V5LA 3L9NA 1H1PA 2J5EA 2GSFA 4PRJA 3GUBA 3A7JA 3OTVA 4R7HA 4OTQA 4QYYA 5DA3A 5HNIX 4C38A 2JIUA 3FDNA 2VN9A 4IXPA 3HLLA 5I5ZA 3RAWA 4RLLA 4F09A 4WBOA 4MXCA 4BRXA 1ZLTA 2BRBA 1ZOHA 4I92A 2BPMA 4KD1A 4L7SA 4NTTA 3UDSA 4TYIA 3KIOC 3DBFA 5D11A 3A4OX 2BAKA 4A4XA 2HW6A 2YDKA 4QMQA 2YHVA 4RWLA 4ANOA 4ITHA 4GFGA 3F2NA 2OIDA 1M14A 4S32A 2C6DA 3S3IA 3QALE 5DLSA 4JDIA 5EDPA 5AWMA 4I6LA 3KXXA 5KMKA 5C8MA 4C61A 3RVGA 5EM6A 1U5QA 4D2TA 1J7IA 4A7CA 4FEUA 4YJPA 3QQJA 4RX9A 3TDWA 2OU7A 4MYGA 3MGYA 1W82A 4D2SA 5HG8A 2R64A 4RIXB 4PX6A 2ETRA 2WOUA 4MBJA 1Y91A 3GB2A 4RBLA 5FP5A 3ZDUA 4APPA 3TUCA 2BRHA 5CEQA 2W0JA 4EOMA 4I4EA 4IBMA 3DK7A 3QLGA 3PY1A 3VQHA 4HVHA 2VUWA 2R3KA 3VUHA 5K4JA 1V0BA 2R3LA 3BYOA 4DLJA 4YLKA 4Y95A 4QTAA 5A4QA 3ULIA 4EKLA 3ACJA 4K6ZA 1PXNA 2XIXA 3FE3A 2VZ6A 4GRBA 2G2FA 3NUPA 4E6QA 3ALOA 3G6HA 1OIRA 1UKIA 3FZRA 4ACHA 3Q4UA 5IQGA 4ZTQA 3ZXTA 2VTRA 3M42A 5T3QA 4AZEA 4FKOA 1WZYA 5CY3A 3MPMA 4KKEA 2VX1A 5H9BA 4BGHA 2J9MA 4YU2A 5KMIA 2UZVA 2NRUA 1Y57A 2WGJA 2BKZA 5CI7A